4LFAE

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 33
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lfaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfaE02
3J80C 4Z7YA 2BM0A 4LF6I 4X66E 1IBMI 4B3SI 1S16A 4LFAI 5FLXC 2L33A 4OX9E 5LMNE 1Z0TA 2HKEA 2JY9A 2L3JA 4WUCA 2HHHI 4JYAI 2UXBI 2NPFA 4LFBE 4UTGA 1XMOE 1Z0EA 4HACB 2HK2A 4M1KA 4LFCE 4DV4E 5LMNI 5A2QC 4DUZI 5GMDA 3PYEA 4DR6E 1QU6A 4NXNE 1O0WA 2UUAI 3V2UC 1H7SA 1KKHA 1HNWI 1RREA 1IBKI 4JG4A 4LF8E 4FWDA 4X64I 3V5RA 3ADGA 1IBME 4DR6I 2RSMA 1HNZE 4B3TE 2KHXA 2DEIA 4DR4E 1OJ4A 4LFCI 1ELOA 4WFTA 1WUUA 3ADJA 5A2QQ 1J26A 1YZ9A 1U2RA 3ZM7A 4JI1E 2UXCE 1N0VC 3ZZTA 4DV3I 4YY3E 4KHPI 4EMDA 1IBLE 4JI8E 4DV6I 1Z0GA 4DUYE 1NHHA 2E5LE 2V2QA 2A2DA 2L3CA 2VQFI 1PVGA 4DUZE 1XNRE 1IBKE 3QT6A 1UHZA 3K1JA 3HULA 5IT9C 4YHHE 2V2VA 3WU4A 4OOGC 4X64E 3GONA 4P52A 1ZM2A 3QT5A 5LMUI 2NUGA 3J7Yp 4DPXA 3B78A 3T1HE 4JV5E 4FN5A 1YYKA 1FNMA 2GS8A 4JI5I 2DIXA 4DR3I 1FI4A 3PYFA 4LF4E 3J81Q 1YYOA 1Z0CA 5LL6R 4DV1E 2UXDE 2UUAE 1B62A 2LUPB 4B3RI 4HACA 2VF3A 2LBSB 4FWHA 1FWKA 3ZZUA 4B3MI 3VYYA 4DPUA 1ZXMA 1T4OA 5IT9Q 2F4VE 5L3JA 1Z0BA 4PRXA 1B63A 4UT4A 2V8PA 2HFUA 1HR0I 4HY1A 4JI8I 4ZVIA 4DV5E 1H7UA 4Z7CA 4JI3E 4X65I 1QZRA 3LPSA 2NUFA 1Z0VA 1N34E 1FJGI 1MU5A 2LTRA 4YY3I 3J7AM 4WYQB 1N33E 1X48A 1HNWE 4LF6E 1Z5BA 1I94E 1N32E 4DR7I 4DU7A 2BM1A 3LNUA 3T1YE 1UEKA 1VISA 2LJHA 2E1RA 4LF4I 4DR2E 2ZBKB 4JI4I 1K47A 4X62I 2J7KA 2X7IA 1X49A 3VYXA 3T1HI 1UILA 1Z5AA 3LLHA 2UU9E 4P7AA 1ZM9A 4DV2I 4MYUA 4DV5I 1KIJA 4DR2I 4JV5I 4LF5E 2L2MA 1EKZA 4LFBI 1H72C 4DR3E 3H4LA 1FWLA 4HXZA 1XMQE 2L2NA 4HYMA 4XTJA 3CWVA 2LTSA 1FKAE 4DV7I 4X62E 1H74A 1ZXNA 4USMA 4USKA 3PYDA 2B7VA 3D4JA 4DPWA 2DB2A 4WUDA 4DV0I 4JI1I 4DUYI 3C4TA 2V2ZA 1ZM4A 5FLXQ 3B82A 1IBLI 4OX9I 4DV6E 2X36A 4JI7I 5BR8E 4JI3I 4X8WA 4JI6I 1NZ0A 2XEXA 4K0KE 2DEJA 3OTOE 1STUA 4LF9E 3F0NA 4R1FA 1X47A 4DR4I 2R42A 5CFFE 1N36E 2ZITA 4DR7E 3ADLA 2UUCI 4JI2E 1XHKA 1D6TA 1S4EA 4AQYI 4MYTA 2RS6A 1PIEA 3ADIA 2VQEE 1J5EI 2HFSA 4DV3E 4LF8I 4JI4E 1N0UA 5IWAE 2HKJA 2Q2EB 2LRSA 3JAMQ 4DV0E 2CPNA 4JI5E 2NUEA 4B3RE 3B8HA 4DR5E 1XNRI 4LF5I 1RC7A 4DPYA 3Q1QA 5LMUE 1EA6A 4NXNI 1XNQE 1ZBTA 1T4LB 2R3VA 3ZZ0A 2HK3A 4GKKI 1GQEA 3J80Q 2L2KB 1KTVA 4LFAE 1RQ0A 3ZKBA 2B7TA 1BKNA 2YT4A 2N3GA 1J5EE 1YYWA 2B3TB 2E5LI 4AQYE 4KQVA 1HR0E 2RS7A 2BV3A 4WUBA 3JAMC 4GKKE 3OTOI 2UUCE 1NHIA 4JI0E 1EI1A 3QT7A 4PU9A 5BR8I 2RTXA 4I3HA 2CZ9A 4JI6E 1PKPA 3T1YI 3LTOA 4X65E 1N32I 2VQFE 4LF7I 3J81C 4GKJI 3PYGA 5IWAI 4X66I 2V34A 1HNXE 4DR1I 3C4BA 1DARA 2ZM6I 1WHQA 2AJ4A 1N34I 2A2CA 4DV4I 1HNZI 4B3TI 4DV1I 2UXDI 4DV2E 1DI2A 2LJPA 1XMOI 4YHHI 3WU3A 2JVAA 4NXME 1Z0WA 2EZ6A 2UUBE 3P1XA 4DV7E 1NHJA 4DU8A 4DPTA 4DR5I 2DMYA 2HHHE 3QT8A 1RR9A 4B3ME 3HTXA 2OI2A 1XNQI 2LUQA 4B3SE 4K0KI 3ZKDA 1XMQI 1KVKA 3WU6A 4KHPE 3WU5A 4JYAE 2EFGA 4RPFA 4DKKA 5GMEA 2UUBI 4JI7E 4M30A 1T4NA 3M6AA 4M2ZA 1ZM3A 3J7AG 3K17A 2VQEI 2UU9I 4PRVA 4GKJE 4JI2I 1A6FA 1H73A 2WW4A 1MX0A 4LF7E 4DR1E 1HNXI 1N33I 2UXBE 2IHR1 1WHNA 2ZM6E 1Z59A 4DXLA 2NA2A 2N3HA 4LF9I 4ED4A 1I94I 1MG7A 4NXMI 2MDRA 1Z5CA 4URLA 1N36I 4FWGA 4JI0I 1FJGE 4FW9A 2F4VI 2UXCI
chains in the Genus database with same CATH superfamily
3J80C 4Z7YA 1UDSA 1Y4SA 1A1IA 2BM0A 3MSWA 5DRPA 4LF6I 2JEAA 2EOXA 4X66E 1IBMI 4B3SI 1S16A 3P3GA 4L8NA 3EPKA 2HGHA 4LFAI 2ELYA 2YWQA 2PO1B 2GHFA 5FLXC 2EM9A 2Z5CA 2L33A 2EN2A 2C38B 4IZJA 4OX9E 5LMNE 2EQ3A 1SR9A 2JE6A 2BA1G 2VF1A 3HXLA 5JEAB 2BR2A 1Z0TA 2HKEA 2JY9A 2L3JA 4WUCA 2HHHI 4JYAI 2UXBI 2LJUA 2BA0D 2NPFA 2EMLA 2I9IA 1XMOE 4LFBE 2WP8B 5A6BD 4UTGA 1Z0EA 4HACB 4IFDB 2EQ0A 2HK2A 4M1KA 4LFCE 4DV4E 5K36B 2V83A 4Q35B 5LMNI 5TSEA 5AASA 5A2QC 4DUZI 5GMDA 3PYEA 4DR6E 2BR2B 2V88A 3IWCA 2EMWA 4IZJD 2YTDA 2YTQA 1QU6A 4NXNE 1O0WA 2C38A 2UUAI 3EPHA 1P47A 2EPUA 3LMLA 2EPCA 3PS2A 3V2UC 1H7SA 4ZYHA 2WBTA 1KKHA 1IQSA 3C6KA 1RREA 1N3GA 1IBKI 2JEAB 1HNWI 4FW7A 4JG4A 1WJPA 2EPPA 2EWLA 3BIDA 1T38A 1BBGA 2HC5A 4BCAA 3P3CA 1ZU1A 4LF8E 2DLQA 1UDNA 4FWDA 2VESA 4X64I 5DRQA 2BA1D 2WBSA 3V5RA 1X3CA 1NEIA 3ADGA 1OYRA 2EPAA 1IBME 1AH5A 2R76A 2EPKX 3C6MA 4DR6I 2RSMA 1HNZE 4B3TE 2KHXA 2DEIA 2YTIA 1DQ3A 3MHSC 4DR4E 2EL4A 1B69A 5C0XE 2CGEA 3M85D 3THOB 1OJ4A 4AM3A 4LFCI 2EOIA 1ELOA 4WFTA 2L8TA 5KL6A 5JEAF 4R2SA 1WUUA 2MC6A 4IFDA 2EN6A 3ADJA 1Y60A 5A2QQ 