4LFAE

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 33
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lfaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfaE02
1Z0CA 1NHIA 1EA6A 1ZXMA 4HACB 2UUBE 2L2KB 4JI3I 5L3JA 4DR5I 2DIXA 2RTXA 3QT8A 4JI7I 4DR4I 1S16A 1KTVA 4KQVA 2N3HA 4OOGC 4JI2I 1FWLA 3M6AA 3ZKDA 2V2QA 1XNQE 3PYFA 2OI2A 4DV6I 1FI4A 1K47A 1HR0E 3ADIA 2UU9E 4JI6E 1EKZA 1QZRA 4LF8I 2UXCE 2X36A 4DV4E 4JI4I 3JAMC 1A6FA 2HFSA 4I3HA 3V2UC 1Z0WA 1HR0I 2UU9I 2LJHA 4PU9A 1PVGA 4HACA 3QT6A 4JV5I 5GMEA 2BM0A 4DPWA 1N32E 1Z0TA 5LMNI 4DV0I 4X65I 4HXZA 1H74A 4ED4A 1WHNA 1IBLI 5LMUI 1N36E 1IBKI 2RSMA 2HHHI 1GQEA 3WU6A 1YYWA 1NZ0A 3PYEA 1N34E 1N36I 2RS6A 3ZZTA 3ADJA 1BKNA 4DKKA 4URLA 1DI2A 2BM1A 2HKJA 2LRSA 1HNXI 1ZM9A 2ZM6E 1N34I 2E1RA 1MX0A 2UXDI 4LF7E 1YYOA 1ZM4A 1STUA 1FJGE 5BR8E 4P52A 3T1YE 4B3RI 4KHPE 4X62E 2DEIA 2ZM6I 4JI1E 1Z5AA 2NPFA 4RPFA 1XMOE 2HKEA 2BV3A 3T1YI 4LF5I 1DARA 1ZM3A 4JI3E 3PYGA 4X62I 4DR5E 4X8WA 1ELOA 4JI7E 3JAMQ 2V34A 3J80C 1WUUA 1FKAE 4USMA 2DEJA 1B63A 4JI2E 1T4OA 4NXNE 1WHQA 3LPSA 1EI1A 3J7AG 4DV6E 2V2VA 3LLHA 4WYQB 1X47A 4DR7I 2LJPA 4MYTA 3B78A 4DV3E 2J7KA 4LF8E 3ADLA 4DR6I 2HK2A 3CWVA 2DMYA 2A2DA 2NUEA 4NXNI 4JI8I 2F4VE 1Z0BA 4JI4E 2VQFE 1I94E 4DV3I 3B8HA 3LNUA 2LBSB 4JV5E 2XEXA 5LMNE 3ZZUA 2F4VI 4DV0E 4X65E 1N0UA 1RQ0A 1Z0VA 4LF6E 2VQFI 4WFTA 2LUQA 4DV5E 1IBLE 1I94I 5A2QQ 5LMUE 3V5RA 4WUBA 3D4JA 4DR2I 1IBKE 2A2CA 4LF6I 4HYMA 1IBME 3T1HI 4DV5I 2HHHE 4JI0E 4UT4A 1H7SA 4DXLA 1KVKA 4JI5I 2NA2A 1RR9A 3K1JA 3HULA 1FNMA 1IBMI 1MU5A 4JI0I 2X7IA 1HNXE 2VQEI 2UXDE 4M30A 2EZ6A 2L2MA 2UUAE 2EFGA 3J80Q 4FWHA 1T4NA 5A2QC 4DV7E 3B82A 1RC7A 4B3RE 4K0KE 1ZXNA 1NHJA 1N0VC 2LTSA 3VYYA 4LF9E 2UUAI 1ZM2A 3LTOA 2B7VA 1FWKA 4DV7I 1T4LB 4LF5E 5LL6R 1HNZE 4K0KI 3H4LA 4Z7YA 2AJ4A 4DR3E 1VISA 1J26A 5IT9C 4DR1E 4LF9I 4LFCE 4YY3I 2YT4A 5FLXQ 1O0WA 2KHXA 4B3SE 2LUPB 1HNZI 3ZKBA 2ZBKB 4DR3I 4DR1I 4YHHE 4LFCI 4DV2E 4JYAE 4DR7E 1QU6A 4AQYI 4DUZI 4B3SI 4DR6E 2DB2A 2CPNA 4JI8E 1X48A 4DPXA 3J81Q 1ZBTA 2V2ZA 1MG7A 4Z7CA 1KIJA 1XNRI 4YHHI 4DPTA 4DV2I 4JYAI 3Q1QA 3ADGA 1XHKA 4M1KA 1S4EA 2E5LE 1OJ4A 2HFUA 3HTXA 4P7AA 1Z59A 4GKKI 1B62A 1PIEA 4OX9E 3QT5A 4ZVIA 3ZM7A 5FLXC 4DUYE 5CFFE 4DU7A 4MYUA 3K17A 1XMQE 3WU3A 4PRVA 2E5LI 2VF3A 4DR2E 2RS7A 1J5EE 2MDRA 1YYKA 3T1HE 1PKPA 1YZ9A 4UTGA 2UUBI 2UUCE 4OX9I 3WU5A 4DUYI 1XMQI 2WW4A 4M2ZA 4JI5E 1N33E 3J81C 4LF4E 1KKHA 1J5EI 4USKA 2UUCI 3F0NA 1H73A 3OTOE 1XNQI 4JG4A 2L3JA 2VQEE 4EMDA 1N33I 3GONA 2Q2EB 5IT9Q 4JI6I 4LF4I 2UXCI 4XTJA 5GMDA 4B3TE 2V8PA 3OTOI 4GKJE 4DV4I 3C4BA 1UEKA 4DV1E 4X64E 2UXBE 2ZITA 4B3TI 4FW9A 1N32I 1Z0EA 4DPUA 4GKJI 4WUCA 4DV1I 3J7AM 1Z5CA 4X64I 4WUDA 2UXBI 4NXME 4YY3E 5IWAE 3QT7A 4HY1A 1UILA 3P1XA 3C4TA 3WU4A 1D6TA 2B3TB 4FN5A 3J7Yp 1HNWE 2R3VA 2L3CA 4AQYE 2LTRA 4NXMI 4DUZE 4X66E 5IWAI 4PRXA 2CZ9A 4LFBE 4LFAE 2HK3A 4R1FA 1U2RA 2R42A 3VYXA 1HNWI 2L2NA 1UHZA 4B3ME 1XNRE 2GS8A 3PYDA 4DU8A 2NUFA 4X66I 4LF7I 2JY9A 2N3GA 1H7UA 2JVAA 2NUGA 1Z5BA 4LFBI 1RREA 4LFAI 1FJGI 3ZZ0A 2IHR1 5BR8I 1NHHA 2B7TA 4GKKE 2L33A 4FWDA 1H72C 4DPYA 4B3MI 4KHPI 1X49A 4JI1I 1Z0GA 4FWGA 4DR4E 1XMOI
chains in the Genus database with same CATH superfamily
5A6BA 1Z0CA 2JWOA 1NHIA 1T39A 3M7NG 1A1IA 1BBOA 2F8BA 1EA6A 1ZXMA 2VF1A 3RMPA 2JEAA 2WNRA 4HACB 2VRDA 2UUBE 2L2KB 4NZVA 1YUJA 3UK3C 5C0XE 2NABA 5L3JA 2DLQA 4DR5I 4JI3I 2DIXA 2RTXA 4OKGA 3QT8A 4JI7I 4DR4I 1S16A 1KTVA 2F1DA 3PRYA 4KQVA 4IFDE 2EOOA 2Z5CB 2EPKX 2EPNA 2MDGA 2N3HA 4OOGC 4IZJA 4DMIA 5JEAF 4JI2I 2EOMA 1R6LA 1FWLA 2YTIA 3M6AA 3ZKDA 2E1MA 2C37A 3GLLA 5C0XC 4OO1E 2V2QA 2I9IA 1XNQE 2MC6A 3PYFA 3J7AM 2OI2A 2WCC3 4DV6I 3M85G 1FI4A 5C0XD 3P3EA 4IFDC 1K47A 1A1GA 4AM3A 2BBGA 1G2FC 1HR0E 3ADIA 3P3GA 2UU9E 1P42A 4JI6E 1EKZA 1JK1A 3KRNA 1QZRA 2EMGA 2IERA 4LF8I 2UXCE 4IFDD 5K36F 4N3OA 2EPRA 4OO1C 2DMIA 2X36A 2DSYA 2EOXA 2KONA 3VK6A 1IQOA 2YTPA 4DV4E 4JI4I 3JAMC 1A1HA 1A6FA 2HFSA 4OO1D 4P78A 4GEQB 4KZSA 1TF3A 4BBYA 1UBDC 4MU1A 4I3HA 3V2UC 1Z0WA 4BC9A 1HR0I 2R76A 2UU9I 2LJHA 4PU9A 1A1FA 2Z5BB 1MGTA 1PVGA 2CTDA 1E3HA 4HACA 2O1UA 3DJWA 2EMKA 2K4VA 3QT6A 2BM0A 2EOFA 2V85A 3AV0A 4BS9A 1N32E 1Z0TA 5GMEA 4DPWA 5LMNI 4DV0I 4X65I 1IMUA 1X6EA 4HXZA 1H74A 5AASA 4AIDA 4ED4A 1WHNA 4IJDA 3P3CA 1IBLI 2FV4B 2JP9A 2Z5CA 2EM5A 4R2EA 4F9AB 5LMUI 