4LFAE

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 33
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lfaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfaE02
1Z0EA 1Z5AA 5BR8E 4PU9A 1QU6A 4B3ME 3ADGA 2A2DA 3V2UC 4LFBE 4ZVIA 1IBKE 1XNQE 4DV6E 4KHPE 1N34I 2ZM6E 1EKZA 2F4VE 3VYXA 1X47A 2UUCI 3J7AG 3D4JA 4URLA 1YYOA 1Z0CA 2VQEE 3ZKBA 4DR3E 4X62I 4JI7I 1ZXNA 4B3TE 2BV3A 4DV5E 4AQYI 4WYQB 4JI2E 4HYMA 3H4LA 4B3RE 4X8WA 4DR7E 2DEIA 2HHHE 2JVAA 3B82A 3ZZ0A 4LFCE 1S4EA 5A2QQ 3ZZUA 4WFTA 4LF8I 2L3CA 2LUQA 1K47A 1N0UA 4DV7E 4NXME 3PYDA 4DPYA 1NHHA 4DV4I 2ZBKB 4Z7YA 4JYAI 4LF8E 2MDRA 1N32E 1QZRA 4JI4I 1EA6A 4FWDA 1T4OA 4DPTA 1S16A 4DKKA 4PRVA 4DPXA 4LF4E 4DR2I 1ZXMA 2UUAI 2DEJA 3OTOI 1FJGI 3M6AA 4PRXA 4DU7A 2L3JA 4X62E 2X7IA 4LF5E 2V2ZA 1H73A 4LFAI 1WHQA 2HFSA 4B3SI 2WW4A 2L2MA 2RTXA 1STUA 1H74A 2BM0A 4DR7I 3T1HI 4JI6I 2VQEI 4DU8A 4NXMI 2UU9I 2B3TB 1UEKA 2E5LI 2RS6A 5L3JA 1FWLA 1U2RA 1ZM4A 4DV0E 4R1FA 1PIEA 3ADIA 1WUUA 3QT8A 4DV2I 4LF6E 4LFBI 5IT9Q 1N33E 3J81C 1D6TA 1VISA 1T4NA 2UUCE 1KIJA 5IWAI 2HKJA 1Z0TA 4GKJI 2KHXA 1ZM2A 3VYYA 4USMA 4I3HA 2UXDI 2AJ4A 4DV3E 1Z0WA 4DR3I 3ADJA 5CFFE 3PYGA 1XNRI 1H7UA 4UT4A 2IHR1 2L33A 5FLXC 1IBKI 1XNQI 4HXZA 1Z5CA 4JI5E 4YY3I 4FWHA 4XTJA 3WU4A 2LRSA 4P52A 2N3GA 5GMEA 4GKKE 4DR4E 3V5RA 1KTVA 4DUZI 4JG4A 3K17A 2DMYA 3T1HE 4P7AA 2N3HA 1PKPA 4JI7E 1GQEA 3QT5A 3LPSA 1PVGA 1N34E 1Z0VA 2JY9A 5LMUE 2LJPA 4DR5I 2A2CA 4LF7E 2YT4A 3ZKDA 4JV5I 4LF9E 5GMDA 4YHHE 1B63A 1FI4A 4LF4I 2Q2EB 3CWVA 3B78A 4KQVA 4MYTA 2UUBI 3J81Q 4DV3I 1RREA 2CPNA 4HACA 1HR0E 5IT9C 1MG7A 1A6FA 4DV0I 4DPUA 1BKNA 1FKAE 3HULA 1ZM9A 3K1JA 1UHZA 4JI8E 1RC7A 1I94E 1X48A 2V2VA 2E5LE 4DR4I 2UU9E 2LTRA 1YYKA 1YZ9A 1NZ0A 3LLHA 4MYUA 4DV4E 2UXDE 1N36E 4X64E 1HNZE 4LFAE 2V34A 4DV1I 4X65E 4USKA 4DR2E 3HTXA 4UTGA 1J5EE 1MX0A 4GKJE 1Z0GA 4HY1A 3J7Yp 2V2QA 4OOGC 2UXBI 1NHJA 3J80Q 1XHKA 1T4LB 2VF3A 4DV5I 1UILA 2L2NA 1YYWA 2R3VA 3T1YI 4FN5A 4FWGA 5A2QC 2NUEA 4OX9E 1FNMA 2J7KA 2EZ6A 2DB2A 1N32I 2RSMA 4JYAE 4JI3E 3QT6A 2ZITA 1J5EI 4DR6E 4GKKI 5IWAE 1HR0I 1XMQI 4JV5E 4YY3E 2B7TA 1XMOE 5LL6R 5LMNE 3QT7A 4LF6I 4WUBA 4JI1E 2NPFA 3JAMQ 3J80C 5BR8I 1OJ4A 2LTSA 4DR5E 2RS7A 1ZM3A 4JI1I 2NA2A 4DV6I 3P1XA 4Z7CA 1N0VC 4JI0I 1Z5BA 4AQYE 3PYEA 4DR1I 2NUFA 3T1YE 4EMDA 2UUBE 4KHPI 3PYFA 2OI2A 4DR6I 4DPWA 4LF9I 2LJHA 1ZBTA 4DUYE 1J26A 4B3RI 1IBLE 1IBME 1HNZI 2HK3A 1Z59A 4JI3I 1O0WA 4K0KI 4LFCI 3J7AM 4X65I 1MU5A 1KKHA 4HACB 1N33I 2V8PA 4JI0E 2HK2A 1XMOI 4X66I 1N36I 1H72C 2LUPB 4M30A 1RR9A 2HFUA 2UXBE 3F0NA 2CZ9A 2XEXA 4B3TI 3OTOE 2NUGA 2UUAE 3C4TA 4OX9I 4DXLA 4NXNE 1ELOA 3C4BA 4JI2I 1DI2A 1DARA 4YHHI 2E1RA 2L2KB 3WU3A 1I94I 4WUDA 2GS8A 4JI4E 1XNRE 3B8HA 4DV1E 2F4VI 2DIXA 2BM1A 4M2ZA 1IBLI 1IBMI 2B7VA 4JI6E 2EFGA 5LMUI 1WHNA 4B3MI 5LMNI 4LF7I 1HNXI 3GONA 2HHHI 4B3SE 3LTOA 3LNUA 2VQFI 2UXCE 4DV2E 1X49A 1RQ0A 3ADLA 1Z0BA 1HNXE 4K0KE 3WU5A 2VQFE 1HNWE 1H7SA 5FLXQ 4DV7I 4M1KA 4DUYI 3WU6A 1B62A 4X66E 1KVKA 1FWKA 2LBSB 3JAMC 4FW9A 1HNWI 4WUCA 4DUZE 1EI1A 4NXNI 2X36A 4DR1E 3ZM7A 1XMQE 4RPFA 1FJGE 2HKEA 4JI5I 2UXCI 4LF5I 1NHIA 2R42A 4X64I 4JI8I 3ZZTA 4ED4A 3Q1QA 2ZM6I
chains in the Genus database with same CATH superfamily
2EJ4A 4O4KA 1Z0EA 1Z5AA 2CSHA 5BR8E 4PU9A 1QU6A 4B3ME 3ADGA 3H1CA 2A2DA 3V2UC 4LFBE 4ZVIA 2M7QA 1IBKE 1A1FA 1XNQE 2BA1G 2GQ0A 4F9CB 3PS1A 2EE8A 4DV6E 4KHPE 1X6FA 2B9DA 1N34I 5KL6A 3RMPA 5AC5A 4BC9A 4TUIA 2ZM6E 1EKZA 3HPZA 2F4VE 3VYXA 1X47A 3J7AG 2UUCI 5A6BD 3D4JA 2EN1A 4URLA 1YYOA 2V87A 2EMAA 2K7IA 4LU9A 1Z0CA 3L7ZA 2EQ3A 3VK6A 2HGHA 2VQEE 2JWOA 2Z5CA 2M1SA 3ZKBA 4ZYGA 4M9VC 2NN6C 4DR3E 3H09A 4X62I 5KL2A 4JI7I 1ZXNA 3L7ZB 4AIMA 4B3TE 2BV3A 4DV5E 2WCC3 2IERA 2JEAA 2EM9A 3M85G 3LMLA 4FK5C 4AQYI 4QNJA 4WYQB 4JI2E 4HYMA 5C0XA 3H4LA 4B3RE 1GTKA 2V8QB 2J65A 2CVEA 2JT2A 4X8WA 2YTIA 3CDJA 4DR7E 2DEIA 3FIGA 2HHHE 2JVAA 2MKNA 1OYSA 3B82A 2EPXA 3ZZ0A 4LFCE 2WZOA 3ECRA 1S4EA 4WXDA 1F2IG 5A2QQ 2LMZA 2V83A 5A6JA 2PNMA 3JU0A 2M4IA 4U3BA 1JK2A 4KZSA 3ZZUA 4WFTA 2C38B 4LF8I 2L3CA 1NEIA 2LUQA 1K47A 4IZKB 2PO0B 4Q28A 4DV7E 1N0UA 4RH8A 4NXME 4O24A 3PYDA 2V86A 2G7HA 2YTQA 3AUZA 1NHHA 4DPYA 4DV4I 2FTXB 2ZBKB 4IZJB 2EN4A 2H36X 4Z7YA 1IBMI 4ZYDA 4LF8E 2MDRA 4JYAI 2YTDA 2WNRA 1N32E 3GLLA 5DROA 5DRQA 4F54A 1QZRA 4JI4I 2I13A 1Y60A 5DNXA 1EA6A 4FWDA 