4RHBB 5C0XD 1J26A 1OYSA 4F9CB 1YZ9A 1U2RA 5JEAA 4LU9A 2YTFA 3ZM7A 4AIDA 4JI1E 4LOMA 4IZJB 4FW4A 2UXCE 1N0VC 5KL2A 2MC5A 4P78A 2JOXA 2PO1A 3ZZTA 4DV3I 3FIGA 4YY3E 5A6KA 4EMDA 4KHPI 1IBLE 5K36C 4F9AB 4JI8E 2JPAA 4DV6I 1Z0GA 4DUYE 1UN6B 2ENAA 1NHHA 1X6EA 2E5LE 2YTGA 4BHCA 2V2QA 3ZOQB 5JEAD 2A2DA 2L3CA 2VQFI 2EOOA 1PVGA 2EOQA 3OMLA 2KONA 4DUZE 1GZ6A 3HPSA 2CTDA 1XNRE 1IBKE 3QT6A 3F6HA 4R2DA 1UHZA 3HKMA 3K1JA 2O1VA 4MLQA 3HULA 4NBQA 5IT9C 3ECRA 2YU5A 4YHHE 2I13A 2V2VA 2CSHA 2EPZA 2EMBA 3WU4A 4OOGC 2EMFA 4X64E 1A1LA 3GONA 1ZM2A 2EPLX 3QT5A 4P52A 5LMUI 1X5WA 1YH8A 2NUGA 4KWYA 3J7Yp 2EM4A 4DPXA 3B78A 3T1HE 2IOQA 4JV5E 4FN5A 1YYKA 1A1GA 1FNMA 2VRDA 2GS8A 1JK2A 1ZAAC 4JI5I 1RHYA 2DIXA 4DR3I 4TUGA 1FI4A 3PYFA 4LF4E 3J81Q 2EPMX 1YYOA 2ELZA 1Z0CA 2IERA 5ELWA 5LL6R 2EL5A 4DV1E 2UXDE 2EOHA 2B9DA 2Z5BB 4FW9A 5K36A 2UUAE 2EM3A 1B62A 2L6MA 4R2QA 2LUPB 4IS9A 4B3RI 3P3EA 2YTNA 2GO4A 2EPNA 4HACA 3PS1A 1WXRA 2VF3A 2WP8A 3BBGA 3HQ1A 2O1UA 2YTEA 2PO0A 2BBGA 2LBSB 4FWHA 2BA0G 4OO1A 1AAYA 1FWKA 3ZZUA 4B3MI 1KJKA 3JTZA 1QNTA 4WSPA 3VYYA 4LCHA 2NN6F 3M85G 2CG9A 2C37B 1GTKA 4DPUA 2Z5CB 1ZXMA 1T4OA 3GMEA 5IT9Q 2F4VE 5L3JA 5AE3A 1Z0BA 2EE8A 5DNYA 1B63A 4PRXA 4UT4A 1VI7A 1A1KA 3Q6NA 3RMPA 2NN6E 4FK5C 2V8PA 2HFUA 1HR0I 4HY1A 4JI8I 2MKDA 4ZVIA 2IOPA 4RH8A 3HJCA 4DV5E 2LT7A 1T39A 2F4VI 4Q28A 1H7UA 3Q6MA 1WRJA 4Z7CA 4JI3E 2GLIA 1UDOA 4X65I 2EM7A 3P06A 1QZRA 2NUFA 1Z0VA 1YUJA 1N34E 3L7ZB 2CVEA 3LPSA 1MU5A 4LCGA 1FJGI 2EP3A 2EORA 2LTRA 1USVA 4YY3I 2D9HA 4WX9A 4M0VA 3J7AM 4WYQB 3EPJA 4MQYA 1N33E 1X48A 1MEYC 1PDAA 1HNWE 2YRHA 2JEBA 4BA1A 4MU1A 2V85A 4LF6E 1Z5BA 2V86A 2C39B 4AIMA 4FW3A 1I94E 3IWDA 1N32E 4TUIA 4DR7I 2EN7A 1UBDC 3M99B 4DU7A 2BM1A 4WPYA 3LNUA 3T1YE 1UEKA 1E3PA 2ENHA 1VISA 2LJHA 3K85A 2EMYA 2EMIA 2EN1A 4R2AA 2HJJA 5A6BA 2E1RA 3K6QA 4BC7A 4LF4I 3EQ1A 4DR2E 2ZBKB 4JI4I 1K47A 3GCMA 4X62I 3EPLA 1YPNA 2J7KA 2X7IA 1X49A 2DGCA 5DNXA 1YHCA 5KL4A 2UXCI 2EN3A 3VYXA 2EMHA 1A1HA 3T1HI 2ODRC 2WNRA 1UILA 5AE1A 2JWOA 2FV4B 1Z5AA 2ADRA 1RMDA 3LLHA 1TF6A 4O4KA 2UU9E 4OO1C 4O24A 4P7AA 2Z5EA 1ZM9A 2PO2B 2EOMA 5IV8B 4MYUA 4DV2I 4DV5I 1KIJA 2EMKA 4DR2I 1ZR9A 4JV5I 4LF5E 2RQLA 2PO2A 2L2MA 1EKZA 4F54A 1XXEA 4LFBI 1H72C 2EOYA 4DR3E 3H4LA 1FWLA 4F2JC 2F1DA 4HXZA 1XMQE 1EH6A 3CDIA 2L2NA 4HYMA 4XTJA 3CWVA 4MU3A 2LTSA 1FKAE 4DV7I 4R2EA 4X62E 3VK6A 1H74A 1ZXNA 1A1JA 4USMA 4BA2A 4USKA 4IFDC 4I8OA 4OO1D 4NZVA 3PYDA 1IQOA 5JEAC 3UHMA 1Y6ZA 2B7VA 2DRPA 2G7HA 2EQ1A 4IS1C 4IZKB 3D4JA 1Z1BA 4DPWA 2DB2A 4QNJA 4WUDA 4DV0I 3CDJA 4JI1I 3GLLA 4DUYI 2EPRA 4U3DA 4BC9A 2KOUA 3C4TA 2V2ZA 1ZM4A 1PJSA 5FLXQ 3TQMA 1USUA 4R03A 3B82A 1IBLI 2PNMA 5C0XC 2C39A 4OX9I 4DV6E 2X36A 4JI7I 1SFEA 2GO3A 2JEBB 5BR8E 4IZKA 4WXDA 4JI3I 3AUZA 4ZYGA 4X8WA 2RPCA 4JI6I 1NZ0A 1R6LA 2XEXA 4K0KE 2DEJA 3OTOE 1IMUA 3KWRA 4FW5A 1STUA 4GQUA 3H1CA 4LF9E 3F0NA 1X6FA 5FWKA 4IFDD 4R1FA 3HPZA 4N4RB 5AC5A 4BA2B 2EMAA 1YFHA 2V8QB 1X47A 4DR4I 2R42A 5CFFE 2EN4A 4ISAA 4IJDA 1N36E 2ZITA 4DR7E 2NN6C 3ADLA 2LVHA 4R2RA 2JR1A 2UUCI 2C37A 3U1YA 2MDGA 2EM2A 4JI2E 1XHKA 3L00A 1D6TA 1S4EA 4AQYI 2GQ0A 4MYTA 2EMGA 2FTXB 2RS6A 1YUIA 1PIEA 4OO1B 4DU8A 3ADIA 2VQEE 2WCC3 2PO0B 1HK7A 1PJQA 2EPXA 5JEAE 1J5EI 2HFSA 4DV3E 4J8ZA 4J3DA 4LF8I 1TF3A 4JI4E 2YRKA 4R2PA 5C0XF 4IFDE 2YTOA 1BB8A 1X6HA 4GZNC 1R6MA 2YRMA 1N0UA 3PRYA 5IXMB 5IWAE 2HKJA 2JT2A 2EM8A 5C0XA 4BHBA 2LRSA 1BBOA 2Q2EB 3KRNA 4LPFA 4U3BA 3JAMQ 4DV0E 2CPNA 4O43A 4JI5E 2NUEA 2NABA 4OO1E 3KZYA 3QG5C 4B3RE 4MU4A 2GPIA 3M7NG 3B8HA 4DR5E 2EOFA 4WSGA 1P42A 1XNRI 5C0XB 4LF5I 1RC7A 4DPYA 3Q1QA 5LMUE 1EA6A 2YSOA 5AE2A 3DD6A 4NXNI 1XNQE 1ZBTA 1JK1A 5K36E 4MU0A 4NHRA 1T4LB 2R3VA 3ZZ0A 2HK3A 4GKKI 4N3OA 2LMZA 1GQEA 3J80Q 2MKNA 2L2KB 1EH8A 2V87A 3DJWA 5K36F 1KTVA 3F6GA 1OYPA 5F3WA 2AE8A 3P76A 2EL6A 4LFAE 1RQ0A 3ZKBA 4R2CA 4BMJA 2B7TA 2E72A 1BKNA 2YT4A 2N3GA 1J5EE 1YYWA 2YSPA 2IESA 2B3TB 1Y5YA 5A69A 4F6MA 2E5LI 5EKWA 3KZZA 4AQYE 4FW6A 2K7IA 4LTYA 2YPNA 4KQVA 4OO1F 1HR0E 2RS7A 2BV3A 2WBUA 2EOSA 3IWBA 3H09A 2N8XA 2RSIA 3JU0A 3JAMC 4X9JA 4WUBA 2VE7C 4GKKE 2BB8A 2JYAA 5ADZA 5EL9A 3OTOI 2UUCE 3M7ND 1NHIA 4JI0E 3PS3A 1EI1A 3QT7A 2O1WA 4PU9A 2EN8A 2EM0A 2RTXA 2JXPA 1LLMC 2JP9A 2O3ZA 4I3HA 5BR8I 2EMXA 4ZYEA 2CZ9A 4JI6E 1PKPA 5KL3A 4F9BB 3T1YI 2PRTA 3NZKA 2FGGA 3LTOA 4X65E 1E3HA 1ZBQA 2VQFE 