2YTOA 2L92A 5C0XF 1N36E 1IBKI 5AE1A 4BC7A 2RSMA 1PJTA 1F2IG 1A1KA 1AAYA 2M7QA 4IFDF 2BA1G 2HHHI 1GQEA 2EMIA 4R2DA 2EN1A 2EPOA 2ELYA 1KYQA 3WU6A 4R2AA 2LT7A 1YYWA 1NZ0A 3PYEA 2FGGA 4OO1F 2YTGA 4R03A 2EN3A 2EMHA 2YRKA 2YTDA 1N34E 3EPLA 2WBUA 2LE2A 2RS6A 1N36I 5A6BD 4M9VC 3ADJA 3ZZTA 1BKNA 3Q6NA 3EPHA 4U3BA 2EL5A 2DRPA 4DKKA 4URLA 2AE8A 1DI2A 2EMBA 1YHCA 3IWDA 2BM1A 2HKJA 2PO1B 1XXEA 2LRSA 4TUIA 1HNXI 2EM2A 1ZM9A 2Z5BA 2C39B 2ZM6E 4HTGA 4LTYA 1N34I 1MX0A 2E1RA 2UXDI 2M1SA 4LF7E 1YYOA 3HJCA 1ZM4A 1STUA 1YUIA 2JEBB 2VE7C 3P06A 3PS1A 2J65A 2EOSA 2V87A 1FJGE 3AUZA 5BR8E 1UN6B 4P52A 3IWCA 3T1YE 5KL7A 4KHPE 1IQSA 5ELWA 4B3RI 2JR1A 4X62E 2DEIA 2ZM6I 2EN8A 4JI1E 1Z5AA 2YTFA 1VI7A 2JE6B 2NPFA 4RPFA 1XMOE 1USUA 2EPXA 4MU0A 4L5NC 4ZYEA 2HKEA 4MQYA 2BV3A 2DGCA 3T1YI 4LF5I 4FW7A 1DARA 5A6JA 5KL6A 4JI3E 1ZM3A 2O1VA 1X5WA 3PYGA 4U3DA 3VHTB 4X62I 4DR5E 4X8WA 1ELOA 5A6AA 5DNLA 4JI7E 3JAMQ 1X6FA 2ADRA 2EOQA 2V34A 3J80C 4O43A 5DRPA 1WUUA 4ZYHA 1FKAE 4USMA 3L00A 2N8XA 1B63A 4IS1C 2YTNA 2DEJA 4JI2E 1EH8A 2EL6A 2GO3A 2WZOA 2M9AA 1T4OA 2EOJA 2Q8UA 4NXNE 1WHQA 4ZYGA 2C39A 3JU0A 3LPSA 2EMLA 2EM8A 1EI1A 3J7AG 5KL4A 4DV6E 2JEBA 2V2VA 4LU9A 2JPAA 5KL3A 3LLHA 1L4SA 4WYQB 1X47A 1Y5YA 4DR7I 2JOXA 2LJPA 4MYTA 3B78A 4DV3E 2EJ4A 2J7KA 2WBTA 4N4RB 4F6MA 4LF8E 3ADLA 5DROA 3ZOQB 2L8TA 4DR6I 4RH8A 3M99B 2HK2A 3CWVA 2DMYA 2A2DA 2NUEA 4MU3A 4NXNI 4JI8I 2CG9A 2F4VE 4Q35B 2YPNA 3CDIA 2L6MA 1MEYC 1Z0BA 4JI4E 2JE6A 4FW4A 2VQFE 1USVA 1I94E 2V89A 3HQ1A 4DV3I 2YRMA 3DF6A 4J8ZA 3B8HA 3LNUA 3Q6MA 3EPJA 2EN6A 4RHBB 2NN6E 2LBSB 4JV5E 2XEXA 4QNKA 2YU8A 1B69A 5LMNE 3ZZUA 2F4VI 2O1TA 4DV0E 4X65E 1N0UA 1RQ0A 1Z0VA 4LF6E 2EL4A 3MSWA 4NBQA 4WFTA 4OZEA 2VQFI 2LUQA 4DV5E 1IBLE 1I94I 5A2QQ 1Z1BA 1P47A 3NZKA 1OYSA 2EOEA 5LMUE 2EORA 5DNXA 3V5RA 4WUBA 2EMXA 1X3CA 2NN6C 3D4JA 4DR2I 3QG5C 1IBKE 1WRJA 2A2CA 3HPSA 4LF6I 2NN6D 4P7DA 4I8OA 4BHBA 4WX9A 1IBME 4HYMA 3T1HI 4DV5I 1ZBQA 2HHHE 4BA2B 1DQ3A 4JI0E 4UT4A 1H7SA 2PO0B 4DXLA 2MKNA 2I13A 3DD6A 1KVKA 2YTQA 2EQ0A 1TN9A 3C6MA 3F6HA 2R1FA 4JI5I 2EMYA 4F9BB 5FWKA 2EMWA 1DGCA 4LCFA 3K85A 2JXPA 2NA2A 1RR9A 1Y60A 3K1JA 3CDJA 3HULA 1FNMA 3U1YA 2EN2A 1IBMI 1MU5A 2GQ0A 1SR9A 5KL5A 4JI0I 2ENCA 1RMDA 2BB8A 2X7IA 1HNXE 3EQ1A 1R6MA 2VQEI 2UXDE 4M30A 2EZ6A 2L2MA 2HGHA 2EQ3A 2GHFA 2PNZB 2WBSA 1GTKA 5F3WA 1YH8A 2UUAE 4NHRA 3OMLA 2RPCA 2EFGA 3J80Q 1NCSA 2YWQA 4FWHA 2EMCA 1T4NA 5A2QC 2EM9A 2BR2B 4DV7E 3B82A 1RC7A 5A69A 4B3RE 2VESA 2RQLA 2V86A 4K0KE 1NHJA 1N0VC 1ZXNA 2V8QB 2NN6F 2WP8B 3BBGA 2YU5A 4GQUA 2LTSA 2V83A 3VYYA 5AE3A 4LF9E 4IZJD 2LCEA 2UUAI 1ZM2A 3LTOA 4LPFA 2B7VA 1UDQA 4MDTA 4LCHA 1FWKA 2V88A 1TF6A 2EOYA 4DV7I 4BA2A 1T4LB 2PO0A 4L8NA 5LL6R 4LF5E 1HNZE 1OYRA 4K0KI 4R2SA 3H1CA 3H4LA 4Z7YA 3L7ZB 5IXMB 3KWRA 2E72A 2GPIA 1A1JA 1G2DC 2AJ4A 4DR3E 1VISA 3BGHA 3HXLA 5IT9C 5KL2A 4DR1E 1LLMC 1J26A 4LF9I 4LFCE 4BA1B 3MHHC 4YY3I 2YT4A 5FLXQ 4IZKB 1O0WA 3JTZA 2O1WA 2KHXA 4B3SE 2PO2B 3KZYA 2LUPB 3HKMA 3ZKBA 2JT2A 2ZBKB 1HNZI 1Y4UA 2EN7A 4WXCA 4DR3I 2PNZA 1ZR9A 4DR1I 4YHHE 4LFCI 4DV2E 4JYAE 4DR7E 1QU6A 4AQYI 1QNTA 2EOHA 3K6QA 1Y6ZA 2BR2A 4DUZI 3FIGA 1GZ6A 2HJJA 4MU4A 2KOUA 4BHCA 4B3SI 3H09A 2PO1A 4DR6E 2WP8A 5LLQA 2DB2A 2CPNA 2EM7A 5JEAB 4JI8E 1X48A 4DPXA 1PJQA 3J81Q 4KWYA 3HPZA 1UDOA 1ZBTA 2V2ZA 2A25A 1MG7A 1KIJA 2EOZA 1WJPA 4Z7CA 4MLVA 1YSAC 4YHHI 1XNRI 4DPTA 2EWLA 4DV2I 4JYAI 4F54A 3Q1QA 2EP3A 4O5GA 3ADGA 1YPNA 1XHKA 4M1KA 4MLQA 1S4EA 2BA0D 2E5LE 1OJ4A 2YTEA 2HFUA 3L7ZA 4WXDA 5K36B 3HTXA 4P7AA 2D9HA 4ZYDA 5TSEA 1Z59A 4GKKI 1B62A 4FK5C 2RSIA 4OX9E 1PIEA 3QT5A 4BA1A 4ZVIA 2YRHA 1JK2A 2EMAA 4F6NA 3PS3A 3ZM7A 5FLXC 2IOPA 4DUYE 5CFFE 4IZKA 4TUGA 1KJKA 3K17A 1XMQE 2YZTA 4MYUA 4DU7A 2PO2A 3WU3A 2EQ1A 4R2RA 4PRVA 2E5LI 4O24A 1HK7A 2VF3A 4DR2E 1UDSA 2RS7A 3UHMA 5T6JA 1J5EE 2MDRA 4Q28A 3LMLA 5AE2A 3T1HE 1PKPA 2LJUA 1YYKA 1YZ9A 2UUCE 1BB8A 2MC5A 4UTGA 2UUBI 2O3ZA 4OX9I 5ADZA 5DRRA 3C6KA 3WU5A 4DUYI 1XMQI 2WW4A 1BBGA 3BF2A 5AC4A 4JI5E 4M2ZA 2K7IA 2H36X 5JEAA 4F9CB 4F2JC 1N33E 3J81C 2YSPA 5C0XB 4LF4E 1KKHA 1J5EI 1N3GA 2YTJA 5DRQA 4R8OA 3M7ND 3TQMA 1SFEA 4USKA 2UUCI 3F0NA 4WPYA 3OTOE 1H73A 4IFDB 1XNQI 2LV2A 4JG4A 5AC5A 2LMZA 2L3JA 3GCMA 2VQEE 2YSOA 1WXRA 4EMDA 2DLKA 1N33I 4OO1B 3GONA 5K36A 2Q2EB 2EMFA 5IT9Q 4JI6I 4LF4I 3BIDA 2PNMA 3KZZA 2UXCI 4XTJA 5GMDA 