4LFAE

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 33
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lfaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfaE02
3Q1QA 3QT5A 2VQFE 3CWVA 1QZRA 4KHPI 1HNXI 1FJGI 4LFAI 3ADGA 1A6FA 4RPFA 3P1XA 3D4JA 2KHXA 4PU9A 1Z0EA 1Z59A 4KHPE 1HNXE 1FJGE 2OI2A 4LFAE 5GMDA 4OOGC 2BM0A 1PVGA 2R42A 1RC7A 3WU3A 1STUA 1Z0BA 4DR1I 4DR6I 1H7SA 4WUCA 4XTJA 1HR0I 1IBLI 2X36A 2UUAI 4ED4A 4DR1E 4DR6E 1D6TA 2NA2A 4MYTA 4PRXA 1HR0E 2ZITA 4DU7A 2HKJA 1IBLE 1J5EI 4P7AA 2UUAE 4JV5I 5FLXQ 1N0VC 1N34I 4HXZA 1J5EE 2CZ9A 4JV5E 4M30A 4B3SI 1N34E 4WYQB 4FN5A 3LLHA 4LF9I 4KQVA 3J7AG 2GS8A 1KTVA 4B3SE 2HFSA 4LFCE 4LF9E 1HNZI 4GKKI 2R3VA 1I94I 4X66I 4JI3I 3T1YE 1HNZE 1EA6A 4GKKE 4DV1I 1WHQA 1WHNA 1I94E 4Z7YA 1H7UA 4X66E 4JI3E 1XNRI 1EI1A 2B7TA 1K47A 4DV7I 3PYDA 5LMUI 4DV1E 4LFBI 4WUBA 5A2QC 4M2ZA 1Z0TA 4DV3I 1XNRE 4JI8I 2BM1A 4X62I 3J81C 3K17A 4DV7E 2MDRA 4LFBE 2UUBI 4DV3E 2Q2EB 4JI8E 4B3RI 4X62E 4OX9I 2V2VA 4DV5I 1O0WA 2CPNA 4USMA 2UUBE 1OJ4A 1IBKI 2UXBI 1N32I 4UTGA 1BKNA 1Z0CA 2LRSA 4B3RE 1X48A 2V2QA 4OX9E 4DV5E 4DPTA 4GKJI 4DV6I 3V2UC 1IBKE 1DI2A 2UXBE 4FW9A 1T4LB 4LF8I 4GKJE 4DV6E 4JYAI 1KIJA 4URLA 4JI6I 3B78A 4I3HA 3OTOI 3PYFA 2L3CA 4LF6I 2VQEI 4LF8E 4JYAE 4FWDA 4WFTA 1X47A 1YZ9A 3OTOE 4UT4A 4X8WA 4LF6E 2VQEE 1YYOA 4B3TI 1YYWA 1J26A 1Z5BA 3LTOA 5LMNI 4LF4I 4P52A 2E5LI 4MYUA 4B3TE 1MU5A 4HYMA 1Z0VA 3VYXA 3B82A 2YT4A 1FNMA 5LMNE 3LPSA 5A2QQ 2B3TB 1HNWI 4LF4E 1H74A 3C4BA 2E5LE 3J81Q 2AJ4A 1MX0A 1N0UA 4LF7I 4JI0I 2NPFA 1WUUA 1N33I 2XEXA 2UXDI 4DPWA 4YY3I 2DB2A 2N3GA 3WU6A 2DMYA 2ZBKB 2HK2A 4LF7E 2UXCI 4JI0E 5IWAI 2LJHA 1N33E 4HACA 1XMOI 2UXDE 4YY3E 3JAMQ 1Z0GA 2L2MA 5LL6R 1XMQI 1ELOA 2B7VA 2LTRA 2UXCE 4X65I 2N3HA 1H73A 2VF3A 3HULA 5IWAE 4JI1I 2LUPB 1XMOE 3ZZ0A 2RS7A 1UEKA 1XMQE 1FI4A 1ZM9A 2LBSB 4AQYI 5IT9C 4X65E 1PIEA 4K0KI 2HHHI 4DKKA 1X49A 4NXNI 1PKPA 2UUCI 4DXLA 4AQYE 2LTSA 4B3MI 3VYYA 4R1FA 4K0KE 1VISA 1ZM2A 1B62A 2HHHE 1S4EA 1XNQI 5LMUE 3PYGA 4NXNE 4M1KA 4USKA 2UUCE 1U2RA 2NUFA 1KVKA 1FKAE 1H72C 4DPYA 4B3ME 3T1HI 1QU6A 4DR3I 3M6AA 4JI4I 1XNQE 3J7AM 2RTXA 3J80C 1UILA 1ZM3A 3QT7A 1RQ0A 2L2NA 3T1HE 4DR3E 1RREA 3ZZTA 3QT6A 4JI4E 3PYEA 2RS6A 4JI5I 1YYKA 1N32E 1ZM4A 2BV3A 3ZZUA 1ZBTA 3ZKDA 4JI5E 5GMEA 4DPXA 2V8PA 2JVAA 4JI6E 4NXMI 1T4NA 2LUQA 1NZ0A 2F4VI 1Z0WA 4DU8A 3J7Yp 4DR2I 4YHHI 4NXME 2F4VE 1FWKA 2DIXA 1KKHA 4DR5I 5IT9Q 3ZM7A 4DR2E 2X7IA 1IBMI 4FWGA 3ADIA 2UU9I 4JI7I 4YHHE 1RR9A 4DUYI 4DUZI 4DR5E 1XHKA 3WU4A 4JI2I 1IBME 2V2ZA 2V34A 2UU9E 4JI7E 1ZXMA 4DUYE 4DUZE 2JY9A 1HNWE 3GONA 2IHR1 1UHZA 2RSMA 2EZ6A 4JI2E 3QT8A 2HKEA 1MG7A 1GQEA 1NHHA 3J80Q 2L33A 2L3JA 1EKZA 2HK3A 4HY1A 3ADLA 1Z5CA 4DR7I 5CFFE 4Z7CA 1ZXNA 4DR4I 2WW4A 4LFCI 1Z5AA 2NUGA 4DR7E 4HACB 4JI1E 4DR4E 3T1YI 2NUEA 1T4OA 4DV0I 1NHIA 1NHJA 3C4TA 5L3JA 4FWHA 1FWLA 3H4LA 3K1JA 4DPUA 4DV0E 3ZKBA 2LJPA 4JG4A 1DARA 3HTXA 4X64I 4PRVA 1B63A 5BR8I 4ZVIA 2E1RA 4LF5I 2A2DA 3WU5A 1N36I 4X64E 2A2CA 5BR8E 4DV2I 4LF5E 5FLXC 2DEJA 1N36E 4DV4I 4WUDA 2HFUA 3ADJA 3F0NA 2ZM6I 3LNUA 3B8HA 4DV2E 1S16A 2L2KB 4DV4E 4EMDA 2ZM6E 2DEIA 2EFGA 2J7KA 3V5RA 2VQFI 3JAMC
chains in the Genus database with same CATH superfamily
4O4KA 1IQSA 4FK5C 4R2SA 2EOHA 2BA0D 4F9AB 2WBUA 2JEBA 3Q1QA 3QT5A 1UBDC 1USVA 2NN6E 4R2DA 2V8QB 2VQFE 1YH8A 3CWVA 1QZRA 4LCFA 4P7DA 1WJPA 4KHPI 1HNXI 1FJGI 4LFAI 2FV4B 3ADGA 1A6FA 4RPFA 2NN6F 3P1XA 3D4JA 2K4VA 4IFDC 5C0XA 4Q35B 2MKNA 2KHXA 4PU9A 2BR2B 2G7HA 2C39B 5A69A 1BBOA 1Z0EA 1Z59A 2VF1A 4KHPE 1G2FC 1YUIA 1YHCA 1HNXE 1FJGE 1E3HA 2EN8A 4LFAE 2OI2A 4ISAA 1ZR9A 5GMDA 4AM3A 2MKDA 4BC7A 4OOGC 5AASA 2BBGA 3EQ1A 1R6MA 2BM0A 1PVGA 2R42A 1RC7A 3L00A 1STUA 1X6HA 2EL4A 1F2IG 3WU3A 1Z0BA 4DR1I 4DR6I 1H7SA 4O43A 5KL4A 2ENAA 2GLIA 4WUCA 4X9JA 2JWOA 5ADZA 4XTJA 5C0XB 1HR0I 2V83A 1NEIA 4RH8A 5JEAF 2AE8A 1OYPA 1IBLI 4HTGA 2PO0B 1UDSA 2X36A 2Z5CA 4O24A 2CVEA 5F3WA 3GLLA 2UUAI 5DRQA 4ED4A 4DR1E 1WRJA 2GPIA 1TF6A 4DR6E 1HK7A 3M85D 1D6TA 2R76A 2NA2A 4MYTA 5K36B 4PRXA 1Z1BA 2ELZA 5IXMB 1HR0E 2ZITA 4DU7A 3QT7A 2HKJA 2EOIA 1IBLE 4MU4A 2EMIA 3THOB 3TQMA 4LCHA 1J5EI 3B4TA 4ZYDA 4P78A 3M7ND 4P7AA 2UUAE 2EOEA 2DLKA 2LJUA 4JV5I 4NBQA 2L92A 3EPLA 5FLXQ 1N0VC 1N34I 4HXZA 3HPSA 1J5EE 2VE7C 2Z5CB 5KL2A 4DMIA 2CZ9A 2EPCA 5A6JA 3U1KA 2MDGA 2CSHA 3M7NG 