3BGHA 1A1FA 4LF7I 1N32I 2LV2A 4DMIA 2J7JA 3J81C 4GKJI 1KYQA 3PYGA 2M9AA 1PJTA 2EPOA 5IWAI 2M7QA 2M1SA 2V34A 4X66I 1HNXE 4DR1I 5A6JA 3C4BA 1DARA 4BS9A 2ZM6I 5DRRA 1WHQA 2DMIA 2AJ4A 2LE2A 2JOBA 2A2CA 1N34I 2PNLA 4OZEA 2O1TA 4DV4I 1HNZI 4B3TI 2Q8UA 4DV1I 2WZOA 2UXDI 3B4TA 4DV2E 2EOEA 1DI2A 2LJPA 2EMZA 4IFDF 1DGCA 1XMOI 4YHHI 3WU3A 2JVAA 4NXME 1Z0WA 2EZ6A 5LLQA 2UUBE 5T6JA 1MGTA 3P1XA 2V89A 5KL5A 4DV7E 2ODRD 1NHJA 1UDQA 5DROA 4DPTA 4DR5I 1EH7A 2DMYA 4O5GA 2YZTA 2HHHE 3QT8A 4HEIA 4B3ME 3HTXA 2EM5A 1RR9A 5DNLA 2OI2A 4HTGA 1XNQI 2LUQA 1G2DC 1G2FC 4B3SE 4K0KI 4F6NA 4QNKA 3ZKDA 1XMQI 1KVKA 2WNRB 3WU6A 3VHTB 4KHPE 3BF2A 3WU5A 4R8OA 1NCSA 4JYAE 2EFGA 2YU8A 4WXCA 2K4VA 4DKKA 4RPFA 5GMEA 2UUBI 2L92A 4JI7E 2Z5BA 5K36D 4M30A 1T4NA 2J65A 2EOZA 3M6AA 4M2ZA 1ZM3A 2EJ4A 3J7AG 2JE6B 3K17A 4KZSA 3THNA 2F8BA 2VQEI 4MLVA 1F2IG 5AC4A 2UU9I 4PRVA 4GKJE 4L5NC 4JI2I 1A6FA 1H73A 2DSYA 2WW4A 1MX0A 4LF7E 4DR1E 1HNXI 4BBYA 1N33I 2UXBE 2EOJA 2IHR1 1WHNA 2YTPA 3AV0A 2EMCA 2ZM6E 4M9VC 2NA2A 1Z59A 4DXLA 3UK3C 2N3HA 4LF9I 4ED4A 2LCEA 5A6AA 2DLKA 2M4IA 1YSAC 1MG7A 1I94I 4MDTA 4NXMI 2A25A 2NN6D 3U1KA 3MHHC 2NN6A 2PNZB 2H36X 2EM6A 2E1MA 2ENCA 2MDRA 4P7DA 1L4SA 1Y4UA 1Z5CA 2R1FA 4BA1B 4LCFA 4URLA 1TN9A 4OKGA 2LO3A 1N36I 2YTJA 2NN6B 2CT1A 2PNZA 3L7ZA 4FWGA 4GEQB 4JI0I 1FJGE 4ZYDA 5KL7A 3DF6A
chains in the Genus database with same CATH topology
3J80C 4Z7YA 1Y4SA 2BM0A 3MSWA 4LF6I 4X66E 1IBMI 4B3SI 1S16A 4L8NA 4LFAI 5FLXC 2Z5CA 2L33A 4IZJA 4OX9E 5LMNE 1SR9A 2VF1A 3HXLA 1Z0TA 2HKEA 2JY9A 2L3JA 4WUCA 2HHHI 4JYAI 2UXBI 2NPFA 4LFBE 4UTGA 1XMOE 1Z0EA 4HACB 2HK2A 4M1KA 4LFCE 4DV4E 2V83A 5LMNI 5AASA 5A2QC 4DUZI 5GMDA 3PYEA 4DR6E 2V88A 3IWCA 4IZJD 1QU6A 4NXNE 1O0WA 2UUAI 3LMLA 3V2UC 1H7SA 1KKHA 1HNWI 1RREA 1IBKI 4JG4A 2EWLA 4BCAA 4LF8E 4FWDA 4X64I 3V5RA 3ADGA 1IBME 4DR6I 2RSMA 1HNZE 4B3TE 2KHXA 2DEIA 1DQ3A 4DR4E 2CGEA 1OJ4A 4LFCI 1ELOA 4WFTA 2L8TA 1WUUA 2MC6A 3ADJA 5A2QQ 1J26A 4F9CB 1YZ9A 1U2RA 4LU9A 3ZM7A 4JI1E 4IZJB 2UXCE 1N0VC 2MC5A 4P78A 2JOXA 3ZZTA 4DV3I 3FIGA 4YY3E 4KHPI 4EMDA 1IBLE 4F9AB 4JI8E 4DV6I 1Z0GA 4DUYE 1NHHA 2E5LE 2V2QA 3ZOQB 2A2DA 2L3CA 2VQFI 1PVGA 3OMLA 2KONA 4DUZE 1GZ6A 3HPSA 1XNRE 1IBKE 3QT6A 3F6HA 1UHZA 3K1JA 2O1VA 3HULA 5IT9C 4YHHE 2V2VA 3WU4A 4OOGC 4X64E 3GONA 4P52A 1ZM2A 3QT5A 5LMUI 2NUGA 3J7Yp 4DPXA 3B78A 3T1HE 2IOQA 4JV5E 4FN5A 1YYKA 1FNMA 2GS8A 4JI5I 2DIXA 4DR3I 4TUGA 1FI4A 3PYFA 4LF4E 3J81Q 1YYOA 1Z0CA 5LL6R 4DV1E 2UXDE 2B9DA 2Z5BB 2UUAE 1B62A 2L6MA 2LUPB 4B3RI 4HACA 1WXRA 2VF3A 3HQ1A 2O1UA 2LBSB 4FWHA 1FWKA 3ZZUA 4B3MI 3JTZA 4WSPA 3VYYA 2CG9A 4DPUA 2Z5CB 1ZXMA 1T4OA 5IT9Q 2F4VE 5L3JA 5AE3A 1Z0BA 5DNYA 1B63A 4PRXA 4UT4A 3Q6NA 3RMPA 2V8PA 2HFUA 1HR0I 4HY1A 4JI8I 4ZVIA 2IOPA 3HJCA 4DV5E 4Q28A 1H7UA 3Q6MA 4Z7CA 4JI3E 4X65I 3P06A 1QZRA 2NUFA 1Z0VA 3LPSA 1N34E 1FJGI 1MU5A 2LTRA 1USVA 4YY3I 3J7AM 4M0VA 4WYQB 1N33E 1X48A 1HNWE 2V85A 4LF6E 1Z5BA 2V86A 1I94E 3IWDA 1N32E 4TUIA 4DR7I 4DU7A 2BM1A 4WPYA 3LNUA 3T1YE 1UEKA 1VISA 2LJHA 3K85A 2E1RA 3K6QA 4BC7A 4LF4I 4DR2E 2ZBKB 4JI4I 1K47A 4X62I 2J7KA 2X7IA 1X49A 2UXCI 3VYXA 3T1HI 2ODRC 1UILA 5AE1A 2JWOA 2FV4B 1Z5AA 3LLHA 2UU9E 4P7AA 2Z5EA 1ZM9A 4DV2I 4MYUA 4DV5I 1KIJA 4DR2I 4JV5I 4LF5E 2L2MA 1EKZA 4F54A 4LFBI 1H72C 4DR3E 3H4LA 1FWLA 4HXZA 1XMQE 2L2NA 4HYMA 4XTJA 3CWVA 2LTSA 1FKAE 4DV7I 4X62E 3VK6A 1H74A 1ZXNA 4USMA 4USKA 4I8OA 3PYDA 1Y6ZA 2B7VA 2G7HA 4IZKB 3D4JA 4DPWA 2DB2A 4WUDA 4DV0I 4JI1I 4DUYI 4BC9A 2KOUA 3C4TA 2V2ZA 1ZM4A 5FLXQ 1USUA 4R03A 3B82A 1IBLI 2PNMA 4OX9I 4DV6E 2X36A 4JI7I 5BR8E 4IZKA 4JI3I 3AUZA 4X8WA 4JI6I 1NZ0A 2XEXA 4K0KE 2DEJA 3OTOE 3KWRA 1STUA 4LF9E 3F0NA 5FWKA 4R1FA 3HPZA 2V8QB 1X47A 4DR4I 2R42A 5CFFE 1N36E 2ZITA 4DR7E 3ADLA 2UUCI 2JR1A 4JI2E 1XHKA 1D6TA 1S4EA 4AQYI 2GQ0A 4MYTA 2FTXB 2RS6A 1PIEA 3ADIA 2VQEE 1J5EI 1HK7A 2HFSA 4DV3E 4J8ZA 4LF8I 4JI4E 1N0UA 3PRYA 5IWAE 2HKJA 2Q2EB 2LRSA 3JAMQ 4DV0E 2CPNA 4JI5E 2NUEA 4B3RE 3B8HA 4DR5E 1XNRI 4LF5I 1RC7A 4DPYA 3Q1QA 5LMUE 1EA6A 5AE2A 4NXNI 1XNQE 1ZBTA 1T4LB 2R3VA 3ZZ0A 2HK3A 4GKKI 4N3OA 2LMZA 1GQEA 3J80Q 2L2KB 2V87A 3DJWA 1KTVA 3F6GA 5F3WA 4LFAE 1RQ0A 3ZKBA 4BMJA 2B7TA 1BKNA 2YT4A 2N3GA 1J5EE 1YYWA 2B3TB 2E5LI 4AQYE 4LTYA 4KQVA 1HR0E 2RS7A 2BV3A 3IWBA 3H09A 3JU0A 4WUBA 3JAMC 2VE7C 4GKKE 5ADZA 3OTOI 2UUCE 1NHIA 4JI0E 1EI1A 