4GZNC 4B3TE 4LOMA 2LO3A 2V8PA 4ISAA 2JOBA 3OTOI 1PDAA 4QNJA 2J7JA 4GKJE 2Z5EA 2PRTA 4DV4I 4BCAA 3C4BA 2M4IA 4BMJA 1EH7A 1UEKA 3M85D 2EM4A 1ZAAC 2NN6B 1NEIA 4DV1E 4X64E 4WSPA 2UXBE 5EL9A 2ZITA 2GLIA 2EPZA 4B3TI 4FW9A 4R2PA 4R2QA 4J3DA 1N32I 1Z0EA 2EM6A 4DPUA 2EPLX 4GKJI 2CVEA 2EN4A 2EMZA 3ECRA 1YFHA 2IOQA 2FTXB 4WUCA 5C0XA 4HEIA 4DV1I 1E3PA 1Z5CA 2EM0A 2IESA 2ENAA 4WUDA 2ENHA 4AIMA 4NXME 4X64I 3B4TA 2UXBI 2MKDA 4YY3E 5IWAE 3PS2A 3QT7A 4O4KA 3GMEA 2G7HA 4HY1A 2EPCA 4IFDA 1UILA 1X6HA 2EE8A 3P1XA 3C4TA 2C38B 3WU4A 1RHYA 1D6TA 2B3TB 4FN5A 3J7Yp 1T38A 2EM3A 5EKWA 1HNWE 1OYPA 4OO1A 2CT1A 5A6KA 5JEAE 2WNRB 2JEAB 3F6GA 1PJSA 3U1KA 5DNYA 2L3CA 2R3VA 4AQYE 2LTRA 4NXMI 4IS9A 4DUZE 4X66E 5IWAI 4PRXA 2ODRC 1AH5A 2LVHA 2BA0G 4R2CA 2CZ9A 4LFBE 2ELZA 2PNLA 1EH6A 2EPMX 4LFAE 3MHSC 2HK3A 2ODRD 4R1FA 4IZJB 1U2RA 2R42A 3VYXA 2BA1D 2NN6A 1HNWI 2CGEA 2L2NA 5JEAC 4FW6A 1UHZA 4B3ME 1XNRE 2GS8A 4FW3A 3THOB 5K36E 4WSGA 2C37B 2B9DA 3THNA 3PYDA 4DU8A 2HC5A 2NUFA 2GO4A 2EPUA 4X66I 5JEAD 4LF7I 1A1LA 2JY9A 2N3GA 1ZU1A 1H7UA 4M0VA 2EPAA 2JVAA 2NUGA 1Z5BA 4LFBI 1RREA 4LFAI 1FJGI 3ZZ0A 2IHR1 5BR8I 1NHHA 1Y4SA 2EPPA 3P76A 2EOIA 3EPKA 2B7TA 4GKKE 2L33A 4FWDA 1H72C 2JYAA 5IV8B 1UDNA 4DPYA 1X49A 4B3MI 4JV5I 4KHPI 5K36C 4LCGA 4JI1I 1Z0GA 4FW5A 4FWGA 2CSHA 4X9JA 4DR4E 5K36D 3IWBA 1XMOI 2C38A
chains in the Genus database with same CATH topology
1Z0CA 2JWOA 1NHIA 1EA6A 1ZXMA 2F8BA 2VF1A 3RMPA 4HACB 2UUBE 2L2KB 4JI3I 5L3JA 4DR5I 2DIXA 2RTXA 3QT8A 4JI7I 4DR4I 1S16A 1KTVA 3PRYA 4KQVA 2Z5CB 2N3HA 4OOGC 4IZJA 4DMIA 4JI2I 1FWLA 3M6AA 3ZKDA 2E1MA 2V2QA 1XNQE 2MC6A 3PYFA 2OI2A 4DV6I 1FI4A 1K47A 1HR0E 3ADIA 2UU9E 4JI6E 1EKZA 1QZRA 4LF8I 2UXCE 4N3OA 2X36A 2DSYA 2KONA 3VK6A 4DV4E 4JI4I 3JAMC 1A6FA 2HFSA 4P78A 4GEQB 4KZSA 4I3HA 4BBYA 3V2UC 1Z0WA 4BC9A 1HR0I 2UU9I 2LJHA 4PU9A 2Z5BB 1PVGA 4HACA 2O1UA 3DJWA 3QT6A 2K4VA 5GMEA 2BM0A 2V85A 3AV0A 4BS9A 1N32E 1Z0TA 4DPWA 5LMNI 4DV0I 4X65I 4HXZA 1H74A 5AASA 4ED4A 1WHNA 1IBLI 2FV4B 2Z5CA 4F9AB 5LMUI 2L92A 1N36E 1IBKI 5AE1A 4BC7A 2RSMA 2M7QA 2HHHI 1GQEA 3WU6A 1YYWA 1NZ0A 3PYEA 2FGGA 4R03A 1N34E 1N36I 2LE2A 2RS6A 3ZZTA 3ADJA 1BKNA 3Q6NA 4DKKA 4URLA 1DI2A 3IWDA 2BM1A 2HKJA 2LRSA 4TUIA 1HNXI 2Z5BA 1ZM9A 2ZM6E 4LTYA 1N34I 1MX0A 2E1RA 2UXDI 2M1SA 4LF7E 1YYOA 3HJCA 1ZM4A 1STUA 2VE7C 3P06A 2V87A 1FJGE 3AUZA 5BR8E 4P52A 3IWCA 3T1YE 4B3RI 4KHPE 2JR1A 4X62E 2DEIA 2ZM6I 4JI1E 1Z5AA 2NPFA 4RPFA 1XMOE 1USUA 4L5NC 2HKEA 2BV3A 3T1YI 4LF5I 1DARA 1ZM3A 2O1VA 4JI3E 3PYGA 4X62I 4DR5E 4X8WA 1ELOA 4JI7E 3JAMQ 2V34A 3J80C 1WUUA 1FKAE 4USMA 2DEJA 1B63A 4JI2E 2WZOA 1T4OA 4NXNE 1WHQA 3JU0A 3LPSA 1EI1A 3J7AG 4DV6E 2V2VA 4LU9A 3LLHA 4WYQB 1X47A 4DR7I 2JOXA 2LJPA 4MYTA 3B78A 4DV3E 2J7KA 4LF8E 3ADLA 3ZOQB 2L8TA 4DR6I 2HK2A 3CWVA 2DMYA 2A2DA 2NUEA 4NXNI 4JI8I 2CG9A 2F4VE 2L6MA 1Z0BA 4JI4E 2VQFE 1USVA 1I94E 2V89A 3HQ1A 4DV3I 3DF6A 4J8ZA 3B8HA 3LNUA 3Q6MA 2LBSB 4JV5E 2XEXA 5LMNE 3ZZUA 2F4VI 2O1TA 4DV0E 4X65E 1N0UA 1RQ0A 1Z0VA 4LF6E 3MSWA 2VQFI 4WFTA 2LUQA 4DV5E 1IBLE 1I94I 5A2QQ 5LMUE 3V5RA 4WUBA 3D4JA 4DR2I 1IBKE 2A2CA 3HPSA 4LF6I 4P7DA 4I8OA 1IBME 4HYMA 3T1HI 4DV5I 1ZBQA 2HHHE 1DQ3A 4JI0E 4UT4A 1H7SA 4DXLA 1KVKA 3F6HA 4JI5I 4F9BB 5FWKA 3K85A 2NA2A 1RR9A 3K1JA 3HULA 1FNMA 1IBMI 1MU5A 2GQ0A 1SR9A 4JI0I 2X7IA 1HNXE 2VQEI 2UXDE 4M30A 2EZ6A 2L2MA 5F3WA 2UUAE 3OMLA 2EFGA 3J80Q 4FWHA 1T4NA 5A2QC 4DV7E 3B82A 1RC7A 4B3RE 2V86A 4K0KE 1ZXNA 1NHJA 1N0VC 2V8QB 2LTSA 2V83A 3VYYA 5AE3A 4LF9E 4IZJD 2UUAI 1ZM2A 3LTOA 2B7VA 1FWKA 2V88A 4DV7I 1T4LB 4L8NA 5LL6R 4LF5E 1HNZE 4K0KI 3H4LA 4Z7YA 3KWRA 2AJ4A 4DR3E 1VISA 1J26A 3HXLA 5IT9C 4DR1E 4LF9I 4LFCE 4YY3I 2YT4A 5FLXQ 4IZKB 1O0WA 3JTZA 2O1WA 2KHXA 4B3SE 2LUPB 1HNZI 3ZKBA 2ZBKB 1Y4UA 4DR3I 4DR1I 4YHHE 4LFCI 4DV2E 4JYAE 4DR7E 1QU6A 4AQYI 3K6QA 4DUZI 1Y6ZA 3FIGA 1GZ6A 2KOUA 4B3SI 3H09A 4DR6E 2DB2A 2CPNA 4JI8E 1X48A 4DPXA 3J81Q 3HPZA 1ZBTA 2V2ZA 1MG7A 4Z7CA 1KIJA 1XNRI 4YHHI 4DPTA 2EWLA 4DV2I 4JYAI 4F54A 3Q1QA 3ADGA 1XHKA 4M1KA 1S4EA 2E5LE 1OJ4A 2HFUA 3HTXA 4P7AA 1Z59A 4GKKI 1B62A 1PIEA 4OX9E 3QT5A 4ZVIA 3ZM7A 5FLXC 2IOPA 4DUYE 5CFFE 4IZKA 4TUGA 4MYUA 3K17A 1XMQE 2YZTA 4DU7A 3WU3A 4PRVA 2E5LI 1HK7A 2VF3A 4DR2E 2RS7A 5T6JA 1J5EE 1YYKA 2MDRA 4Q28A 3LMLA 5AE2A 3T1HE 1PKPA 1YZ9A 4UTGA 2UUCE 2UUBI 2MC5A 4OX9I 5ADZA 3WU5A 