1T4OA 4FW9A 5K36B 2DLKA 4DPTA 2GPIA 2EMYA 1MEYC 2N8XA 4DKKA 1S16A 3K6QA 2O1WA 2WP8A 4PRVA 2MC6A 4O5GA 4LF4E 4DPXA 4DR2I 1ZXMA 2YRMA 2WNRB 2UUAI 2EM4A 2DEJA 3OTOI 2EM7A 1FJGI 2NN6A 3M6AA 2VF1A 2O3ZA 4MU0A 4AIDA 4PRXA 4DU7A 2L3JA 4X62E 2X7IA 1EH8A 4O43A 2EPKX 4LF5E 2V2ZA 1X6EA 1H73A 1WHQA 5JEAF 4LFAI 2HFSA 2IOPA 2E1MA 2EP3A 2EL6A 2C38A 4LTYA 2D9HA 2EL4A 4B3SI 4FW5A 2WBTA 5DRPA 2C37A 2WW4A 2L2MA 2ZM6I 2RTXA 3BGHA 3ZOQB 4P78A 1STUA 1H74A 2BM0A 4R2SA 2O1UA 1X3CA 4DR7I 3HXLA 3T1HI 2VQEI 4JI6I 4DU8A 4NXMI 2UU9I 2B3TB 2EOEA 2HC5A 1UEKA 2E5LI 2RS6A 2IESA 3KRNA 5L3JA 1LLMC 1FWLA 5LLQA 2F1DA 2RSIA 1YSAC 1WRJA 4J3DA 2EN2A 1Z1BA 1SFEA 1U2RA 1ZM4A 4BA1A 4DV0E 4LOMA 4R1FA 2EMKA 1PIEA 3ADIA 1WUUA 3QT8A 4DV2I 2PRTA 4OO1B 2JEAB 3KZYA 3UHMA 4LF6E 2EQ0A 2JE6B 4LFBI 5IT9Q 1PJQA 1N33E 2ELYA 3J81C 2I9IA 4J8ZA 1D6TA 2EN8A 4IJDA 1VISA 1T4NA 2PNZB 1BB8A 2UUCE 1KIJA 2EMGA 5IWAI 2EMIA 3QG5C 3KWRA 3KZZA 5DNYA 2HKJA 1Z0TA 3PRYA 4WUCA 3Q6NA 4GKJI 2EOXA 2LCEA 2KHXA 1ZM2A 3VYYA 2ENAA 4USMA 1X6HA 4MLVA 5KL5A 2PNLA 2AJ4A 2EM3A 4I3HA 2UXDI 4DV3E 1IQOA 2YTGA 1Z0WA 4DR3I 3PS2A 2EOYA 3ADJA 5CFFE 3PYGA 1UDSA 4U3DA 2EMWA 1XNRI 3F6HA 1H7UA 4UT4A 3P3EA 2IHR1 2L33A 1R6LA 2KONA 2L92A 5FLXC 3C6KA 3EPJA 1BBOA 4HXZA 1IBKI 1Z5CA 1XNQI 4JI5E 2CG9A 1GZ6A 4FWHA 4XTJA 4YY3I 3WU4A 2LRSA 3L00A 2N3GA 4P52A 2Z5EA 2C37B 1DGCA 4IS1C 5DRRA 4ZYEA 5GMEA 4R2DA 4ZYHA 2CGEA 4GKKE 5C0XF 4M0VA 4BCAA 2EM5A 4DR4E 3V5RA 5K36D 1KTVA 3K85A 2DSYA 3U1KA 2EM0A 4JG4A 2LT7A 4QNKA 3K17A 4ISAA 4DUZI 4R2AA 1ZBQA 2DMYA 3T1HE 2YTEA 2YRKA 2N3HA 4P7AA 1VI7A 1PKPA 4JI7E 2FV4B 2EPZA 2YZTA 5JEAC 1GQEA 3QT5A 3LPSA 2V89A 1PVGA 2YSPA 1N34E 1IMUA 2JY9A 1Z0VA 5LMUE 2EORA 1TN9A 1XXEA 4BMJA 2WBUA 2LJPA 3GMEA 4DR5I 1KYQA 2BR2B 2EOSA 2MC5A 4LF7E 2A2CA 2YT4A 3ZKDA 2YTNA 4JV5I 3EPKA 2Z5CB 5C0XC 4WSGA 4LF9E 2EOFA 5GMDA 4YHHE 4F6MA 2EM2A 1B63A 1FI4A 4IZKA 4LF4I 2FGGA 2JOXA 3EPHA 2Q2EB 5T6JA 3CWVA 3B78A 4KQVA 4MYTA 2UUBI 5K36F 2J7JA 2JPAA 1UDNA 2Z5BB 3J81Q 4DV3I 2VRDA 2CPNA 1HR0E 2ENHA 1SR9A 5IT9C 2DRPA 1MG7A 1RREA 4HACA 1WJPA 2EL5A 3VHTB 4HTGA 4MU3A 4F2JC 3P06A 4FW3A 5JEAD 4FW6A 1A6FA 3PS3A 4DV0I 4DPUA 1BKNA 3BF2A 2EPOA 4R2RA 1FKAE 1UBDC 3HULA 4IFDA 1ZM9A 3K1JA 2GHFA 1UHZA 4JI8E 1HNWI 1RC7A 1OYRA 1EH6A 1YPNA 1X48A 2ODRC 1I94E 2V2VA 2E5LE 4AM3A 2NN6F 1DQ3A 5FWKA 3P3CA 1A1GA 2UU9E 4DR4I 4L8NA 1ZR9A 2LTRA 1YYKA 1N3GA 2ODRD 2EMXA 2YTFA 1YZ9A 4WX9A 2DMIA 1NZ0A 3LLHA 4MYUA 1UDOA 2VESA 3THOB 2EOHA 4IFDE 2EOZA 2EM8A 4DV4E 2UXDE 4F9AB 1N36E 4X64E 1HNZE 1R6MA 4LFAE 1UN6B 3P3GA 2V34A 4GZNC 4FW4A 2YWQA 1NCSA 1E3PA 2YTPA 4DV1I 5K36C 1IQSA 4X65E 1AAYA 5KL3A 2RPCA 5AC4A 4USKA 4DR2E 1G2DC 3HTXA 4Q35B 4UTGA 1B69A 1J5EE 1A1IA 1MX0A 4GKJE 1Z0GA 1PJSA 4HY1A 5AE2A 4L5NC 3J7Yp 2YRHA 2M9AA 2V2QA 4OOGC 2UXBI 2JEBB 4NHRA 1MGTA 4R2QA 2A25A 2GO4A 2EN3A 1NHJA 2PO1B 3J80Q 2Z5BA 1XHKA 1HK7A 1T4LB 2YSOA 2VF3A 4BA2A 3M7ND 4DV5I 1UILA 2L2NA 1YYWA 4OKGA 5C0XD 2R3VA 3T1YI 2ENCA 1UDQA 4FN5A 4FWGA 5A6KA 1KJKA 2EN7A 1YFHA 5A2QC 1USVA 2MDGA 3DJWA 2BR2A 4IFDD 2NUEA 5ADZA 4OX9E 2EPMX 4RHBB 1FNMA 2J7KA 2EZ6A 4GQUA 5AASA 2DB2A 1N32I 2O1TA 3CDIA 2RSMA 4JYAE 4JI3E 3QT6A 4R2EA 2ZITA 1BBGA 4IZJA 2EPCA 2EPAA 4DR6E 1J5EI 2PO2A 2EMZA 4GKKI 5IWAE 5ELWA 1HR0I 4R8OA 2EPUA 2JOBA 1XMQI 1RMDA 5IXMB 1A1HA 5KL7A 4JV5E 1YHCA 2EPPA 4YY3E 5K36E 2EOJA 2B7TA 4LCFA 1XMOE 3IWCA 5LL6R 5LMNE 1E3HA 1TF6A 1YUJA 1Y4SA 3QT7A 4LF6I 1USUA 2EMFA 5C0XE 4WUBA 2EOMA 4LPFA 4JI1E 2YU8A 4OO1F 4F9BB 2NPFA 3JAMQ 3HKMA 2K4VA 3GCMA 2F8BA 4WSPA 3J80C 5BR8I 4R2CA 3EQ1A 2DGCA 4I8OA 2EMCA 1OJ4A 2LTSA 5A6BA 4DR5E 2RS7A 5F3WA 2EQ1A 4BC7A 1ZM3A 3B4TA 2NA2A 4JI1I 2LVHA 4DV6I 3P1XA 2ADRA 4Z7CA 1N0VC 4JI0I 5C0XB 1Z5BA 3BBGA 4AQYE 1P42A 2C39B 4NBQA 3PYEA 4DR1I 5K36A 5JEAA 2NUFA 4TUGA 3T1YE 4EMDA 4IS9A 2UUBE 4KHPI 3PYFA 4OO1D 4BBYA 4F6NA 5AE3A 3P76A 4LCHA 4IFDF 2OI2A 4DR6I 3MSWA 4DPWA 4X9JA 2EOQA 4LF9I 2LJHA 5AE1A 1ZBTA 4GEQB 4OO1C 3JTZA 4BS9A 2BBGA 4BA2B 2GLIA 4OO1A 2WBSA 2EPRA 2EOIA 5EL9A 4DUYE 1Y5YA 1J26A 4BA1B 4B3RI 3OMLA 1YH8A 1IBLE 1IBME 1HNZI 5KL4A 3M7NG 2HK3A 4LCGA 1Z59A 1OYPA 4IFDB 4JI3I 2LJUA 1O0WA 2AE8A 4K0KI 4LFCI 3J7AM 2CTDA 3HJCA 4X65I 4DMIA 1MU5A 1KKHA 2O1VA 4HACB 1N33I 1P47A 2V8PA 3TQMA 4JI0E 3IWDA 2HK2A 2NN6E 4X66I 1XMOI 1H72C 1N36I 2LUPB 1A1LA 2Q8UA 4M30A 2JP9A 1RR9A 2HFUA 