3QT7A 2O1WA 4PU9A 5BR8I 2RTXA 4I3HA 2CZ9A 4JI6E 1PKPA 4F9BB 3T1YI 2FGGA 3LTOA 4X65E 1N32I 1ZBQA 2VQFE 4LF7I 4DMIA 3J81C 4GKJI 3PYGA 5IWAI 2M7QA 2M1SA 2V34A 4X66I 1HNXE 4DR1I 3C4BA 1DARA 4BS9A 2ZM6I 1WHQA 2AJ4A 1N34I 2LE2A 2JOBA 2A2CA 2PNLA 2O1TA 4DV4I 1HNZI 4B3TI 4DV1I 2WZOA 2UXDI 4DV2E 1DI2A 2LJPA 1XMOI 4YHHI 3WU3A 2JVAA 4NXME 1Z0WA 2EZ6A 2UUBE 3P1XA 5T6JA 4DV7E 2V89A 1NHJA 4DPTA 2ODRD 4DU8A 4DR5I 2YZTA 2DMYA 2HHHE 3QT8A 1RR9A 4B3ME 3HTXA 2OI2A 1XNQI 2LUQA 4B3SE 4K0KI 3ZKDA 1XMQI 1KVKA 3WU6A 4KHPE 3WU5A 4R8OA 4JYAE 2EFGA 4RPFA 2K4VA 4DKKA 5GMEA 2UUBI 2L92A 4JI7E 2Z5BA 4M30A 1T4NA 3M6AA 4M2ZA 1ZM3A 3J7AG 3K17A 4KZSA 2F8BA 2VQEI 2UU9I 4PRVA 4GKJE 4L5NC 4JI2I 1A6FA 1H73A 2DSYA 2WW4A 1MX0A 4LF7E 4DR1E 1HNXI 4BBYA 1N33I 2UXBE 2IHR1 1WHNA 3AV0A 2ZM6E 1Z59A 4DXLA 2NA2A 2N3HA 4LF9I 4ED4A 2M4IA 1I94I 1MG7A 4NXMI 2H36X 2MDRA 2E1MA 1Y4UA 1Z5CA 4P7DA 4URLA 1N36I 4FWGA 4GEQB 4JI0I 1FJGE 4FW9A 2F4VI 3DF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 C;  4Z7Y A;  2BM0 A;  4LF6 I;  4X66 E;  1IBM I;  4B3S I;  1S16 A;  4LFA I;  5FLX C;  2L33 A;  4OX9 E;  5LMN E;  1Z0T A;  2HKE A;  2JY9 A;  2L3J A;  4WUC A;  2HHH I;  4JYA I;  2UXB I;  2NPF A;  4LFB E;  4UTG A;  1XMO E;  1Z0E A;  4HAC B;  2HK2 A;  4M1K A;  4LFC E;  4DV4 E;  5LMN I;  5A2Q C;  4DUZ I;  5GMD A;  3PYE A;  4DR6 E;  1QU6 A;  4NXN E;  1O0W A;  2UUA I;  3V2U C;  1H7S A;  1KKH A;  1HNW I;  1RRE A;  1IBK I;  4JG4 A;  4LF8 E;  4FWD A;  4X64 I;  3V5R A;  3ADG A;  1IBM E;  4DR6 I;  2RSM A;  1HNZ E;  4B3T E;  2KHX A;  2DEI A;  4DR4 E;  1OJ4 A;  4LFC I;  1ELO A;  4WFT A;  1WUU A;  3ADJ A;  5A2Q Q;  1J26 A;  1YZ9 A;  1U2R A;  3ZM7 A;  4JI1 E;  2UXC E;  1N0V C;  3ZZT A;  4DV3 I;  4YY3 E;  4KHP I;  4EMD A;  1IBL E;  4JI8 E;  4DV6 I;  1Z0G A;  4DUY E;  1NHH A;  2E5L E;  2V2Q A;  2A2D A;  2L3C A;  2VQF I;  1PVG A;  4DUZ E;  1XNR E;  1IBK E;  3QT6 A;  1UHZ A;  3K1J A;  3HUL A;  5IT9 C;  4YHH E;  2V2V A;  3WU4 A;  4OOG C;  4X64 E;  3GON A;  4P52 A;  1ZM2 A;  3QT5 A;  5LMU I;  2NUG A;  3J7Y p;  4DPX A;  3B78 A;  3T1H E;  4JV5 E;  4FN5 A;  1YYK A;  1FNM A;  2GS8 A;  4JI5 I;  2DIX A;  4DR3 I;  1FI4 A;  3PYF A;  4LF4 E;  3J81 Q;  1YYO A;  1Z0C A;  5LL6 R;  4DV1 E;  2UXD E;  2UUA E;  1B62 A;  2LUP B;  4B3R I;  4HAC A;  2VF3 A;  2LBS B;  4FWH A;  1FWK A;  3ZZU A;  4B3M I;  3VYY A;  4DPU A;  1ZXM A;  1T4O A;  5IT9 Q;  2F4V E;  5L3J A;  1Z0B A;  4PRX A;  1B63 A;  4UT4 A;  2V8P A;  2HFU A;  1HR0 I;  4HY1 A;  4JI8 I;  4ZVI A;  4DV5 E;  1H7U A;  4Z7C A;  4JI3 E;  4X65 I;  1QZR A;  3LPS A;  2NUF A;  1Z0V A;  1N34 E;  1FJG I;  1MU5 A;  2LTR A;  4YY3 I;  3J7A M;  4WYQ B;  1N33 E;  1X48 A;  1HNW E;  4LF6 E;  1Z5B A;  1I94 E;  1N32 E;  4DR7 I;  4DU7 A;  2BM1 A;  3LNU A;  3T1Y E;  1UEK A;  1VIS A;  2LJH A;  2E1R A;  4LF4 I;  4DR2 E;  2ZBK B;  4JI4 I;  1K47 A;  4X62 I;  2J7K A;  2X7I A;  1X49 A;  3VYX A;  3T1H I;  1UIL A;  1Z5A A;  3LLH A;  2UU9 E;  4P7A A;  1ZM9 A;  4DV2 I;  4MYU A;  4DV5 I;  1KIJ A;  4DR2 I;  4JV5 I;  4LF5 E;  2L2M A;  1EKZ A;  4LFB I;  1H72 C;  4DR3 E;  3H4L A;  1FWL A;  4HXZ A;  1XMQ E;  2L2N A;  4HYM A;  4XTJ A;  3CWV A;  2LTS A;  1FKA E;  4DV7 I;  4X62 E;  1H74 A;  1ZXN A;  4USM A;  4USK A;  3PYD A;  2B7V A;  3D4J A;  4DPW A;  2DB2 A;  4WUD A;  4DV0 I;  4JI1 I;  4DUY I;  3C4T A;  2V2Z A;  1ZM4 A;  5FLX Q;  3B82 A;  1IBL I;  4OX9 I;  4DV6 E;  2X36 A;  4JI7 I;  5BR8 E;  4JI3 I;  4X8W A;  4JI6 I;  1NZ0 A;  2XEX A;  4K0K E;  2DEJ A;  3OTO E;  1STU A;  4LF9 E;  3F0N A;  4R1F A;  1X47 A;  4DR4 I;  2R42 A;  5CFF E;  1N36 E;  2ZIT A;  4DR7 E;  3ADL A;  2UUC I;  4JI2 E;  1XHK A;  1D6T A;  1S4E A;  4AQY I;  4MYT A;  2RS6 A;  1PIE A;  3ADI A;  2VQE E;  1J5E I;  2HFS A;  4DV3 E;  4LF8 I;  4JI4 E;  1N0U A;  5IWA E;  2HKJ A;  2Q2E B;  2LRS A;  3JAM Q;  4DV0 E;  2CPN A;  4JI5 E;  2NUE A;  4B3R E;  3B8H A;  4DR5 E;  1XNR I;  4LF5 I;  1RC7 A;  4DPY A;  3Q1Q A;  5LMU E;  1EA6 A;  4NXN I;  1XNQ E;  1ZBT A;  1T4L B;  2R3V A;  3ZZ0 A;  2HK3 A;  4GKK I;  1GQE A;  3J80 Q;  2L2K B;  1KTV A;  4LFA E;  1RQ0 A;  3ZKB A;  2B7T A;  1BKN A;  2YT4 A;  2N3G A;  1J5E E;  1YYW A;  2B3T B;  2E5L I;  4AQY E;  4KQV A;  1HR0 E;  2RS7 A;  2BV3 A;  4WUB A;  3JAM C;  4GKK E;  3OTO I;  2UUC E;  1NHI A;  