4LFAD

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 58
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4lfaD01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4lfaD02
3T1HD 4LFBD 1KSKA 1HNXD 4JI8D 1XNQD 1HNZD 1N34D 5LMND 4DV0D 4LF6D 3OTOD 4LF7D 1JH3A 4DR3D 1H3FA 4X65D 1KSVA 1VIOA 4DV3D 4X66D 4GKJD 4DUYD 1C06A 4DR2D 4B3MD 2UUAD 3DH3A 4LF9D 2UXCD 1N32D 2UXDD 2ZM6D 4AQYD 4LGTA 2UUBD 4KHPD 4B3TD 4OUDA 4B3SD 1IBLD 2KTLA 4JI3D 4LFAD 4JYAD 2UXBD 4JI2D 5BR8D 4JI4D 4JI1D 4JI7D 4LFCD 4OX9D 1J5ED 5LMUD 4X62D 4LF4D 1KSLA 1HR0D 1I94D 1N36D 2F4VD 4DR7D 1N33D 4DR1D 1XMOD 2HHHD 4DR5D 4JI6D 2JANA 4X64D 1C05A 4NXMD 4YY3D 4DV2D 1HNWD 4YHHD 1IBKD 5IWAD 4LF5D 4LF8D 4K0KD 4NXND 1XNRD 4JI0D 4DV4D 2UUCD 4GKKD 1H3EA 2VQFD 1DM9A 1FJGD 2VQED 4DV6D 4DV1D 4DV7D 4DUZD 2K6PA 4JV5D 4DR4D 3KBGA 4DR6D 3HP7A 1P9KA 1XMQD 1FKAD 4B3RD 4DV5D 2E5LD 4JI5D 3T1YD 1IBMD 2ISTA 2UU9D
chains in the Genus database with same CATH superfamily
3T1HD 4LFBD 1KSKA 1HNXD 4JI8D 5KNLA 1XNQD 1HNZD 1N34D 5LMND 2ZTBA 4DV0D 4LF6D 3OTOD 4LF7D 5A2QE 1JH3A 4DR3D 3KYCB 1H3FA 4X65D 1KSVA 1VIOA 4DV3D 4X66D 4GKJD 4DUYD 1C06A 4DR2D 4B3MD 2UUAD 3DH3A 4LF9D 2UXCD 4W5VB 5FLXE 1N32D 2UXDD 3JAME 1Y8QB 2ZM6D 3J80E 4AQYD 4LGTA 2UUBD 4KHPD 4B3TD 4OUDA 4B3SD 1IBLD 2KTLA 4JI3D 4LFAD 4JYAD 3J7AF 2UXBD 4JI2D 5BR8D 3CMMA 4II2A 4JI4D 2I1SA 4JI1D 4JI7D 2LQ7A 4LFCD 4OX9D 1J5ED 3ONGA 5LMUD 4X62D 4LF4D 1KSLA 1HR0D 1I94D 1N36D 2F4VD 4DR7D 1N33D 4DR1D 1XMOD 2HHHD 4DR5D 4JI6D 5LL6S 2JANA 4X64D 1C05A 4NXMD 4YY3D 4DV2D 5FQ2B 1HNWD 4YHHD 1IBKD 5IWAD 4LF5D 4LF8D 4K0KD 1Y8XB 4NXND 5IT9E 1XNRD 4JI0D 4DV4D 2UUCD 4GKKD 4NNJA 1H3EA 2VQFD 4II3A 1DM9A 1FJGD 2VQED 2L3NA 4DV6D 4DV1D 4DV7D 4DUZD 2K6PA 3FN1A 4JV5D 4DR4D 3KBGA 2NVUB 3J81E 4DR6D 3HP7A 3KYDB 1P9KA 1XMQD 3ONHA 1FKAD 4B3RD 4DV5D 2E5LD 4JI5D 1Y8RB 3T1YD 1IBMD 2ISTA 2UU9D
chains in the Genus database with same CATH topology