4JV5E 3Q6NA 4LU9A 2EPMX 4M30A 2EN1A 1YFHA 4B3SI 1N34E 1UDNA 3F6HA 3P06A 4WYQB 4FN5A 4MU0A 3LLHA 4LF9I 4KQVA 3FIGA 1MGTA 2E72A 2NN6A 3J7AG 2VRDA 5KL5A 2GS8A 3ZOQB 1KJKA 4R2EA 2YTDA 1KTVA 2M4IA 4B3SE 4M0VA 2HFSA 4BA2A 4LFCE 2L6MA 1A1FA 4LF9E 1HNZI 4ZYHA 4GKKI 1BBGA 1A1GA 1Y4UA 2JE6A 2R3VA 1I94I 4X66I 4JI3I 3GMEA 4IZJA 3T1YE 4OO1D 4ZYEA 2YTNA 1HNZE 1IQOA 1EA6A 4GKKE 3BGHA 4N3OA 4DV1I 5K36C 1WHQA 1WHNA 1I94E 4Z7YA 1H7UA 4X66E 4JI3E 2YTFA 4ZYGA 4BCAA 1XNRI 1EI1A 2B7TA 4BA2B 2EOZA 4F2JC 1K47A 2LO3A 2IERA 4DV7I 3PYDA 4KWYA 5LMUI 2JE6B 2EOFA 4DV1E 4LFBI 4OO1E 4WUBA 5A2QC 2IOQA 4M2ZA 2CTDA 1Z0TA 1XNRE 4DV3I 4JI8I 1KYQA 2BM1A 4X62I 3HPZA 3J81C 1VI7A 2PRTA 2RQLA 2EPKX 3K17A 4DV7E 2MDRA 4OO1F 3C6MA 4LFBE 3H1CA 2UUBI 1GZ6A 4BS9A 4DV3E 4GZNC 2Q2EB 4OZEA 4JI8E 5KL6A 4B3RI 4X62E 2R1FA 3BF2A 2H36X 4IZKA 4OX9I 1UN6B 2V2VA 4DV5I 2EL6A 1O0WA 2CPNA 4USMA 2UUBE 1OJ4A 2VESA 1IBKI 1ZBQA 2J7JA 2UXBI 1N32I 4UTGA 1BKNA 1Z0CA 2LRSA 4B3RE 1X48A 2V2QA 4Q28A 4OX9E 4DV5E 4DPTA 2EMAA 1A1IA 4GKJI 2IESA 4FW3A 4DV6I 1OYRA 3P3CA 3NZKA 2EMCA 2DRPA 3V2UC 4IZJD 2EPNA 4J3DA 1IBKE 2EN3A 1DI2A 2UXBE 1UDOA 2PNLA 2CGEA 2WNRA 4FW9A 5EKWA 4IZKB 4MLQA 1T4LB 4LF8I 4GKJE 2EQ0A 3K6QA 4DV6E 2LT7A 2YTQA 3JTZA 5JEAD 4JYAI 1KIJA 4URLA 2CT1A 2EPUA 2KONA 2BA0G 3B78A 4I3HA 3OTOI 4JI6I 2EMZA 2EM6A 5IV8B 1BB8A 3PYFA 4IFDD 2L3CA 4LF6I 4BBYA 4O5GA 4LF8E 2GO3A 2VQEI 4X65I 1T39A 1L4SA 2F8BA 2EMLA 4JYAE 2JEBB 4FWDA 4LCGA 4WFTA 1X47A 3UK3C 2WNRB 3VHTB 1YZ9A 3OTOE 5JEAE 4UT4A 2EOSA 4IS9A 2WBTA 2YRMA 4X8WA 1PJTA 3RMPA 5DNLA 4LF6E 5KL3A 2VQEE 4LPFA 2ODRC 4U3BA 1YYOA 2EOMA 4B3TI 1SFEA 2EM3A 1YYWA 3PS1A 4WXCA 2EPPA 4F9BB 2EJ4A 1J26A 4OO1A 1N3GA 3EPKA 1Z5BA 3LTOA 5LMNI 2EE8A 4IFDF 4LF4I 1P47A 1Y4SA 4P52A 3JU0A 2EMFA 3PRYA 4OKGA 2E5LI 4MYUA 2YRKA 4B3TE 1MU5A 3H09A 4R2PA 2LVHA 4NZVA 4HYMA 2F1DA 1Z0VA 3VYXA 3B82A 2O1WA 2YT4A 1FNMA 5LMNE 4TUGA 1E3PA 3LPSA 2B3TB 5A2QQ 1HNWI 4LF4E 1H74A 2ELYA 1EH8A 3C4BA 2DLQA 2E5LE 3J81Q 3M85G 2AJ4A 1P42A 5AE2A 2EPOA 4OO1B 3OMLA 1MX0A 1N0UA 1ZAAC 4LF7I 4JI0I 2NPFA 1WUUA 5ELWA 3DF6A 1N33I 2XEXA 2UXDI 4U3DA 1A1KA 4DPWA 4YY3I 3AUZA 4I8OA 2JYAA 3LMLA 1A1HA 2L8TA 2LE2A 2DB2A 2N3GA 3WU6A 2DMYA 2ZBKB 2HK2A 3M99B 4LF7E 2UXCI 4JI0E 2FGGA 5IWAI 2A25A 2LJHA 2EM2A 1N33E 4HACA 2M1SA 1DGCA 2UXDE 2JT2A 1XMOI 4YY3E 2O1TA 3JAMQ 3IWCA 2RPCA 1Z0GA 2L2MA 5LL6R 3QG5C 1XMQI 4HEIA 4R2AA 4LOMA 1ELOA 3P3GA 2B7VA 2K7IA 3HJCA 5C0XC 1OYSA 2LTRA 2UXCE 1Y60A 2N3HA 1H73A 2VF3A 2LV2A 3HULA 5IWAE 2E1MA 4JI1I 3MSWA 2LUPB 2ENHA 1XMOE 3ZZ0A 5AC5A 2RS7A 2O1UA 1UDQA 1UEKA 1XMQE 1FI4A 5AE3A 3MHSC 1ZM9A 3HKMA 2NN6B 2LBSB 4AQYI 1T38A 5IT9C 2PO2A 5K36D 4X65E 1PIEA 5JEAA 1RHYA 2EORA 4R2RA 4K0KI 2GQ0A 2HHHI 3HQ1A 2MC6A 1X49A 4DKKA 4IFDA 3DJWA 4NXNI 2J65A 1PKPA 2UUCI 4DXLA 3EPJA 4AQYE 3IWBA 2PO1A 2LTSA 2YU5A 4IZJB 3VYYA 4B3MI 2C38A 4R1FA 4K0KE 1VISA 1ZM2A 5A6BD 1B62A 2EOOA 2HHHE 2YSPA 5C0XF 2EPLX 1S4EA 1XNQI 5LMUE 3PYGA 5DNYA 4NXNE 4M1KA 4USKA 2UUCE 1U2RA 3Q6MA 4BMJA 4WPYA 4FW4A 2NUFA 1A1LA 5JEAB 1KVKA 1FKAE 1H72C 4DPYA 2BB8A 2EMWA 4RHBB 1TN9A 4B3ME 1QU6A 5FWKA 4DR3I 3T1HI 3M6AA 5K36F 4JI4I 2WBSA 1XNQE 3J7AM 2DGCA 3BIDA 2ADRA 2PO1B 4F6MA 2DMIA 2EMKA 4AIMA 2EQ1A 1X3CA 2RTXA 3J80C 1RMDA 1UILA 2EP3A 1ZM3A 2YTGA 2C38B 1RQ0A 2L2NA 3T1HE 3CDJA 4DR3E 2EOQA 1R6LA 3UHMA 2YZTA 4BA1A 1RREA 4BHCA 5T6JA 1YSAC 4JI4E 1MEYC 2GO4A 3QT6A 3ZZTA 4TUIA 3PYEA 2RS6A 1DQ3A 1X6FA 4JI5I 1YYKA 2YWQA 3AV0A 5LLQA 1USUA 1N32E 2JOXA 2EM0A 2EWLA 2FTXB 2NN6C 4WX9A 3U1YA 2N8XA 1ZM4A 4F6NA 5A6KA 2BV3A 3ZZUA 1ZBTA 2EPXA 4QNKA 4WXDA 3KWRA 3ZKDA 4JI5E 5GMEA 4QNJA 5DNXA 3C6KA 2V88A 2EPZA 2JP9A 1PJQA 2BR2A 4DPXA 4WSGA 2V8PA 3F6GA 2WP8A 2JVAA 3PS3A 4JI6E 2EPRA 2YRHA 4MU3A 4NXMI 1T4NA 2JOBA 3DD6A 2LUQA 4MLVA 1NZ0A 5JEAC 2F4VI 5A6AA 1JK1A 2EMYA 1Z0WA 3K85A 4IFDE 5TSEA 2ODRD 4DU8A 3J7Yp 2O1VA 4DR2I 2EM9A 1SR9A 2EMGA 2EMBA 2EPAA 4YHHI 2EOXA 4NXME 2WCC3 2O3ZA 2EOJA 2F4VE 1FWKA 2HGHA 2PO0A 2B9DA 2DIXA 1KKHA 4DR5I 5IT9Q 2WP8B 3ZM7A 2C37A 4R03A 4DR2E 2X7IA 5DRPA 2RSIA 1IBMI 5K36A 1YPNA 4FWGA 4IJDA 4IS1C 3ADIA 2V85A 4YHHE 1RR9A 2EMXA 2LMZA 2YTIA 4DUYI 4DUZI 2UU9I 2YPNA 2V87A 2JR1A 2KOUA 4DR5E 4WSPA 1XHKA 4R2QA 2EM8A 3WU4A 2LCEA 2EM4A 4JI2I 1IBME 3CDIA 2EMHA 2V2ZA 2V34A 2UU9E 4JI7E 1AH5A 4DUYE 4DUZE 1IMUA 1ZXMA 3L7ZA 5A6BA 4BC9A 4JI7I 