4JI0 E;  1EI1 A;  3QT7 A;  4PU9 A;  5BR8 I;  2RTX A;  4I3H A;  2CZ9 A;  4JI6 E;  1PKP A;  3T1Y I;  3LTO A;  4X65 E;  1N32 I;  2VQF E;  4LF7 I;  3J81 C;  4GKJ I;  3PYG A;  5IWA I;  4X66 I;  2V34 A;  1HNX E;  4DR1 I;  3C4B A;  1DAR A;  2ZM6 I;  1WHQ A;  2AJ4 A;  1N34 I;  2A2C A;  4DV4 I;  1HNZ I;  4B3T I;  4DV1 I;  2UXD I;  4DV2 E;  1DI2 A;  2LJP A;  1XMO I;  4YHH I;  3WU3 A;  2JVA A;  4NXM E;  1Z0W A;  2EZ6 A;  2UUB E;  3P1X A;  4DV7 E;  1NHJ A;  4DU8 A;  4DPT A;  4DR5 I;  2DMY A;  2HHH E;  3QT8 A;  1RR9 A;  4B3M E;  3HTX A;  2OI2 A;  1XNQ I;  2LUQ A;  4B3S E;  4K0K I;  3ZKD A;  1XMQ I;  1KVK A;  3WU6 A;  4KHP E;  3WU5 A;  4JYA E;  2EFG A;  4RPF A;  4DKK A;  5GME A;  2UUB I;  4JI7 E;  4M30 A;  1T4N A;  3M6A A;  4M2Z A;  1ZM3 A;  3J7A G;  3K17 A;  2VQE I;  2UU9 I;  4PRV A;  4GKJ E;  4JI2 I;  1A6F A;  1H73 A;  2WW4 A;  1MX0 A;  4LF7 E;  4DR1 E;  1HNX I;  1N33 I;  2UXB E;  2IHR 1;  1WHN A;  2ZM6 E;  1Z59 A;  4DXL A;  2NA2 A;  2N3H A;  4LF9 I;  4ED4 A;  1I94 I;  1MG7 A;  4NXM I;  2MDR A;  1Z5C A;  4URL A;  1N36 I;  4FWG A;  4JI0 I;  1FJG E;  4FW9 A;  2F4V I;  2UXC I; 
#chains in the Genus database with same CATH topology
 3J80 C;  4Z7Y A;  1UDS A;  1Y4S A;  1A1I A;  2BM0 A;  3MSW A;  5DRP A;  4LF6 I;  2JEA A;  2EOX A;  4X66 E;  1IBM I;  4B3S I;  1S16 A;  3P3G A;  4L8N A;  3EPK A;  2HGH A;  4LFA I;  2ELY A;  2YWQ A;  2PO1 B;  2GHF A;  5FLX C;  2EM9 A;  2Z5C A;  2L33 A;  2EN2 A;  2C38 B;  4IZJ A;  4OX9 E;  5LMN E;  2EQ3 A;  1SR9 A;  2JE6 A;  2BA1 G;  2VF1 A;  3HXL A;  5JEA B;  2BR2 A;  1Z0T A;  2HKE A;  2JY9 A;  2L3J A;  4WUC A;  2HHH I;  4JYA I;  2UXB I;  2LJU A;  2BA0 D;  2NPF A;  2EML A;  2I9I A;  1XMO E;  4LFB E;  2WP8 B;  5A6B D;  4UTG A;  1Z0E A;  4HAC B;  4IFD B;  2EQ0 A;  2HK2 A;  4M1K A;  4LFC E;  4DV4 E;  5K36 B;  2V83 A;  4Q35 B;  5LMN I;  5TSE A;  5AAS A;  5A2Q C;  4DUZ I;  5GMD A;  3PYE A;  4DR6 E;  2BR2 B;  2V88 A;  3IWC A;  2EMW A;  4IZJ D;  2YTD A;  2YTQ A;  1QU6 A;  4NXN E;  1O0W A;  2C38 A;  2UUA I;  3EPH A;  1P47 A;  2EPU A;  3LML A;  2EPC A;  3PS2 A;  3V2U C;  1H7S A;  4ZYH A;  2WBT A;  1KKH A;  1IQS A;  3C6K A;  1RRE A;  1N3G A;  1IBK I;  2JEA B;  1HNW I;  4FW7 A;  4JG4 A;  1WJP A;  2EPP A;  2EWL A;  3BID A;  1T38 A;  1BBG A;  2HC5 A;  4BCA A;  3P3C A;  1ZU1 A;  4LF8 E;  2DLQ A;  1UDN A;  4FWD A;  2VES A;  4X64 I;  5DRQ A;  2BA1 D;  2WBS A;  3V5R A;  1X3C A;  1NEI A;  3ADG A;  1OYR A;  2EPA A;  1IBM E;  1AH5 A;  2R76 A;  2EPK X;  3C6M A;  4DR6 I;  2RSM A;  1HNZ E;  4B3T E;  2KHX A;  2DEI A;  2YTI A;  1DQ3 A;  3MHS C;  4DR4 E;  2EL4 A;  1B69 A;  5C0X E;  2CGE A;  3M85 D;  3THO B;  1OJ4 A;  4AM3 A;  4LFC I;  2EOI A;  1ELO A;  4WFT A;  2L8T A;  5KL6 A;  5JEA F;  4R2S A;  1WUU A;  2MC6 A;  4IFD A;  2EN6 A;  3ADJ A;  1Y60 A;  5A2Q Q;  4RHB B;  5C0X D;  1J26 A;  1OYS A;  4F9C B;  1YZ9 A;  1U2R A;  5JEA A;  4LU9 A;  2YTF A;  3ZM7 A;  4AID A;  4JI1 E;  4LOM A;  4IZJ B;  4FW4 A;  2UXC E;  1N0V C;  5KL2 A;  2MC5 A;  4P78 A;  2JOX A;  2PO1 A;  3ZZT A;  4DV3 I;  3FIG A;  4YY3 E;  5A6K A;  4EMD A;  4KHP I;  1IBL E;  5K36 C;  4F9A B;  4JI8 E;  2JPA A;  4DV6 I;  1Z0G A;  4DUY E;  1UN6 B;  2ENA A;  1NHH A;  1X6E A;  2E5L E;  2YTG A;  4BHC A;  2V2Q A;  3ZOQ B;  5JEA D;  2A2D A;  2L3C A;  2VQF I;  2EOO A;  1PVG A;  2EOQ A;  3OML A;  2KON A;  4DUZ E;  1GZ6 A;  3HPS A;  2CTD A;  1XNR E;  1IBK E;  3QT6 A;  3F6H A;  4R2D A;  1UHZ A;  3HKM A;  3K1J A;  2O1V A;  4MLQ A;  3HUL A;  4NBQ A;  5IT9 C;  3ECR A;  2YU5 A;  4YHH E;  2I13 A;  2V2V A;  2CSH A;  2EPZ A;  2EMB A;  3WU4 A;  4OOG C;  2EMF A;  4X64 E;  1A1L A;  3GON A;  1ZM2 A;  2EPL X;  3QT5 A;  4P52 A;  5LMU I;  1X5W A;  1YH8 A;  2NUG A;  4KWY A;  3J7Y p;  2EM4 A;  4DPX A;  3B78 A;  3T1H E;  2IOQ A;  4JV5 E;  4FN5 A;  1YYK A;  1A1G A;  1FNM A;  2VRD A;  2GS8 A;  1JK2 A;  1ZAA C;  4JI5 I;  1RHY A;  2DIX A;  4DR3 I;  4TUG A;  1FI4 A;  3PYF A;  4LF4 E;  3J81 Q;  2EPM X;  1YYO A;  2ELZ A;  1Z0C A;  2IER A;  5ELW A;  5LL6 R;  2EL5 A;  4DV1 E;  2UXD E;  2EOH A;  2B9D A;  2Z5B B;  4FW9 A;  5K36 A;  2UUA E;  2EM3 A;  1B62 A;  2L6M A;  4R2Q A;  2LUP B;  4IS9 A;  4B3R I;  3P3E A;  2YTN A;  2GO4 A;  2EPN A;  4HAC A;  3PS1 A;  1WXR A;  2VF3 A;  2WP8 A;  3BBG A;  3HQ1 