4DUYI 1XMQI 2WW4A 4M2ZA 4JI5E 2H36X 4F9CB 1N33E 3J81C 4LF4E 1KKHA 1J5EI 4R8OA 4USKA 2UUCI 3F0NA 4WPYA 3OTOE 1H73A 1XNQI 4JG4A 2L3JA 2LMZA 2VQEE 1WXRA 4EMDA 1N33I 3GONA 2Q2EB 5IT9Q 4JI6I 4LF4I 2PNMA 2UXCI 4XTJA 5GMDA 4B3TE 2V8PA 2JOBA 3OTOI 4GKJE 2Z5EA 4DV4I 4BCAA 3C4BA 2M4IA 4BMJA 1UEKA 4DV1E 4X64E 4WSPA 2UXBE 2ZITA 4B3TI 4FW9A 1N32I 1Z0EA 4DPUA 4GKJI 2IOQA 2FTXB 4WUCA 4DV1I 3J7AM 1Z5CA 4X64I 4WUDA 2UXBI 4NXME 4YY3E 5IWAE 3QT7A 2G7HA 4HY1A 1UILA 3P1XA 3C4TA 3WU4A 1D6TA 2B3TB 4FN5A 3J7Yp 1HNWE 3F6GA 5DNYA 2L3CA 2R3VA 4AQYE 2LTRA 4NXMI 4DUZE 4X66E 5IWAI 4PRXA 2ODRC 2CZ9A 4LFBE 2PNLA 4LFAE 2HK3A 4R1FA 2ODRD 4IZJB 1U2RA 2R42A 3VYXA 1HNWI 2CGEA 2L2NA 1UHZA 4B3ME 1XNRE 2GS8A 2B9DA 3PYDA 4DU8A 2NUFA 4X66I 4LF7I 2JY9A 2N3GA 1H7UA 4M0VA 2JVAA 2NUGA 1Z5BA 4LFBI 1RREA 4LFAI 1FJGI 3ZZ0A 2IHR1 5BR8I 1NHHA 1Y4SA 2B7TA 4GKKE 2L33A 4FWDA 1H72C 4DPYA 4B3MI 4JV5I 4KHPI 1X49A 4JI1I 1Z0GA 4FWGA 4DR4E 3IWBA 1XMOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0C A;  1NHI A;  1EA6 A;  1ZXM A;  4HAC B;  2UUB E;  2L2K B;  4JI3 I;  5L3J A;  4DR5 I;  2DIX A;  2RTX A;  3QT8 A;  4JI7 I;  4DR4 I;  1S16 A;  1KTV A;  4KQV A;  2N3H A;  4OOG C;  4JI2 I;  1FWL A;  3M6A A;  3ZKD A;  2V2Q A;  1XNQ E;  3PYF A;  2OI2 A;  4DV6 I;  1FI4 A;  1K47 A;  1HR0 E;  3ADI A;  2UU9 E;  4JI6 E;  1EKZ A;  1QZR A;  4LF8 I;  2UXC E;  2X36 A;  4DV4 E;  4JI4 I;  3JAM C;  1A6F A;  2HFS A;  4I3H A;  3V2U C;  1Z0W A;  1HR0 I;  2UU9 I;  2LJH A;  4PU9 A;  1PVG A;  4HAC A;  3QT6 A;  4JV5 I;  5GME A;  2BM0 A;  4DPW A;  1N32 E;  1Z0T A;  5LMN I;  4DV0 I;  4X65 I;  4HXZ A;  1H74 A;  4ED4 A;  1WHN A;  1IBL I;  5LMU I;  1N36 E;  1IBK I;  2RSM A;  2HHH I;  1GQE A;  3WU6 A;  1YYW A;  1NZ0 A;  3PYE A;  1N34 E;  1N36 I;  2RS6 A;  3ZZT A;  3ADJ A;  1BKN A;  4DKK A;  4URL A;  1DI2 A;  2BM1 A;  2HKJ A;  2LRS A;  1HNX I;  1ZM9 A;  2ZM6 E;  1N34 I;  2E1R A;  1MX0 A;  2UXD I;  4LF7 E;  1YYO A;  1ZM4 A;  1STU A;  1FJG E;  5BR8 E;  4P52 A;  3T1Y E;  4B3R I;  4KHP E;  4X62 E;  2DEI A;  2ZM6 I;  4JI1 E;  1Z5A A;  2NPF A;  4RPF A;  1XMO E;  2HKE A;  2BV3 A;  3T1Y I;  4LF5 I;  1DAR A;  1ZM3 A;  4JI3 E;  3PYG A;  4X62 I;  4DR5 E;  4X8W A;  1ELO A;  4JI7 E;  3JAM Q;  2V34 A;  3J80 C;  1WUU A;  1FKA E;  4USM A;  2DEJ A;  1B63 A;  4JI2 E;  1T4O A;  4NXN E;  1WHQ A;  3LPS A;  1EI1 A;  3J7A G;  4DV6 E;  2V2V A;  3LLH A;  4WYQ B;  1X47 A;  4DR7 I;  2LJP A;  4MYT A;  3B78 A;  4DV3 E;  2J7K A;  4LF8 E;  3ADL A;  4DR6 I;  2HK2 A;  3CWV A;  2DMY A;  2A2D A;  2NUE A;  4NXN I;  4JI8 I;  2F4V E;  1Z0B A;  4JI4 E;  2VQF E;  1I94 E;  4DV3 I;  3B8H A;  3LNU A;  2LBS B;  4JV5 E;  2XEX A;  5LMN E;  3ZZU A;  2F4V I;  4DV0 E;  4X65 E;  1N0U A;  1RQ0 A;  1Z0V A;  4LF6 E;  2VQF I;  4WFT A;  2LUQ A;  4DV5 E;  1IBL E;  1I94 I;  5A2Q Q;  5LMU E;  3V5R A;  4WUB A;  3D4J A;  4DR2 I;  1IBK E;  2A2C A;  4LF6 I;  4HYM A;  1IBM E;  3T1H I;  4DV5 I;  2HHH E;  4JI0 E;  4UT4 A;  1H7S A;  4DXL A;  1KVK A;  4JI5 I;  2NA2 A;  1RR9 A;  3K1J A;  3HUL A;  1FNM A;  1IBM I;  1MU5 A;  4JI0 I;  2X7I A;  1HNX E;  2VQE I;  2UXD E;  4M30 A;  2EZ6 A;  2L2M A;  2UUA E;  2EFG A;  3J80 Q;  4FWH A;  1T4N A;  5A2Q C;  4DV7 E;  3B82 A;  1RC7 A;  4B3R E;  4K0K E;  1ZXN A;  1NHJ A;  1N0V C;  2LTS A;  3VYY A;  4LF9 E;  2UUA I;  1ZM2 A;  3LTO A;  2B7V A;  1FWK A;  4DV7 I;  1T4L B;  4LF5 E;  5LL6 R;  1HNZ E;  4K0K I;  3H4L A;  4Z7Y A;  2AJ4 A;  4DR3 E;  1VIS A;  1J26 A;  5IT9 C;  4DR1 E;  4LF9 I;  4LFC E;  4YY3 I;  2YT4 A;  5FLX Q;  1O0W A;  2KHX A;  4B3S E;  2LUP B;  1HNZ I;  3ZKB A;  2ZBK B;  4DR3 I;  4DR1 I;  4YHH E;  4LFC I;  4DV2 E;  4JYA E;  4DR7 E;  1QU6 A;  4AQY I;  4DUZ I;  4B3S I;  4DR6 E;  2DB2 A;  2CPN A;  4JI8 E;  1X48 A;  4DPX A;  3J81 Q;  1ZBT A;  2V2Z A;  1MG7 A;  4Z7C A;  1KIJ A;  1XNR I;  4YHH I;  4DPT A;  4DV2 I;  4JYA I;  3Q1Q A;  3ADG A;  1XHK A;  4M1K A;  1S4E A;  2E5L E;  1OJ4 A;  2HFU A;  3HTX A;  4P7A A;  1Z59 A;  4GKK I;  1B62 A;  1PIE A;  4OX9 E;  3QT5 A;  4ZVI A;  3ZM7 A;  5FLX C;  4DUY E;  5CFF E;  4DU7 A;  4MYU A;  3K17 A;  1XMQ E;  3WU3 A;  4PRV A;  2E5L I;  2VF3 A;  4DR2 E;  2RS7 A;  1J5E E;  2MDR A;  1YYK A;  3T1H E;  1PKP A;  1YZ9 A;  4UTG A;  2UUB I;  2UUC E;  4OX9 I;  3WU5 A;  4DUY I;  1XMQ I;  2WW4 A;  