4LFAE

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 33
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lfaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfaE02
2B3TB 3WU5A 1FJGI 1HNXE 4DV1I 3ADGA 3H4LA 2ZM6I 1RC7A 1T4NA 1I94E 2R3VA 2V8PA 2VQFE 1QZRA 2L3JA 4K0KI 2NPFA 4DPXA 1H7SA 4UTGA 1UILA 2CZ9A 2NUGA 1YYKA 5BR8I 1MG7A 4JI7E 4LF7E 4FWDA 3V2UC 1EKZA 4HACB 4JV5E 4WFTA 4LFAE 4JG4A 3Q1QA 4YHHI 2N3HA 1BKNA 2BM1A 4FN5A 4B3SE 5FLXQ 5IWAI 4M1KA 4WUDA 4X62E 3T1HI 2R42A 3ZKDA 2HKEA 2VQEI 1N0VC 3LNUA 1PKPA 4LF8I 4I3HA 1UEKA 3T1YI 3M6AA 1N34I 2VF3A 2NA2A 1IBMI 1KIJA 2IHR1 3VYYA 2UXBI 4X66I 3J7AM 4DPUA 1XMOE 1D6TA 1IBKE 4LFCE 2E5LI 2DEJA 4DUYE 4USKA 4JI4E 2V2ZA 4JI7I 4M30A 1HNZE 2B7VA 5IT9C 4B3MI 3B82A 2ZBKB 3VYXA 4B3SI 1J5EE 1YZ9A 2EZ6A 4DU7A 4FW9A 1DI2A 4WUCA 1HR0I 4KHPE 2ZM6E 2RS7A 4DV3I 4NXMI 3ADLA 4K0KE 3LLHA 4LF9E 1PIEA 5BR8E 1N32I 1XMOI 1ZM3A 2A2CA 2UUCI 4DR1E 2HK3A 1Z0BA 4DV6I 3JAMC 2DB2A 3QT7A 4X65I 1KTVA 4JYAI 1XNRI 4YHHE 5IWAE 2HFSA 4WYQB 1HNZI 2BV3A 3J7Yp 2L3CA 3T1HE 4LFBI 4PRVA 2VQEE 1ZM9A 3J80Q 3B8HA 4DR4I 3J81C 1QU6A 1KKHA 4DUZI 4LF8E 3T1YE 1N34E 1IBME 2HKJA 1NZ0A 4LF6I 2JY9A 2UXBE 4X66E 2LTRA 4YY3I 2E5LE 4KHPI 1NHIA 3OTOI 2E1RA 4RPFA 2UXDE 4JI3I 1ELOA 2A2DA 2N3GA 1STUA 2ZITA 4LF9I 2DEIA 4NXNI 2HHHI 4DR1I 2LRSA 4LF4E 4B3ME 1YYOA 4LF5E 2L2NA 4DR7E 4GKJI 1KVKA 5LMNE 4GKKI 4MYTA 1A6FA 1S16A 4JI8I 2L33A 1X47A 3ZZTA 1HR0E 2V34A 4DV3E 4FWGA 4NXME 4B3RI 3HTXA 3ZM7A 2EFGA 1N32E 3J81Q 1XNQI 2LJHA 2UUCE 4DXLA 5A2QC 4DV6E 2X36A 2UXDI 3ADIA 1H7UA 4X65E 4JYAE 1NHHA 1MU5A 1XNRE 2UU9E 1DARA 4JI2E 2DMYA 2X7IA 3CWVA 2AJ4A 3C4TA 3V5RA 1WHQA 4JI5I 4LF4I 4HY1A 4LFBE 1S4EA 4LF5I 4DR4E 3PYDA 4R1FA 4DUZE 3WU3A 4Z7CA 2L2MA 4DR7I 1PVGA 5LMNI 2UUBE 4OX9E 3LPSA 4DV7E 4LF6E 2LUPB 1N36I 1UHZA 4YY3E 1N33I 3OTOE 1B62A 2F4VI 4JI3E 2OI2A 4PU9A 1ZM2A 1IBLI 1H73A 4PRXA 4NXNE 3B78A 2HHHE 1B63A 4DR6E 4DPTA 4DV2I 1Z0CA 1YYWA 2LTSA 1RR9A 2UU9I 4JI2I 4GKJE 4GKKE 3F0NA 3ZZ0A 4JI8E 4WUBA 3ZZUA 5FLXC 4HYMA 4URLA 1J26A 1RREA 2UUBI 4OX9I 5IT9Q 4DV7I 4B3RE 1Z5BA 3QT8A 4EMDA 1XNQE 4X64I 5LL6R 4UT4A 1H72C 4DV4I 1Z0WA 3ZKBA 3HULA 2YT4A 1NHJA 1FWLA 4DR3I 4DV0I 4P7AA 2WW4A 1Z0VA 4JI5E 4DR6I 3J7AG 4B3TI 1GQEA 1MX0A 4USMA 1FWKA 2L2KB 5LMUI 4JI6I 4DPYA 4DR2I 2DIXA 1VISA 3JAMQ 1Z0TA 4JI1I 1X49A 3GONA 2UUAE 1N36E 1N33E 2J7KA 2F4VE 2MDRA 4DPWA 4FWHA 1H74A 1X48A 4JI0I 1IBLE 4DU8A 5GMDA 1XMQI 3PYEA 3PYFA 4DV2E 1HNWI 4DV5I 2LJPA 4DR5I 1FKAE 1N0UA 3D4JA 2BM0A 1K47A 4ZVIA 2V2QA 3LTOA 4XTJA 2JVAA 4AQYI 1OJ4A 4HXZA 1HNXI 4KQVA 1I94I 5CFFE 2VQFI 1WHNA 2GS8A 3J80C 2XEXA 4M2ZA 2HK2A 3K1JA 4ED4A 2UUAI 4X64E 5L3JA 1Z0GA 4LF7I 4DV4E 5GMEA 4Z7YA 1Z5CA 4JV5I 1Z59A 2RS6A 4LFAI 4DR3E 2NUFA 3ADJA 4DV0E 2UXCE 2RTXA 1RQ0A 4B3TE 2KHXA 2V2VA 4X62I 3P1XA 1FJGE 1Z5AA 4DV1E 5LMUE 4JI6E 4OOGC 2B7TA 4DR2E 1FNMA 3QT6A 1T4LB 5A2QQ 1ZXNA 2LBSB 1XHKA 4JI1E 2HFUA 1Z0EA 1ZXMA 2Q2EB 3QT5A 4P52A 2NUEA 1IBKI 4LFCI 2CPNA 1ZBTA 4DUYI 4JI0E 3PYGA 1EA6A 3WU6A 1WUUA 4JI4I 1FI4A 1ZM4A 1XMQE 4HACA 2RSMA 1T4OA 3C4BA 1HNWE 4X8WA 3WU4A 4DV5E 4DR5E 4DKKA 2LUQA 4MYUA 1J5EI 2UXCI 1U2RA 1EI1A 3K17A 4AQYE 1O0WA
chains in the Genus database with same CATH superfamily
2B3TB 4F2JC 3WU5A 4LCFA 1FJGI 4HEIA 2DMIA 2EMHA 2N8XA 1HNXE 4DV1I 1EH6A 2ELZA 3ADGA 4U3DA 3M99B 3H4LA 2ZM6I 1RC7A 4BS9A 1T4NA 1I94E 2R3VA 3U1KA 3TQMA 3EPHA 2V8PA 2VQFE 1QZRA 1PJSA 2EMYA 2YTOA 2VE7C 4M0VA 2L3JA 1UN6B 2GO3A 1BBOA 4K0KI 2NPFA 4DPXA 1H7SA 4F9BB 4UTGA 1UILA 2CZ9A 2NUGA 3MHSC 5ADZA 1YYKA 5BR8I 2EM5A 4MDTA 1MG7A 1EH7A 4JI7E 4LF7E 2WNRA 1TF6A 2VRDA 3RMPA 4FWDA 2PNZA 3V2UC 1EKZA 4HACB 4JV5E 2K4VA 2DRPA 4RHBB 4WFTA 4LFAE 2JP9A 2EPUA 2YRHA 4JG4A 3Q1QA 2LV2A 5KL3A 2H36X 4YHHI 2N3HA 1BKNA 2BM1A 4FN5A 4B3SE 5FLXQ 4ZYDA 2EN3A 1PDAA 2MC5A 4M1KA 5IWAI 2I13A 2PO2A 5A6BA 4WUDA 1IQSA 2BA0D 2EOZA 4X62E 3T1HI 2R42A 2PO1A 4P78A 3ZKDA 2HKEA 2LO3A 2VQEI 1X5WA 1N0VC 3LNUA 1PKPA 2YU8A 2J65A 1UEKA 2EMZA 3M6AA 4I3HA 2VF3A 2NA2A 3EPLA 3T1YI 1N34I 1IBMI 4BCAA 1KIJA 2IHR1 3VYYA 2UXBI 4OKGA 1WXRA 4X66I 3J7AM 3GCMA 4F9AB 4DPUA 1XMOE 1D6TA 1IBKE 2EOQA 1A1HA 4LFCE 2WNRB 2BA1G 2E5LI 2C39A 2PNZB 2EM6A 1A1LA 2DEJA 3DJWA 2EM3A 1G2FC 2EPRA 1A1KA 4DUYE 1Y60A 4USKA 5C0XE 4IS9A 1TN9A 5A6BD 5AC4A 4JI4E 4WXCA 4LPFA 2ELYA 1YUIA 2O1VA 2V2ZA 4M30A 4JI7I 