A;  2O1U A;  2YTE A;  2PO0 A;  2BBG A;  2LBS B;  4FWH A;  2BA0 G;  4OO1 A;  1AAY A;  1FWK A;  3ZZU A;  4B3M I;  1KJK A;  3JTZ A;  1QNT A;  4WSP A;  3VYY A;  4LCH A;  2NN6 F;  3M85 G;  2CG9 A;  2C37 B;  1GTK A;  4DPU A;  2Z5C B;  1ZXM A;  1T4O A;  3GME A;  5IT9 Q;  2F4V E;  5L3J A;  5AE3 A;  1Z0B A;  2EE8 A;  5DNY A;  1B63 A;  4PRX A;  4UT4 A;  1VI7 A;  1A1K A;  3Q6N A;  3RMP A;  2NN6 E;  4FK5 C;  2V8P A;  2HFU A;  1HR0 I;  4HY1 A;  4JI8 I;  2MKD A;  4ZVI A;  2IOP A;  4RH8 A;  3HJC A;  4DV5 E;  2LT7 A;  1T39 A;  2F4V I;  4Q28 A;  1H7U A;  3Q6M A;  1WRJ A;  4Z7C A;  4JI3 E;  2GLI A;  1UDO A;  4X65 I;  2EM7 A;  3P06 A;  1QZR A;  2NUF A;  1Z0V A;  1YUJ A;  1N34 E;  3L7Z B;  2CVE A;  3LPS A;  1MU5 A;  4LCG A;  1FJG I;  2EP3 A;  2EOR A;  2LTR A;  1USV A;  4YY3 I;  2D9H A;  4WX9 A;  4M0V A;  3J7A M;  4WYQ B;  3EPJ A;  4MQY A;  1N33 E;  1X48 A;  1MEY C;  1PDA A;  1HNW E;  2YRH A;  2JEB A;  4BA1 A;  4MU1 A;  2V85 A;  4LF6 E;  1Z5B A;  2V86 A;  2C39 B;  4AIM A;  4FW3 A;  1I94 E;  3IWD A;  1N32 E;  4TUI A;  4DR7 I;  2EN7 A;  1UBD C;  3M99 B;  4DU7 A;  2BM1 A;  4WPY A;  3LNU A;  3T1Y E;  1UEK A;  1E3P A;  2ENH A;  1VIS A;  2LJH A;  3K85 A;  2EMY A;  2EMI A;  2EN1 A;  4R2A A;  2HJJ A;  5A6B A;  2E1R A;  3K6Q A;  4BC7 A;  4LF4 I;  3EQ1 A;  4DR2 E;  2ZBK B;  4JI4 I;  1K47 A;  3GCM A;  4X62 I;  3EPL A;  1YPN A;  2J7K A;  2X7I A;  1X49 A;  2DGC A;  5DNX A;  1YHC A;  5KL4 A;  2UXC I;  2EN3 A;  3VYX A;  2EMH A;  1A1H A;  3T1H I;  2ODR C;  2WNR A;  1UIL A;  5AE1 A;  2JWO A;  2FV4 B;  1Z5A A;  2ADR A;  1RMD A;  3LLH A;  1TF6 A;  4O4K A;  2UU9 E;  4OO1 C;  4O24 A;  4P7A A;  2Z5E A;  1ZM9 A;  2PO2 B;  2EOM A;  5IV8 B;  4MYU A;  4DV2 I;  4DV5 I;  1KIJ A;  2EMK A;  4DR2 I;  1ZR9 A;  4JV5 I;  4LF5 E;  2RQL A;  2PO2 A;  2L2M A;  1EKZ A;  4F54 A;  1XXE A;  4LFB I;  1H72 C;  2EOY A;  4DR3 E;  3H4L A;  1FWL A;  4F2J C;  2F1D A;  4HXZ A;  1XMQ E;  1EH6 A;  3CDI A;  2L2N A;  4HYM A;  4XTJ A;  3CWV A;  4MU3 A;  2LTS A;  1FKA E;  4DV7 I;  4R2E A;  4X62 E;  3VK6 A;  1H74 A;  1ZXN A;  1A1J A;  4USM A;  4BA2 A;  4USK A;  4IFD C;  4I8O A;  4OO1 D;  4NZV A;  3PYD A;  1IQO A;  5JEA C;  3UHM A;  1Y6Z A;  2B7V A;  2DRP A;  2G7H A;  2EQ1 A;  4IS1 C;  4IZK B;  3D4J A;  1Z1B A;  4DPW A;  2DB2 A;  4QNJ A;  4WUD A;  4DV0 I;  3CDJ A;  4JI1 I;  3GLL A;  4DUY I;  2EPR A;  4U3D A;  4BC9 A;  2KOU A;  3C4T A;  2V2Z A;  1ZM4 A;  1PJS A;  5FLX Q;  3TQM A;  1USU A;  4R03 A;  3B82 A;  1IBL I;  2PNM A;  5C0X C;  2C39 A;  4OX9 I;  4DV6 E;  2X36 A;  4JI7 I;  1SFE A;  2GO3 A;  2JEB B;  5BR8 E;  4IZK A;  4WXD A;  4JI3 I;  3AUZ A;  4ZYG A;  4X8W A;  2RPC A;  4JI6 I;  1NZ0 A;  1R6L A;  2XEX A;  4K0K E;  2DEJ A;  3OTO E;  1IMU A;  3KWR A;  4FW5 A;  1STU A;  4GQU A;  3H1C A;  4LF9 E;  3F0N A;  1X6F A;  5FWK A;  4IFD D;  4R1F A;  3HPZ A;  4N4R B;  5AC5 A;  4BA2 B;  2EMA A;  1YFH A;  2V8Q B;  1X47 A;  4DR4 I;  2R42 A;  5CFF E;  2EN4 A;  4ISA A;  4IJD A;  1N36 E;  2ZIT A;  4DR7 E;  2NN6 C;  3ADL A;  2LVH A;  4R2R A;  2JR1 A;  2UUC I;  2C37 A;  3U1Y A;  2MDG A;  2EM2 A;  4JI2 E;  1XHK A;  3L00 A;  1D6T A;  1S4E A;  4AQY I;  2GQ0 A;  4MYT A;  2EMG A;  2FTX B;  2RS6 A;  1YUI A;  1PIE A;  4OO1 B;  4DU8 A;  3ADI A;  2VQE E;  2WCC 3;  2PO0 B;  1HK7 A;  1PJQ A;  2EPX A;  5JEA E;  1J5E I;  2HFS A;  4DV3 E;  4J8Z A;  4J3D A;  4LF8 I;  1TF3 A;  4JI4 E;  2YRK A;  4R2P A;  5C0X F;  4IFD E;  2YTO A;  1BB8 A;  1X6H A;  4GZN C;  1R6M A;  2YRM A;  1N0U A;  3PRY A;  5IXM B;  5IWA E;  2HKJ A;  2JT2 A;  2EM8 A;  5C0X A;  4BHB A;  2LRS A;  1BBO A;  2Q2E B;  3KRN A;  4LPF A;  4U3B A;  3JAM Q;  4DV0 E;  2CPN A;  4O43 A;  4JI5 E;  2NUE A;  2NAB A;  4OO1 E;  3KZY A;  3QG5 C;  4B3R E;  4MU4 A;  2GPI A;  3M7N G;  3B8H A;  4DR5 E;  2EOF A;  4WSG A;  1P42 A;  1XNR I;  5C0X B;  4LF5 I;  1RC7 A;  4DPY A;  3Q1Q A;  5LMU E;  1EA6 A;  2YSO A;  5AE2 A;  3DD6 A;  4NXN I;  1XNQ E;  1ZBT A;  1JK1 A;  5K36 E;  4MU0 A;  4NHR A;  1T4L B;  2R3V A;  3ZZ0 A;  2HK3 A;  4GKK I;  4N3O A;  2LMZ A;  1GQE A;  3J80 Q;  2MKN A;  2L2K B;  1EH8 A;  2V87 A;  3DJW A;  5K36 F;  1KTV A;  3F6G A;  1OYP A;  5F3W A;  2AE8 A;  3P76 A;  2EL6 A;  4LFA E;  1RQ0 A;  3ZKB A;  4R2C A;  4BMJ A;  2B7T A;  2E72 A;  1BKN A;  2YT4 A;  