4M2Z A;  4JI5 E;  1N33 E;  3J81 C;  4LF4 E;  1KKH A;  1J5E I;  4USK A;  2UUC I;  3F0N A;  1H73 A;  3OTO E;  1XNQ I;  4JG4 A;  2L3J A;  2VQE E;  4EMD A;  1N33 I;  3GON A;  2Q2E B;  5IT9 Q;  4JI6 I;  4LF4 I;  2UXC I;  4XTJ A;  5GMD A;  4B3T E;  2V8P A;  3OTO I;  4GKJ E;  4DV4 I;  3C4B A;  1UEK A;  4DV1 E;  4X64 E;  2UXB E;  2ZIT A;  4B3T I;  4FW9 A;  1N32 I;  1Z0E A;  4DPU A;  4GKJ I;  4WUC A;  4DV1 I;  3J7A M;  1Z5C A;  4X64 I;  4WUD A;  2UXB I;  4NXM E;  4YY3 E;  5IWA E;  3QT7 A;  4HY1 A;  1UIL A;  3P1X A;  3C4T A;  3WU4 A;  1D6T A;  2B3T B;  4FN5 A;  3J7Y p;  1HNW E;  2R3V A;  2L3C A;  4AQY E;  2LTR A;  4NXM I;  4DUZ E;  4X66 E;  5IWA I;  4PRX A;  2CZ9 A;  4LFB E;  4LFA E;  2HK3 A;  4R1F A;  1U2R A;  2R42 A;  3VYX A;  1HNW I;  2L2N A;  1UHZ A;  4B3M E;  1XNR E;  2GS8 A;  3PYD A;  4DU8 A;  2NUF A;  4X66 I;  4LF7 I;  2JY9 A;  2N3G A;  1H7U A;  2JVA A;  2NUG A;  1Z5B A;  4LFB I;  1RRE A;  4LFA I;  1FJG I;  3ZZ0 A;  2IHR 1;  5BR8 I;  1NHH A;  2B7T A;  4GKK E;  2L33 A;  4FWD A;  1H72 C;  4DPY A;  4B3M I;  4KHP I;  1X49 A;  4JI1 I;  1Z0G A;  4FWG A;  4DR4 E;  1XMO I; 
#chains in the Genus database with same CATH topology
 5A6B A;  1Z0C A;  2JWO A;  1NHI A;  1T39 A;  3M7N G;  1A1I A;  1BBO A;  2F8B A;  1EA6 A;  1ZXM A;  2VF1 A;  3RMP A;  2JEA A;  2WNR A;  4HAC B;  2VRD A;  2UUB E;  2L2K B;  4NZV A;  1YUJ A;  3UK3 C;  5C0X E;  2NAB A;  5L3J A;  2DLQ A;  4DR5 I;  4JI3 I;  2DIX A;  2RTX A;  4OKG A;  3QT8 A;  4JI7 I;  4DR4 I;  1S16 A;  1KTV A;  2F1D A;  3PRY A;  4KQV A;  4IFD E;  2EOO A;  2Z5C B;  2EPK X;  2EPN A;  2MDG A;  2N3H A;  4OOG C;  4IZJ A;  4DMI A;  5JEA F;  4JI2 I;  2EOM A;  1R6L A;  1FWL A;  2YTI A;  3M6A A;  3ZKD A;  2E1M A;  2C37 A;  3GLL A;  5C0X C;  4OO1 E;  2V2Q A;  2I9I A;  1XNQ E;  2MC6 A;  3PYF A;  3J7A M;  2OI2 A;  2WCC 3;  4DV6 I;  3M85 G;  1FI4 A;  5C0X D;  3P3E A;  4IFD C;  1K47 A;  1A1G A;  4AM3 A;  2BBG A;  1G2F C;  1HR0 E;  3ADI A;  3P3G A;  2UU9 E;  1P42 A;  4JI6 E;  1EKZ A;  1JK1 A;  3KRN A;  1QZR A;  2EMG A;  2IER A;  4LF8 I;  2UXC E;  4IFD D;  5K36 F;  4N3O A;  2EPR A;  4OO1 C;  2DMI A;  2X36 A;  2DSY A;  2EOX A;  2KON A;  3VK6 A;  1IQO A;  2YTP A;  4DV4 E;  4JI4 I;  3JAM C;  1A1H A;  1A6F A;  2HFS A;  4OO1 D;  4P78 A;  4GEQ B;  4KZS A;  1TF3 A;  4BBY A;  1UBD C;  4MU1 A;  4I3H A;  3V2U C;  1Z0W A;  4BC9 A;  1HR0 I;  2R76 A;  2UU9 I;  2LJH A;  4PU9 A;  1A1F A;  2Z5B B;  1MGT A;  1PVG A;  2CTD A;  1E3H A;  4HAC A;  2O1U A;  3DJW A;  2EMK A;  2K4V A;  3QT6 A;  2BM0 A;  2EOF A;  2V85 A;  3AV0 A;  4BS9 A;  1N32 E;  1Z0T A;  5GME A;  4DPW A;  5LMN I;  4DV0 I;  4X65 I;  1IMU A;  1X6E A;  4HXZ A;  1H74 A;  5AAS A;  4AID A;  4ED4 A;  1WHN A;  4IJD A;  3P3C A;  1IBL I;  2FV4 B;  2JP9 A;  2Z5C A;  2EM5 A;  4R2E A;  4F9A B;  5LMU I;  2YTO A;  2L92 A;  5C0X F;  1N36 E;  1IBK I;  5AE1 A;  4BC7 A;  2RSM A;  1PJT A;  1F2I G;  1A1K A;  1AAY A;  2M7Q A;  4IFD F;  2BA1 G;  2HHH I;  1GQE A;  2EMI A;  4R2D A;  2EN1 A;  2EPO A;  2ELY A;  1KYQ A;  3WU6 A;  4R2A A;  2LT7 A;  1YYW A;  1NZ0 A;  3PYE A;  2FGG A;  4OO1 F;  2YTG A;  4R03 A;  2EN3 A;  2EMH A;  2YRK A;  2YTD A;  1N34 E;  3EPL A;  2WBU A;  2LE2 A;  2RS6 A;  1N36 I;  5A6B D;  4M9V C;  3ADJ A;  3ZZT A;  1BKN A;  3Q6N A;  3EPH A;  4U3B A;  2EL5 A;  2DRP A;  4DKK A;  4URL A;  2AE8 A;  1DI2 A;  2EMB A;  1YHC A;  3IWD A;  2BM1 A;  2HKJ A;  2PO1 B;  1XXE A;  2LRS A;  4TUI A;  1HNX I;  2EM2 A;  1ZM9 A;  2Z5B A;  2C39 B;  2ZM6 E;  4HTG A;  4LTY A;  1N34 I;  1MX0 A;  2E1R A;  2UXD I;  2M1S A;  4LF7 E;  1YYO A;  3HJC A;  1ZM4 A;  1STU A;  1YUI A;  2JEB B;  2VE7 C;  3P06 A;  3PS1 A;  2J65 A;  2EOS A;  2V87 A;  1FJG E;  3AUZ A;  5BR8 E;  1UN6 B;  4P52 A;  3IWC A;  3T1Y E;  5KL7 A;  4KHP E;  1IQS A;  5ELW A;  4B3R I;  2JR1 A;  4X62 E;  2DEI A;  2ZM6 I;  2EN8 A;  4JI1 E;  1Z5A A;  2YTF A;  1VI7 A;  2JE6 B;  2NPF A;  4RPF A;  1XMO E;  1USU A;  2EPX A;  4MU0 A;  4L5N C;  4ZYE A;  2HKE A;  4MQY A;  2BV3 A;  2DGC A;  3T1Y I;  4LF5 I;  4FW7 A;  1DAR A;  5A6J A;  5KL6 A;  4JI3 E;  1ZM3 A;  2O1V A;  1X5W A;  3PYG A;  4U3D A;  3VHT B;  4X62 I;  4DR5 E;  4X8W A;  1ELO A;  5A6A A;  5DNL A;  4JI7 E;  3JAM Q;  1X6F A;  2ADR A;  2EOQ A;  2V34 A;  3J80 C;  4O43 A;  5DRP