1WXRA 2EM5A 2JY9A 1HNWE 4BHBA 3VK6A 2IHR1 2YTJA 3GONA 2C37B 1UHZA 2RSMA 2EZ6A 4JI2E 3QT8A 3KRNA 3GCMA 3ECRA 4LTYA 4FW7A 2WZOA 2HKEA 1MG7A 1GQEA 4M9VC 1NHHA 4MDTA 2L33A 3J80Q 2L3JA 2EM7A 3KZZA 1EKZA 2V89A 1Y6ZA 2HK3A 4HY1A 3IWDA 2M9AA 2EL5A 1Y5YA 3ADLA 1Z5CA 3L7ZB 4DR7I 2IOPA 1EH7A 2EN6A 3BBGA 5CFFE 1XXEA 5AE1A 5EL9A 4Z7CA 5C0XD 1YUJA 5KL7A 1ZXNA 4R8OA 2Z5BA 4DR4I 2WW4A 2JEAA 1PJSA 4LFCI 1Z5AA 2PNMA 2NUGA 1ZU1A 1LLMC 4DR7E 1TF3A 2YU8A 2YSOA 2HJJA 4N4RB 2JPAA 4FW5A 4HACB 2V86A 4JI1E 1A1JA 4DR4E 3T1YI 2NUEA 1T4OA 2EN7A 2NABA 5C0XE 4DV0I 4GEQB 1NHIA 2MC5A 2GHFA 1G2DC 2YTPA 1NHJA 2D9HA 3C4TA 2Z5EA 5L3JA 4OO1C 2Z5BB 4FWHA 1FWLA 3H4LA 2JEAB 2EN4A 3HXLA 2ENCA 3K1JA 5K36E 4GQUA 2EOYA 4DPUA 4DV0E 4NHRA 2EN2A 3ZKBA 4R2CA 2LJPA 4JG4A 1DARA 1JK2A 3HTXA 2EQ3A 2PO2B 4X64I 1X5WA 5AC4A 5DRRA 4PRVA 1NCSA 2YTEA 1B63A 5BR8I 4J8ZA 4ZVIA 2E1RA 1QNTA 2M7QA 4LF5I 2A2DA 2CG9A 1X6EA 4IFDB 3P76A 3WU5A 1N36I 2JXPA 2I13A 3PS2A 4MQYA 4X64E 2A2CA 3MHHC 2DSYA 5BR8E 4L8NA 2BA1D 2PNZA 4DV2I 1EH6A 4LF5E 5FLXC 4F9CB 4KZSA 3P3EA 2DEJA 1N36E 5DROA 4DV4I 1AAYA 2I9IA 4WUDA 2HFUA 3ADJA 3F0NA 2ZM6I 4FW6A 2Q8UA 3EPHA 3LNUA 3B8HA 4F54A 4MU1A 4DV2E 2HC5A 3KZYA 1S16A 2L2KB 2BA1G 2NN6D 1B69A 4L5NC 4DV4E 4EMDA 2ZM6E 2YTOA 2DEIA 2EFGA 1PDAA 2J7KA 3V5RA 2PNZB 2VQFI 3THNA 4AIDA 4BA1B 3JAMC 2C39A 1GTKA
chains in the Genus database with same CATH topology
4F9AB 3Q1QA 3QT5A 1USVA 2V8QB 2VQFE 3CWVA 1QZRA 4P7DA 4KHPI 1HNXI 1FJGI 4LFAI 2FV4B 3ADGA 1A6FA 4RPFA 3P1XA 3D4JA 2K4VA 2KHXA 4PU9A 2G7HA 1Z0EA 1Z59A 2VF1A 4KHPE 1HNXE 1FJGE 2OI2A 4LFAE 5GMDA 5AASA 4BC7A 4OOGC 2BM0A 1PVGA 2R42A 1RC7A 3WU3A 1STUA 1Z0BA 4DR1I 4DR6I 1H7SA 4WUCA 2JWOA 5ADZA 4XTJA 1HR0I 2V83A 1IBLI 2X36A 2Z5CA 5F3WA 2UUAI 4ED4A 4DR1E 4DR6E 1HK7A 1D6TA 2NA2A 4MYTA 4PRXA 1HR0E 2ZITA 4DU7A 2HKJA 1IBLE 1J5EI 4P78A 4P7AA 2UUAE 4JV5I 2L92A 5FLXQ 1N0VC 1N34I 4HXZA 3HPSA 1J5EE 2VE7C 2Z5CB 4DMIA 2CZ9A 4JV5E 3Q6NA 4LU9A 4M30A 4B3SI 1N34E 3F6HA 3P06A 4WYQB 4FN5A 3LLHA 4LF9I 4KQVA 3FIGA 3J7AG 2GS8A 3ZOQB 1KTVA 2M4IA 4B3SE 4M0VA 2HFSA 4LFCE 2L6MA 4LF9E 1HNZI 4GKKI 2R3VA 1Y4UA 1I94I 4X66I 4JI3I 4IZJA 3T1YE 1HNZE 1EA6A 4GKKE 4N3OA 4DV1I 1WHQA 1WHNA 1I94E 4Z7YA 1H7UA 4X66E 4JI3E 1XNRI 4BCAA 1EI1A 2B7TA 1K47A 4DV7I 3PYDA 5LMUI 4DV1E 4LFBI 4WUBA 5A2QC 2IOQA 4M2ZA 1Z0TA 4DV3I 1XNRE 4JI8I 2BM1A 4X62I 3HPZA 3J81C 3K17A 4DV7E 2MDRA 4LFBE 2UUBI 1GZ6A 4BS9A 4DV3E 2Q2EB 4JI8E 4B3RI 4X62E 2H36X 4IZKA 4OX9I 2V2VA 4DV5I 1O0WA 2CPNA 4USMA 2UUBE 1OJ4A 1IBKI 1ZBQA 2UXBI 1N32I 4UTGA 1BKNA 1Z0CA 2LRSA 4B3RE 1X48A 2V2QA 4Q28A 4OX9E 4DV5E 4DPTA 4GKJI 4DV6I 3V2UC 4IZJD 1IBKE 1DI2A 2UXBE 2PNLA 2CGEA 4FW9A 4IZKB 1T4LB 4LF8I 4GKJE 3K6QA 4DV6E 4JYAI 3JTZA 1KIJA 4URLA 2KONA 3B78A 4I3HA 4JI6I 3OTOI 3PYFA 2L3CA 4LF6I 4BBYA 4LF8E 2VQEI 2F8BA 4JYAE 4FWDA 4WFTA 1X47A 1YZ9A 3OTOE 4UT4A 4X8WA 3RMPA 4LF6E 2VQEE 2ODRC 1YYOA 4B3TI 1YYWA 4F9BB 1J26A 1Z5BA 3LTOA 5LMNI 4LF4I 1Y4SA 4P52A 3JU0A 3PRYA 2E5LI 4MYUA 4B3TE 1MU5A 3H09A 4HYMA 1Z0VA 3VYXA 3B82A 2O1WA 2YT4A 1FNMA 5LMNE 4TUGA 3LPSA 5A2QQ 2B3TB 1HNWI 4LF4E 1H74A 3C4BA 2E5LE 3J81Q 2AJ4A 5AE2A 3OMLA 1MX0A 1N0UA 4LF7I 4JI0I 2NPFA 1WUUA 3DF6A 1N33I 2XEXA 2UXDI 4DPWA 4YY3I 3AUZA 4I8OA 3LMLA 2L8TA 2LE2A 2DB2A 2N3GA 3WU6A 2DMYA 2ZBKB 2HK2A 4LF7E 2UXCI 4JI0E 2FGGA 5IWAI 2LJHA 1N33E 4HACA 1XMOI 2M1SA 2UXDE 4YY3E 2O1TA 3JAMQ 3IWCA 1Z0GA 2L2MA 5LL6R 1XMQI 1ELOA 2B7VA 3HJCA 2LTRA 2UXCE 4X65I 2N3HA 1H73A 2VF3A 3HULA 5IWAE 2E1MA 4JI1I 3MSWA 2LUPB 1XMOE 3ZZ0A 2RS7A 2O1UA 1UEKA 1XMQE 1FI4A 5AE3A 1ZM9A 2LBSB 4AQYI 5IT9C 4X65E 1PIEA 4K0KI 2GQ0A 2HHHI 3HQ1A 2MC6A 1X49A 4DKKA 3DJWA 4NXNI 1PKPA 2UUCI 4DXLA 4AQYE 3IWBA 2LTSA 4IZJB 3VYYA 4B3MI 4R1FA 4K0KE 1VISA 1ZM2A 1B62A 2HHHE 1S4EA 1XNQI 5LMUE 3PYGA 5DNYA 4NXNE 4M1KA 4USKA 2UUCE 1U2RA 3Q6MA 4BMJA 4WPYA 2NUFA 1KVKA 1FKAE 1H72C 4DPYA 4B3ME 3T1HI 1QU6A 5FWKA 4DR3I 3M6AA 4JI4I 1XNQE 3J7AM 2RTXA 3J80C 1UILA 1ZM3A 3QT7A 1RQ0A 2L2NA 3T1HE 4DR3E 2YZTA 1RREA 3ZZTA 5T6JA 4JI4E 3QT6A 4TUIA 3PYEA 2RS6A 1DQ3A 4JI5I 1YYKA 1USUA 3AV0A 1N32E 2JOXA 2EWLA 2FTXB 1ZM4A 2BV3A 3ZZUA 1ZBTA 3KWRA 3ZKDA 4JI5E 5GMEA 2V88A 4DPXA 2V8PA 3F6GA 2JVAA 4JI6E 4NXMI 1T4NA 2JOBA 2LUQA 1NZ0A 2F4VI 3K85A 1Z0WA 2ODRD 4DU8A 3J7Yp 2O1VA 4DR2I 1SR9A 4YHHI 4NXME 2F4VE 1FWKA 2B9DA 2DIXA 1KKHA 4DR5I 