2N3G A;  1J5E E;  1YYW A;  2YSP A;  2IES A;  2B3T B;  1Y5Y A;  5A69 A;  4F6M A;  2E5L I;  5EKW A;  3KZZ A;  4AQY E;  4FW6 A;  2K7I A;  4LTY A;  2YPN A;  4KQV A;  4OO1 F;  1HR0 E;  2RS7 A;  2BV3 A;  2WBU A;  2EOS A;  3IWB A;  3H09 A;  2N8X A;  2RSI A;  3JU0 A;  3JAM C;  4X9J A;  4WUB A;  2VE7 C;  4GKK E;  2BB8 A;  2JYA A;  5ADZ A;  5EL9 A;  3OTO I;  2UUC E;  3M7N D;  1NHI A;  4JI0 E;  3PS3 A;  1EI1 A;  3QT7 A;  2O1W A;  4PU9 A;  2EN8 A;  2EM0 A;  2RTX A;  2JXP A;  1LLM C;  2JP9 A;  2O3Z A;  4I3H A;  5BR8 I;  2EMX A;  4ZYE A;  2CZ9 A;  4JI6 E;  1PKP A;  5KL3 A;  4F9B B;  3T1Y I;  2PRT A;  3NZK A;  2FGG A;  3LTO A;  4X65 E;  1E3H A;  1ZBQ A;  2VQF E;  3BGH A;  1A1F A;  4LF7 I;  1N32 I;  2LV2 A;  4DMI A;  2J7J A;  3J81 C;  4GKJ I;  1KYQ A;  3PYG A;  2M9A A;  1PJT A;  2EPO A;  5IWA I;  2M7Q A;  2M1S A;  2V34 A;  4X66 I;  1HNX E;  4DR1 I;  5A6J A;  3C4B A;  1DAR A;  4BS9 A;  2ZM6 I;  5DRR A;  1WHQ A;  2DMI A;  2AJ4 A;  2LE2 A;  2JOB A;  2A2C A;  1N34 I;  2PNL A;  4OZE A;  2O1T A;  4DV4 I;  1HNZ I;  4B3T I;  2Q8U A;  4DV1 I;  2WZO A;  2UXD I;  3B4T A;  4DV2 E;  2EOE A;  1DI2 A;  2LJP A;  2EMZ A;  4IFD F;  1DGC A;  1XMO I;  4YHH I;  3WU3 A;  2JVA A;  4NXM E;  1Z0W A;  2EZ6 A;  5LLQ A;  2UUB E;  5T6J A;  1MGT A;  3P1X A;  2V89 A;  5KL5 A;  4DV7 E;  2ODR D;  1NHJ A;  1UDQ A;  5DRO A;  4DPT A;  4DR5 I;  1EH7 A;  2DMY A;  4O5G A;  2YZT A;  2HHH E;  3QT8 A;  4HEI A;  4B3M E;  3HTX A;  2EM5 A;  1RR9 A;  5DNL A;  2OI2 A;  4HTG A;  1XNQ I;  2LUQ A;  1G2D C;  1G2F C;  4B3S E;  4K0K I;  4F6N A;  4QNK A;  3ZKD A;  1XMQ I;  1KVK A;  2WNR B;  3WU6 A;  3VHT B;  4KHP E;  3BF2 A;  3WU5 A;  4R8O A;  1NCS A;  4JYA E;  2EFG A;  2YU8 A;  4WXC A;  2K4V A;  4DKK A;  4RPF A;  5GME A;  2UUB I;  2L92 A;  4JI7 E;  2Z5B A;  5K36 D;  4M30 A;  1T4N A;  2J65 A;  2EOZ A;  3M6A A;  4M2Z A;  1ZM3 A;  2EJ4 A;  3J7A G;  2JE6 B;  3K17 A;  4KZS A;  3THN A;  2F8B A;  2VQE I;  4MLV A;  1F2I G;  5AC4 A;  2UU9 I;  4PRV A;  4GKJ E;  4L5N C;  4JI2 I;  1A6F A;  1H73 A;  2DSY A;  2WW4 A;  1MX0 A;  4LF7 E;  4DR1 E;  1HNX I;  4BBY A;  1N33 I;  2UXB E;  2EOJ A;  2IHR 1;  1WHN A;  2YTP A;  3AV0 A;  2EMC A;  2ZM6 E;  4M9V C;  2NA2 A;  1Z59 A;  4DXL A;  3UK3 C;  2N3H A;  4LF9 I;  4ED4 A;  2LCE A;  5A6A A;  2DLK A;  2M4I A;  1YSA C;  1MG7 A;  1I94 I;  4MDT A;  4NXM I;  2A25 A;  2NN6 D;  3U1K A;  3MHH C;  2NN6 A;  2PNZ B;  2H36 X;  2EM6 A;  2E1M A;  2ENC A;  2MDR A;  4P7D A;  1L4S A;  1Y4U A;  1Z5C A;  2R1F A;  4BA1 B;  4LCF A;  4URL A;  1TN9 A;  4OKG A;  2LO3 A;  1N36 I;  2YTJ A;  2NN6 B;  2CT1 A;  2PNZ A;  3L7Z A;  4FWG A;  4GEQ B;  4JI0 I;  1FJG E;  4ZYD A;  5KL7 A;  3DF6 A; 
#chains in the Genus database with same CATH homology
 3J80 C;  4Z7Y A;  1Y4S A;  2BM0 A;  3MSW A;  4LF6 I;  4X66 E;  1IBM I;  4B3S I;  1S16 A;  4L8N A;  4LFA I;  5FLX C;  2Z5C A;  2L33 A;  4IZJ A;  4OX9 E;  5LMN E;  1SR9 A;  2VF1 A;  3HXL A;  1Z0T A;  2HKE A;  2JY9 A;  2L3J A;  4WUC A;  2HHH I;  4JYA I;  2UXB I;  2NPF A;  4LFB E;  4UTG A;  1XMO E;  1Z0E A;  4HAC B;  2HK2 A;  4M1K A;  4LFC E;  4DV4 E;  2V83 A;  5LMN I;  5AAS A;  5A2Q C;  4DUZ I;  5GMD A;  3PYE A;  4DR6 E;  2V88 A;  3IWC A;  4IZJ D;  1QU6 A;  4NXN E;  1O0W A;  2UUA I;  3LML A;  3V2U C;  1H7S A;  1KKH A;  1HNW I;  1RRE A;  1IBK I;  4JG4 A;  2EWL A;  4BCA A;  4LF8 E;  4FWD A;  4X64 I;  3V5R A;  3ADG A;  1IBM E;  4DR6 I;  2RSM A;  1HNZ E;  4B3T E;  2KHX A;  2DEI A;  1DQ3 A;  4DR4 E;  2CGE A;  1OJ4 A;  4LFC I;  1ELO A;  4WFT A;  2L8T A;  1WUU A;  2MC6 A;  3ADJ A;  5A2Q Q;  1J26 A;  4F9C B;  1YZ9 A;  1U2R A;  4LU9 A;  3ZM7 A;  4JI1 E;  4IZJ B;  2UXC E;  1N0V C;  2MC5 A;  4P78 A;  2JOX A;  3ZZT A;  4DV3 I;  3FIG A;  4YY3 E;  4KHP I;  4EMD A;  1IBL E;  4F9A B;  4JI8 E;  4DV6 I;  1Z0G A;  4DUY E;  1NHH A;  2E5L E;  2V2Q A;  3ZOQ B;  2A2D A;  2L3C A;  2VQF I;  1PVG A;  3OML A;  2KON A;  4DUZ E;  1GZ6 A;  3HPS A;  1XNR E;  1IBK E;  3QT6 A;  3F6H A;  1UHZ A;  3K1J A;  2O1V A;  3HUL A;  5IT9 C;  4YHH E;  2V2V A;  3WU4 A;  4OOG C;  4X64 E;  3GON A;  4P52 A;  1ZM2 A;  3QT5 A;  5LMU I;  2NUG A;  3J7Y p;  4DPX A;  3B78 A;  3T1H E;  2IOQ A;  4JV5 E;  4FN5 A;  1YYK A;  1FNM A;  2GS8 A;  4JI5 I;  2DIX A;  4DR3 I;  4TUG A;  1FI4 A;  3PYF A;  