A;  1WUU A;  4ZYH A;  1FKA E;  4USM A;  3L00 A;  2N8X A;  1B63 A;  4IS1 C;  2YTN A;  2DEJ A;  4JI2 E;  1EH8 A;  2EL6 A;  2GO3 A;  2WZO A;  2M9A A;  1T4O A;  2EOJ A;  2Q8U A;  4NXN E;  1WHQ A;  4ZYG A;  2C39 A;  3JU0 A;  3LPS A;  2EML A;  2EM8 A;  1EI1 A;  3J7A G;  5KL4 A;  4DV6 E;  2JEB A;  2V2V A;  4LU9 A;  2JPA A;  5KL3 A;  3LLH A;  1L4S A;  4WYQ B;  1X47 A;  1Y5Y A;  4DR7 I;  2JOX A;  2LJP A;  4MYT A;  3B78 A;  4DV3 E;  2EJ4 A;  2J7K A;  2WBT A;  4N4R B;  4F6M A;  4LF8 E;  3ADL A;  5DRO A;  3ZOQ B;  2L8T A;  4DR6 I;  4RH8 A;  3M99 B;  2HK2 A;  3CWV A;  2DMY A;  2A2D A;  2NUE A;  4MU3 A;  4NXN I;  4JI8 I;  2CG9 A;  2F4V E;  4Q35 B;  2YPN A;  3CDI A;  2L6M A;  1MEY C;  1Z0B A;  4JI4 E;  2JE6 A;  4FW4 A;  2VQF E;  1USV A;  1I94 E;  2V89 A;  3HQ1 A;  4DV3 I;  2YRM A;  3DF6 A;  4J8Z A;  3B8H A;  3LNU A;  3Q6M A;  3EPJ A;  2EN6 A;  4RHB B;  2NN6 E;  2LBS B;  4JV5 E;  2XEX A;  4QNK A;  2YU8 A;  1B69 A;  5LMN E;  3ZZU A;  2F4V I;  2O1T A;  4DV0 E;  4X65 E;  1N0U A;  1RQ0 A;  1Z0V A;  4LF6 E;  2EL4 A;  3MSW A;  4NBQ A;  4WFT A;  4OZE A;  2VQF I;  2LUQ A;  4DV5 E;  1IBL E;  1I94 I;  5A2Q Q;  1Z1B A;  1P47 A;  3NZK A;  1OYS A;  2EOE A;  5LMU E;  2EOR A;  5DNX A;  3V5R A;  4WUB A;  2EMX A;  1X3C A;  2NN6 C;  3D4J A;  4DR2 I;  3QG5 C;  1IBK E;  1WRJ A;  2A2C A;  3HPS A;  4LF6 I;  2NN6 D;  4P7D A;  4I8O A;  4BHB A;  4WX9 A;  1IBM E;  4HYM A;  3T1H I;  4DV5 I;  1ZBQ A;  2HHH E;  4BA2 B;  1DQ3 A;  4JI0 E;  4UT4 A;  1H7S A;  2PO0 B;  4DXL A;  2MKN A;  2I13 A;  3DD6 A;  1KVK A;  2YTQ A;  2EQ0 A;  1TN9 A;  3C6M A;  3F6H A;  2R1F A;  4JI5 I;  2EMY A;  4F9B B;  5FWK A;  2EMW A;  1DGC A;  4LCF A;  3K85 A;  2JXP A;  2NA2 A;  1RR9 A;  1Y60 A;  3K1J A;  3CDJ A;  3HUL A;  1FNM A;  3U1Y A;  2EN2 A;  1IBM I;  1MU5 A;  2GQ0 A;  1SR9 A;  5KL5 A;  4JI0 I;  2ENC A;  1RMD A;  2BB8 A;  2X7I A;  1HNX E;  3EQ1 A;  1R6M A;  2VQE I;  2UXD E;  4M30 A;  2EZ6 A;  2L2M A;  2HGH A;  2EQ3 A;  2GHF A;  2PNZ B;  2WBS A;  1GTK A;  5F3W A;  1YH8 A;  2UUA E;  4NHR A;  3OML A;  2RPC A;  2EFG A;  3J80 Q;  1NCS A;  2YWQ A;  4FWH A;  2EMC A;  1T4N A;  5A2Q C;  2EM9 A;  2BR2 B;  4DV7 E;  3B82 A;  1RC7 A;  5A69 A;  4B3R E;  2VES A;  2RQL A;  2V86 A;  4K0K E;  1NHJ A;  1N0V C;  1ZXN A;  2V8Q B;  2NN6 F;  2WP8 B;  3BBG A;  2YU5 A;  4GQU A;  2LTS A;  2V83 A;  3VYY A;  5AE3 A;  4LF9 E;  4IZJ D;  2LCE A;  2UUA I;  1ZM2 A;  3LTO A;  4LPF A;  2B7V A;  1UDQ A;  4MDT A;  4LCH A;  1FWK A;  2V88 A;  1TF6 A;  2EOY A;  4DV7 I;  4BA2 A;  1T4L B;  2PO0 A;  4L8N A;  5LL6 R;  4LF5 E;  1HNZ E;  1OYR A;  4K0K I;  4R2S A;  3H1C A;  3H4L A;  4Z7Y A;  3L7Z B;  5IXM B;  3KWR A;  2E72 A;  2GPI A;  1A1J A;  1G2D C;  2AJ4 A;  4DR3 E;  1VIS A;  3BGH A;  3HXL A;  5IT9 C;  5KL2 A;  4DR1 E;  1LLM C;  1J26 A;  4LF9 I;  4LFC E;  4BA1 B;  3MHH C;  4YY3 I;  2YT4 A;  5FLX Q;  4IZK B;  1O0W A;  3JTZ A;  2O1W A;  2KHX A;  4B3S E;  2PO2 B;  3KZY A;  2LUP B;  3HKM A;  3ZKB A;  2JT2 A;  2ZBK B;  1HNZ I;  1Y4U A;  2EN7 A;  4WXC A;  4DR3 I;  2PNZ A;  1ZR9 A;  4DR1 I;  4YHH E;  4LFC I;  4DV2 E;  4JYA E;  4DR7 E;  1QU6 A;  4AQY I;  1QNT A;  2EOH A;  3K6Q A;  1Y6Z A;  2BR2 A;  4DUZ I;  3FIG A;  1GZ6 A;  2HJJ A;  4MU4 A;  2KOU A;  4BHC A;  4B3S I;  3H09 A;  2PO1 A;  4DR6 E;  2WP8 A;  5LLQ A;  2DB2 A;  2CPN A;  2EM7 A;  5JEA B;  4JI8 E;  1X48 A;  4DPX A;  1PJQ A;  3J81 Q;  4KWY A;  3HPZ A;  1UDO A;  1ZBT A;  2V2Z A;  2A25 A;  1MG7 A;  1KIJ A;  2EOZ A;  1WJP A;  4Z7C A;  4MLV A;  1YSA C;  4YHH I;  1XNR I;  4DPT A;  2EWL A;  4DV2 I;  4JYA I;  4F54 A;  3Q1Q A;  2EP3 A;  4O5G A;  3ADG A;  1YPN A;  1XHK A;  4M1K A;  4MLQ A;  1S4E A;  2BA0 D;  2E5L E;  1OJ4 A;  2YTE A;  2HFU A;  3L7Z A;  4WXD A;  5K36 B;  3HTX A;  4P7A A;  2D9H A;  4ZYD A;  5TSE A;  1Z59 A;  4GKK I;  1B62 A;  4FK5 C;  2RSI A;  4OX9 E;  1PIE A;  3QT5 A;  4BA1 A;  4ZVI A;  2YRH A;  1JK2 A;  2EMA A;  4F6N A;  3PS3 A;  3ZM7 A;  5FLX C;  2IOP A;  4DUY E;  5CFF E;  4IZK A;  4TUG A;  1KJK A;  3K17 A;  1XMQ E;  2YZT A;  4MYU A;  4DU7 A;  2PO2 A;  3WU3 A;  2EQ1 A;  4R2R A;  4PRV A;  2E5L I;  4O24 A;  1HK7 A;  2VF3 A;  4DR2 E;  1UDS A;  2RS7 A;  3UHM A;  5T6J A;  1J5E E;  2MDR A;  4Q28 A;  3LML A;  5AE2 A;  3T1H E;  1PKP A;  2LJU A;  1YYK A;  