5IT9Q 3ZM7A 4R03A 4DR2E 2X7IA 1IBMI 4FWGA 3ADIA 2UU9I 2V85A 4YHHE 1RR9A 4DUYI 2LMZA 4DUZI 4JI7I 2V87A 2JR1A 2KOUA 4DR5E 4WSPA 1XHKA 3WU4A 4JI2I 1IBME 2V2ZA 2V34A 2UU9E 4JI7E 1ZXMA 4DUYE 4DUZE 4BC9A 1WXRA 2JY9A 1HNWE 3GONA 3VK6A 2IHR1 1UHZA 2RSMA 2EZ6A 4JI2E 3QT8A 4LTYA 2WZOA 2HKEA 1MG7A 1GQEA 1NHHA 3J80Q 2L33A 2L3JA 1EKZA 1Y6ZA 2HK3A 2V89A 4HY1A 3IWDA 3ADLA 1Z5CA 4DR7I 2IOPA 5CFFE 5AE1A 4Z7CA 1ZXNA 4R8OA 2Z5BA 4DR4I 2WW4A 4LFCI 1Z5AA 2PNMA 2NUGA 4DR7E 4HACB 2V86A 4JI1E 4DR4E 3T1YI 2NUEA 1T4OA 4DV0I 4GEQB 1NHIA 2MC5A 1NHJA 2Z5EA 3C4TA 5L3JA 2Z5BB 4FWHA 1FWLA 3H4LA 3HXLA 3K1JA 4DPUA 4DV0E 3ZKBA 2LJPA 4JG4A 1DARA 3HTXA 4X64I 4PRVA 1B63A 5BR8I 4J8ZA 4ZVIA 2E1RA 2M7QA 4LF5I 2A2DA 2CG9A 3WU5A 1N36I 4X64E 2A2CA 2DSYA 5BR8E 4L8NA 4DV2I 4LF5E 5FLXC 4F9CB 4KZSA 2DEJA 1N36E 4DV4I 4WUDA 2HFUA 3ADJA 3F0NA 2ZM6I 3LNUA 3B8HA 4F54A 4DV2E 1S16A 2L2KB 4L5NC 4DV4E 4EMDA 2ZM6E 2DEIA 2EFGA 2J7KA 3V5RA 2VQFI 3JAMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q1Q A;  3QT5 A;  2VQF E;  3CWV A;  1QZR A;  4KHP I;  1HNX I;  1FJG I;  4LFA I;  3ADG A;  1A6F A;  4RPF A;  3P1X A;  3D4J A;  2KHX A;  4PU9 A;  1Z0E A;  1Z59 A;  4KHP E;  1HNX E;  1FJG E;  2OI2 A;  4LFA E;  5GMD A;  4OOG C;  2BM0 A;  1PVG A;  2R42 A;  1RC7 A;  3WU3 A;  1STU A;  1Z0B A;  4DR1 I;  4DR6 I;  1H7S A;  4WUC A;  4XTJ A;  1HR0 I;  1IBL I;  2X36 A;  2UUA I;  4ED4 A;  4DR1 E;  4DR6 E;  1D6T A;  2NA2 A;  4MYT A;  4PRX A;  1HR0 E;  2ZIT A;  4DU7 A;  2HKJ A;  1IBL E;  1J5E I;  4P7A A;  2UUA E;  4JV5 I;  5FLX Q;  1N0V C;  1N34 I;  4HXZ A;  1J5E E;  2CZ9 A;  4JV5 E;  4M30 A;  4B3S I;  1N34 E;  4WYQ B;  4FN5 A;  3LLH A;  4LF9 I;  4KQV A;  3J7A G;  2GS8 A;  1KTV A;  4B3S E;  2HFS A;  4LFC E;  4LF9 E;  1HNZ I;  4GKK I;  2R3V A;  1I94 I;  4X66 I;  4JI3 I;  3T1Y E;  1HNZ E;  1EA6 A;  4GKK E;  4DV1 I;  1WHQ A;  1WHN A;  1I94 E;  4Z7Y A;  1H7U A;  4X66 E;  4JI3 E;  1XNR I;  1EI1 A;  2B7T A;  1K47 A;  4DV7 I;  3PYD A;  5LMU I;  4DV1 E;  4LFB I;  4WUB A;  5A2Q C;  4M2Z A;  1Z0T A;  4DV3 I;  1XNR E;  4JI8 I;  2BM1 A;  4X62 I;  3J81 C;  3K17 A;  4DV7 E;  2MDR A;  4LFB E;  2UUB I;  4DV3 E;  2Q2E B;  4JI8 E;  4B3R I;  4X62 E;  4OX9 I;  2V2V A;  4DV5 I;  1O0W A;  2CPN A;  4USM A;  2UUB E;  1OJ4 A;  1IBK I;  2UXB I;  1N32 I;  4UTG A;  1BKN A;  1Z0C A;  2LRS A;  4B3R E;  1X48 A;  2V2Q A;  4OX9 E;  4DV5 E;  4DPT A;  4GKJ I;  4DV6 I;  3V2U C;  1IBK E;  1DI2 A;  2UXB E;  4FW9 A;  1T4L B;  4LF8 I;  4GKJ E;  4DV6 E;  4JYA I;  1KIJ A;  4URL A;  4JI6 I;  3B78 A;  4I3H A;  3OTO I;  3PYF A;  2L3C A;  4LF6 I;  2VQE I;  4LF8 E;  4JYA E;  4FWD A;  4WFT A;  1X47 A;  1YZ9 A;  3OTO E;  4UT4 A;  4X8W A;  4LF6 E;  2VQE E;  1YYO A;  4B3T I;  1YYW A;  1J26 A;  1Z5B A;  3LTO A;  5LMN I;  4LF4 I;  4P52 A;  2E5L I;  4MYU A;  4B3T E;  1MU5 A;  4HYM A;  1Z0V A;  3VYX A;  3B82 A;  2YT4 A;  1FNM A;  5LMN E;  3LPS A;  5A2Q Q;  2B3T B;  1HNW I;  4LF4 E;  1H74 A;  3C4B A;  2E5L E;  3J81 Q;  2AJ4 A;  1MX0 A;  1N0U A;  4LF7 I;  4JI0 I;  2NPF A;  1WUU A;  1N33 I;  2XEX A;  2UXD I;  4DPW A;  4YY3 I;  2DB2 A;  2N3G A;  3WU6 A;  2DMY A;  2ZBK B;  2HK2 A;  4LF7 E;  2UXC I;  4JI0 E;  5IWA I;  2LJH A;  1N33 E;  4HAC A;  1XMO I;  2UXD E;  4YY3 E;  3JAM Q;  1Z0G A;  2L2M A;  5LL6 R;  1XMQ I;  1ELO A;  2B7V A;  2LTR A;  2UXC E;  4X65 I;  2N3H A;  1H73 A;  2VF3 A;  3HUL A;  5IWA E;  4JI1 I;  2LUP B;  1XMO E;  3ZZ0 A;  2RS7 A;  1UEK A;  1XMQ E;  1FI4 A;  1ZM9 A;  2LBS B;  4AQY I;  5IT9 C;  4X65 E;  1PIE A;  4K0K I;  2HHH I;  4DKK A;  1X49 A;  4NXN I;  1PKP A;  2UUC I;  4DXL A;  4AQY E;  2LTS A;  4B3M I;  3VYY A;  4R1F A;  4K0K E;  1VIS A;  1ZM2 A;  1B62 A;  2HHH E;  1S4E A;  1XNQ I;  5LMU E;  3PYG A;  4NXN E;  4M1K A;  4USK A;  2UUC E;  1U2R A;  2NUF A;  1KVK A;  1FKA E;  1H72 C;  4DPY A;  4B3M E;  3T1H I;  1QU6 A;  4DR3 I;  3M6A A;  4JI4 I;  1XNQ E;  3J7A M;  2RTX A;  3J80 C;  1UIL A;  1ZM3 A;  3QT7 A;  1RQ0 A;  2L2N A;  3T1H E;  4DR3 E;  1RRE A;  3ZZT A;  3QT6 A;  4JI4 E;  3PYE A;  2RS6 A;  4JI5 I;  1YYK A;  1N32 E;  1ZM4 A;  2BV3 A;  3ZZU A;  1ZBT A;  3ZKD A;  4JI5 E;  5GME A;  4DPX A;  2V8P A;  2JVA A;  4JI6 E;  4NXM I;  1T4N A;  2LUQ A;  1NZ0 A;  2F4V I;  1Z0W A;  4DU8 A;  3J7Y p;  4DR2 I;  4YHH I;  4NXM E;  2F4V E;  