4LF4 E;  3J81 Q;  1YYO A;  1Z0C A;  5LL6 R;  4DV1 E;  2UXD E;  2B9D A;  2Z5B B;  2UUA E;  1B62 A;  2L6M A;  2LUP B;  4B3R I;  4HAC A;  1WXR A;  2VF3 A;  3HQ1 A;  2O1U A;  2LBS B;  4FWH A;  1FWK A;  3ZZU A;  4B3M I;  3JTZ A;  4WSP A;  3VYY A;  2CG9 A;  4DPU A;  2Z5C B;  1ZXM A;  1T4O A;  5IT9 Q;  2F4V E;  5L3J A;  5AE3 A;  1Z0B A;  5DNY A;  1B63 A;  4PRX A;  4UT4 A;  3Q6N A;  3RMP A;  2V8P A;  2HFU A;  1HR0 I;  4HY1 A;  4JI8 I;  4ZVI A;  2IOP A;  3HJC A;  4DV5 E;  4Q28 A;  1H7U A;  3Q6M A;  4Z7C A;  4JI3 E;  4X65 I;  3P06 A;  1QZR A;  2NUF A;  1Z0V A;  3LPS A;  1N34 E;  1FJG I;  1MU5 A;  2LTR A;  1USV A;  4YY3 I;  3J7A M;  4M0V A;  4WYQ B;  1N33 E;  1X48 A;  1HNW E;  2V85 A;  4LF6 E;  1Z5B A;  2V86 A;  1I94 E;  3IWD A;  1N32 E;  4TUI A;  4DR7 I;  4DU7 A;  2BM1 A;  4WPY A;  3LNU A;  3T1Y E;  1UEK A;  1VIS A;  2LJH A;  3K85 A;  2E1R A;  3K6Q A;  4BC7 A;  4LF4 I;  4DR2 E;  2ZBK B;  4JI4 I;  1K47 A;  4X62 I;  2J7K A;  2X7I A;  1X49 A;  2UXC I;  3VYX A;  3T1H I;  2ODR C;  1UIL A;  5AE1 A;  2JWO A;  2FV4 B;  1Z5A A;  3LLH A;  2UU9 E;  4P7A A;  2Z5E A;  1ZM9 A;  4DV2 I;  4MYU A;  4DV5 I;  1KIJ A;  4DR2 I;  4JV5 I;  4LF5 E;  2L2M A;  1EKZ A;  4F54 A;  4LFB I;  1H72 C;  4DR3 E;  3H4L A;  1FWL A;  4HXZ A;  1XMQ E;  2L2N A;  4HYM A;  4XTJ A;  3CWV A;  2LTS A;  1FKA E;  4DV7 I;  4X62 E;  3VK6 A;  1H74 A;  1ZXN A;  4USM A;  4USK A;  4I8O A;  3PYD A;  1Y6Z A;  2B7V A;  2G7H A;  4IZK B;  3D4J A;  4DPW A;  2DB2 A;  4WUD A;  4DV0 I;  4JI1 I;  4DUY I;  4BC9 A;  2KOU A;  3C4T A;  2V2Z A;  1ZM4 A;  5FLX Q;  1USU A;  4R03 A;  3B82 A;  1IBL I;  2PNM A;  4OX9 I;  4DV6 E;  2X36 A;  4JI7 I;  5BR8 E;  4IZK A;  4JI3 I;  3AUZ A;  4X8W A;  4JI6 I;  1NZ0 A;  2XEX A;  4K0K E;  2DEJ A;  3OTO E;  3KWR A;  1STU A;  4LF9 E;  3F0N A;  5FWK A;  4R1F A;  3HPZ A;  2V8Q B;  1X47 A;  4DR4 I;  2R42 A;  5CFF E;  1N36 E;  2ZIT A;  4DR7 E;  3ADL A;  2UUC I;  2JR1 A;  4JI2 E;  1XHK A;  1D6T A;  1S4E A;  4AQY I;  2GQ0 A;  4MYT A;  2FTX B;  2RS6 A;  1PIE A;  3ADI A;  2VQE E;  1J5E I;  1HK7 A;  2HFS A;  4DV3 E;  4J8Z A;  4LF8 I;  4JI4 E;  1N0U A;  3PRY A;  5IWA E;  2HKJ A;  2Q2E B;  2LRS A;  3JAM Q;  4DV0 E;  2CPN A;  4JI5 E;  2NUE A;  4B3R E;  3B8H A;  4DR5 E;  1XNR I;  4LF5 I;  1RC7 A;  4DPY A;  3Q1Q A;  5LMU E;  1EA6 A;  5AE2 A;  4NXN I;  1XNQ E;  1ZBT A;  1T4L B;  2R3V A;  3ZZ0 A;  2HK3 A;  4GKK I;  4N3O A;  2LMZ A;  1GQE A;  3J80 Q;  2L2K B;  2V87 A;  3DJW A;  1KTV A;  3F6G A;  5F3W A;  4LFA E;  1RQ0 A;  3ZKB A;  4BMJ A;  2B7T A;  1BKN A;  2YT4 A;  2N3G A;  1J5E E;  1YYW A;  2B3T B;  2E5L I;  4AQY E;  4LTY A;  4KQV A;  1HR0 E;  2RS7 A;  2BV3 A;  3IWB A;  3H09 A;  3JU0 A;  4WUB A;  3JAM C;  2VE7 C;  4GKK E;  5ADZ A;  3OTO I;  2UUC E;  1NHI A;  4JI0 E;  1EI1 A;  3QT7 A;  2O1W A;  4PU9 A;  5BR8 I;  2RTX A;  4I3H A;  2CZ9 A;  4JI6 E;  1PKP A;  4F9B B;  3T1Y I;  2FGG A;  3LTO A;  4X65 E;  1N32 I;  1ZBQ A;  2VQF E;  4LF7 I;  4DMI A;  3J81 C;  4GKJ I;  3PYG A;  5IWA I;  2M7Q A;  2M1S A;  2V34 A;  4X66 I;  1HNX E;  4DR1 I;  3C4B A;  1DAR A;  4BS9 A;  2ZM6 I;  1WHQ A;  2AJ4 A;  1N34 I;  2LE2 A;  2JOB A;  2A2C A;  2PNL A;  2O1T A;  4DV4 I;  1HNZ I;  4B3T I;  4DV1 I;  2WZO A;  2UXD I;  4DV2 E;  1DI2 A;  2LJP A;  1XMO I;  4YHH I;  3WU3 A;  2JVA A;  4NXM E;  1Z0W A;  2EZ6 A;  2UUB E;  3P1X A;  5T6J A;  4DV7 E;  2V89 A;  1NHJ A;  4DPT A;  2ODR D;  4DU8 A;  4DR5 I;  2YZT A;  2DMY A;  2HHH E;  3QT8 A;  1RR9 A;  4B3M E;  3HTX A;  2OI2 A;  1XNQ I;  2LUQ A;  4B3S E;  4K0K I;  3ZKD A;  1XMQ I;  1KVK A;  3WU6 A;  4KHP E;  3WU5 A;  4R8O A;  4JYA E;  2EFG A;  4RPF A;  2K4V A;  4DKK A;  5GME A;  2UUB I;  2L92 A;  4JI7 E;  2Z5B A;  4M30 A;  1T4N A;  3M6A A;  4M2Z A;  1ZM3 A;  3J7A G;  3K17 A;  4KZS A;  2F8B A;  2VQE I;  2UU9 I;  4PRV A;  4GKJ E;  4L5N C;  4JI2 I;  1A6F A;  1H73 A;  2DSY A;  2WW4 A;  1MX0 A;  4LF7 E;  4DR1 E;  1HNX I;  4BBY A;  1N33 I;  2UXB E;  2IHR 1;  1WHN A;  3AV0 A;  2ZM6 E;  1Z59 A;  4DXL A;  2NA2 A;  2N3H A;  4LF9 I;  4ED4 A;  2M4I A;  1I94 I;  1MG7 A;  4NXM I;  2H36 X;  2MDR A;  2E1M A;  1Y4U A;  1Z5C A;  4P7D A;  4URL A;  1N36 I;  4FWG A;  4GEQ B;  4JI0 I;  1FJG E;  4FW9 A;  2F4V I;  3DF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...