2UXBE 4BHCA 2CZ9A 3F0NA 2XEXA 4B3TI 1Y4UA 2MKDA 4BHBA 5A6AA 3OTOE 1TF3A 2NUGA 2UUAE 2LE2A 3C4TA 3NZKA 2V88A 4OX9I 4MU1A 4DXLA 4NXNE 1ELOA 1Y6ZA 3C4BA 2NN6B 5A69A 2YTJA 1DI2A 1DARA 4YHHI 4JI2I 2E1RA 2L2KB 2YPNA 3WU3A 1I94I 4WUDA 4JI4E 2GS8A 1XNRE 2JE6A 5JEAB 2WP8B 4IZJD 2C39A 3B8HA 4DV1E 3EPLA 1QNTA 2F4VI 1G2FC 4HEIA 2CT1A 2DIXA 4MDTA 2BM1A 2R76A 4M2ZA 4NZVA 2L8TA 2B7VA 1L4SA 3THNA 1IBLI 3UK3C 4JI6E 2EFGA 3IWBA 5LMUI 1WHNA 2ELZA 2V85A 2JYAA 4B3MI 4MQYA 3DD6A 2L6MA 5LMNI 5IV8B 2IOQA 2HJJA 5JEAE 4LF7I 1PJTA 2BB8A 1EH7A 4R2PA 1HNXI 3GONA 2HHHI 2BA1D 5TSEA 4IFDC 2DLQA 4B3SE 3LTOA 1PDAA 2LV2A 3LNUA 2VQFI 2EM6A 4MLQA 1T39A 2UXCE 2VE7C 5EKWA 2E72A 5DNLA 2BA0D 4R03A 4DV2E 1X49A 1RQ0A 3ADLA 1Z0BA 1HNXE 4N3OA 2EPNA 1A1KA 3C6MA 1JK1A 4K0KE 3WU5A 2KOUA 1RHYA 4KWYA 2EWLA 1T38A 2PO2B 3HQ1A 2VQFE 2RQLA 3M85D 1HNWE 1H7SA 5FLXQ 4DV7I 4WPYA 3U1YA 1AH5A 4M1KA 4DUYI 3WU6A 2YTOA 1B62A 1A1JA 4X66E 4WXCA 2EPLX 1KVKA 4P7DA 2EMBA 1FWKA 3JAMC 2EOOA 2LBSB 2EMHA 1WXRA 4DUZE 1ZU1A 3M99B 2YU5A 3MHHC 1ZAAC 1EI1A 2GO3A 2EMLA 2PNZA 4NXNI 2X36A 3BIDA 3Q6MA 2R1FA 3AV0A 4FW7A 2NABA 2PO0A 1X5WA 4DR1E 3ZM7A 1XMQE 4RPFA 1FJGE 2HKEA 4JI5I 3HPSA 3MHSC 2EN6A 2NN6D 4N4RB 2LO3A 2UXCI 2JR1A 2PO1A 1YUIA 2JXPA 4MU4A 4LF5I 1NHIA 2R42A 4X64I 4JI8I 3ZZTA 4ED4A 3Q1QA 4OZEA 3F6GA 2JEBA 4OO1E 2BA0G 3DF6A
chains in the Genus database with same CATH topology
1Z0EA 1Z5AA 5BR8E 4PU9A 1QU6A 4B3ME 3ADGA 2A2DA 3V2UC 4LFBE 4ZVIA 2M7QA 1IBKE 1XNQE 2GQ0A 4F9CB 4DV6E 4KHPE 2B9DA 1N34I 3RMPA 4BC9A 4TUIA 2ZM6E 1EKZA 3HPZA 2F4VE 3VYXA 1X47A 3J7AG 2UUCI 3D4JA 4URLA 1YYOA 2V87A 4LU9A 1Z0CA 3VK6A 2VQEE 2JWOA 2Z5CA 2M1SA 3ZKBA 4DR3E 3H09A 4X62I 4JI7I 1ZXNA 4B3TE 2BV3A 4DV5E 3LMLA 4AQYI 4WYQB 4JI2E 4HYMA 3H4LA 4B3RE 2V8QB 4X8WA 4DR7E 2DEIA 3FIGA 2HHHE 2JVAA 3B82A 3ZZ0A 4LFCE 2WZOA 1S4EA 5A2QQ 2LMZA 2V83A 2PNMA 3JU0A 2M4IA 4KZSA 3ZZUA 4WFTA 4LF8I 2L3CA 2LUQA 1K47A 4IZKB 4Q28A 4DV7E 1N0UA 4NXME 3PYDA 2V86A 2G7HA 3AUZA 4DPYA 1NHHA 4DV4I 2FTXB 2ZBKB 4IZJB 2H36X 4Z7YA 4JYAI 4LF8E 2MDRA 1N32E 4F54A 1QZRA 4JI4I 1EA6A 4FWDA 1T4OA 4DPTA 1S16A 4DKKA 3K6QA 2O1WA 4PRVA 4DPXA 2MC6A 4LF4E 4DR2I 1ZXMA 2UUAI 2DEJA 3OTOI 1FJGI 3M6AA 2VF1A 4PRXA 4DU7A 2L3JA 4X62E 2X7IA 4LF5E 2V2ZA 1H73A 4LFAI 1WHQA 2HFSA 2IOPA 2E1MA 4B3SI 4LTYA 2WW4A 2L2MA 2ZM6I 2RTXA 3ZOQB 4P78A 1STUA 1H74A 2BM0A 2O1UA 4DR7I 3HXLA 3T1HI 2VQEI 4JI6I 4DU8A 4NXMI 2UU9I 2B3TB 1UEKA 2E5LI 2RS6A 5L3JA 1FWLA 1U2RA 1ZM4A 4DV0E 4R1FA 1PIEA 3ADIA 1WUUA 3QT8A 4DV2I 4LF6E 4LFBI 5IT9Q 1N33E 3J81C 4J8ZA 1D6TA 1VISA 1T4NA 2UUCE 1KIJA 5IWAI 3KWRA 5DNYA 2HKJA 1Z0TA 3PRYA 4GKJI 3Q6NA 2KHXA 1ZM2A 3VYYA 4USMA 4I3HA 2PNLA 2UXDI 2AJ4A 4DV3E 1Z0WA 4DR3I 3ADJA 5CFFE 3PYGA 1XNRI 3F6HA 1H7UA 4UT4A 2IHR1 2L33A 2KONA 2L92A 5FLXC 1IBKI 1XNQI 4HXZA 1Z5CA 4JI5E 2CG9A 1GZ6A 4FWHA 4XTJA 4YY3I 3WU4A 2LRSA 4P52A 2N3GA 2Z5EA 5GMEA 2CGEA 4GKKE 4M0VA 4BCAA 4DR4E 3V5RA 1KTVA 3K85A 2DSYA 4DUZI 4JG4A 3K17A 1ZBQA 2DMYA 3T1HE 4P7AA 2N3HA 1PKPA 4JI7E 2FV4B 2YZTA 1GQEA 3QT5A 3LPSA 2V89A 1PVGA 1N34E 1Z0VA 2JY9A 5LMUE 4BMJA 2LJPA 4DR5I 2MC5A 4LF7E 2A2CA 2YT4A 3ZKDA 4JV5I 2Z5CB 4LF9E 5GMDA 4YHHE 4IZKA 1B63A 1FI4A 4LF4I 2FGGA 2JOXA 2Q2EB 5T6JA 3CWVA 3B78A 4KQVA 4MYTA 2UUBI 2Z5BB 3J81Q 4DV3I 1HR0E 1RREA 2CPNA 1SR9A 5IT9C 4HACA 1MG7A 3P06A 1A6FA 4DV0I 4DPUA 1BKNA 1FKAE 3HULA 1ZM9A 3K1JA 1UHZA 4JI8E 1RC7A 2ODRC 1I94E 1X48A 2V2VA 2E5LE 1DQ3A 5FWKA 4DR4I 2UU9E 4L8NA 2LTRA 1YYKA 2ODRD 1YZ9A 1NZ0A 3LLHA 4MYUA 4DV4E 2UXDE 4F9AB 1N36E 4X64E 1HNZE 4LFAE 2V34A 4DV1I 4X65E 4USKA 4DR2E 3HTXA 4UTGA 1J5EE 1MX0A 4GKJE 1Z0GA 4HY1A 5AE2A 4L5NC 3J7Yp 2V2QA 4OOGC 2UXBI 1NHJA 3J80Q 2Z5BA 1XHKA 1HK7A 1T4LB 2VF3A 4DV5I 1UILA 2L2NA 1YYWA 2R3VA 3T1YI 4FN5A 4FWGA 5A2QC 1USVA 3DJWA 2NUEA 5ADZA 4OX9E 1FNMA 2J7KA 2EZ6A 5AASA 2DB2A 1N32I 2O1TA 2RSMA 4JYAE 4JI3E 3QT6A 2ZITA 4IZJA 1J5EI 4DR6E 4GKKI 5IWAE 1HR0I 4R8OA 2JOBA 1XMQI 4JV5E 4YY3E 2B7TA 1XMOE 3IWCA 5LL6R 5LMNE 1Y4SA 3QT7A 4LF6I 1USUA 4WUBA 4JI1E 4F9BB 2NPFA 3JAMQ 2K4VA 2F8BA 4WSPA 3J80C 5BR8I 4I8OA 1OJ4A 2LTSA 4DR5E 2RS7A 5F3WA 1ZM3A 4BC7A 4JI1I 2NA2A 4DV6I 3P1XA 4Z7CA 1N0VC 4JI0I 1Z5BA 4AQYE 3PYEA 4DR1I 2NUFA 4TUGA 3T1YE 4EMDA 2UUBE 4KHPI 3PYFA 4BBYA 5AE3A 2OI2A 4DR6I 3MSWA 4DPWA 4LF9I 2LJHA 5AE1A 1ZBTA 4GEQB 3JTZA 4BS9A 4DUYE 1J26A 4B3RI 