1FWK A;  2DIX A;  1KKH A;  4DR5 I;  5IT9 Q;  3ZM7 A;  4DR2 E;  2X7I A;  1IBM I;  4FWG A;  3ADI A;  2UU9 I;  4JI7 I;  4YHH E;  1RR9 A;  4DUY I;  4DUZ I;  4DR5 E;  1XHK A;  3WU4 A;  4JI2 I;  1IBM E;  2V2Z A;  2V34 A;  2UU9 E;  4JI7 E;  1ZXM A;  4DUY E;  4DUZ E;  2JY9 A;  1HNW E;  3GON A;  2IHR 1;  1UHZ A;  2RSM A;  2EZ6 A;  4JI2 E;  3QT8 A;  2HKE A;  1MG7 A;  1GQE A;  1NHH A;  3J80 Q;  2L33 A;  2L3J A;  1EKZ A;  2HK3 A;  4HY1 A;  3ADL A;  1Z5C A;  4DR7 I;  5CFF E;  4Z7C A;  1ZXN A;  4DR4 I;  2WW4 A;  4LFC I;  1Z5A A;  2NUG A;  4DR7 E;  4HAC B;  4JI1 E;  4DR4 E;  3T1Y I;  2NUE A;  1T4O A;  4DV0 I;  1NHI A;  1NHJ A;  3C4T A;  5L3J A;  4FWH A;  1FWL A;  3H4L A;  3K1J A;  4DPU A;  4DV0 E;  3ZKB A;  2LJP A;  4JG4 A;  1DAR A;  3HTX A;  4X64 I;  4PRV A;  1B63 A;  5BR8 I;  4ZVI A;  2E1R A;  4LF5 I;  2A2D A;  3WU5 A;  1N36 I;  4X64 E;  2A2C A;  5BR8 E;  4DV2 I;  4LF5 E;  5FLX C;  2DEJ A;  1N36 E;  4DV4 I;  4WUD A;  2HFU A;  3ADJ A;  3F0N A;  2ZM6 I;  3LNU A;  3B8H A;  4DV2 E;  1S16 A;  2L2K B;  4DV4 E;  4EMD A;  2ZM6 E;  2DEI A;  2EFG A;  2J7K A;  3V5R A;  2VQF I;  3JAM C; 
#chains in the Genus database with same CATH topology
 4O4K A;  1IQS A;  4FK5 C;  4R2S A;  2EOH A;  2BA0 D;  4F9A B;  2WBU A;  2JEB A;  3Q1Q A;  3QT5 A;  1UBD C;  1USV A;  2NN6 E;  4R2D A;  2V8Q B;  2VQF E;  1YH8 A;  3CWV A;  1QZR A;  4LCF A;  4P7D A;  1WJP A;  4KHP I;  1HNX I;  1FJG I;  4LFA I;  2FV4 B;  3ADG A;  1A6F A;  4RPF A;  2NN6 F;  3P1X A;  3D4J A;  2K4V A;  4IFD C;  5C0X A;  4Q35 B;  2MKN A;  2KHX A;  4PU9 A;  2BR2 B;  2G7H A;  2C39 B;  5A69 A;  1BBO A;  1Z0E A;  1Z59 A;  2VF1 A;  4KHP E;  1G2F C;  1YUI A;  1YHC A;  1HNX E;  1FJG E;  1E3H A;  2EN8 A;  4LFA E;  2OI2 A;  4ISA A;  1ZR9 A;  5GMD A;  4AM3 A;  2MKD A;  4BC7 A;  4OOG C;  5AAS A;  2BBG A;  3EQ1 A;  1R6M A;  2BM0 A;  1PVG A;  2R42 A;  1RC7 A;  3L00 A;  1STU A;  1X6H A;  2EL4 A;  1F2I G;  3WU3 A;  1Z0B A;  4DR1 I;  4DR6 I;  1H7S A;  4O43 A;  5KL4 A;  2ENA A;  2GLI A;  4WUC A;  4X9J A;  2JWO A;  5ADZ A;  4XTJ A;  5C0X B;  1HR0 I;  2V83 A;  1NEI A;  4RH8 A;  5JEA F;  2AE8 A;  1OYP A;  1IBL I;  4HTG A;  2PO0 B;  1UDS A;  2X36 A;  2Z5C A;  4O24 A;  2CVE A;  5F3W A;  3GLL A;  2UUA I;  5DRQ A;  4ED4 A;  4DR1 E;  1WRJ A;  2GPI A;  1TF6 A;  4DR6 E;  1HK7 A;  3M85 D;  1D6T A;  2R76 A;  2NA2 A;  4MYT A;  5K36 B;  4PRX A;  1Z1B A;  2ELZ A;  5IXM B;  1HR0 E;  2ZIT A;  4DU7 A;  3QT7 A;  2HKJ A;  2EOI A;  1IBL E;  4MU4 A;  2EMI A;  3THO B;  3TQM A;  4LCH A;  1J5E I;  3B4T A;  4ZYD A;  4P78 A;  3M7N D;  4P7A A;  2UUA E;  2EOE A;  2DLK A;  2LJU A;  4JV5 I;  4NBQ A;  2L92 A;  3EPL A;  5FLX Q;  1N0V C;  1N34 I;  4HXZ A;  3HPS A;  1J5E E;  2VE7 C;  2Z5C B;  5KL2 A;  4DMI A;  2CZ9 A;  2EPC A;  5A6J A;  3U1K A;  2MDG A;  2CSH A;  3M7N G;  4JV5 E;  3Q6N A;  4LU9 A;  2EPM X;  4M30 A;  2EN1 A;  1YFH A;  4B3S I;  1N34 E;  1UDN A;  3F6H A;  3P06 A;  4WYQ B;  4FN5 A;  4MU0 A;  3LLH A;  4LF9 I;  4KQV A;  3FIG A;  1MGT A;  2E72 A;  2NN6 A;  3J7A G;  2VRD A;  5KL5 A;  2GS8 A;  3ZOQ B;  1KJK A;  4R2E A;  2YTD A;  1KTV A;  2M4I A;  4B3S E;  4M0V A;  2HFS A;  4BA2 A;  4LFC E;  2L6M A;  1A1F A;  4LF9 E;  1HNZ I;  4ZYH A;  4GKK I;  1BBG A;  1A1G A;  1Y4U A;  2JE6 A;  2R3V A;  1I94 I;  4X66 I;  4JI3 I;  3GME A;  4IZJ A;  3T1Y E;  4OO1 D;  4ZYE A;  2YTN A;  1HNZ E;  1IQO A;  1EA6 A;  4GKK E;  3BGH A;  4N3O A;  4DV1 I;  5K36 C;  1WHQ A;  1WHN A;  1I94 E;  4Z7Y A;  1H7U A;  4X66 E;  4JI3 E;  2YTF A;  4ZYG A;  4BCA A;  1XNR I;  1EI1 A;  2B7T A;  4BA2 B;  2EOZ A;  4F2J C;  1K47 A;  2LO3 A;  2IER A;  4DV7 I;  3PYD A;  4KWY A;  5LMU I;  2JE6 B;  2EOF A;  4DV1 E;  4LFB I;  4OO1 E;  4WUB A;  5A2Q C;  2IOQ A;  4M2Z A;  2CTD A;  1Z0T A;  1XNR E;  4DV3 I;  4JI8 I;  1KYQ A;  2BM1 A;  4X62 I;  3HPZ A;  3J81 C;  1VI7 A;  2PRT A;  2RQL A;  2EPK X;  3K17 A;  4DV7 E;  2MDR A;  4OO1 F;  3C6M A;  4LFB E;  3H1C A;  2UUB I;  1GZ6 A;  4BS9 A;  4DV3 E;  4GZN C;  2Q2E B;  4OZE A;  4JI8 E;  5KL6 A;  4B3R I;  4X62 E;  2R1F A;  3BF2 A;  2H36 X;  4IZK A;  4OX9 I;  1UN6 B;  2V2V A;  4DV5 I;  2EL6 A;  1O0W A;  2CPN A;  4USM A;  2UUB E;  1OJ4 A;  2VES A;  1IBK I;  1ZBQ A;  2J7J A;  2UXB I;  1N32 I;  4UTG A;  1BKN A;  1Z0C A;  2LRS A;  4B3R