1HNZE 2B7VA 2PO2B 2DLQA 5IT9C 2EN1A 4B3MI 5A6AA 2PO1B 2EM7A 4MU1A 2EPPA 4BHCA 4IFDF 3B82A 1PJQA 2ZBKB 1VI7A 3VYXA 4B3SI 1J5EE 1KYQA 1YZ9A 3P3GA 4IFDC 2EZ6A 5KL2A 3HJCA 4DU7A 2M7QA 1DGCA 3AV0A 2EMGA 2DLKA 4BBYA 5KL5A 4LU9A 2ADRA 2C38A 4FW9A 3IWBA 2YTPA 2L6MA 1DI2A 4WUCA 3UHMA 2EMWA 1HR0I 4KHPE 2ZM6E 2RS7A 2C39B 2YPNA 4OO1E 3F6GA 2CT1A 5DNYA 4DV3I 3GLLA 3VHTB 4NXMI 2EOYA 3ADLA 4K0KE 1UDQA 1E3PA 2EMFA 3LLHA 3AUZA 5DNLA 5C0XC 2CG9A 2NN6E 5EL9A 1NCSA 2EPCA 4MLQA 4LF9E 4R2DA 2LT7A 1PIEA 5BR8E 4BC7A 2RSIA 1YFHA 1XXEA 2A2CA 1ZM3A 2HJJA 4DR1E 2CVEA 1Z0BA 2HK3A 2UUCI 4FW7A 4DV6I 4BHBA 3JAMC 2DB2A 2ODRC 2PNMA 2R76A 1R6MA 3QT7A 4X65I 1KTVA 5JEAE 3QG5C 4JYAI 3THOB 1XNRI 2V86A 4YHHE 5KL4A 4WSGA 4M9VC 5IWAE 4NBQA 2HFSA 4WYQB 3BGHA 1YUJA 2PRTA 2JE6B 3B4TA 2EJ4A 4OZEA 4U3BA 1HNZI 3M7NG 4ZYEA 1G2DC 2V85A 2LMZA 3J7Yp 2L3CA 5A6JA 3T1HE 2ENHA 2BV3A 2C38B 2IOQA 4PRVA 2FTXB 4BA1B 4LFBI 4OO1F 2VQEE 1ZM9A 3J80Q 3B8HA 2E72A 1JK1A 4DR4I 2LVHA 3J81C 2WCC3 1QU6A 3IWDA 1RMDA 1KKHA 4DUZI 4Q28A 2VF1A 3T1YE 1N34E 2YWQA 1IBME 4LF8E 2HKJA 2NN6F 2CGEA 4OO1C 4IFDA 4R2PA 1Y4SA 2WBUA 1NZ0A 2NN6C 2JY9A 2UXBE 4LF6I 4X66E 2LTRA 1SFEA 1ZR9A 3LMLA 1A1FA 4FK5C 4YY3I 2E5LE 5FWKA 4KHPI 3P06A 1NHIA 3OTOI 5AE2A 2WZOA 1OYPA 2E1RA 4ZYGA 2UXDE 2C37A 3PS3A 1ELOA 4RPFA 4JI3I 4R2SA 4LCGA 2LJUA 2A2DA 4R2RA 2PO0A 2N3GA 2FV4B 2EM2A 2YTJA 4IZKA 1STUA 2ZITA 4LF9I 4LTYA 4GZNC 2EMIA 2DEIA 2J7JA 4NXNI 2HHHI 4DR1I 2LRSA 4LF4E 2PNLA 2L8TA 4B3ME 1X6HA 2WBTA 1YYOA 1A1GA 4LF5E 4IFDD 1USVA 2L2NA 2EOEA 2EOIA 3HPSA 4IJDA 2EORA 4MU3A 2JOXA 3L00A 4DR7E 1E3HA 4GKJI 4P7DA 1KVKA 5LMNE 4IFDB 4GKKI 4MYTA 2JEBA 1A6FA 1S16A 4JI8I 2EMKA 2L33A 1X47A 2EP3A 2RPCA 3ZZTA 4MLVA 4DMIA 1HR0E 2A25A 4IS1C 4O5GA 1TF3A 2V34A 2MKDA 5K36A 3GMEA 2CSHA 4N4RB 3P3CA 2EM9A 4DV3E 3KZYA 4FWGA 4NXME 2LCEA 2YTIA 4F6MA 1P42A 3HTXA 3ZM7A 4B3RI 2NN6A 4IZKB 1T39A 2I9IA 5DNXA 3UK3C 2EFGA 1N32E 3BIDA 3J81Q 2LJHA 5AASA 3FIGA 5IXMB 2UUCE 5A2QC 3Q6NA 4DXLA 4DV6E 3DF6A 2X36A 1QNTA 2UXDI 3ADIA 1H7UA 4X65E 4JYAE 1NHHA 2JR1A 1MU5A 2GPIA 1XNRE 4IZJA 2UU9E 1DARA 5EKWA 4GEQB 4JI2E 3PRYA 2DMYA 2X7IA 1BBGA 2AJ4A 3CWVA 1AH5A 3C4TA 3V5RA 1YPNA 1WHQA 4JI5I 5K36D 2GHFA 4LF4I 2BA1D 2JEBB 4HY1A 4LFBE 1S4EA 2IESA 4OO1D 2YU5A 4LF5I 4DR4E 2WP8A 2YSPA 5K36B 3PYDA 4R1FA 3KZZA 5KL7A 4DUZE 3WU3A 4Z7CA 2L2MA 2EN4A 2NN6D 4DR7I 1PVGA 5LMNI 2O1UA 1IMUA 2UUBE 4OX9E 3LPSA 4DV7E 2O1TA 3HXLA 4LF6E 2M9AA 2EMXA 2LUPB 4L5NC 1N36I 4HTGA 4L8NA 1UHZA 2EMLA 4YY3E 1N33I 1A1IA 3OTOE 1B62A 5C0XF 2R1FA 2F4VI 4BA2A 2BR2A 4IZJD 2L92A 4JI3E 2OI2A 4PU9A 1ZM2A 1IBLI 1F2IG 1XNQI 1H73A 4KWYA 4LOMA 1NEIA 4PRXA 2EOHA 4WPYA 4NXNE 3B78A 2HHHE 4R2QA 5A6KA 1ZU1A 1B63A 3M85G 4DR6E 3MHHC 2EQ3A 2M4IA 4DPTA 4QNKA 3IWCA 4DV2I 4FW3A 1Z0CA 1YYWA 2WP8B 2LTSA 1UDOA 1RR9A 3DD6A 2UU9I 2EPMX 4JI2I 3THNA 2EOFA 2EPOA 4ZYHA 4GKJE 1OYRA 4F54A 2EN6A 2EM0A 2HGHA 2O1WA 4GKKE 3F0NA 2B9DA 3ZZ0A 3NZKA 4JI8E 4WUBA 4TUIA 4MU4A 3ZZUA 2IOPA 5FLXC 1WJPA 5AE3A 2EOJA 2BR2B 3PS1A 3PS2A 5ELWA 4HYMA 2EPAA 5T6JA 4URLA 1J26A 4X9JA 1KJKA 1RREA 3HQ1A 2UUBI 4OX9I 5IT9Q 2YZTA 3M7ND 4DV7I 4B3RE 1Z5BA 3EPKA 4O4KA 3QT8A 4EMDA 2MC6A 1EH8A 4QNJA 4FW4A 4NHRA 2EN7A 1XNQE 5LL6R 4UT4A 4X64I 3VK6A 2EMCA 1H72C 5JEAF 4DV4I 1Z0WA 2Z5CA 1MEYC 5DRPA 3C6KA 2BB8A 4ISAA 3ZKBA 2EPNA 1LLMC 5JEAC 3HULA 5C0XA 2K7IA 2YT4A 1NHJA 1FWLA 2WBSA 4GQUA 4DR3I 3K6QA 4NZVA 1YHCA 4WX9A 5DRRA 5DROA 4DV0I 4P7AA 2EPKX 2WW4A 4AIDA 1Z0VA 2E1MA 4JI5E 2ENAA 2YTGA 1OYSA 4DR6I 3J7AG 4B3TI 1GQEA 1MX0A 4USMA 1FWKA 4N3OA 2L2KB 5DRQA 1N32I 4O43A 5LMUI 4JI6I 1Y6ZA 4DPYA 1ZAAC 2EOSA 2IERA 4DR2I 2EL5A 3H09A 2D9HA 2JXPA 2DIXA 1VISA 2V8QB 1MGTA 3JAMQ 1Z0TA 1RHYA 3P76A 3ECRA 1SR9A 4JI1I 1X49A 4BMJA 3GONA 2UUAE 1N36E 2G7HA 1N33E 3JTZA 2EL4A 2J7KA 3CDJA 5C0XD 2JWOA 1X6FA 2F4VE 2YTDA 4WSPA 2BA0G 2MDRA 4OO1A 2Z5CB 2C37B 4DPWA 4FWHA 1H74A 2V83A 1X48A 4JI0I 2PO0B 1IBLE 4DU8A 1BB8A 4R2CA 2AE8A 5C0XB 2YTQA 2LE2A 2YTEA 5GMDA 2YRKA 3H1CA 2ODRD 2KONA 4I8OA 4TUGA 3KRNA 1XMQI 3HPZA 3PYEA 3K85A 1AAYA 3PYFA 4DV2E 1HNWI 5JEAA 2DSYA 4DV5I 2EN2A 4LCHA 2LJPA 4MQYA 4DR5I 2F8BA 4BC9A 2V87A 1FKAE 1ZBQA 3L7ZA 4IFDE 1N0UA 3D4JA 2GQ0A 2BM0A 1K47A 4ZVIA 2V2QA 2O3ZA 3LTOA 2EL6A 4XTJA 5IV8B 2JVAA 4AQYI 2EMBA 3P3EA 4KZSA 2JOBA 1OJ4A 4HXZA 1HNXI 1JK2A 4KQVA 1YSAC 2JYAA 1I94I 5CFFE 