3T1HD 4LFBD 1KSKA 1HNXD 4JI8D 1XNQD 1HNZD 1N34D 5LMND 4DV0D 4LF6D 3OTOD 4LF7D 1JH3A 4DR3D 1H3FA 4X65D 1KSVA 1VIOA 4DV3D 4X66D 4GKJD 4DUYD 1C06A 4DR2D 4B3MD 2UUAD 3DH3A 4LF9D 2UXCD 1N32D 2UXDD 2ZM6D 4AQYD 4LGTA 2UUBD 4KHPD 4B3TD 4OUDA 4B3SD 1IBLD 2KTLA 4JI3D 4LFAD 4JYAD 2UXBD 4JI2D 5BR8D 4JI4D 4JI1D 4JI7D 4LFCD 4OX9D 1J5ED 5LMUD 4X62D 4LF4D 1KSLA 1HR0D 1I94D 1N36D 2F4VD 4DR7D 1N33D 4DR1D 1XMOD 2HHHD 4DR5D 4JI6D 2JANA 4X64D 1C05A 4NXMD 4YY3D 4DV2D 1HNWD 4YHHD 1IBKD 5IWAD 4LF5D 4LF8D 4K0KD 4NXND 1XNRD 4JI0D 4DV4D 2UUCD 4GKKD 1H3EA 2VQFD 1DM9A 1FJGD 2VQED 2L3NA 4DV6D 4DV1D 4DV7D 4DUZD 2K6PA 4JV5D 4DR4D 3KBGA 4DR6D 3HP7A 1P9KA 1XMQD 1FKAD 4B3RD 4DV5D 2E5LD 4JI5D 3T1YD 1IBMD 2ISTA 2UU9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H D;  4LFB D;  1KSK A;  1HNX D;  4JI8 D;  1XNQ D;  1HNZ D;  1N34 D;  5LMN D;  4DV0 D;  4LF6 D;  3OTO D;  4LF7 D;  1JH3 A;  4DR3 D;  1H3F A;  4X65 D;  1KSV A;  1VIO A;  4DV3 D;  4X66 D;  4GKJ D;  4DUY D;  1C06 A;  4DR2 D;  4B3M D;  2UUA D;  3DH3 A;  4LF9 D;  2UXC D;  1N32 D;  2UXD D;  2ZM6 D;  4AQY D;  4LGT A;  2UUB D;  4KHP D;  4B3T D;  4OUD A;  4B3S D;  1IBL D;  2KTL A;  4JI3 D;  4LFA D;  4JYA D;  2UXB D;  4JI2 D;  5BR8 D;  4JI4 D;  4JI1 D;  4JI7 D;  4LFC D;  4OX9 D;  1J5E D;  5LMU D;  4X62 D;  4LF4 D;  1KSL A;  1HR0 D;  1I94 D;  1N36 D;  2F4V D;  4DR7 D;  1N33 D;  4DR1 D;  1XMO D;  2HHH D;  4DR5 D;  4JI6 D;  2JAN A;  4X64 D;  1C05 A;  4NXM D;  4YY3 D;  4DV2 D;  1HNW D;  4YHH D;  1IBK D;  5IWA D;  4LF5 D;  4LF8 D;  4K0K D;  4NXN D;  1XNR D;  4JI0 D;  4DV4 D;  2UUC D;  4GKK D;  1H3E A;  2VQF D;  1DM9 A;  1FJG D;  2VQE D;  4DV6 D;  4DV1 D;  4DV7 D;  4DUZ D;  2K6P A;  4JV5 D;  4DR4 D;  3KBG A;  4DR6 D;  3HP7 A;  1P9K A;  1XMQ D;  1FKA D;  4B3R D;  4DV5 D;  2E5L D;  4JI5 D;  3T1Y D;  1IBM D;  2IST A;  2UU9 D; 
#chains in the Genus database with same CATH topology
 3T1H D;  4LFB D;  1KSK A;  1HNX D;  4JI8 D;  5KNL A;  1XNQ D;  1HNZ D;  1N34 D;  5LMN D;  2ZTB A;  4DV0 D;  4LF6 D;  3OTO D;  4LF7 D;  5A2Q E;  1JH3 A;  4DR3 D;  3KYC B;  1H3F A;  4X65 D;  1KSV A;  1VIO A;  4DV3 D;  4X66 D;  4GKJ D;  4DUY D;  1C06 A;  4DR2 D;  4B3M D;  2UUA D;  3DH3 A;  4LF9 D;  2UXC D;  4W5V B;  5FLX E;  1N32 D;  2UXD D;  3JAM E;  1Y8Q B;  2ZM6 D;  3J80 E;  4AQY D;  4LGT A;  