E;  1X48 A;  2V2Q A;  4Q28 A;  4OX9 E;  4DV5 E;  4DPT A;  2EMA A;  1A1I A;  4GKJ I;  2IES A;  4FW3 A;  4DV6 I;  1OYR A;  3P3C A;  3NZK A;  2EMC A;  2DRP A;  3V2U C;  4IZJ D;  2EPN A;  4J3D A;  1IBK E;  2EN3 A;  1DI2 A;  2UXB E;  1UDO A;  2PNL A;  2CGE A;  2WNR A;  4FW9 A;  5EKW A;  4IZK B;  4MLQ A;  1T4L B;  4LF8 I;  4GKJ E;  2EQ0 A;  3K6Q A;  4DV6 E;  2LT7 A;  2YTQ A;  3JTZ A;  5JEA D;  4JYA I;  1KIJ A;  4URL A;  2CT1 A;  2EPU A;  2KON A;  2BA0 G;  3B78 A;  4I3H A;  3OTO I;  4JI6 I;  2EMZ A;  2EM6 A;  5IV8 B;  1BB8 A;  3PYF A;  4IFD D;  2L3C A;  4LF6 I;  4BBY A;  4O5G A;  4LF8 E;  2GO3 A;  2VQE I;  4X65 I;  1T39 A;  1L4S A;  2F8B A;  2EML A;  4JYA E;  2JEB B;  4FWD A;  4LCG A;  4WFT A;  1X47 A;  3UK3 C;  2WNR B;  3VHT B;  1YZ9 A;  3OTO E;  5JEA E;  4UT4 A;  2EOS A;  4IS9 A;  2WBT A;  2YRM A;  4X8W A;  1PJT A;  3RMP A;  5DNL A;  4LF6 E;  5KL3 A;  2VQE E;  4LPF A;  2ODR C;  4U3B A;  1YYO A;  2EOM A;  4B3T I;  1SFE A;  2EM3 A;  1YYW A;  3PS1 A;  4WXC A;  2EPP A;  4F9B B;  2EJ4 A;  1J26 A;  4OO1 A;  1N3G A;  3EPK A;  1Z5B A;  3LTO A;  5LMN I;  2EE8 A;  4IFD F;  4LF4 I;  1P47 A;  1Y4S A;  4P52 A;  3JU0 A;  2EMF A;  3PRY A;  4OKG A;  2E5L I;  4MYU A;  2YRK A;  4B3T E;  1MU5 A;  3H09 A;  4R2P A;  2LVH A;  4NZV A;  4HYM A;  2F1D A;  1Z0V A;  3VYX A;  3B82 A;  2O1W A;  2YT4 A;  1FNM A;  5LMN E;  4TUG A;  1E3P A;  3LPS A;  2B3T B;  5A2Q Q;  1HNW I;  4LF4 E;  1H74 A;  2ELY A;  1EH8 A;  3C4B A;  2DLQ A;  2E5L E;  3J81 Q;  3M85 G;  2AJ4 A;  1P42 A;  5AE2 A;  2EPO A;  4OO1 B;  3OML A;  1MX0 A;  1N0U A;  1ZAA C;  4LF7 I;  4JI0 I;  2NPF A;  1WUU A;  5ELW A;  3DF6 A;  1N33 I;  2XEX A;  2UXD I;  4U3D A;  1A1K A;  4DPW A;  4YY3 I;  3AUZ A;  4I8O A;  2JYA A;  3LML A;  1A1H A;  2L8T A;  2LE2 A;  2DB2 A;  2N3G A;  3WU6 A;  2DMY A;  2ZBK B;  2HK2 A;  3M99 B;  4LF7 E;  2UXC I;  4JI0 E;  2FGG A;  5IWA I;  2A25 A;  2LJH A;  2EM2 A;  1N33 E;  4HAC A;  2M1S A;  1DGC A;  2UXD E;  2JT2 A;  1XMO I;  4YY3 E;  2O1T A;  3JAM Q;  3IWC A;  2RPC A;  1Z0G A;  2L2M A;  5LL6 R;  3QG5 C;  1XMQ I;  4HEI A;  4R2A A;  4LOM A;  1ELO A;  3P3G A;  2B7V A;  2K7I A;  3HJC A;  5C0X C;  1OYS A;  2LTR A;  2UXC E;  1Y60 A;  2N3H A;  1H73 A;  2VF3 A;  2LV2 A;  3HUL A;  5IWA E;  2E1M A;  4JI1 I;  3MSW A;  2LUP B;  2ENH A;  1XMO E;  3ZZ0 A;  5AC5 A;  2RS7 A;  2O1U A;  1UDQ A;  1UEK A;  1XMQ E;  1FI4 A;  5AE3 A;  3MHS C;  1ZM9 A;  3HKM A;  2NN6 B;  2LBS B;  4AQY I;  1T38 A;  5IT9 C;  2PO2 A;  5K36 D;  4X65 E;  1PIE A;  5JEA A;  1RHY A;  2EOR A;  4R2R A;  4K0K I;  2GQ0 A;  2HHH I;  3HQ1 A;  2MC6 A;  1X49 A;  4DKK A;  4IFD A;  3DJW A;  4NXN I;  2J65 A;  1PKP A;  2UUC I;  4DXL A;  3EPJ A;  4AQY E;  3IWB A;  2PO1 A;  2LTS A;  2YU5 A;  4IZJ B;  3VYY A;  4B3M I;  2C38 A;  4R1F A;  4K0K E;  1VIS A;  1ZM2 A;  5A6B D;  1B62 A;  2EOO A;  2HHH E;  2YSP A;  5C0X F;  2EPL X;  1S4E A;  1XNQ I;  5LMU E;  3PYG A;  5DNY A;  4NXN E;  4M1K A;  4USK A;  2UUC E;  1U2R A;  3Q6M A;  4BMJ A;  4WPY A;  4FW4 A;  2NUF A;  1A1L A;  5JEA B;  1KVK A;  1FKA E;  1H72 C;  4DPY A;  2BB8 A;  2EMW A;  4RHB B;  1TN9 A;  4B3M E;  1QU6 A;  5FWK A;  4DR3 I;  3T1H I;  3M6A A;  5K36 F;  4JI4 I;  2WBS A;  1XNQ E;  3J7A M;  2DGC A;  3BID A;  2ADR A;  2PO1 B;  4F6M A;  2DMI A;  2EMK A;  4AIM A;  2EQ1 A;  1X3C A;  2RTX A;  3J80 C;  1RMD A;  1UIL A;  2EP3 A;  1ZM3 A;  2YTG A;  2C38 B;  1RQ0 A;  2L2N A;  3T1H E;  3CDJ A;  4DR3 E;  2EOQ A;  1R6L A;  3UHM A;  2YZT A;  4BA1 A;  1RRE A;  4BHC A;  5T6J A;  1YSA C;  4JI4 E;  1MEY C;  2GO4 A;  3QT6 A;  3ZZT A;  4TUI A;  3PYE A;  2RS6 A;  1DQ3 A;  1X6F A;  4JI5 I;  1YYK A;  2YWQ A;  3AV0 A;  5LLQ A;  1USU A;  1N32 E;  2JOX A;  2EM0 A;  2EWL A;  2FTX B;  2NN6 C;  4WX9 A;  3U1Y A;  2N8X A;  1ZM4 A;  4F6N A;  5A6K A;  2BV3 A;  3ZZU A;  1ZBT A;  2EPX A;  4QNK A;  4WXD A;  3KWR A;  3ZKD A;  4JI5 E;  5GME A;  4QNJ A;  5DNX A;  3C6K A;  2V88 A;  2EPZ A;  2JP9 A;  1PJQ A;  2BR2 A;  4DPX A;  4WSG A;  2V8P A;  3F6G A;  2WP8 A;  2JVA A;  3PS3 A;  4JI6 E;  2EPR A;  2YRH A;  4MU3 A;  4NXM I;  1T4N A;  2JOB A;  3DD6 A;  2LUQ A;  4MLV A;  1NZ0 A;  5JEA C;  2F4V I;  5A6A A;  1JK1 A;  2EMY A;  1Z0W A;  3K85 A;  4IFD E;  5TSE A;  2ODR D;  4DU8 A;  3J7Y p;  2O1V A;  4DR2 I;  