3Q6MA 2VQFI 4OO1B 2YTFA 2JT2A 2VESA 2EOMA 1IQOA 1WHNA 2EOOA 5KL6A 3J80C 2GS8A 2XEXA 2NN6B 1X6EA 4M2ZA 2HK2A 3K1JA 4R2EA 4ED4A 1N3GA 2UUAI 4X64E 5L3JA 1USUA 1Z0GA 1X3CA 4LF7I 4DV4E 5GMEA 5JEAD 2JEAA 3BBGA 2YSOA 4J8ZA 1L4SA 1HK7A 1Z5CA 2DGCA 3HKMA 4FW5A 4Z7YA 4JV5I 5F3WA 5TSEA 1Z59A 2RS6A 5JEAB 2RQLA 2CTDA 4LFAI 4IZJB 4J3DA 1YH8A 4DR3E 2EM8A 2NUFA 3ADJA 4DV0E 2UXCE 2RTXA 3JU0A 2JE6A 3C6MA 3OMLA 2EE8A 3L7ZB 1RQ0A 2EM4A 3BF2A 2Q8UA 4RH8A 1B69A 1XMOI 4B3TE 2KHXA 2V2VA 4BA1A 4X62I 2GLIA 3P1XA 1FJGE 1Z5AA 5K36E 4DV1E 5LMUE 4JI6E 5A69A 2V88A 1Y5YA 4FW6A 2EPLX 4OOGC 1PJTA 2EPXA 2YTNA 2F1DA 2B7TA 4DR2E 1FNMA 1UDSA 2Z5BA 3QT6A 1A1JA 1T4LB 5A2QQ 1T38A 4F9CB 1R6LA 4LF8I 1ZXNA 2LBSB 2EOXA 1XHKA 3ZOQB 4JI1E 1UDNA 3M85D 4F6NA 4AM3A 2HFUA 1Z0EA 1ZXMA 2Q2EB 3QT5A 2FGGA 4P52A 1GZ6A 4MU0A 3KWRA 2NUEA 1IBKI 4LFCI 1WRJA 2JEAB 2EQ1A 2MKNA 4BA2B 2CPNA 4R8OA 3U1YA 1ZBTA 2YRMA 4DUYI 4JI0E 2HC5A 3PYGA 1EA6A 4O24A 1Y4UA 2EWLA 4AIMA 3WU6A 3EPJA 1WUUA 3F6HA 5AE1A 2Z5EA 4JI4I 1FI4A 4R03A 1ZM4A 5LLQA 1XMQE 2EMAA 2EPZA 5K36F 4HACA 2RSMA 2KOUA 5AC5A 1T4OA 2M1SA 3C4BA 1GTKA 4X8WA 1HNWE 3WU4A 2MDGA 4DV5E 2NABA 5K36C 2EQ0A 1UBDC 4WXDA 4DR5E 4DKKA 2LUQA 4MYUA 2ENCA 2Z5BB 1J5EI 2V89A 2JPAA 2BBGA 2EN8A 2UXCI 1U2RA 3CDIA 4Q35B 4R2AA 1EI1A 1P47A 1DQ3A 3MSWA 1Z1BA 2GO4A 3EQ1A 3K17A 4AQYE 1O0WA
chains in the Genus database with same CATH topology
2B3TB 3WU5A 1FJGI 1HNXE 4DV1I 3ADGA 3H4LA 2ZM6I 1RC7A 4BS9A 1T4NA 1I94E 2R3VA 2V8PA 2VQFE 1QZRA 2VE7C 4M0VA 2L3JA 4K0KI 2NPFA 4DPXA 1H7SA 4F9BB 4UTGA 1UILA 2CZ9A 2NUGA 5ADZA 1YYKA 5BR8I 1MG7A 4JI7E 4LF7E 3RMPA 4FWDA 3V2UC 1EKZA 4HACB 4JV5E 2K4VA 4WFTA 4LFAE 4JG4A 3Q1QA 2H36X 4YHHI 2N3HA 1BKNA 2BM1A 4FN5A 4B3SE 5FLXQ 2MC5A 5IWAI 4M1KA 4WUDA 4X62E 3T1HI 2R42A 4P78A 3ZKDA 2HKEA 2VQEI 1N0VC 3LNUA 1PKPA 4LF8I 4I3HA 1UEKA 3T1YI 3M6AA 1N34I 2VF3A 2NA2A 1IBMI 4BCAA 1KIJA 2IHR1 3VYYA 2UXBI 1WXRA 4X66I 3J7AM 4F9AB 4DPUA 1XMOE 1D6TA 1IBKE 4LFCE 2E5LI 2DEJA 3DJWA 4DUYE 4USKA 4JI4E 2O1VA 2V2ZA 4JI7I 4M30A 1HNZE 2B7VA 5IT9C 4B3MI 3B82A 2ZBKB 3VYXA 4B3SI 1J5EE 1YZ9A 2EZ6A 3HJCA 4DU7A 2M7QA 3AV0A 4BBYA 4LU9A 4FW9A 3IWBA 2L6MA 1DI2A 4WUCA 1HR0I 4KHPE 2ZM6E 2RS7A 3F6GA 5DNYA 4DV3I 4NXMI 3ADLA 4K0KE 3LLHA 3AUZA 2CG9A 4LF9E 1PIEA 5BR8E 4BC7A 1XMOI 1ZM3A 1N32I 2A2CA 2UUCI 4DR1E 2HK3A 1Z0BA 4DV6I 3JAMC 2DB2A 2ODRC 2PNMA 3QT7A 4X65I 1KTVA 4JYAI 1XNRI 2V86A 4YHHE 5IWAE 2HFSA 4WYQB 1HNZI 2BV3A 2V85A 2LMZA 3J7Yp 2L3CA 2IOQA 3T1HE 4LFBI 4PRVA 2FTXB 2VQEE 1ZM9A 3J80Q 3B8HA 4DR4I 3J81C 1QU6A 3IWDA 1KKHA 4DUZI 4Q28A 2VF1A 3T1YE 1N34E 1IBME 4LF8E 2HKJA 2CGEA 1Y4SA 1NZ0A 4LF6I 2JY9A 2UXBE 4X66E 2LTRA 3LMLA 4YY3I 2E5LE 5FWKA 4KHPI 3P06A 1NHIA 3OTOI 5AE2A 2WZOA 2E1RA 4RPFA 2UXDE 4JI3I 1ELOA 2A2DA 2N3GA 2FV4B 4IZKA 1STUA 2ZITA 4LF9I 4LTYA 2DEIA 4NXNI 2HHHI 4DR1I 2LRSA 4LF4E 2PNLA 2L8TA 4B3ME 1YYOA 4LF5E 1USVA 2L2NA 3HPSA 2JOXA 4DR7E 4GKJI 4P7DA 1KVKA 5LMNE 4GKKI 4MYTA 1A6FA 1S16A 4JI8I 2L33A 1X47A 3ZZTA 4DMIA 1HR0E 2V34A 4DV3E 4FWGA 4NXME 4B3RI 3HTXA 3ZM7A 4IZKB 2EFGA 1N32E 3J81Q 1XNQI 2LJHA 5AASA 3FIGA 2UUCE 3Q6NA 5A2QC 4DXLA 4DV6E 3DF6A 2X36A 2UXDI 3ADIA 1H7UA 4X65E 4JYAE 1NHHA 2JR1A 1MU5A 1XNRE 4IZJA 2UU9E 1DARA 4GEQB 4JI2E 3PRYA 2DMYA 2X7IA 3CWVA 2AJ4A 3C4TA 3V5RA 1WHQA 4JI5I 4LF4I 4HY1A 4LFBE 1S4EA 4LF5I 4DR4E 3PYDA 4R1FA 4DUZE 3WU3A 4Z7CA 2L2MA 4DR7I 1PVGA 5LMNI 2O1UA 2UUBE 4OX9E 3LPSA 4DV7E 2O1TA 3HXLA 4LF6E 2LUPB 4L5NC 1N36I 4L8NA 1UHZA 4YY3E 1N33I 3OTOE 1B62A 2F4VI 4IZJD 2L92A 4JI3E 2OI2A 4PU9A 1ZM2A 1IBLI 1H73A 4PRXA 4WPYA 4NXNE 3B78A 2HHHE 1B63A 4DR6E 2M4IA 4DPTA 3IWCA 4DV2I 1Z0CA 1YYWA 2LTSA 1RR9A 2UU9I 4JI2I 4GKJE 4F54A 2O1WA 4GKKE 3F0NA 2B9DA 3ZZ0A 4JI8E 4WUBA 4TUIA 3ZZUA 2IOPA 5FLXC 5AE3A 4HYMA 5T6JA 4URLA 1J26A 1RREA 2UUBI 3HQ1A 4OX9I 5IT9Q 2YZTA 4DV7I 4B3RE 1Z5BA 3QT8A 4EMDA 2MC6A 1XNQE 4X64I 5LL6R 4UT4A 3VK6A 1H72C 4DV4I 1Z0WA 2Z5CA 3ZKBA 3HULA 2YT4A 1NHJA 1FWLA 4DR3I 3K6QA 4DV0I 4P7AA 2WW4A 1Z0VA 2E1MA 4JI5E 4DR6I 3J7AG 4B3TI 1GQEA 1MX0A 4USMA 1FWKA 4N3OA 2L2KB 5LMUI 4JI6I 1Y6ZA 4DPYA 4DR2I 3H09A 2DIXA 1VISA 2V8QB 3JAMQ 1Z0TA 1SR9A 4JI1I 1X49A 4BMJA 3GONA 2UUAE 1N36E 2G7HA 1N33E 3JTZA 2J7KA 2JWOA 2F4VE 4WSPA 2MDRA 2Z5CB 4DPWA 4FWHA 1H74A 2V83A 1X48A 4JI0I 1IBLE 4DU8A 2LE2A 5GMDA 2ODRD 2KONA 4I8OA 4TUGA 1XMQI 3HPZA 