3OMLA 1IBLE 1IBME 1HNZI 2HK3A 1Z59A 4JI3I 1O0WA 4K0KI 4LFCI 3J7AM 3HJCA 4X65I 4DMIA 1MU5A 1KKHA 2O1VA 4HACB 1N33I 2V8PA 4JI0E 3IWDA 2HK2A 4X66I 1XMOI 1N36I 1H72C 2LUPB 4M30A 1RR9A 2HFUA 2UXBE 3F0NA 2CZ9A 2XEXA 4B3TI 1Y4UA 3OTOE 2NUGA 2UUAE 2LE2A 3C4TA 2V88A 4OX9I 4DXLA 1Y6ZA 4NXNE 1ELOA 3C4BA 4JI2I 1DI2A 1DARA 4YHHI 2E1RA 2L2KB 3WU3A 1I94I 4WUDA 4JI4E 2GS8A 1XNRE 4IZJD 3B8HA 4DV1E 2F4VI 2DIXA 2BM1A 4M2ZA 1IBLI 1IBMI 2L8TA 2B7VA 4JI6E 2EFGA 5LMUI 3IWBA 1WHNA 2V85A 4B3MI 5LMNI 2L6MA 2IOQA 4LF7I 1HNXI 3GONA 2HHHI 4B3SE 3LTOA 3LNUA 2VQFI 2UXCE 2VE7C 4R03A 4DV2E 1X49A 1RQ0A 3ADLA 1Z0BA 1HNXE 4N3OA 4K0KE 3WU5A 2KOUA 2EWLA 3HQ1A 2VQFE 1HNWE 1H7SA 5FLXQ 4DV7I 4WPYA 4M1KA 4DUYI 3WU6A 1B62A 4X66E 1KVKA 4P7DA 1FWKA 3JAMC 2LBSB 4FW9A 1WXRA 4WUCA 4DUZE 1HNWI 1EI1A 4NXNI 2X36A 3Q6MA 3AV0A 4DR1E 3ZM7A 1XMQE 4RPFA 1FJGE 2HKEA 4JI5I 3HPSA 2UXCI 2JR1A 4LF5I 1NHIA 2R42A 4X64I 4JI8I 3ZZTA 4ED4A 3Q1QA 3F6GA 3DF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0E A;  1Z5A A;  5BR8 E;  4PU9 A;  1QU6 A;  4B3M E;  3ADG A;  2A2D A;  3V2U C;  4LFB E;  4ZVI A;  1IBK E;  1XNQ E;  4DV6 E;  4KHP E;  1N34 I;  2ZM6 E;  1EKZ A;  2F4V E;  3VYX A;  1X47 A;  2UUC I;  3J7A G;  3D4J A;  4URL A;  1YYO A;  1Z0C A;  2VQE E;  3ZKB A;  4DR3 E;  4X62 I;  4JI7 I;  1ZXN A;  4B3T E;  2BV3 A;  4DV5 E;  4AQY I;  4WYQ B;  4JI2 E;  4HYM A;  3H4L A;  4B3R E;  4X8W A;  4DR7 E;  2DEI A;  2HHH E;  2JVA A;  3B82 A;  3ZZ0 A;  4LFC E;  1S4E A;  5A2Q Q;  3ZZU A;  4WFT A;  4LF8 I;  2L3C A;  2LUQ A;  1K47 A;  1N0U A;  4DV7 E;  4NXM E;  3PYD A;  4DPY A;  1NHH A;  4DV4 I;  2ZBK B;  4Z7Y A;  4JYA I;  4LF8 E;  2MDR A;  1N32 E;  1QZR A;  4JI4 I;  1EA6 A;  4FWD A;  1T4O A;  4DPT A;  1S16 A;  4DKK A;  4PRV A;  4DPX A;  4LF4 E;  4DR2 I;  1ZXM A;  2UUA I;  2DEJ A;  3OTO I;  1FJG I;  3M6A A;  4PRX A;  4DU7 A;  2L3J A;  4X62 E;  2X7I A;  4LF5 E;  2V2Z A;  1H73 A;  4LFA I;  1WHQ A;  2HFS A;  4B3S I;  2WW4 A;  2L2M A;  2RTX A;  1STU A;  1H74 A;  2BM0 A;  4DR7 I;  3T1H I;  4JI6 I;  2VQE I;  4DU8 A;  4NXM I;  2UU9 I;  2B3T B;  1UEK A;  2E5L I;  2RS6 A;  5L3J A;  1FWL A;  1U2R A;  1ZM4 A;  4DV0 E;  4R1F A;  1PIE A;  3ADI A;  1WUU A;  3QT8 A;  4DV2 I;  4LF6 E;  4LFB I;  5IT9 Q;  1N33 E;  3J81 C;  1D6T A;  1VIS A;  1T4N A;  2UUC E;  1KIJ A;  5IWA I;  2HKJ A;  1Z0T A;  4GKJ I;  2KHX A;  1ZM2 A;  3VYY A;  4USM A;  4I3H A;  2UXD I;  2AJ4 A;  4DV3 E;  1Z0W A;  4DR3 I;  3ADJ A;  5CFF E;  3PYG A;  1XNR I;  1H7U A;  4UT4 A;  2IHR 1;  2L33 A;  5FLX C;  1IBK I;  1XNQ I;  4HXZ A;  1Z5C A;  4JI5 E;  4YY3 I;  4FWH A;  4XTJ A;  3WU4 A;  2LRS A;  4P52 A;  2N3G A;  5GME A;  4GKK E;  4DR4 E;  3V5R A;  1KTV A;  4DUZ I;  4JG4 A;  3K17 A;  2DMY A;  3T1H E;  4P7A A;  2N3H A;  1PKP A;  4JI7 E;  1GQE A;  3QT5 A;  3LPS A;  1PVG A;  1N34 E;  1Z0V A;  2JY9 A;  5LMU E;  2LJP A;  4DR5 I;  2A2C A;  4LF7 E;  2YT4 A;  3ZKD A;  4JV5 I;  4LF9 E;  5GMD A;  4YHH E;  1B63 A;  1FI4 A;  4LF4 I;  2Q2E B;  3CWV A;  3B78 A;  4KQV A;  4MYT A;  2UUB I;  3J81 Q;  4DV3 I;  1RRE A;  2CPN A;  4HAC A;  1HR0 E;  5IT9 C;  1MG7 A;  1A6F A;  4DV0 I;  4DPU A;  1BKN A;  1FKA E;  3HUL A;  1ZM9 A;  3K1J A;  1UHZ A;  4JI8 E;  1RC7 A;  1I94 E;  1X48 A;  2V2V A;  2E5L E;  4DR4 I;  2UU9 E;  2LTR A;  1YYK A;  1YZ9 A;  1NZ0 A;  3LLH A;  4MYU A;  4DV4 E;  2UXD E;  1N36 E;  4X64 E;  1HNZ E;  4LFA E;  2V34 A;  4DV1 I;  4X65 E;  4USK A;  4DR2 E;  3HTX A;  4UTG A;  1J5E E;  1MX0 A;  4GKJ E;  1Z0G A;  4HY1 A;  3J7Y p;  2V2Q A;  4OOG C;  2UXB I;  1NHJ A;  3J80 Q;  1XHK A;  1T4L B;  2VF3 A;  4DV5 I;  1UIL A;  2L2N A;  1YYW A;  2R3V A;  3T1Y I;  4FN5 A;  4FWG A;  5A2Q C;  2NUE A;  4OX9 E;  1FNM A;  2J7K A;  2EZ6 A;  2DB2 A;  1N32 I;  2RSM A;  4JYA E;  4JI3 E;  3QT6 A;  2ZIT A;  1J5E I;  4DR6 E;  4GKK I;  5IWA E;  1HR0 I;  1XMQ I;  4JV5 E;  4YY3 E;  2B7T A;  1XMO E;  5LL6 R;  5LMN E;  3QT7 A;  4LF6 I;  4WUB A;  4JI1 E;  2NPF A;  3JAM Q;  3J80 C;  5BR8 I;  1OJ4 A;  2LTS A;  4DR5 E;  2RS7 A;  1ZM3 A;  4JI1 I;  2NA2 A;  4DV6 I;  3P1X A;  4Z7C A;  1N0V C;  4JI0 I;  1Z5B A;  4AQY E;  3PYE A;  4DR1 I;  2NUF A;  3T1Y E;  4EMD A;  2UUB E;  4KHP I;  3PYF A;  2OI2 A;  4DR6 I;  4DPW A;  4LF9 I;  2LJH A;  1ZBT A;  4DUY E;  1J26 A;  4B3R I;  1IBL E;  1IBM E;  