1YZ9 A;  2UUC E;  1BB8 A;  2MC5 A;  4UTG A;  2UUB I;  2O3Z A;  4OX9 I;  5ADZ A;  5DRR A;  3C6K A;  3WU5 A;  4DUY I;  1XMQ I;  2WW4 A;  1BBG A;  3BF2 A;  5AC4 A;  4JI5 E;  4M2Z A;  2K7I A;  2H36 X;  5JEA A;  4F9C B;  4F2J C;  1N33 E;  3J81 C;  2YSP A;  5C0X B;  4LF4 E;  1KKH A;  1J5E I;  1N3G A;  2YTJ A;  5DRQ A;  4R8O A;  3M7N D;  3TQM A;  1SFE A;  4USK A;  2UUC I;  3F0N A;  4WPY A;  3OTO E;  1H73 A;  4IFD B;  1XNQ I;  2LV2 A;  4JG4 A;  5AC5 A;  2LMZ A;  2L3J A;  3GCM A;  2VQE E;  2YSO A;  1WXR A;  4EMD A;  2DLK A;  1N33 I;  4OO1 B;  3GON A;  5K36 A;  2Q2E B;  2EMF A;  5IT9 Q;  4JI6 I;  4LF4 I;  3BID A;  2PNM A;  3KZZ A;  2UXC I;  4XTJ A;  5GMD A;  4GZN C;  4B3T E;  4LOM A;  2LO3 A;  2V8P A;  4ISA A;  2JOB A;  3OTO I;  1PDA A;  4QNJ A;  2J7J A;  4GKJ E;  2Z5E A;  2PRT A;  4DV4 I;  4BCA A;  3C4B A;  2M4I A;  4BMJ A;  1EH7 A;  1UEK A;  3M85 D;  2EM4 A;  1ZAA C;  2NN6 B;  1NEI A;  4DV1 E;  4X64 E;  4WSP A;  2UXB E;  5EL9 A;  2ZIT A;  2GLI A;  2EPZ A;  4B3T I;  4FW9 A;  4R2P A;  4R2Q A;  4J3D A;  1N32 I;  1Z0E A;  2EM6 A;  4DPU A;  2EPL X;  4GKJ I;  2CVE A;  2EN4 A;  2EMZ A;  3ECR A;  1YFH A;  2IOQ A;  2FTX B;  4WUC A;  5C0X A;  4HEI A;  4DV1 I;  1E3P A;  1Z5C A;  2EM0 A;  2IES A;  2ENA A;  4WUD A;  2ENH A;  4AIM A;  4NXM E;  4X64 I;  3B4T A;  2UXB I;  2MKD A;  4YY3 E;  5IWA E;  3PS2 A;  3QT7 A;  4O4K A;  3GME A;  2G7H A;  4HY1 A;  2EPC A;  4IFD A;  1UIL A;  1X6H A;  2EE8 A;  3P1X A;  3C4T A;  2C38 B;  3WU4 A;  1RHY A;  1D6T A;  2B3T B;  4FN5 A;  3J7Y p;  1T38 A;  2EM3 A;  5EKW A;  1HNW E;  1OYP A;  4OO1 A;  2CT1 A;  5A6K A;  5JEA E;  2WNR B;  2JEA B;  3F6G A;  1PJS A;  3U1K A;  5DNY A;  2L3C A;  2R3V A;  4AQY E;  2LTR A;  4NXM I;  4IS9 A;  4DUZ E;  4X66 E;  5IWA I;  4PRX A;  2ODR C;  1AH5 A;  2LVH A;  2BA0 G;  4R2C A;  2CZ9 A;  4LFB E;  2ELZ A;  2PNL A;  1EH6 A;  2EPM X;  4LFA E;  3MHS C;  2HK3 A;  2ODR D;  4R1F A;  4IZJ B;  1U2R A;  2R42 A;  3VYX A;  2BA1 D;  2NN6 A;  1HNW I;  2CGE A;  2L2N A;  5JEA C;  4FW6 A;  1UHZ A;  4B3M E;  1XNR E;  2GS8 A;  4FW3 A;  3THO B;  5K36 E;  4WSG A;  2C37 B;  2B9D A;  3THN A;  3PYD A;  4DU8 A;  2HC5 A;  2NUF A;  2GO4 A;  2EPU A;  4X66 I;  5JEA D;  4LF7 I;  1A1L A;  2JY9 A;  2N3G A;  1ZU1 A;  1H7U A;  4M0V A;  2EPA A;  2JVA A;  2NUG A;  1Z5B A;  4LFB I;  1RRE A;  4LFA I;  1FJG I;  3ZZ0 A;  2IHR 1;  5BR8 I;  1NHH A;  1Y4S A;  2EPP A;  3P76 A;  2EOI A;  3EPK A;  2B7T A;  4GKK E;  2L33 A;  4FWD A;  1H72 C;  2JYA A;  5IV8 B;  1UDN A;  4DPY A;  1X49 A;  4B3M I;  4JV5 I;  4KHP I;  5K36 C;  4LCG A;  4JI1 I;  1Z0G A;  4FW5 A;  4FWG A;  2CSH A;  4X9J A;  4DR4 E;  5K36 D;  3IWB A;  1XMO I;  2C38 A; 
#chains in the Genus database with same CATH homology
 1Z0C A;  2JWO A;  1NHI A;  1EA6 A;  1ZXM A;  2F8B A;  2VF1 A;  3RMP A;  4HAC B;  2UUB E;  2L2K B;  4JI3 I;  5L3J A;  4DR5 I;  2DIX A;  2RTX A;  3QT8 A;  4JI7 I;  4DR4 I;  1S16 A;  1KTV A;  3PRY A;  4KQV A;  2Z5C B;  2N3H A;  4OOG C;  4IZJ A;  4DMI A;  4JI2 I;  1FWL A;  3M6A A;  3ZKD A;  2E1M A;  2V2Q A;  1XNQ E;  2MC6 A;  3PYF A;  2OI2 A;  4DV6 I;  1FI4 A;  1K47 A;  1HR0 E;  3ADI A;  2UU9 E;  4JI6 E;  1EKZ A;  1QZR A;  4LF8 I;  2UXC E;  4N3O A;  2X36 A;  2DSY A;  2KON A;  3VK6 A;  4DV4 E;  4JI4 I;  3JAM C;  1A6F A;  2HFS A;  4P78 A;  4GEQ B;  4KZS A;  4I3H A;  4BBY A;  3V2U C;  1Z0W A;  4BC9 A;  1HR0 I;  2UU9 I;  2LJH A;  4PU9 A;  2Z5B B;  1PVG A;  4HAC A;  2O1U A;  3DJW A;  3QT6 A;  2K4V A;  5GME A;  2BM0 A;  2V85 A;  3AV0 A;  4BS9 A;  1N32 E;  1Z0T A;  4DPW A;  5LMN I;  4DV0 I;  4X65 I;  4HXZ A;  1H74 A;  5AAS A;  4ED4 A;  1WHN A;  1IBL I;  2FV4 B;  2Z5C A;  4F9A B;  5LMU I;  2L92 A;  1N36 E;  1IBK I;  5AE1 A;  4BC7 A;  2RSM A;  2M7Q A;  2HHH I;  1GQE A;  3WU6 A;  1YYW A;  1NZ0 A;  3PYE A;  2FGG A;  4R03 A;  1N34 E;  1N36 I;  2LE2 A;  2RS6 A;  3ZZT A;  3ADJ A;  1BKN A;  3Q6N A;  4DKK A;  4URL A;  1DI2 A;  3IWD A;  2BM1 A;  2HKJ A;  2LRS A;  4TUI A;  1HNX I;  2Z5B A;  1ZM9 A;  2ZM6 E;  4LTY A;  1N34 I;  1MX0 A;  2E1R A;  2UXD I;  2M1S A;  4LF7 E;  1YYO A;  3HJC A;  1ZM4 A;  1STU A;  2VE7 C;  3P06 A;  2V87 A;  1FJG E;  3AUZ A;  5BR8 E;  4P52 A;  3IWC A;  3T1Y E;  4B3R I;  4KHP E;  2JR1 A;  4X62 E;  2DEI A;  2ZM6 I;  4JI1 E;  1Z5A A;  