2UUB D;  4KHP D;  4B3T D;  4OUD A;  4B3S D;  1IBL D;  2KTL A;  4JI3 D;  4LFA D;  4JYA D;  3J7A F;  2UXB D;  4JI2 D;  5BR8 D;  3CMM A;  4II2 A;  4JI4 D;  2I1S A;  4JI1 D;  4JI7 D;  2LQ7 A;  4LFC D;  4OX9 D;  1J5E D;  3ONG A;  5LMU D;  4X62 D;  4LF4 D;  1KSL A;  1HR0 D;  1I94 D;  1N36 D;  2F4V D;  4DR7 D;  1N33 D;  4DR1 D;  1XMO D;  2HHH D;  4DR5 D;  4JI6 D;  5LL6 S;  2JAN A;  4X64 D;  1C05 A;  4NXM D;  4YY3 D;  4DV2 D;  5FQ2 B;  1HNW D;  4YHH D;  1IBK D;  5IWA D;  4LF5 D;  4LF8 D;  4K0K D;  1Y8X B;  4NXN D;  5IT9 E;  1XNR D;  4JI0 D;  4DV4 D;  2UUC D;  4GKK D;  4NNJ A;  1H3E A;  2VQF D;  4II3 A;  1DM9 A;  1FJG D;  2VQE D;  2L3N A;  4DV6 D;  4DV1 D;  4DV7 D;  4DUZ D;  2K6P A;  3FN1 A;  4JV5 D;  4DR4 D;  3KBG A;  2NVU B;  3J81 E;  4DR6 D;  3HP7 A;  3KYD B;  1P9K A;  1XMQ D;  3ONH A;  1FKA D;  4B3R D;  4DV5 D;  2E5L D;  4JI5 D;  1Y8R B;  3T1Y D;  1IBM D;  2IST A;  2UU9 D; 
#chains in the Genus database with same CATH homology
 3T1H D;  4LFB D;  1KSK A;  1HNX D;  4JI8 D;  1XNQ D;  1HNZ D;  1N34 D;  5LMN D;  4DV0 D;  4LF6 D;  3OTO D;  4LF7 D;  1JH3 A;  4DR3 D;  1H3F A;  4X65 D;  1KSV A;  1VIO A;  4DV3 D;  4X66 D;  4GKJ D;  4DUY D;  1C06 A;  4DR2 D;  4B3M D;  2UUA D;  3DH3 A;  4LF9 D;  2UXC D;  1N32 D;  2UXD D;  2ZM6 D;  4AQY D;  4LGT A;  2UUB D;  4KHP D;  4B3T D;  4OUD A;  4B3S D;  1IBL D;  2KTL A;  4JI3 D;  4LFA D;  4JYA D;  2UXB D;  4JI2 D;  5BR8 D;  4JI4 D;  4JI1 D;  4JI7 D;  4LFC D;  4OX9 D;  1J5E D;  5LMU D;  4X62 D;  4LF4 D;  1KSL A;  1HR0 D;  1I94 D;  1N36 D;  2F4V D;  4DR7 D;  1N33 D;  4DR1 D;  1XMO D;  2HHH D;  4DR5 D;  4JI6 D;  2JAN A;  4X64 D;  1C05 A;  4NXM D;  4YY3 D;  4DV2 D;  1HNW D;  4YHH D;  1IBK D;  5IWA D;  4LF5 D;  4LF8 D;  4K0K D;  4NXN D;  1XNR D;  4JI0 D;  4DV4 D;  2UUC D;  4GKK D;  1H3E A;  2VQF D;  1DM9 A;  1FJG D;  2VQE D;  2L3N A;  4DV6 D;  4DV1 D;  4DV7 D;  4DUZ D;  2K6P A;  4JV5 D;  4DR4 D;  3KBG A;  4DR6 D;  3HP7 A;  1P9K A;  1XMQ D;  1FKA D;  4B3R D;  4DV5 D;  2E5L D;  4JI5 D;  3T1Y D;  1IBM D;  2IST A;  2UU9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...