1HNZ I;  2HK3 A;  1Z59 A;  4JI3 I;  1O0W A;  4K0K I;  4LFC I;  3J7A M;  4X65 I;  1MU5 A;  1KKH A;  4HAC B;  1N33 I;  2V8P A;  4JI0 E;  2HK2 A;  1XMO I;  4X66 I;  1N36 I;  1H72 C;  2LUP B;  4M30 A;  1RR9 A;  2HFU A;  2UXB E;  3F0N A;  2CZ9 A;  2XEX A;  4B3T I;  3OTO E;  2NUG A;  2UUA E;  3C4T A;  4OX9 I;  4DXL A;  4NXN E;  1ELO A;  3C4B A;  4JI2 I;  1DI2 A;  1DAR A;  4YHH I;  2E1R A;  2L2K B;  3WU3 A;  1I94 I;  4WUD A;  2GS8 A;  4JI4 E;  1XNR E;  3B8H A;  4DV1 E;  2F4V I;  2DIX A;  2BM1 A;  4M2Z A;  1IBL I;  1IBM I;  2B7V A;  4JI6 E;  2EFG A;  5LMU I;  1WHN A;  4B3M I;  5LMN I;  4LF7 I;  1HNX I;  3GON A;  2HHH I;  4B3S E;  3LTO A;  3LNU A;  2VQF I;  2UXC E;  4DV2 E;  1X49 A;  1RQ0 A;  3ADL A;  1Z0B A;  1HNX E;  4K0K E;  3WU5 A;  2VQF E;  1HNW E;  1H7S A;  5FLX Q;  4DV7 I;  4M1K A;  4DUY I;  3WU6 A;  1B62 A;  4X66 E;  1KVK A;  1FWK A;  2LBS B;  3JAM C;  4FW9 A;  1HNW I;  4WUC A;  4DUZ E;  1EI1 A;  4NXN I;  2X36 A;  4DR1 E;  3ZM7 A;  1XMQ E;  4RPF A;  1FJG E;  2HKE A;  4JI5 I;  2UXC I;  4LF5 I;  1NHI A;  2R42 A;  4X64 I;  4JI8 I;  3ZZT A;  4ED4 A;  3Q1Q A;  2ZM6 I; 
#chains in the Genus database with same CATH topology
 2EJ4 A;  4O4K A;  1Z0E A;  1Z5A A;  2CSH A;  5BR8 E;  4PU9 A;  1QU6 A;  4B3M E;  3ADG A;  3H1C A;  2A2D A;  3V2U C;  4LFB E;  4ZVI A;  2M7Q A;  1IBK E;  1A1F A;  1XNQ E;  2BA1 G;  2GQ0 A;  4F9C B;  3PS1 A;  2EE8 A;  4DV6 E;  4KHP E;  1X6F A;  2B9D A;  1N34 I;  5KL6 A;  3RMP A;  5AC5 A;  4BC9 A;  4TUI A;  2ZM6 E;  1EKZ A;  3HPZ A;  2F4V E;  3VYX A;  1X47 A;  3J7A G;  2UUC I;  5A6B D;  3D4J A;  2EN1 A;  4URL A;  1YYO A;  2V87 A;  2EMA A;  2K7I A;  4LU9 A;  1Z0C A;  3L7Z A;  2EQ3 A;  3VK6 A;  2HGH A;  2VQE E;  2JWO A;  2Z5C A;  2M1S A;  3ZKB A;  4ZYG A;  4M9V C;  2NN6 C;  4DR3 E;  3H09 A;  4X62 I;  5KL2 A;  4JI7 I;  1ZXN A;  3L7Z B;  4AIM A;  4B3T E;  2BV3 A;  4DV5 E;  2WCC 3;  2IER A;  2JEA A;  2EM9 A;  3M85 G;  3LML A;  4FK5 C;  4AQY I;  4QNJ A;  4WYQ B;  4JI2 E;  4HYM A;  5C0X A;  3H4L A;  4B3R E;  1GTK A;  2V8Q B;  2J65 A;  2CVE A;  2JT2 A;  4X8W A;  2YTI A;  3CDJ A;  4DR7 E;  2DEI A;  3FIG A;  2HHH E;  2JVA A;  2MKN A;  1OYS A;  3B82 A;  2EPX A;  3ZZ0 A;  4LFC E;  2WZO A;  3ECR A;  1S4E A;  4WXD A;  1F2I G;  5A2Q Q;  2LMZ A;  2V83 A;  5A6J A;  2PNM A;  3JU0 A;  2M4I A;  4U3B A;  1JK2 A;  4KZS A;  3ZZU A;  4WFT A;  2C38 B;  4LF8 I;  2L3C A;  1NEI A;  2LUQ A;  1K47 A;  4IZK B;  2PO0 B;  4Q28 A;  4DV7 E;  1N0U A;  4RH8 A;  4NXM E;  4O24 A;  3PYD A;  2V86 A;  2G7H A;  2YTQ A;  3AUZ A;  1NHH A;  4DPY A;  4DV4 I;  2FTX B;  2ZBK B;  4IZJ B;  2EN4 A;  2H36 X;  4Z7Y A;  1IBM I;  4ZYD A;  4LF8 E;  2MDR A;  4JYA I;  2YTD A;  2WNR A;  1N32 E;  3GLL A;  5DRO A;  5DRQ A;  4F54 A;  1QZR A;  4JI4 I;  2I13 A;  1Y60 A;  5DNX A;  1EA6 A;  4FWD A;  1T4O A;  4FW9 A;  5K36 B;  2DLK A;  4DPT A;  2GPI A;  2EMY A;  1MEY C;  2N8X A;  4DKK A;  1S16 A;  3K6Q A;  2O1W A;  2WP8 A;  4PRV A;  2MC6 A;  4O5G A;  4LF4 E;  4DPX A;  4DR2 I;  1ZXM A;  2YRM A;  2WNR B;  2UUA I;  2EM4 A;  2DEJ A;  3OTO I;  2EM7 A;  1FJG I;  2NN6 A;  3M6A A;  2VF1 A;  2O3Z A;  4MU0 A;  4AID A;  4PRX A;  4DU7 A;  2L3J A;  4X62 E;  2X7I A;  1EH8 A;  4O43 A;  2EPK X;  4LF5 E;  2V2Z A;  1X6E A;  1H73 A;  1WHQ A;  5JEA F;  4LFA I;  2HFS A;  2IOP A;  2E1M A;  2EP3 A;  2EL6 A;  2C38 A;  4LTY A;  2D9H A;  2EL4 A;  4B3S I;  4FW5 A;  2WBT A;  5DRP A;  2C37 A;  2WW4 A;  2L2M A;  2ZM6 I;  2RTX A;  3BGH A;  3ZOQ B;  4P78 A;  1STU A;  1H74 A;  2BM0 A;  4R2S A;  2O1U A;  1X3C A;  4DR7 I;  3HXL A;  3T1H I;  2VQE I;  4JI6 I;  4DU8 A;  4NXM I;  2UU9 I;  2B3T B;  2EOE A;  2HC5 A;  1UEK A;  2E5L I;  2RS6 A;  2IES A;  3KRN A;  5L3J A;  1LLM C;  1FWL A;  5LLQ A;  2F1D A;  2RSI A;  1YSA C;  1WRJ A;  4J3D A;  2EN2 A;  1Z1B A;  1SFE A;  1U2R A;  1ZM4 A;  4BA1 A;  4DV0 E;  4LOM A;  4R1F A;  2EMK A;  1PIE A;  3ADI A;  1WUU A;  3QT8 A;  4DV2 I;  2PRT A;  4OO1 B;  2JEA B;  3KZY A;  3UHM A;  4LF6 E;  2EQ0 A;  2JE6 B;  4LFB I;  5IT9 Q;  1PJQ A;  1N33 E;  2ELY A;  3J81 C;  2I9I A;  4J8Z A;  1D6T A;  2EN8 A;  4IJD A;  1VIS A;  1T4N A;  2PNZ B;  1BB8 A;  2UUC E;  1KIJ A;  2EMG A;  5IWA I;  2EMI A;  3QG5 C;  3KWR A;  3KZZ A;  5DNY A;  2HKJ A;  1Z0T A;  3PRY A;  4WUC A;  3Q6N