2NPF A;  4RPF A;  1XMO E;  1USU A;  4L5N C;  2HKE A;  2BV3 A;  3T1Y I;  4LF5 I;  1DAR A;  1ZM3 A;  2O1V A;  4JI3 E;  3PYG A;  4X62 I;  4DR5 E;  4X8W A;  1ELO A;  4JI7 E;  3JAM Q;  2V34 A;  3J80 C;  1WUU A;  1FKA E;  4USM A;  2DEJ A;  1B63 A;  4JI2 E;  2WZO A;  1T4O A;  4NXN E;  1WHQ A;  3JU0 A;  3LPS A;  1EI1 A;  3J7A G;  4DV6 E;  2V2V A;  4LU9 A;  3LLH A;  4WYQ B;  1X47 A;  4DR7 I;  2JOX A;  2LJP A;  4MYT A;  3B78 A;  4DV3 E;  2J7K A;  4LF8 E;  3ADL A;  3ZOQ B;  2L8T A;  4DR6 I;  2HK2 A;  3CWV A;  2DMY A;  2A2D A;  2NUE A;  4NXN I;  4JI8 I;  2CG9 A;  2F4V E;  2L6M A;  1Z0B A;  4JI4 E;  2VQF E;  1USV A;  1I94 E;  2V89 A;  3HQ1 A;  4DV3 I;  3DF6 A;  4J8Z A;  3B8H A;  3LNU A;  3Q6M A;  2LBS B;  4JV5 E;  2XEX A;  5LMN E;  3ZZU A;  2F4V I;  2O1T A;  4DV0 E;  4X65 E;  1N0U A;  1RQ0 A;  1Z0V A;  4LF6 E;  3MSW A;  2VQF I;  4WFT A;  2LUQ A;  4DV5 E;  1IBL E;  1I94 I;  5A2Q Q;  5LMU E;  3V5R A;  4WUB A;  3D4J A;  4DR2 I;  1IBK E;  2A2C A;  3HPS A;  4LF6 I;  4P7D A;  4I8O A;  1IBM E;  4HYM A;  3T1H I;  4DV5 I;  1ZBQ A;  2HHH E;  1DQ3 A;  4JI0 E;  4UT4 A;  1H7S A;  4DXL A;  1KVK A;  3F6H A;  4JI5 I;  4F9B B;  5FWK A;  3K85 A;  2NA2 A;  1RR9 A;  3K1J A;  3HUL A;  1FNM A;  1IBM I;  1MU5 A;  2GQ0 A;  1SR9 A;  4JI0 I;  2X7I A;  1HNX E;  2VQE I;  2UXD E;  4M30 A;  2EZ6 A;  2L2M A;  5F3W A;  2UUA E;  3OML A;  2EFG A;  3J80 Q;  4FWH A;  1T4N A;  5A2Q C;  4DV7 E;  3B82 A;  1RC7 A;  4B3R E;  2V86 A;  4K0K E;  1ZXN A;  1NHJ A;  1N0V C;  2V8Q B;  2LTS A;  2V83 A;  3VYY A;  5AE3 A;  4LF9 E;  4IZJ D;  2UUA I;  1ZM2 A;  3LTO A;  2B7V A;  1FWK A;  2V88 A;  4DV7 I;  1T4L B;  4L8N A;  5LL6 R;  4LF5 E;  1HNZ E;  4K0K I;  3H4L A;  4Z7Y A;  3KWR A;  2AJ4 A;  4DR3 E;  1VIS A;  1J26 A;  3HXL A;  5IT9 C;  4DR1 E;  4LF9 I;  4LFC E;  4YY3 I;  2YT4 A;  5FLX Q;  4IZK B;  1O0W A;  3JTZ A;  2O1W A;  2KHX A;  4B3S E;  2LUP B;  1HNZ I;  3ZKB A;  2ZBK B;  1Y4U A;  4DR3 I;  4DR1 I;  4YHH E;  4LFC I;  4DV2 E;  4JYA E;  4DR7 E;  1QU6 A;  4AQY I;  3K6Q A;  4DUZ I;  1Y6Z A;  3FIG A;  1GZ6 A;  2KOU A;  4B3S I;  3H09 A;  4DR6 E;  2DB2 A;  2CPN A;  4JI8 E;  1X48 A;  4DPX A;  3J81 Q;  3HPZ A;  1ZBT A;  2V2Z A;  1MG7 A;  4Z7C A;  1KIJ A;  1XNR I;  4YHH I;  4DPT A;  2EWL A;  4DV2 I;  4JYA I;  4F54 A;  3Q1Q A;  3ADG A;  1XHK A;  4M1K A;  1S4E A;  2E5L E;  1OJ4 A;  2HFU A;  3HTX A;  4P7A A;  1Z59 A;  4GKK I;  1B62 A;  1PIE A;  4OX9 E;  3QT5 A;  4ZVI A;  3ZM7 A;  5FLX C;  2IOP A;  4DUY E;  5CFF E;  4IZK A;  4TUG A;  4MYU A;  3K17 A;  1XMQ E;  2YZT A;  4DU7 A;  3WU3 A;  4PRV A;  2E5L I;  1HK7 A;  2VF3 A;  4DR2 E;  2RS7 A;  5T6J A;  1J5E E;  1YYK A;  2MDR A;  4Q28 A;  3LML A;  5AE2 A;  3T1H E;  1PKP A;  1YZ9 A;  4UTG A;  2UUC E;  2UUB I;  2MC5 A;  4OX9 I;  5ADZ A;  3WU5 A;  4DUY I;  1XMQ I;  2WW4 A;  4M2Z A;  4JI5 E;  2H36 X;  4F9C B;  1N33 E;  3J81 C;  4LF4 E;  1KKH A;  1J5E I;  4R8O A;  4USK A;  2UUC I;  3F0N A;  4WPY A;  3OTO E;  1H73 A;  1XNQ I;  4JG4 A;  2L3J A;  2LMZ A;  2VQE E;  1WXR A;  4EMD A;  1N33 I;  3GON A;  2Q2E B;  5IT9 Q;  4JI6 I;  4LF4 I;  2PNM A;  2UXC I;  4XTJ A;  5GMD A;  4B3T E;  2V8P A;  2JOB A;  3OTO I;  4GKJ E;  2Z5E A;  4DV4 I;  4BCA A;  3C4B A;  2M4I A;  4BMJ A;  1UEK A;  4DV1 E;  4X64 E;  4WSP A;  2UXB E;  2ZIT A;  4B3T I;  4FW9 A;  1N32 I;  1Z0E A;  4DPU A;  4GKJ I;  2IOQ A;  2FTX B;  4WUC A;  4DV1 I;  3J7A M;  1Z5C A;  4X64 I;  4WUD A;  2UXB I;  4NXM E;  4YY3 E;  5IWA E;  3QT7 A;  2G7H A;  4HY1 A;  1UIL A;  3P1X A;  3C4T A;  3WU4 A;  1D6T A;  2B3T B;  4FN5 A;  3J7Y p;  1HNW E;  3F6G A;  5DNY A;  2L3C A;  2R3V A;  4AQY E;  2LTR A;  4NXM I;  4DUZ E;  4X66 E;  5IWA I;  4PRX A;  2ODR C;  2CZ9 A;  4LFB E;  2PNL A;  4LFA E;  2HK3 A;  4R1F A;  2ODR D;  4IZJ B;  1U2R A;  2R42 A;  3VYX A;  1HNW I;  2CGE A;  2L2N A;  1UHZ A;  4B3M E;  1XNR E;  2GS8 A;  2B9D A;  3PYD A;  4DU8 A;  2NUF A;  4X66 I;  4LF7 I;  2JY9 A;  2N3G A;  1H7U A;  4M0V A;  2JVA A;  2NUG A;  1Z5B A;  4LFB I;  1RRE A;  4LFA I;  1FJG I;  3ZZ0 A;  2IHR 1;  5BR8 I;  1NHH A;  1Y4S A;  2B7T A;  4GKK E;  2L33 A;  4FWD A;  1H72 C;  4DPY A;  4B3M I;  4JV5 I;  4KHP I;  1X49 A;  4JI1 I;  1Z0G A;  4FWG A;  4DR4 E;  3IWB A;  1XMO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...