3PYEA 3K85A 3PYFA 4DV2E 1HNWI 2DSYA 4DV5I 2LJPA 4DR5I 2F8BA 4BC9A 2V87A 1FKAE 1ZBQA 1N0UA 3D4JA 2GQ0A 2BM0A 1K47A 4ZVIA 2V2QA 3LTOA 4XTJA 2JVAA 4AQYI 4KZSA 2JOBA 1OJ4A 4HXZA 1HNXI 4KQVA 1I94I 5CFFE 3Q6MA 2VQFI 1WHNA 2GS8A 3J80C 2XEXA 4M2ZA 2HK2A 3K1JA 4ED4A 2UUAI 4X64E 5L3JA 1USUA 1Z0GA 4LF7I 4DV4E 5GMEA 1HK7A 4J8ZA 4Z7YA 1Z5CA 4JV5I 5F3WA 1Z59A 2RS6A 4LFAI 4IZJB 4DR3E 2NUFA 3ADJA 4DV0E 2UXCE 2RTXA 3JU0A 3OMLA 1RQ0A 4B3TE 2KHXA 2V2VA 4X62I 3P1XA 1FJGE 1Z5AA 4DV1E 5LMUE 4JI6E 2V88A 4OOGC 2B7TA 4DR2E 1FNMA 2Z5BA 3QT6A 1T4LB 5A2QQ 4F9CB 1ZXNA 2LBSB 1XHKA 3ZOQB 4JI1E 2HFUA 1Z0EA 1ZXMA 2Q2EB 3QT5A 2FGGA 4P52A 1GZ6A 3KWRA 2NUEA 1IBKI 4LFCI 2CPNA 4R8OA 1ZBTA 4DUYI 4JI0E 3PYGA 1EA6A 1Y4UA 2EWLA 3WU6A 1WUUA 3F6HA 5AE1A 2Z5EA 4JI4I 1FI4A 4R03A 1ZM4A 1XMQE 4HACA 2RSMA 2KOUA 1T4OA 2M1SA 3C4BA 1HNWE 4X8WA 3WU4A 4DV5E 4DR5E 4DKKA 2LUQA 4MYUA 2Z5BB 1J5EI 2V89A 2UXCI 1U2RA 1EI1A 1DQ3A 3MSWA 3K17A 4AQYE 1O0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3T B;  3WU5 A;  1FJG I;  1HNX E;  4DV1 I;  3ADG A;  3H4L A;  2ZM6 I;  1RC7 A;  1T4N A;  1I94 E;  2R3V A;  2V8P A;  2VQF E;  1QZR A;  2L3J A;  4K0K I;  2NPF A;  4DPX A;  1H7S A;  4UTG A;  1UIL A;  2CZ9 A;  2NUG A;  1YYK A;  5BR8 I;  1MG7 A;  4JI7 E;  4LF7 E;  4FWD A;  3V2U C;  1EKZ A;  4HAC B;  4JV5 E;  4WFT A;  4LFA E;  4JG4 A;  3Q1Q A;  4YHH I;  2N3H A;  1BKN A;  2BM1 A;  4FN5 A;  4B3S E;  5FLX Q;  5IWA I;  4M1K A;  4WUD A;  4X62 E;  3T1H I;  2R42 A;  3ZKD A;  2HKE A;  2VQE I;  1N0V C;  3LNU A;  1PKP A;  4LF8 I;  4I3H A;  1UEK A;  3T1Y I;  3M6A A;  1N34 I;  2VF3 A;  2NA2 A;  1IBM I;  1KIJ A;  2IHR 1;  3VYY A;  2UXB I;  4X66 I;  3J7A M;  4DPU A;  1XMO E;  1D6T A;  1IBK E;  4LFC E;  2E5L I;  2DEJ A;  4DUY E;  4USK A;  4JI4 E;  2V2Z A;  4JI7 I;  4M30 A;  1HNZ E;  2B7V A;  5IT9 C;  4B3M I;  3B82 A;  2ZBK B;  3VYX A;  4B3S I;  1J5E E;  1YZ9 A;  2EZ6 A;  4DU7 A;  4FW9 A;  1DI2 A;  4WUC A;  1HR0 I;  4KHP E;  2ZM6 E;  2RS7 A;  4DV3 I;  4NXM I;  3ADL A;  4K0K E;  3LLH A;  4LF9 E;  1PIE A;  5BR8 E;  1N32 I;  1XMO I;  1ZM3 A;  2A2C A;  2UUC I;  4DR1 E;  2HK3 A;  1Z0B A;  4DV6 I;  3JAM C;  2DB2 A;  3QT7 A;  4X65 I;  1KTV A;  4JYA I;  1XNR I;  4YHH E;  5IWA E;  2HFS A;  4WYQ B;  1HNZ I;  2BV3 A;  3J7Y p;  2L3C A;  3T1H E;  4LFB I;  4PRV A;  2VQE E;  1ZM9 A;  3J80 Q;  3B8H A;  4DR4 I;  3J81 C;  1QU6 A;  1KKH A;  4DUZ I;  4LF8 E;  3T1Y E;  1N34 E;  1IBM E;  2HKJ A;  1NZ0 A;  4LF6 I;  2JY9 A;  2UXB E;  4X66 E;  2LTR A;  4YY3 I;  2E5L E;  4KHP I;  1NHI A;  3OTO I;  2E1R A;  4RPF A;  2UXD E;  4JI3 I;  1ELO A;  2A2D A;  2N3G A;  1STU A;  2ZIT A;  4LF9 I;  2DEI A;  4NXN I;  2HHH I;  4DR1 I;  2LRS A;  4LF4 E;  4B3M E;  1YYO A;  4LF5 E;  2L2N A;  4DR7 E;  4GKJ I;  1KVK A;  5LMN E;  4GKK I;  4MYT A;  1A6F A;  1S16 A;  4JI8 I;  2L33 A;  1X47 A;  3ZZT A;  1HR0 E;  2V34 A;  4DV3 E;  4FWG A;  4NXM E;  4B3R I;  3HTX A;  3ZM7 A;  2EFG A;  1N32 E;  3J81 Q;  1XNQ I;  2LJH A;  2UUC E;  4DXL A;  5A2Q C;  4DV6 E;  2X36 A;  2UXD I;  3ADI A;  1H7U A;  4X65 E;  4JYA E;  1NHH A;  1MU5 A;  1XNR E;  2UU9 E;  1DAR A;  4JI2 E;  2DMY A;  2X7I A;  3CWV A;  2AJ4 A;  3C4T A;  3V5R A;  1WHQ A;  4JI5 I;  4LF4 I;  4HY1 A;  4LFB E;  1S4E A;  4LF5 I;  4DR4 E;  3PYD A;  4R1F A;  4DUZ E;  3WU3 A;  4Z7C A;  2L2M A;  4DR7 I;  1PVG A;  5LMN I;  2UUB E;  4OX9 E;  3LPS A;  4DV7 E;  4LF6 E;  2LUP B;  1N36 I;  1UHZ A;  4YY3 E;  1N33 I;  3OTO E;  1B62 A;  2F4V I;  4JI3 E;  2OI2 A;  4PU9 A;  1ZM2 A;  1IBL I;  1H73 A;  4PRX A;  4NXN E;  3B78 A;  2HHH E;  1B63 A;  4DR6 E;  4DPT A;  4DV2 I;  1Z0C A;  1YYW A;  2LTS A;  1RR9 A;  2UU9 I;  4JI2 I;  4GKJ E;  4GKK E;  3F0N A;  3ZZ0 A;  4JI8 E;  4WUB A;  3ZZU A;  5FLX C;  4HYM A;  4URL A;  1J26 A;  1RRE A;  2UUB I;  4OX9 I;  5IT9 Q;  4DV7 I;  4B3R E;  1Z5B A;  3QT8 A;  4EMD A;  1XNQ E;  4X64 I;  5LL6 R;  4UT4 A;  1H72 C;  4DV4 I;  1Z0W A;  3ZKB A;  3HUL A;  2YT4 A;  1NHJ A;  1FWL A;  4DR3 I;  4DV0 I;  4P7A A;  2WW4 A;  1Z0V A;  4JI5 E;  4DR6 I;  3J7A G;  4B3T I;  1GQE A;  1MX0 A;  4USM A;  1FWK A;  2L2K B;  5LMU I;  4JI6 I;  4DPY A;  4DR2 I;  2DIX A;  1VIS A;  3JAM Q;  1Z0T A;  4JI1 I;  1X49 A;  3GON A;  2UUA E;  1N36 E;  1N33 E;  2J7K A;  2F4V E;  2MDR A;  4DPW A;  4FWH A;  1H74 A;  