2EM9 A;  1SR9 A;  2EMG A;  2EMB A;  2EPA A;  4YHH I;  2EOX A;  4NXM E;  2WCC 3;  2O3Z A;  2EOJ A;  2F4V E;  1FWK A;  2HGH A;  2PO0 A;  2B9D A;  2DIX A;  1KKH A;  4DR5 I;  5IT9 Q;  2WP8 B;  3ZM7 A;  2C37 A;  4R03 A;  4DR2 E;  2X7I A;  5DRP A;  2RSI A;  1IBM I;  5K36 A;  1YPN A;  4FWG A;  4IJD A;  4IS1 C;  3ADI A;  2V85 A;  4YHH E;  1RR9 A;  2EMX A;  2LMZ A;  2YTI A;  4DUY I;  4DUZ I;  2UU9 I;  2YPN A;  2V87 A;  2JR1 A;  2KOU A;  4DR5 E;  4WSP A;  1XHK A;  4R2Q A;  2EM8 A;  3WU4 A;  2LCE A;  2EM4 A;  4JI2 I;  1IBM E;  3CDI A;  2EMH A;  2V2Z A;  2V34 A;  2UU9 E;  4JI7 E;  1AH5 A;  4DUY E;  4DUZ E;  1IMU A;  1ZXM A;  3L7Z A;  5A6B A;  4BC9 A;  4JI7 I;  1WXR A;  2EM5 A;  2JY9 A;  1HNW E;  4BHB A;  3VK6 A;  2IHR 1;  2YTJ A;  3GON A;  2C37 B;  1UHZ A;  2RSM A;  2EZ6 A;  4JI2 E;  3QT8 A;  3KRN A;  3GCM A;  3ECR A;  4LTY A;  4FW7 A;  2WZO A;  2HKE A;  1MG7 A;  1GQE A;  4M9V C;  1NHH A;  4MDT A;  2L33 A;  3J80 Q;  2L3J A;  2EM7 A;  3KZZ A;  1EKZ A;  2V89 A;  1Y6Z A;  2HK3 A;  4HY1 A;  3IWD A;  2M9A A;  2EL5 A;  1Y5Y A;  3ADL A;  1Z5C A;  3L7Z B;  4DR7 I;  2IOP A;  1EH7 A;  2EN6 A;  3BBG A;  5CFF E;  1XXE A;  5AE1 A;  5EL9 A;  4Z7C A;  5C0X D;  1YUJ A;  5KL7 A;  1ZXN A;  4R8O A;  2Z5B A;  4DR4 I;  2WW4 A;  2JEA A;  1PJS A;  4LFC I;  1Z5A A;  2PNM A;  2NUG A;  1ZU1 A;  1LLM C;  4DR7 E;  1TF3 A;  2YU8 A;  2YSO A;  2HJJ A;  4N4R B;  2JPA A;  4FW5 A;  4HAC B;  2V86 A;  4JI1 E;  1A1J A;  4DR4 E;  3T1Y I;  2NUE A;  1T4O A;  2EN7 A;  2NAB A;  5C0X E;  4DV0 I;  4GEQ B;  1NHI A;  2MC5 A;  2GHF A;  1G2D C;  2YTP A;  1NHJ A;  2D9H A;  3C4T A;  2Z5E A;  5L3J A;  4OO1 C;  2Z5B B;  4FWH A;  1FWL A;  3H4L A;  2JEA B;  2EN4 A;  3HXL A;  2ENC A;  3K1J A;  5K36 E;  4GQU A;  2EOY A;  4DPU A;  4DV0 E;  4NHR A;  2EN2 A;  3ZKB A;  4R2C A;  2LJP A;  4JG4 A;  1DAR A;  1JK2 A;  3HTX A;  2EQ3 A;  2PO2 B;  4X64 I;  1X5W A;  5AC4 A;  5DRR A;  4PRV A;  1NCS A;  2YTE A;  1B63 A;  5BR8 I;  4J8Z A;  4ZVI A;  2E1R A;  1QNT A;  2M7Q A;  4LF5 I;  2A2D A;  2CG9 A;  1X6E A;  4IFD B;  3P76 A;  3WU5 A;  1N36 I;  2JXP A;  2I13 A;  3PS2 A;  4MQY A;  4X64 E;  2A2C A;  3MHH C;  2DSY A;  5BR8 E;  4L8N A;  2BA1 D;  2PNZ A;  4DV2 I;  1EH6 A;  4LF5 E;  5FLX C;  4F9C B;  4KZS A;  3P3E A;  2DEJ A;  1N36 E;  5DRO A;  4DV4 I;  1AAY A;  2I9I A;  4WUD A;  2HFU A;  3ADJ A;  3F0N A;  2ZM6 I;  4FW6 A;  2Q8U A;  3EPH A;  3LNU A;  3B8H A;  4F54 A;  4MU1 A;  4DV2 E;  2HC5 A;  3KZY A;  1S16 A;  2L2K B;  2BA1 G;  2NN6 D;  1B69 A;  4L5N C;  4DV4 E;  4EMD A;  2ZM6 E;  2YTO A;  2DEI A;  2EFG A;  1PDA A;  2J7K A;  3V5R A;  2PNZ B;  2VQF I;  3THN A;  4AID A;  4BA1 B;  3JAM C;  2C39 A;  1GTK A; 
#chains in the Genus database with same CATH homology
 4F9A B;  3Q1Q A;  3QT5 A;  1USV A;  2V8Q B;  2VQF E;  3CWV A;  1QZR A;  4P7D A;  4KHP I;  1HNX I;  1FJG I;  4LFA I;  2FV4 B;  3ADG A;  1A6F A;  4RPF A;  3P1X A;  3D4J A;  2K4V A;  2KHX A;  4PU9 A;  2G7H A;  1Z0E A;  1Z59 A;  2VF1 A;  4KHP E;  1HNX E;  1FJG E;  2OI2 A;  4LFA E;  5GMD A;  5AAS A;  4BC7 A;  4OOG C;  2BM0 A;  1PVG A;  2R42 A;  1RC7 A;  3WU3 A;  1STU A;  1Z0B A;  4DR1 I;  4DR6 I;  1H7S A;  4WUC A;  2JWO A;  5ADZ A;  4XTJ A;  1HR0 I;  2V83 A;  1IBL I;  2X36 A;  2Z5C A;  5F3W A;  2UUA I;  4ED4 A;  4DR1 E;  4DR6 E;  1HK7 A;  1D6T A;  2NA2 A;  4MYT A;  4PRX A;  1HR0 E;  2ZIT A;  4DU7 A;  2HKJ A;  1IBL E;  1J5E I;  4P78 A;  4P7A A;  2UUA E;  4JV5 I;  2L92 A;  5FLX Q;  1N0V C;  1N34 I;  4HXZ A;  3HPS A;  1J5E E;  2VE7 C;  2Z5C B;  4DMI A;  2CZ9 A;  4JV5 E;  3Q6N A;  4LU9 A;  4M30 A;  4B3S I;  1N34 E;  3F6H A;  3P06 A;  4WYQ B;  4FN5 A;  3LLH A;  4LF9 I;  4KQV A;  3FIG A;  3J7A G;  2GS8 A;  3ZOQ B;  1KTV A;  2M4I A;  4B3S E;  4M0V A;  2HFS A;  4LFC E;  2L6M A;  4LF9 E;  1HNZ I;  4GKK I;  2R3V A;  1Y4U A;  1I94 I;  4X66 I;  4JI3 I;  4IZJ A;  3T1Y E;  1HNZ E;  1EA6 A;  4GKK E;  4N3O A;  4DV1 I;  1WHQ A;  1WHN A;  1I94 E;  4Z7Y A;  1H7U A;  4X66 E;  4JI3 E;  1XNR I;  4BCA A;  1EI1 A;  2B7T A;  1K47 A;  4DV7 I;  3PYD A;  5LMU I;  4DV1 E;  4LFB I;  4WUB A;  5A2Q C;  2IOQ A;  4M2Z A;  1Z0T A;  4DV3 I;  1XNR E;  4JI8 I;  2BM1 A;  4X62 I;  3HPZ A;  3J81 C;  3K17 A;  4DV7 E;  2MDR A;  4LFB E;  2UUB I;  1GZ6 A;  4BS9 A;  4DV3 E;  2Q2E B;  