A;  4GKJ I;  2EOX A;  2LCE A;  2KHX A;  1ZM2 A;  3VYY A;  2ENA A;  4USM A;  1X6H A;  4MLV A;  5KL5 A;  2PNL A;  2AJ4 A;  2EM3 A;  4I3H A;  2UXD I;  4DV3 E;  1IQO A;  2YTG A;  1Z0W A;  4DR3 I;  3PS2 A;  2EOY A;  3ADJ A;  5CFF E;  3PYG A;  1UDS A;  4U3D A;  2EMW A;  1XNR I;  3F6H A;  1H7U A;  4UT4 A;  3P3E A;  2IHR 1;  2L33 A;  1R6L A;  2KON A;  2L92 A;  5FLX C;  3C6K A;  3EPJ A;  1BBO A;  4HXZ A;  1IBK I;  1Z5C A;  1XNQ I;  4JI5 E;  2CG9 A;  1GZ6 A;  4FWH A;  4XTJ A;  4YY3 I;  3WU4 A;  2LRS A;  3L00 A;  2N3G A;  4P52 A;  2Z5E A;  2C37 B;  1DGC A;  4IS1 C;  5DRR A;  4ZYE A;  5GME A;  4R2D A;  4ZYH A;  2CGE A;  4GKK E;  5C0X F;  4M0V A;  4BCA A;  2EM5 A;  4DR4 E;  3V5R A;  5K36 D;  1KTV A;  3K85 A;  2DSY A;  3U1K A;  2EM0 A;  4JG4 A;  2LT7 A;  4QNK A;  3K17 A;  4ISA A;  4DUZ I;  4R2A A;  1ZBQ A;  2DMY A;  3T1H E;  2YTE A;  2YRK A;  2N3H A;  4P7A A;  1VI7 A;  1PKP A;  4JI7 E;  2FV4 B;  2EPZ A;  2YZT A;  5JEA C;  1GQE A;  3QT5 A;  3LPS A;  2V89 A;  1PVG A;  2YSP A;  1N34 E;  1IMU A;  2JY9 A;  1Z0V A;  5LMU E;  2EOR A;  1TN9 A;  1XXE A;  4BMJ A;  2WBU A;  2LJP A;  3GME A;  4DR5 I;  1KYQ A;  2BR2 B;  2EOS A;  2MC5 A;  4LF7 E;  2A2C A;  2YT4 A;  3ZKD A;  2YTN A;  4JV5 I;  3EPK A;  2Z5C B;  5C0X C;  4WSG A;  4LF9 E;  2EOF A;  5GMD A;  4YHH E;  4F6M A;  2EM2 A;  1B63 A;  1FI4 A;  4IZK A;  4LF4 I;  2FGG A;  2JOX A;  3EPH A;  2Q2E B;  5T6J A;  3CWV A;  3B78 A;  4KQV A;  4MYT A;  2UUB I;  5K36 F;  2J7J A;  2JPA A;  1UDN A;  2Z5B B;  3J81 Q;  4DV3 I;  2VRD A;  2CPN A;  1HR0 E;  2ENH A;  1SR9 A;  5IT9 C;  2DRP A;  1MG7 A;  1RRE A;  4HAC A;  1WJP A;  2EL5 A;  3VHT B;  4HTG A;  4MU3 A;  4F2J C;  3P06 A;  4FW3 A;  5JEA D;  4FW6 A;  1A6F A;  3PS3 A;  4DV0 I;  4DPU A;  1BKN A;  3BF2 A;  2EPO A;  4R2R A;  1FKA E;  1UBD C;  3HUL A;  4IFD A;  1ZM9 A;  3K1J A;  2GHF A;  1UHZ A;  4JI8 E;  1HNW I;  1RC7 A;  1OYR A;  1EH6 A;  1YPN A;  1X48 A;  2ODR C;  1I94 E;  2V2V A;  2E5L E;  4AM3 A;  2NN6 F;  1DQ3 A;  5FWK A;  3P3C A;  1A1G A;  2UU9 E;  4DR4 I;  4L8N A;  1ZR9 A;  2LTR A;  1YYK A;  1N3G A;  2ODR D;  2EMX A;  2YTF A;  1YZ9 A;  4WX9 A;  2DMI A;  1NZ0 A;  3LLH A;  4MYU A;  1UDO A;  2VES A;  3THO B;  2EOH A;  4IFD E;  2EOZ A;  2EM8 A;  4DV4 E;  2UXD E;  4F9A B;  1N36 E;  4X64 E;  1HNZ E;  1R6M A;  4LFA E;  1UN6 B;  3P3G A;  2V34 A;  4GZN C;  4FW4 A;  2YWQ A;  1NCS A;  1E3P A;  2YTP A;  4DV1 I;  5K36 C;  1IQS A;  4X65 E;  1AAY A;  5KL3 A;  2RPC A;  5AC4 A;  4USK A;  4DR2 E;  1G2D C;  3HTX A;  4Q35 B;  4UTG A;  1B69 A;  1J5E E;  1A1I A;  1MX0 A;  4GKJ E;  1Z0G A;  1PJS A;  4HY1 A;  5AE2 A;  4L5N C;  3J7Y p;  2YRH A;  2M9A A;  2V2Q A;  4OOG C;  2UXB I;  2JEB B;  4NHR A;  1MGT A;  4R2Q A;  2A25 A;  2GO4 A;  2EN3 A;  1NHJ A;  2PO1 B;  3J80 Q;  2Z5B A;  1XHK A;  1HK7 A;  1T4L B;  2YSO A;  2VF3 A;  4BA2 A;  3M7N D;  4DV5 I;  1UIL A;  2L2N A;  1YYW A;  4OKG A;  5C0X D;  2R3V A;  3T1Y I;  2ENC A;  1UDQ A;  4FN5 A;  4FWG A;  5A6K A;  1KJK A;  2EN7 A;  1YFH A;  5A2Q C;  1USV A;  2MDG A;  3DJW A;  2BR2 A;  4IFD D;  2NUE A;  5ADZ A;  4OX9 E;  2EPM X;  4RHB B;  1FNM A;  2J7K A;  2EZ6 A;  4GQU A;  5AAS A;  2DB2 A;  1N32 I;  2O1T A;  3CDI A;  2RSM A;  4JYA E;  4JI3 E;  3QT6 A;  4R2E A;  2ZIT A;  1BBG A;  4IZJ A;  2EPC A;  2EPA A;  4DR6 E;  1J5E I;  2PO2 A;  2EMZ A;  4GKK I;  5IWA E;  5ELW A;  1HR0 I;  4R8O A;  2EPU A;  2JOB A;  1XMQ I;  1RMD A;  5IXM B;  1A1H A;  5KL7 A;  4JV5 E;  1YHC A;  2EPP A;  4YY3 E;  5K36 E;  2EOJ A;  2B7T A;  4LCF A;  1XMO E;  3IWC A;  5LL6 R;  5LMN E;  1E3H A;  1TF6 A;  1YUJ A;  1Y4S A;  3QT7 A;  4LF6 I;  1USU A;  2EMF A;  5C0X E;  4WUB A;  2EOM A;  4LPF A;  4JI1 E;  2YU8 A;  4OO1 F;  4F9B B;  2NPF A;  3JAM Q;  3HKM A;  2K4V A;  3GCM A;  2F8B A;  4WSP A;  3J80 C;  5BR8 I;  4R2C A;  3EQ1 A;  2DGC A;  4I8O A;  2EMC A;  1OJ4 A;  2LTS A;  5A6B A;  4DR5 E;  2RS7 A;  5F3W A;  2EQ1 A;  4BC7 A;  1ZM3 A;  3B4T A;  2NA2 A;  4JI1 I;  2LVH A;  4DV6 I;  3P1X A;  2ADR A;  4Z7C A;  1N0V C;  4JI0 I;  5C0X B;  1Z5B A;  3BBG A;  4AQY E;  1P42 A;  2C39 B;  4NBQ A;  3PYE A;  4DR1 I;  5K36 A;  5JEA A;  2NUF A;  4TUG A;  3T1Y E;  4EMD A;  4IS9 A;  2UUB E;  4KHP I;  3PYF A;  4OO1 D;  4BBY A;  4F6N A;  5AE3 A;  3P76 A;  4LCH A;  4IFD F;  