1X48 A;  4JI0 I;  1IBL E;  4DU8 A;  5GMD A;  1XMQ I;  3PYE A;  3PYF A;  4DV2 E;  1HNW I;  4DV5 I;  2LJP A;  4DR5 I;  1FKA E;  1N0U A;  3D4J A;  2BM0 A;  1K47 A;  4ZVI A;  2V2Q A;  3LTO A;  4XTJ A;  2JVA A;  4AQY I;  1OJ4 A;  4HXZ A;  1HNX I;  4KQV A;  1I94 I;  5CFF E;  2VQF I;  1WHN A;  2GS8 A;  3J80 C;  2XEX A;  4M2Z A;  2HK2 A;  3K1J A;  4ED4 A;  2UUA I;  4X64 E;  5L3J A;  1Z0G A;  4LF7 I;  4DV4 E;  5GME A;  4Z7Y A;  1Z5C A;  4JV5 I;  1Z59 A;  2RS6 A;  4LFA I;  4DR3 E;  2NUF A;  3ADJ A;  4DV0 E;  2UXC E;  2RTX A;  1RQ0 A;  4B3T E;  2KHX A;  2V2V A;  4X62 I;  3P1X A;  1FJG E;  1Z5A A;  4DV1 E;  5LMU E;  4JI6 E;  4OOG C;  2B7T A;  4DR2 E;  1FNM A;  3QT6 A;  1T4L B;  5A2Q Q;  1ZXN A;  2LBS B;  1XHK A;  4JI1 E;  2HFU A;  1Z0E A;  1ZXM A;  2Q2E B;  3QT5 A;  4P52 A;  2NUE A;  1IBK I;  4LFC I;  2CPN A;  1ZBT A;  4DUY I;  4JI0 E;  3PYG A;  1EA6 A;  3WU6 A;  1WUU A;  4JI4 I;  1FI4 A;  1ZM4 A;  1XMQ E;  4HAC A;  2RSM A;  1T4O A;  3C4B A;  1HNW E;  4X8W A;  3WU4 A;  4DV5 E;  4DR5 E;  4DKK A;  2LUQ A;  4MYU A;  1J5E I;  2UXC I;  1U2R A;  1EI1 A;  3K17 A;  4AQY E;  1O0W A; 
#chains in the Genus database with same CATH topology
 2B3T B;  4F2J C;  3WU5 A;  4LCF A;  1FJG I;  4HEI A;  2DMI A;  2EMH A;  2N8X A;  1HNX E;  4DV1 I;  1EH6 A;  2ELZ A;  3ADG A;  4U3D A;  3M99 B;  3H4L A;  2ZM6 I;  1RC7 A;  4BS9 A;  1T4N A;  1I94 E;  2R3V A;  3U1K A;  3TQM A;  3EPH A;  2V8P A;  2VQF E;  1QZR A;  1PJS A;  2EMY A;  2YTO A;  2VE7 C;  4M0V A;  2L3J A;  1UN6 B;  2GO3 A;  1BBO A;  4K0K I;  2NPF A;  4DPX A;  1H7S A;  4F9B B;  4UTG A;  1UIL A;  2CZ9 A;  2NUG A;  3MHS C;  5ADZ A;  1YYK A;  5BR8 I;  2EM5 A;  4MDT A;  1MG7 A;  1EH7 A;  4JI7 E;  4LF7 E;  2WNR A;  1TF6 A;  2VRD A;  3RMP A;  4FWD A;  2PNZ A;  3V2U C;  1EKZ A;  4HAC B;  4JV5 E;  2K4V A;  2DRP A;  4RHB B;  4WFT A;  4LFA E;  2JP9 A;  2EPU A;  2YRH A;  4JG4 A;  3Q1Q A;  2LV2 A;  5KL3 A;  2H36 X;  4YHH I;  2N3H A;  1BKN A;  2BM1 A;  4FN5 A;  4B3S E;  5FLX Q;  4ZYD A;  2EN3 A;  1PDA A;  2MC5 A;  4M1K A;  5IWA I;  2I13 A;  2PO2 A;  5A6B A;  4WUD A;  1IQS A;  2BA0 D;  2EOZ A;  4X62 E;  3T1H I;  2R42 A;  2PO1 A;  4P78 A;  3ZKD A;  2HKE A;  2LO3 A;  2VQE I;  1X5W A;  1N0V C;  3LNU A;  1PKP A;  2YU8 A;  2J65 A;  1UEK A;  2EMZ A;  3M6A A;  4I3H A;  2VF3 A;  2NA2 A;  3EPL A;  3T1Y I;  1N34 I;  1IBM I;  4BCA A;  1KIJ A;  2IHR 1;  3VYY A;  2UXB I;  4OKG A;  1WXR A;  4X66 I;  3J7A M;  3GCM A;  4F9A B;  4DPU A;  1XMO E;  1D6T A;  1IBK E;  2EOQ A;  1A1H A;  4LFC E;  2WNR B;  2BA1 G;  2E5L I;  2C39 A;  2PNZ B;  2EM6 A;  1A1L A;  2DEJ A;  3DJW A;  2EM3 A;  1G2F C;  2EPR A;  1A1K A;  4DUY E;  1Y60 A;  4USK A;  5C0X E;  4IS9 A;  1TN9 A;  5A6B D;  5AC4 A;  4JI4 E;  4WXC A;  4LPF A;  2ELY A;  1YUI A;  2O1V A;  2V2Z A;  4M30 A;  4JI7 I;  1HNZ E;  2B7V A;  2PO2 B;  2DLQ A;  5IT9 C;  2EN1 A;  4B3M I;  5A6A A;  2PO1 B;  2EM7 A;  4MU1 A;  2EPP A;  4BHC A;  4IFD F;  3B82 A;  1PJQ A;  2ZBK B;  1VI7 A;  3VYX A;  4B3S I;  1J5E E;  1KYQ A;  1YZ9 A;  3P3G A;  4IFD C;  2EZ6 A;  5KL2 A;  3HJC A;  4DU7 A;  2M7Q A;  1DGC A;  3AV0 A;  2EMG A;  2DLK A;  4BBY A;  5KL5 A;  4LU9 A;  2ADR A;  2C38 A;  4FW9 A;  3IWB A;  2YTP A;  2L6M A;  1DI2 A;  4WUC A;  3UHM A;  2EMW A;  1HR0 I;  4KHP E;  2ZM6 E;  2RS7 A;  2C39 B;  2YPN A;  4OO1 E;  3F6G A;  2CT1 A;  5DNY A;  4DV3 I;  3GLL A;  3VHT B;  4NXM I;  2EOY A;  3ADL A;  4K0K E;  1UDQ A;  1E3P A;  2EMF A;  3LLH A;  3AUZ A;  5DNL A;  5C0X C;  2CG9 A;  2NN6 E;  5EL9 A;  1NCS A;  2EPC A;  4MLQ A;  4LF9 E;  4R2D A;  2LT7 A;  1PIE A;  5BR8 E;  4BC7 A;  2RSI A;  1YFH A;  1XXE A;  2A2C A;  1ZM3 A;  2HJJ A;  4DR1 E;  2CVE A;  1Z0B A;  2HK3 A;  2UUC I;  4FW7 A;  4DV6 I;  4BHB A;  3JAM C;  2DB2 A;  2ODR C;  2PNM A;  2R76 A;  1R6M A;  3QT7 A;  4X65 I;  1KTV A;  5JEA E;  3QG5 C;  4JYA I;  3THO B;  1XNR I;  2V86 A;  4YHH E;  5KL4 A;  4WSG A;  4M9V C;  5IWA E;  4NBQ A;  2HFS A;  4WYQ B;  3BGH A;  1YUJ A;  2PRT A;  2JE6 B;  3B4T A;  2EJ4 A;  4OZE A;  4U3B A;  1HNZ I;  3M7N G;  4ZYE A;  1G2D C;  2V85 A;  2LMZ A;  3J7Y p;  2L3C A;  5A6J A;  3T1H E;  2ENH A;  2BV3 A;  2C38 B;  2IOQ A;  4PRV A;  2FTX B;  4BA1 B;  4LFB I;  4OO1 F;  2VQE E;  1ZM9 A;  3J80 Q;  3B8H A;  2E72 A;  1JK1 A;  4DR4 