4JI8 E;  4B3R I;  4X62 E;  2H36 X;  4IZK A;  4OX9 I;  2V2V A;  4DV5 I;  1O0W A;  2CPN A;  4USM A;  2UUB E;  1OJ4 A;  1IBK I;  1ZBQ A;  2UXB I;  1N32 I;  4UTG A;  1BKN A;  1Z0C A;  2LRS A;  4B3R E;  1X48 A;  2V2Q A;  4Q28 A;  4OX9 E;  4DV5 E;  4DPT A;  4GKJ I;  4DV6 I;  3V2U C;  4IZJ D;  1IBK E;  1DI2 A;  2UXB E;  2PNL A;  2CGE A;  4FW9 A;  4IZK B;  1T4L B;  4LF8 I;  4GKJ E;  3K6Q A;  4DV6 E;  4JYA I;  3JTZ A;  1KIJ A;  4URL A;  2KON A;  3B78 A;  4I3H A;  4JI6 I;  3OTO I;  3PYF A;  2L3C A;  4LF6 I;  4BBY A;  4LF8 E;  2VQE I;  2F8B A;  4JYA E;  4FWD A;  4WFT A;  1X47 A;  1YZ9 A;  3OTO E;  4UT4 A;  4X8W A;  3RMP A;  4LF6 E;  2VQE E;  2ODR C;  1YYO A;  4B3T I;  1YYW A;  4F9B B;  1J26 A;  1Z5B A;  3LTO A;  5LMN I;  4LF4 I;  1Y4S A;  4P52 A;  3JU0 A;  3PRY A;  2E5L I;  4MYU A;  4B3T E;  1MU5 A;  3H09 A;  4HYM A;  1Z0V A;  3VYX A;  3B82 A;  2O1W A;  2YT4 A;  1FNM A;  5LMN E;  4TUG A;  3LPS A;  5A2Q Q;  2B3T B;  1HNW I;  4LF4 E;  1H74 A;  3C4B A;  2E5L E;  3J81 Q;  2AJ4 A;  5AE2 A;  3OML A;  1MX0 A;  1N0U A;  4LF7 I;  4JI0 I;  2NPF A;  1WUU A;  3DF6 A;  1N33 I;  2XEX A;  2UXD I;  4DPW A;  4YY3 I;  3AUZ A;  4I8O A;  3LML A;  2L8T A;  2LE2 A;  2DB2 A;  2N3G A;  3WU6 A;  2DMY A;  2ZBK B;  2HK2 A;  4LF7 E;  2UXC I;  4JI0 E;  2FGG A;  5IWA I;  2LJH A;  1N33 E;  4HAC A;  1XMO I;  2M1S A;  2UXD E;  4YY3 E;  2O1T A;  3JAM Q;  3IWC A;  1Z0G A;  2L2M A;  5LL6 R;  1XMQ I;  1ELO A;  2B7V A;  3HJC A;  2LTR A;  2UXC E;  4X65 I;  2N3H A;  1H73 A;  2VF3 A;  3HUL A;  5IWA E;  2E1M A;  4JI1 I;  3MSW A;  2LUP B;  1XMO E;  3ZZ0 A;  2RS7 A;  2O1U A;  1UEK A;  1XMQ E;  1FI4 A;  5AE3 A;  1ZM9 A;  2LBS B;  4AQY I;  5IT9 C;  4X65 E;  1PIE A;  4K0K I;  2GQ0 A;  2HHH I;  3HQ1 A;  2MC6 A;  1X49 A;  4DKK A;  3DJW A;  4NXN I;  1PKP A;  2UUC I;  4DXL A;  4AQY E;  3IWB A;  2LTS A;  4IZJ B;  3VYY A;  4B3M I;  4R1F A;  4K0K E;  1VIS A;  1ZM2 A;  1B62 A;  2HHH E;  1S4E A;  1XNQ I;  5LMU E;  3PYG A;  5DNY A;  4NXN E;  4M1K A;  4USK A;  2UUC E;  1U2R A;  3Q6M A;  4BMJ A;  4WPY A;  2NUF A;  1KVK A;  1FKA E;  1H72 C;  4DPY A;  4B3M E;  3T1H I;  1QU6 A;  5FWK A;  4DR3 I;  3M6A A;  4JI4 I;  1XNQ E;  3J7A M;  2RTX A;  3J80 C;  1UIL A;  1ZM3 A;  3QT7 A;  1RQ0 A;  2L2N A;  3T1H E;  4DR3 E;  2YZT A;  1RRE A;  3ZZT A;  5T6J A;  4JI4 E;  3QT6 A;  4TUI A;  3PYE A;  2RS6 A;  1DQ3 A;  4JI5 I;  1YYK A;  1USU A;  3AV0 A;  1N32 E;  2JOX A;  2EWL A;  2FTX B;  1ZM4 A;  2BV3 A;  3ZZU A;  1ZBT A;  3KWR A;  3ZKD A;  4JI5 E;  5GME A;  2V88 A;  4DPX A;  2V8P A;  3F6G A;  2JVA A;  4JI6 E;  4NXM I;  1T4N A;  2JOB A;  2LUQ A;  1NZ0 A;  2F4V I;  3K85 A;  1Z0W A;  2ODR D;  4DU8 A;  3J7Y p;  2O1V A;  4DR2 I;  1SR9 A;  4YHH I;  4NXM E;  2F4V E;  1FWK A;  2B9D A;  2DIX A;  1KKH A;  4DR5 I;  5IT9 Q;  3ZM7 A;  4R03 A;  4DR2 E;  2X7I A;  1IBM I;  4FWG A;  3ADI A;  2UU9 I;  2V85 A;  4YHH E;  1RR9 A;  4DUY I;  2LMZ A;  4DUZ I;  4JI7 I;  2V87 A;  2JR1 A;  2KOU A;  4DR5 E;  4WSP A;  1XHK A;  3WU4 A;  4JI2 I;  1IBM E;  2V2Z A;  2V34 A;  2UU9 E;  4JI7 E;  1ZXM A;  4DUY E;  4DUZ E;  4BC9 A;  1WXR A;  2JY9 A;  1HNW E;  3GON A;  3VK6 A;  2IHR 1;  1UHZ A;  2RSM A;  2EZ6 A;  4JI2 E;  3QT8 A;  4LTY A;  2WZO A;  2HKE A;  1MG7 A;  1GQE A;  1NHH A;  3J80 Q;  2L33 A;  2L3J A;  1EKZ A;  1Y6Z A;  2HK3 A;  2V89 A;  4HY1 A;  3IWD A;  3ADL A;  1Z5C A;  4DR7 I;  2IOP A;  5CFF E;  5AE1 A;  4Z7C A;  1ZXN A;  4R8O A;  2Z5B A;  4DR4 I;  2WW4 A;  4LFC I;  1Z5A A;  2PNM A;  2NUG A;  4DR7 E;  4HAC B;  2V86 A;  4JI1 E;  4DR4 E;  3T1Y I;  2NUE A;  1T4O A;  4DV0 I;  4GEQ B;  1NHI A;  2MC5 A;  1NHJ A;  2Z5E A;  3C4T A;  5L3J A;  2Z5B B;  4FWH A;  1FWL A;  3H4L A;  3HXL A;  3K1J A;  4DPU A;  4DV0 E;  3ZKB A;  2LJP A;  4JG4 A;  1DAR A;  3HTX A;  4X64 I;  4PRV A;  1B63 A;  5BR8 I;  4J8Z A;  4ZVI A;  2E1R A;  2M7Q A;  4LF5 I;  2A2D A;  2CG9 A;  3WU5 A;  1N36 I;  4X64 E;  2A2C A;  2DSY A;  5BR8 E;  4L8N A;  4DV2 I;  4LF5 E;  5FLX C;  4F9C B;  4KZS A;  2DEJ A;  1N36 E;  4DV4 I;  4WUD A;  2HFU A;  3ADJ A;  3F0N A;  2ZM6 I;  3LNU A;  3B8H A;  4F54 A;  4DV2 E;  1S16 A;  2L2K B;  4L5N C;  4DV4 E;  4EMD A;  2ZM6 E;  2DEI A;  2EFG A;  2J7K A;  3V5R A;  2VQF I;  3JAM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...