2OI2 A;  4DR6 I;  3MSW A;  4DPW A;  4X9J A;  2EOQ A;  4LF9 I;  2LJH A;  5AE1 A;  1ZBT A;  4GEQ B;  4OO1 C;  3JTZ A;  4BS9 A;  2BBG A;  4BA2 B;  2GLI A;  4OO1 A;  2WBS A;  2EPR A;  2EOI A;  5EL9 A;  4DUY E;  1Y5Y A;  1J26 A;  4BA1 B;  4B3R I;  3OML A;  1YH8 A;  1IBL E;  1IBM E;  1HNZ I;  5KL4 A;  3M7N G;  2HK3 A;  4LCG A;  1Z59 A;  1OYP A;  4IFD B;  4JI3 I;  2LJU A;  1O0W A;  2AE8 A;  4K0K I;  4LFC I;  3J7A M;  2CTD A;  3HJC A;  4X65 I;  4DMI A;  1MU5 A;  1KKH A;  2O1V A;  4HAC B;  1N33 I;  1P47 A;  2V8P A;  3TQM A;  4JI0 E;  3IWD A;  2HK2 A;  2NN6 E;  4X66 I;  1XMO I;  1H72 C;  1N36 I;  2LUP B;  1A1L A;  2Q8U A;  4M30 A;  2JP9 A;  1RR9 A;  2HFU A;  2UXB E;  4BHC A;  2CZ9 A;  3F0N A;  2XEX A;  4B3T I;  1Y4U A;  2MKD A;  4BHB A;  5A6A A;  3OTO E;  1TF3 A;  2NUG A;  2UUA E;  2LE2 A;  3C4T A;  3NZK A;  2V88 A;  4OX9 I;  4MU1 A;  4DXL A;  4NXN E;  1ELO A;  1Y6Z A;  3C4B A;  2NN6 B;  5A69 A;  2YTJ A;  1DI2 A;  1DAR A;  4YHH I;  4JI2 I;  2E1R A;  2L2K B;  2YPN A;  3WU3 A;  1I94 I;  4WUD A;  4JI4 E;  2GS8 A;  1XNR E;  2JE6 A;  5JEA B;  2WP8 B;  4IZJ D;  2C39 A;  3B8H A;  4DV1 E;  3EPL A;  1QNT A;  2F4V I;  1G2F C;  4HEI A;  2CT1 A;  2DIX A;  4MDT A;  2BM1 A;  2R76 A;  4M2Z A;  4NZV A;  2L8T A;  2B7V A;  1L4S A;  3THN A;  1IBL I;  3UK3 C;  4JI6 E;  2EFG A;  3IWB A;  5LMU I;  1WHN A;  2ELZ A;  2V85 A;  2JYA A;  4B3M I;  4MQY A;  3DD6 A;  2L6M A;  5LMN I;  5IV8 B;  2IOQ A;  2HJJ A;  5JEA E;  4LF7 I;  1PJT A;  2BB8 A;  1EH7 A;  4R2P A;  1HNX I;  3GON A;  2HHH I;  2BA1 D;  5TSE A;  4IFD C;  2DLQ A;  4B3S E;  3LTO A;  1PDA A;  2LV2 A;  3LNU A;  2VQF I;  2EM6 A;  4MLQ A;  1T39 A;  2UXC E;  2VE7 C;  5EKW A;  2E72 A;  5DNL A;  2BA0 D;  4R03 A;  4DV2 E;  1X49 A;  1RQ0 A;  3ADL A;  1Z0B A;  1HNX E;  4N3O A;  2EPN A;  1A1K A;  3C6M A;  1JK1 A;  4K0K E;  3WU5 A;  2KOU A;  1RHY A;  4KWY A;  2EWL A;  1T38 A;  2PO2 B;  3HQ1 A;  2VQF E;  2RQL A;  3M85 D;  1HNW E;  1H7S A;  5FLX Q;  4DV7 I;  4WPY A;  3U1Y A;  1AH5 A;  4M1K A;  4DUY I;  3WU6 A;  2YTO A;  1B62 A;  1A1J A;  4X66 E;  4WXC A;  2EPL X;  1KVK A;  4P7D A;  2EMB A;  1FWK A;  3JAM C;  2EOO A;  2LBS B;  2EMH A;  1WXR A;  4DUZ E;  1ZU1 A;  3M99 B;  2YU5 A;  3MHH C;  1ZAA C;  1EI1 A;  2GO3 A;  2EML A;  2PNZ A;  4NXN I;  2X36 A;  3BID A;  3Q6M A;  2R1F A;  3AV0 A;  4FW7 A;  2NAB A;  2PO0 A;  1X5W A;  4DR1 E;  3ZM7 A;  1XMQ E;  4RPF A;  1FJG E;  2HKE A;  4JI5 I;  3HPS A;  3MHS C;  2EN6 A;  2NN6 D;  4N4R B;  2LO3 A;  2UXC I;  2JR1 A;  2PO1 A;  1YUI A;  2JXP A;  4MU4 A;  4LF5 I;  1NHI A;  2R42 A;  4X64 I;  4JI8 I;  3ZZT A;  4ED4 A;  3Q1Q A;  4OZE A;  3F6G A;  2JEB A;  4OO1 E;  2BA0 G;  3DF6 A; 
#chains in the Genus database with same CATH homology
 1Z0E A;  1Z5A A;  5BR8 E;  4PU9 A;  1QU6 A;  4B3M E;  3ADG A;  2A2D A;  3V2U C;  4LFB E;  4ZVI A;  2M7Q A;  1IBK E;  1XNQ E;  2GQ0 A;  4F9C B;  4DV6 E;  4KHP E;  2B9D A;  1N34 I;  3RMP A;  4BC9 A;  4TUI A;  2ZM6 E;  1EKZ A;  3HPZ A;  2F4V E;  3VYX A;  1X47 A;  3J7A G;  2UUC I;  3D4J A;  4URL A;  1YYO A;  2V87 A;  4LU9 A;  1Z0C A;  3VK6 A;  2VQE E;  2JWO A;  2Z5C A;  2M1S A;  3ZKB A;  4DR3 E;  3H09 A;  4X62 I;  4JI7 I;  1ZXN A;  4B3T E;  2BV3 A;  4DV5 E;  3LML A;  4AQY I;  4WYQ B;  4JI2 E;  4HYM A;  3H4L A;  4B3R E;  2V8Q B;  4X8W A;  4DR7 E;  2DEI A;  3FIG A;  2HHH E;  2JVA A;  3B82 A;  3ZZ0 A;  4LFC E;  2WZO A;  1S4E A;  5A2Q Q;  2LMZ A;  2V83 A;  2PNM A;  3JU0 A;  2M4I A;  4KZS A;  3ZZU A;  4WFT A;  4LF8 I;  2L3C A;  2LUQ A;  1K47 A;  4IZK B;  4Q28 A;  4DV7 E;  1N0U A;  4NXM E;  3PYD A;  2V86 A;  2G7H A;  3AUZ A;  4DPY A;  1NHH A;  4DV4 I;  2FTX B;  2ZBK B;  4IZJ B;  2H36 X;  4Z7Y A;  4JYA I;  4LF8 E;  2MDR A;  1N32 E;  4F54 A;  1QZR A;  4JI4 I;  1EA6 A;  4FWD A;  1T4O A;  4DPT A;  1S16 A;  4DKK A;  3K6Q A;  2O1W A;  4PRV A;  4DPX A;  2MC6 A;  4LF4 E;  4DR2 I;  1ZXM A;  2UUA I;  2DEJ A;  3OTO I;  1FJG I;  3M6A A;  2VF1 A;  4PRX A;  4DU7 A;  2L3J A;  4X62 E;  2X7I A;  4LF5 E;  2V2Z A;  1H73 A;  4LFA I;  1WHQ A;  2HFS A;  2IOP A;  2E1M A;  4B3S I;  4LTY A;  2WW4 A;  2L2M A;  2ZM6 I;  2RTX A;  3ZOQ B;  4P78 A;  1STU A;  1H74 A;  2BM0 A;  2O1U A;  4DR7 I;  3HXL A;  3T1H I;  2VQE I;  4JI6 I;  4DU8 A;  4NXM I;  2UU9 I;  2B3T B;  1UEK A;  