I;  2LVH A;  3J81 C;  2WCC 3;  1QU6 A;  3IWD A;  1RMD A;  1KKH A;  4DUZ I;  4Q28 A;  2VF1 A;  3T1Y E;  1N34 E;  2YWQ A;  1IBM E;  4LF8 E;  2HKJ A;  2NN6 F;  2CGE A;  4OO1 C;  4IFD A;  4R2P A;  1Y4S A;  2WBU A;  1NZ0 A;  2NN6 C;  2JY9 A;  2UXB E;  4LF6 I;  4X66 E;  2LTR A;  1SFE A;  1ZR9 A;  3LML A;  1A1F A;  4FK5 C;  4YY3 I;  2E5L E;  5FWK A;  4KHP I;  3P06 A;  1NHI A;  3OTO I;  5AE2 A;  2WZO A;  1OYP A;  2E1R A;  4ZYG A;  2UXD E;  2C37 A;  3PS3 A;  1ELO A;  4RPF A;  4JI3 I;  4R2S A;  4LCG A;  2LJU A;  2A2D A;  4R2R A;  2PO0 A;  2N3G A;  2FV4 B;  2EM2 A;  2YTJ A;  4IZK A;  1STU A;  2ZIT A;  4LF9 I;  4LTY A;  4GZN C;  2EMI A;  2DEI A;  2J7J A;  4NXN I;  2HHH I;  4DR1 I;  2LRS A;  4LF4 E;  2PNL A;  2L8T A;  4B3M E;  1X6H A;  2WBT A;  1YYO A;  1A1G A;  4LF5 E;  4IFD D;  1USV A;  2L2N A;  2EOE A;  2EOI A;  3HPS A;  4IJD A;  2EOR A;  4MU3 A;  2JOX A;  3L00 A;  4DR7 E;  1E3H A;  4GKJ I;  4P7D A;  1KVK A;  5LMN E;  4IFD B;  4GKK I;  4MYT A;  2JEB A;  1A6F A;  1S16 A;  4JI8 I;  2EMK A;  2L33 A;  1X47 A;  2EP3 A;  2RPC A;  3ZZT A;  4MLV A;  4DMI A;  1HR0 E;  2A25 A;  4IS1 C;  4O5G A;  1TF3 A;  2V34 A;  2MKD A;  5K36 A;  3GME A;  2CSH A;  4N4R B;  3P3C A;  2EM9 A;  4DV3 E;  3KZY A;  4FWG A;  4NXM E;  2LCE A;  2YTI A;  4F6M A;  1P42 A;  3HTX A;  3ZM7 A;  4B3R I;  2NN6 A;  4IZK B;  1T39 A;  2I9I A;  5DNX A;  3UK3 C;  2EFG A;  1N32 E;  3BID A;  3J81 Q;  2LJH A;  5AAS A;  3FIG A;  5IXM B;  2UUC E;  5A2Q C;  3Q6N A;  4DXL A;  4DV6 E;  3DF6 A;  2X36 A;  1QNT A;  2UXD I;  3ADI A;  1H7U A;  4X65 E;  4JYA E;  1NHH A;  2JR1 A;  1MU5 A;  2GPI A;  1XNR E;  4IZJ A;  2UU9 E;  1DAR A;  5EKW A;  4GEQ B;  4JI2 E;  3PRY A;  2DMY A;  2X7I A;  1BBG A;  2AJ4 A;  3CWV A;  1AH5 A;  3C4T A;  3V5R A;  1YPN A;  1WHQ A;  4JI5 I;  5K36 D;  2GHF A;  4LF4 I;  2BA1 D;  2JEB B;  4HY1 A;  4LFB E;  1S4E A;  2IES A;  4OO1 D;  2YU5 A;  4LF5 I;  4DR4 E;  2WP8 A;  2YSP A;  5K36 B;  3PYD A;  4R1F A;  3KZZ A;  5KL7 A;  4DUZ E;  3WU3 A;  4Z7C A;  2L2M A;  2EN4 A;  2NN6 D;  4DR7 I;  1PVG A;  5LMN I;  2O1U A;  1IMU A;  2UUB E;  4OX9 E;  3LPS A;  4DV7 E;  2O1T A;  3HXL A;  4LF6 E;  2M9A A;  2EMX A;  2LUP B;  4L5N C;  1N36 I;  4HTG A;  4L8N A;  1UHZ A;  2EML A;  4YY3 E;  1N33 I;  1A1I A;  3OTO E;  1B62 A;  5C0X F;  2R1F A;  2F4V I;  4BA2 A;  2BR2 A;  4IZJ D;  2L92 A;  4JI3 E;  2OI2 A;  4PU9 A;  1ZM2 A;  1IBL I;  1F2I G;  1XNQ I;  1H73 A;  4KWY A;  4LOM A;  1NEI A;  4PRX A;  2EOH A;  4WPY A;  4NXN E;  3B78 A;  2HHH E;  4R2Q A;  5A6K A;  1ZU1 A;  1B63 A;  3M85 G;  4DR6 E;  3MHH C;  2EQ3 A;  2M4I A;  4DPT A;  4QNK A;  3IWC A;  4DV2 I;  4FW3 A;  1Z0C A;  1YYW A;  2WP8 B;  2LTS A;  1UDO A;  1RR9 A;  3DD6 A;  2UU9 I;  2EPM X;  4JI2 I;  3THN A;  2EOF A;  2EPO A;  4ZYH A;  4GKJ E;  1OYR A;  4F54 A;  2EN6 A;  2EM0 A;  2HGH A;  2O1W A;  4GKK E;  3F0N A;  2B9D A;  3ZZ0 A;  3NZK A;  4JI8 E;  4WUB A;  4TUI A;  4MU4 A;  3ZZU A;  2IOP A;  5FLX C;  1WJP A;  5AE3 A;  2EOJ A;  2BR2 B;  3PS1 A;  3PS2 A;  5ELW A;  4HYM A;  2EPA A;  5T6J A;  4URL A;  1J26 A;  4X9J A;  1KJK A;  1RRE A;  3HQ1 A;  2UUB I;  4OX9 I;  5IT9 Q;  2YZT A;  3M7N D;  4DV7 I;  4B3R E;  1Z5B A;  3EPK A;  4O4K A;  3QT8 A;  4EMD A;  2MC6 A;  1EH8 A;  4QNJ A;  4FW4 A;  4NHR A;  2EN7 A;  1XNQ E;  5LL6 R;  4UT4 A;  4X64 I;  3VK6 A;  2EMC A;  1H72 C;  5JEA F;  4DV4 I;  1Z0W A;  2Z5C A;  1MEY C;  5DRP A;  3C6K A;  2BB8 A;  4ISA A;  3ZKB A;  2EPN A;  1LLM C;  5JEA C;  3HUL A;  5C0X A;  2K7I A;  2YT4 A;  1NHJ A;  1FWL A;  2WBS A;  4GQU A;  4DR3 I;  3K6Q A;  4NZV A;  1YHC A;  4WX9 A;  5DRR A;  5DRO A;  4DV0 I;  4P7A A;  2EPK X;  2WW4 A;  4AID A;  1Z0V A;  2E1M A;  4JI5 E;  2ENA A;  2YTG A;  1OYS A;  4DR6 I;  3J7A G;  4B3T I;  1GQE A;  1MX0 A;  4USM A;  1FWK A;  4N3O A;  2L2K B;  5DRQ A;  1N32 I;  4O43 A;  5LMU I;  4JI6 I;  1Y6Z A;  4DPY A;  1ZAA C;  2EOS A;  2IER A;  4DR2 I;  2EL5 A;  3H09 A;  2D9H A;  2JXP A;  2DIX A;  1VIS A;  2V8Q B;  1MGT A;  3JAM Q;  1Z0T A;  1RHY A;  3P76 A;  3ECR A;  1SR9 A;  4JI1 I;  1X49 A;  4BMJ A;  3GON A;  2UUA E;  1N36 E;  2G7H A;  1N33 E;  3JTZ A;  2EL4 A;  2J7K A;  3CDJ A;  5C0X D;  2JWO A;  1X6F A;  2F4V E;  2YTD A;  4WSP A;  2BA0 G;  2MDR A;  4OO1 A;  2Z5C B;  2C37 B;  4DPW A;  4FWH A;  1H74 A;  2V83 A;  1X48 A;  4JI0 I;  2PO0 B;  1IBL E;  4DU8 A;  1BB8 A;  4R2C A;  2AE8 A;  5C0X B;  2YTQ A;  2LE2 A;  2YTE A;  5GMD A;  2YRK A;  3H1C A;  2ODR D;  2KON A;  4I8O A;  4TUG A;  3KRN A;  1XMQ I;  3HPZ A;  3PYE A;  3K85 A;  1AAY A;  3PYF A;  4DV2 E;  1HNW I;  5JEA A;  2DSY A;  4DV5 I;  2EN2 A;  4LCH A;  2LJP A;  4MQY A;  4DR5 I;  2F8B A;  4BC9 A;  2V87 A;  1FKA E;  1ZBQ A;  3L7Z A;  4IFD E;  1N0U A;  3D4J A;  2GQ0 A;  2BM0 A;  1K47 A;  4ZVI A;  2V2Q A;  2O3Z A;  3LTO A;  2EL6 A;  4XTJ A;  5IV8 B;  2JVA A;  4AQY I;  2EMB A;  3P3E A;  4KZS A;  2JOB A;  1OJ4 A;  4HXZ A;  1HNX I;  1JK2 A;  4KQV A;  1YSA C;  2JYA A;  1I94 I;  5CFF E;  3Q6M A;  2VQF I;  4OO1 B;  2YTF A;  2JT2 A;  2VES A;  2EOM A;  1IQO A;  1WHN A;  2EOO A;  5KL6 A;  3J80 C;  2GS8 A;  2XEX A;  2NN6 B;  1X6E A;  4M2Z A;  2HK2 A;  3K1J A;  4R2E A;  4ED4 A;  1N3G A;  2UUA I;  4X64 E;  5L3J A;  1USU A;  1Z0G A;  1X3C A;  4LF7 I;  4DV4 E;  5GME A;  5JEA D;  2JEA A;  3BBG A;  2YSO A;  4J8Z A;  1L4S A;  1HK7 A;  1Z5C A;  2DGC A;  3HKM A;  4FW5 A;  4Z7Y A;  4JV5 I;  5F3W A;  5TSE A;  1Z59 A;  2RS6 A;  5JEA B;  2RQL A;  2CTD A;  4LFA I;  4IZJ B;  4J3D A;  1YH8 A;  4DR3 E;  2EM8 A;  2NUF A;  3ADJ A;  4DV0 E;  2UXC E;  2RTX A;  3JU0 A;  2JE6 A;  3C6M A;  3OML A;  2EE8 A;  3L7Z B;  1RQ0 A;  2EM4 A;  3BF2 A;  2Q8U A;  4RH8 A;  1B69 A;  1XMO I;  4B3T E;  2KHX A;  2V2V A;  4BA1 A;  4X62 I;  2GLI A;  3P1X A;  1FJG E;  1Z5A A;  5K36 E;  4DV1 E;  5LMU E;  4JI6 E;  5A69 A;  2V88 A;  1Y5Y A;  4FW6 A;  2EPL X;  4OOG C;  1PJT A;  2EPX A;  2YTN A;  2F1D A;  2B7T A;  4DR2 E;  1FNM A;  1UDS A;  2Z5B A;  3QT6 A;  1A1J A;  1T4L B;  5A2Q Q;  1T38 A;  4F9C B;  1R6L A;  4LF8 I;  1ZXN A;  2LBS B;  2EOX A;  1XHK A;  3ZOQ B;  4JI1 E;  1UDN A;  3M85 D;  4F6N A;  4AM3 A;  2HFU A;  1Z0E A;  1ZXM A;  2Q2E B;  3QT5 A;  2FGG A;  4P52 A;  1GZ6 A;  4MU0 A;  3KWR A;  2NUE A;  1IBK I;  4LFC I;  1WRJ A;  2JEA B;  2EQ1 A;  2MKN A;  4BA2 B;  2CPN A;  4R8O A;  3U1Y A;  1ZBT A;  2YRM A;  4DUY I;  4JI0 E;  2HC5 A;  3PYG A;  1EA6 A;  4O24 A;  1Y4U A;  2EWL A;  4AIM A;  3WU6 A;  3EPJ A;  1WUU A;  3F6H A;  5AE1 A;  2Z5E A;  4JI4 I;  1FI4 A;  4R03 A;  1ZM4 A;  5LLQ A;  1XMQ E;  2EMA A;  2EPZ A;  5K36 F;  4HAC A;  2RSM A;  2KOU A;  5AC5 A;  1T4O A;  2M1S A;  3C4B A;  1GTK A;  4X8W A;  1HNW E;  3WU4 A;  2MDG A;  4DV5 E;  2NAB A;  5K36 C;  2EQ0 A;  1UBD C;  4WXD A;  4DR5 E;  4DKK A;  2LUQ A;  4MYU A;  2ENC A;  2Z5B B;  1J5E I;  2V89 A;  2JPA A;  2BBG A;  2EN8 A;  2UXC I;  1U2R A;  3CDI A;  4Q35 B;  4R2A A;  1EI1 A;  1P47 A;  1DQ3 A;  3MSW A;  1Z1B A;  2GO4 A;  3EQ1 A;  3K17 A;  4AQY E;  1O0W A; 
#chains in the Genus database with same CATH homology
 2B3T B;  3WU5 A;  1FJG I;  1HNX E;  4DV1 I;  3ADG A;  3H4L A;  2ZM6 I;  1RC7 A;  4BS9 A;  1T4N A;  1I94 E;  2R3V A;  2V8P A;  2VQF E;  1QZR A;  2VE7 C;  4M0V A;  2L3J A;  4K0K I;  2NPF A;  4DPX A;  1H7S A;  4F9B B;  4UTG A;  1UIL A;  2CZ9 A;  2NUG A;  5ADZ A;  1YYK A;  5BR8 I;  1MG7 A;  4JI7 E;  4LF7 E;  3RMP A;  4FWD A;  3V2U C;  1EKZ A;  4HAC B;  4JV5 E;  2K4V A;  4WFT A;  4LFA E;  4JG4 A;  3Q1Q A;  2H36 X;  4YHH I;  2N3H A;  1BKN A;  2BM1 A;  4FN5 A;  4B3S E;  5FLX Q;  2MC5 A;  5IWA I;  4M1K A;  4WUD A;  4X62 E;  3T1H I;  2R42 A;  4P78 A;  3ZKD A;  2HKE A;  2VQE I;  1N0V C;  3LNU A;  1PKP A;  4LF8 I;  4I3H A;  1UEK A;  3T1Y I;  3M6A A;  1N34 I;  2VF3 A;  2NA2 A;  1IBM I;  4BCA A;  1KIJ A;  2IHR 1;  3VYY A;  2UXB I;  1WXR A;  4X66 I;  3J7A M;  4F9A B;  4DPU A;  1XMO E;  1D6T A;  1IBK E;  4LFC E;  2E5L I;  2DEJ A;  3DJW A;  4DUY E;  4USK A;  4JI4 E;  2O1V A;  2V2Z A;  4JI7 I;  4M30 A;  1HNZ E;  2B7V A;  5IT9 C;  4B3M I;  3B82 A;  2ZBK B;  3VYX A;  4B3S I;  1J5E E;  1YZ9 A;  2EZ6 A;  3HJC A;  4DU7 A;  2M7Q A;  3AV0 A;  4BBY A;  4LU9 A;  4FW9 A;  3IWB A;  2L6M A;  1DI2 A;  4WUC A;  1HR0 I;  4KHP E;  2ZM6 E;  2RS7 A;  3F6G A;  5DNY A;  4DV3 I;  4NXM I;  3ADL A;  4K0K E;  3LLH A;  3AUZ A;  2CG9 A;  4LF9 E;  1PIE A;  5BR8 E;  4BC7 A;  1XMO I;  1ZM3 A;  1N32 I;  2A2C A;  2UUC I;  4DR1 E;  2HK3 A;  1Z0B A;  4DV6 I;  3JAM C;  2DB2 A;  2ODR C;  2PNM A;  3QT7 A;  4X65 I;  1KTV A;  4JYA I;  1XNR I;  2V86 A;  4YHH E;  5IWA E;  2HFS A;  4WYQ B;  