2E5L I;  2RS6 A;  5L3J A;  1FWL A;  1U2R A;  1ZM4 A;  4DV0 E;  4R1F A;  1PIE A;  3ADI A;  1WUU A;  3QT8 A;  4DV2 I;  4LF6 E;  4LFB I;  5IT9 Q;  1N33 E;  3J81 C;  4J8Z A;  1D6T A;  1VIS A;  1T4N A;  2UUC E;  1KIJ A;  5IWA I;  3KWR A;  5DNY A;  2HKJ A;  1Z0T A;  3PRY A;  4GKJ I;  3Q6N A;  2KHX A;  1ZM2 A;  3VYY A;  4USM A;  4I3H A;  2PNL A;  2UXD I;  2AJ4 A;  4DV3 E;  1Z0W A;  4DR3 I;  3ADJ A;  5CFF E;  3PYG A;  1XNR I;  3F6H A;  1H7U A;  4UT4 A;  2IHR 1;  2L33 A;  2KON A;  2L92 A;  5FLX C;  1IBK I;  1XNQ I;  4HXZ A;  1Z5C A;  4JI5 E;  2CG9 A;  1GZ6 A;  4FWH A;  4XTJ A;  4YY3 I;  3WU4 A;  2LRS A;  4P52 A;  2N3G A;  2Z5E A;  5GME A;  2CGE A;  4GKK E;  4M0V A;  4BCA A;  4DR4 E;  3V5R A;  1KTV A;  3K85 A;  2DSY A;  4DUZ I;  4JG4 A;  3K17 A;  1ZBQ A;  2DMY A;  3T1H E;  4P7A A;  2N3H A;  1PKP A;  4JI7 E;  2FV4 B;  2YZT A;  1GQE A;  3QT5 A;  3LPS A;  2V89 A;  1PVG A;  1N34 E;  1Z0V A;  2JY9 A;  5LMU E;  4BMJ A;  2LJP A;  4DR5 I;  2MC5 A;  4LF7 E;  2A2C A;  2YT4 A;  3ZKD A;  4JV5 I;  2Z5C B;  4LF9 E;  5GMD A;  4YHH E;  4IZK A;  1B63 A;  1FI4 A;  4LF4 I;  2FGG A;  2JOX A;  2Q2E B;  5T6J A;  3CWV A;  3B78 A;  4KQV A;  4MYT A;  2UUB I;  2Z5B B;  3J81 Q;  4DV3 I;  1HR0 E;  1RRE A;  2CPN A;  1SR9 A;  5IT9 C;  4HAC A;  1MG7 A;  3P06 A;  1A6F A;  4DV0 I;  4DPU A;  1BKN A;  1FKA E;  3HUL A;  1ZM9 A;  3K1J A;  1UHZ A;  4JI8 E;  1RC7 A;  2ODR C;  1I94 E;  1X48 A;  2V2V A;  2E5L E;  1DQ3 A;  5FWK A;  4DR4 I;  2UU9 E;  4L8N A;  2LTR A;  1YYK A;  2ODR D;  1YZ9 A;  1NZ0 A;  3LLH A;  4MYU A;  4DV4 E;  2UXD E;  4F9A B;  1N36 E;  4X64 E;  1HNZ E;  4LFA E;  2V34 A;  4DV1 I;  4X65 E;  4USK A;  4DR2 E;  3HTX A;  4UTG A;  1J5E E;  1MX0 A;  4GKJ E;  1Z0G A;  4HY1 A;  5AE2 A;  4L5N C;  3J7Y p;  2V2Q A;  4OOG C;  2UXB I;  1NHJ A;  3J80 Q;  2Z5B A;  1XHK A;  1HK7 A;  1T4L B;  2VF3 A;  4DV5 I;  1UIL A;  2L2N A;  1YYW A;  2R3V A;  3T1Y I;  4FN5 A;  4FWG A;  5A2Q C;  1USV A;  3DJW A;  2NUE A;  5ADZ A;  4OX9 E;  1FNM A;  2J7K A;  2EZ6 A;  5AAS A;  2DB2 A;  1N32 I;  2O1T A;  2RSM A;  4JYA E;  4JI3 E;  3QT6 A;  2ZIT A;  4IZJ A;  1J5E I;  4DR6 E;  4GKK I;  5IWA E;  1HR0 I;  4R8O A;  2JOB A;  1XMQ I;  4JV5 E;  4YY3 E;  2B7T A;  1XMO E;  3IWC A;  5LL6 R;  5LMN E;  1Y4S A;  3QT7 A;  4LF6 I;  1USU A;  4WUB A;  4JI1 E;  4F9B B;  2NPF A;  3JAM Q;  2K4V A;  2F8B A;  4WSP A;  3J80 C;  5BR8 I;  4I8O A;  1OJ4 A;  2LTS A;  4DR5 E;  2RS7 A;  5F3W A;  1ZM3 A;  4BC7 A;  4JI1 I;  2NA2 A;  4DV6 I;  3P1X A;  4Z7C A;  1N0V C;  4JI0 I;  1Z5B A;  4AQY E;  3PYE A;  4DR1 I;  2NUF A;  4TUG A;  3T1Y E;  4EMD A;  2UUB E;  4KHP I;  3PYF A;  4BBY A;  5AE3 A;  2OI2 A;  4DR6 I;  3MSW A;  4DPW A;  4LF9 I;  2LJH A;  5AE1 A;  1ZBT A;  4GEQ B;  3JTZ A;  4BS9 A;  4DUY E;  1J26 A;  4B3R I;  3OML A;  1IBL E;  1IBM E;  1HNZ I;  2HK3 A;  1Z59 A;  4JI3 I;  1O0W A;  4K0K I;  4LFC I;  3J7A M;  3HJC A;  4X65 I;  4DMI A;  1MU5 A;  1KKH A;  2O1V A;  4HAC B;  1N33 I;  2V8P A;  4JI0 E;  3IWD A;  2HK2 A;  4X66 I;  1XMO I;  1N36 I;  1H72 C;  2LUP B;  4M30 A;  1RR9 A;  2HFU A;  2UXB E;  3F0N A;  2CZ9 A;  2XEX A;  4B3T I;  1Y4U A;  3OTO E;  2NUG A;  2UUA E;  2LE2 A;  3C4T A;  2V88 A;  4OX9 I;  4DXL A;  1Y6Z A;  4NXN E;  1ELO A;  3C4B A;  4JI2 I;  1DI2 A;  1DAR A;  4YHH I;  2E1R A;  2L2K B;  3WU3 A;  1I94 I;  4WUD A;  4JI4 E;  2GS8 A;  1XNR E;  4IZJ D;  3B8H A;  4DV1 E;  2F4V I;  2DIX A;  2BM1 A;  4M2Z A;  1IBL I;  1IBM I;  2L8T A;  2B7V A;  4JI6 E;  2EFG A;  5LMU I;  3IWB A;  1WHN A;  2V85 A;  4B3M I;  5LMN I;  2L6M A;  2IOQ A;  4LF7 I;  1HNX I;  3GON A;  2HHH I;  4B3S E;  3LTO A;  3LNU A;  2VQF I;  2UXC E;  2VE7 C;  4R03 A;  4DV2 E;  1X49 A;  1RQ0 A;  3ADL A;  1Z0B A;  1HNX E;  4N3O A;  4K0K E;  3WU5 A;  2KOU A;  2EWL A;  3HQ1 A;  2VQF E;  1HNW E;  1H7S A;  5FLX Q;  4DV7 I;  4WPY A;  4M1K A;  4DUY I;  3WU6 A;  1B62 A;  4X66 E;  1KVK A;  4P7D A;  1FWK A;  3JAM C;  2LBS B;  4FW9 A;  1WXR A;  4WUC A;  4DUZ E;  1HNW I;  1EI1 A;  4NXN I;  2X36 A;  3Q6M A;  3AV0 A;  4DR1 E;  3ZM7 A;  1XMQ E;  4RPF A;  1FJG E;  2HKE A;  4JI5 I;  3HPS A;  2UXC I;  2JR1 A;  4LF5 I;  1NHI A;  2R42 A;  4X64 I;  4JI8 I;  3ZZT A;  4ED4 A;  3Q1Q A;  3F6G A;  3DF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...