1HNZ I;  2BV3 A;  2V85 A;  2LMZ A;  3J7Y p;  2L3C A;  2IOQ A;  3T1H E;  4LFB I;  4PRV A;  2FTX B;  2VQE E;  1ZM9 A;  3J80 Q;  3B8H A;  4DR4 I;  3J81 C;  1QU6 A;  3IWD A;  1KKH A;  4DUZ I;  4Q28 A;  2VF1 A;  3T1Y E;  1N34 E;  1IBM E;  4LF8 E;  2HKJ A;  2CGE A;  1Y4S A;  1NZ0 A;  4LF6 I;  2JY9 A;  2UXB E;  4X66 E;  2LTR A;  3LML A;  4YY3 I;  2E5L E;  5FWK A;  4KHP I;  3P06 A;  1NHI A;  3OTO I;  5AE2 A;  2WZO A;  2E1R A;  4RPF A;  2UXD E;  4JI3 I;  1ELO A;  2A2D A;  2N3G A;  2FV4 B;  4IZK A;  1STU A;  2ZIT A;  4LF9 I;  4LTY A;  2DEI A;  4NXN I;  2HHH I;  4DR1 I;  2LRS A;  4LF4 E;  2PNL A;  2L8T A;  4B3M E;  1YYO A;  4LF5 E;  1USV A;  2L2N A;  3HPS A;  2JOX A;  4DR7 E;  4GKJ I;  4P7D A;  1KVK A;  5LMN E;  4GKK I;  4MYT A;  1A6F A;  1S16 A;  4JI8 I;  2L33 A;  1X47 A;  3ZZT A;  4DMI A;  1HR0 E;  2V34 A;  4DV3 E;  4FWG A;  4NXM E;  4B3R I;  3HTX A;  3ZM7 A;  4IZK B;  2EFG A;  1N32 E;  3J81 Q;  1XNQ I;  2LJH A;  5AAS A;  3FIG A;  2UUC E;  3Q6N A;  5A2Q C;  4DXL A;  4DV6 E;  3DF6 A;  2X36 A;  2UXD I;  3ADI A;  1H7U A;  4X65 E;  4JYA E;  1NHH A;  2JR1 A;  1MU5 A;  1XNR E;  4IZJ A;  2UU9 E;  1DAR A;  4GEQ B;  4JI2 E;  3PRY A;  2DMY A;  2X7I A;  3CWV A;  2AJ4 A;  3C4T A;  3V5R A;  1WHQ A;  4JI5 I;  4LF4 I;  4HY1 A;  4LFB E;  1S4E A;  4LF5 I;  4DR4 E;  3PYD A;  4R1F A;  4DUZ E;  3WU3 A;  4Z7C A;  2L2M A;  4DR7 I;  1PVG A;  5LMN I;  2O1U A;  2UUB E;  4OX9 E;  3LPS A;  4DV7 E;  2O1T A;  3HXL A;  4LF6 E;  2LUP B;  4L5N C;  1N36 I;  4L8N A;  1UHZ A;  4YY3 E;  1N33 I;  3OTO E;  1B62 A;  2F4V I;  4IZJ D;  2L92 A;  4JI3 E;  2OI2 A;  4PU9 A;  1ZM2 A;  1IBL I;  1H73 A;  4PRX A;  4WPY A;  4NXN E;  3B78 A;  2HHH E;  1B63 A;  4DR6 E;  2M4I A;  4DPT A;  3IWC A;  4DV2 I;  1Z0C A;  1YYW A;  2LTS A;  1RR9 A;  2UU9 I;  4JI2 I;  4GKJ E;  4F54 A;  2O1W A;  4GKK E;  3F0N A;  2B9D A;  3ZZ0 A;  4JI8 E;  4WUB A;  4TUI A;  3ZZU A;  2IOP A;  5FLX C;  5AE3 A;  4HYM A;  5T6J A;  4URL A;  1J26 A;  1RRE A;  2UUB I;  3HQ1 A;  4OX9 I;  5IT9 Q;  2YZT A;  4DV7 I;  4B3R E;  1Z5B A;  3QT8 A;  4EMD A;  2MC6 A;  1XNQ E;  4X64 I;  5LL6 R;  4UT4 A;  3VK6 A;  1H72 C;  4DV4 I;  1Z0W A;  2Z5C A;  3ZKB A;  3HUL A;  2YT4 A;  1NHJ A;  1FWL A;  4DR3 I;  3K6Q A;  4DV0 I;  4P7A A;  2WW4 A;  1Z0V A;  2E1M A;  4JI5 E;  4DR6 I;  3J7A G;  4B3T I;  1GQE A;  1MX0 A;  4USM A;  1FWK A;  4N3O A;  2L2K B;  5LMU I;  4JI6 I;  1Y6Z A;  4DPY A;  4DR2 I;  3H09 A;  2DIX A;  1VIS A;  2V8Q B;  3JAM Q;  1Z0T A;  1SR9 A;  4JI1 I;  1X49 A;  4BMJ A;  3GON A;  2UUA E;  1N36 E;  2G7H A;  1N33 E;  3JTZ A;  2J7K A;  2JWO A;  2F4V E;  4WSP A;  2MDR A;  2Z5C B;  4DPW A;  4FWH A;  1H74 A;  2V83 A;  1X48 A;  4JI0 I;  1IBL E;  4DU8 A;  2LE2 A;  5GMD A;  2ODR D;  2KON A;  4I8O A;  4TUG A;  1XMQ I;  3HPZ A;  3PYE A;  3K85 A;  3PYF A;  4DV2 E;  1HNW I;  2DSY A;  4DV5 I;  2LJP A;  4DR5 I;  2F8B A;  4BC9 A;  2V87 A;  1FKA E;  1ZBQ A;  1N0U A;  3D4J A;  2GQ0 A;  2BM0 A;  1K47 A;  4ZVI A;  2V2Q A;  3LTO A;  4XTJ A;  2JVA A;  4AQY I;  4KZS A;  2JOB A;  1OJ4 A;  4HXZ A;  1HNX I;  4KQV A;  1I94 I;  5CFF E;  3Q6M A;  2VQF I;  1WHN A;  2GS8 A;  3J80 C;  2XEX A;  4M2Z A;  2HK2 A;  3K1J A;  4ED4 A;  2UUA I;  4X64 E;  5L3J A;  1USU A;  1Z0G A;  4LF7 I;  4DV4 E;  5GME A;  1HK7 A;  4J8Z A;  4Z7Y A;  1Z5C A;  4JV5 I;  5F3W A;  1Z59 A;  2RS6 A;  4LFA I;  4IZJ B;  4DR3 E;  2NUF A;  3ADJ A;  4DV0 E;  2UXC E;  2RTX A;  3JU0 A;  3OML A;  1RQ0 A;  4B3T E;  2KHX A;  2V2V A;  4X62 I;  3P1X A;  1FJG E;  1Z5A A;  4DV1 E;  5LMU E;  4JI6 E;  2V88 A;  4OOG C;  2B7T A;  4DR2 E;  1FNM A;  2Z5B A;  3QT6 A;  1T4L B;  5A2Q Q;  4F9C B;  1ZXN A;  2LBS B;  1XHK A;  3ZOQ B;  4JI1 E;  2HFU A;  1Z0E A;  1ZXM A;  2Q2E B;  3QT5 A;  2FGG A;  4P52 A;  1GZ6 A;  3KWR A;  2NUE A;  1IBK I;  4LFC I;  2CPN A;  4R8O A;  1ZBT A;  4DUY I;  4JI0 E;  3PYG A;  1EA6 A;  1Y4U A;  2EWL A;  3WU6 A;  1WUU A;  3F6H A;  5AE1 A;  2Z5E A;  4JI4 I;  1FI4 A;  4R03 A;  1ZM4 A;  1XMQ E;  4HAC A;  2RSM A;  2KOU A;  1T4O A;  2M1S A;  3C4B A;  1HNW E;  4X8W A;  3WU4 A;  4DV5 E;  4DR5 E;  4DKK A;  2LUQ A;  4MYU A;  2Z5B B;  1J5E I;  2V89 A;  2UXC I;  1U2R A;  1EI1 A;  1DQ3 A;  3MSW A;  3K17 A;  4AQY E;  1O0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...