4LFAK

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lfaK00
2UUBK 4DR3K 2UXBK 4JI0K 3J7AP 4CW7B 4JI6K 1IBLK 4LFAK 4NXNK 4JI1K 4LF8K 1J5EK 4LF5K 5AJ3K 5LMNK 4DV7K 4JI7K 3J80O 4DV0K 1HNWK 4LFBK 4JI3K 4LF9K 2UUAK 5IT9O 4YY3K 1I94K 4X65K 4DR1K 4KHPK 3T1YK 3T1HK 1N32K 3J7YP 4JYAK 4DV6K 2VQFK 2E5LK 4LF4K 2UUCK 1N33K 4JI4K 4B3MK 1FJGK 3JAMO 3J81O 4B3RK 4OX9K 1XNQK 1XMOK 4DV1K 4B3TK 4LF6K 4DV5K 4YHHK 4GKKK 2UXDK 1IBKK 5LMUK 4X64K 4NXMK 4GKJK 4DR6K 4K0KK 3OTOK 4JV5K 5IWAK 4X62K 4X66K 1N34K 1XMQK 4JI5K 4DUZK 1HNZK 5BR8K 2HHHK 4JI2K 4CVNE 1N36K 4LFCK 2UXCK 4DUYK 4DR2K 1HNXK 4LF7K 1XNRK 4V19S 4DV3K 4DV4K 1IBMK 4B3SK 4DV2K 4DR4K 2UU9K 2F4VK 1HR0K 4DR7K 2ZM6K 5LL6Z 4DR5K 5FLXO 4AQYK 4JI8K 5A2QO 2VQEK
chains in the Genus database with same CATH superfamily
1RBRA 1HMVA 1JKHA 4NYFA 1XC9A 4FJHA 2WC9A 1VSJA 3PV8A 1IBLK 1OH8A 1BOTO 4JLHA 2NRRA 4O8UA 4DF8A 3AO3A 2OZMA 5SZTA 3UKUB 3TR8A 5LMNK 3HBTA 5LJVA 3C6TA 2Q0UA 2HMPA 3TAEA 4CFCA 2HHSA 4CJKA 3KIOA 4KHPK 4OLBA 4L3QA 1P8ZA 1NKCA 2YV0X 2X74A 1JLCA 5M1KA 1ESVA 3SAGA 3CFPA 4JRPA 3WNEA 2VGNA 2YNHA 1TAQA 4OGEA 5EU7A 2V7YA 4IOCL 2E6MA 4J2AA 4A2AA 5AQWA 4GKKK 2VG5A 1NGBA 2GTDA 2G8IA 1XWLA 5BPNA 4B1WB 3GE1A 1HX1A 3VPZA 1LOTB 1BISA 1NKBA 1LAWA 1YT3A 3DRRA 3NDKA 5GAGP 4CEZA 3MWPA 4FK2A 1P90A 4IEIA 4OKJA 4YOWA 1XUPO 1ATSA 3ZETB 3OY9A 3KK2A 1BIZA 4JKCA 1S1WA 4F4KA 2VG7A 4MQ3A 4I7FA 4DF4A 1RDWX 4MO4A 2X6NA 3O3HA 3HP9A 4Z4GA 3OS1A 5AQPA 5CHIA 1EKEA 1DTQA 4A5AA 1K9MO 2O8DB 3F2KA 1RDUA 4AHTA 1KRPA 2NRHA 4H4OA 3VTHA 1JLEA 1B9DA 4GNIA 1T8EA 4CK3A 3EZWA 1NNEA 3CFOA 3D2FB 3QINA 1J53A 4DSKA 2HHVA 4DSJA 3TTFA 1GOAA 2HBKA 5AQUA 3ZSQA 3TAGA 1BI4B 3V9SA 1RT1A 3LDNA 2CGKA 4MO5A 1Z25A 1JCGA 4O44A 4DV0K 5I42A 4CJ7A 2QKBA 1K8AO 4CF0A 2VYPA 2UUAK 3DRSA 3PX4A 1NK4A 4FM1A 1ASVA 1HPZA 4KH6A 3ZSWA 1KAZA 4EZ9A 5BN8A 4W5QA 3E1YA 3L2UA 3T1YK 1DGKN 1I39A 2HHQA 1C0FA 3DLEA 3ZT4A 3SUOA 1JLGA 5EY4A 1BL3A 4RW7A 5KPRA 3OYHA 3HM9A 1A5XA 2F7TA 2Z1HA 2I5JA 3TU5A 1MWKA 4A59A 4NO7A 1KSPA 2F8SA 3UKUA 4W5NA 2HBLA 3JAMO 2E2QA 2Q0RA 1U4BA 5DK5A 5TKWA 4DLEA 1FW6A 5MLCQ 4B3TK 3ZSVA 3NCIA 1VK0A 3R1XA 1L3TA 1TL3A 4DQQA 3LP1A 1QTMA 3FZLA 3IDHA 1JJ2M 2ITGA 1VSEA 3SLCA 3MX5A 4QCLA 4CZFA 3KTQA 2QWMA 4N47A 4CJ4A 4DU1A 3G10A 1U45A 4CEDA 1J6ZA 2OPQA 1RFQA 1C0TA 2XY5A 2Z1JA 5AR0A 3AVGA 5HRRA 3CMAN 3I33A 3CCMN 3V81A 2QWOA 3OYNA 5C42A 3SYZA 4KHQA 3MXIA 4GV9A 4DTSA 4DV2K 3MCPA 1VSFA 5JVHL 5FPEA 2CGJA 4IJNA 3M3ZA 3HP6A 4ZTJA 4FPBA 3HJFA 3QBWA 4FLZA 3O1WA 4E0DA 1HPMA 1YIJN 4O4GA 3VEVA 3ZEUB 3K9JA 1RT6A 4EP5A 4ELTA 1OH7A 3GBTA 3I0RA 3ZETA 3UIQA 4BC5A 5ADXA 3CETA 3NFAA 4FJJA 3AA2A 3LP2A 3MAQA 4DSEA 1NG9A 2BUPA 1YTUA 1RDBA 5AFUH 1B9FA 3AA5X 4YY3K 2O8DA 2FSJA 5C24A 4JKGB 3LWLA 4BR4A 3L4IA 3LZJA 1SZ2A 4OLAA 1N32K 2FC0A 3AVMA 3K59A 1Y64A 4CZIA 3D2FA 5BRHA 3B8AX 3UB5A 4CJ5A 4OPKA 1WUAA 3AO1A 1GLDG 1BA1A 1BI4A 3QIOA 3J81O 2H3GX 4RW6A 2YNGA 1F21A 4U7BA 5F1XA 4PHTX 3AVHA 2QKKA 1NMNA 2KZMA 3H45C 3VQPA 1IBKK 4CERA 1VRUA 1SUQA 2HB5A 4G1QA 4DFKA 2QEXN 4CZKA 3AVAA 3K5MA 4M3XA 1BDGA 3QESA 4X62K 4JS4A 4K41A 3NH1A 3H1QA 5CYQA 4BG8A 3MXMA 4DQIA 2G8UA 4JI2K 3NH2A 2FF6A 1RBTA 3ATUA 3AA4A 4BRAA 2E2OA 3KK3A 3QERA 1RBUA 2OTJN 3J8AA 1VAZA 4KH5A 1S3XA 3W3DA 1NJZA 1FXXA 4MDBA 4YOXA 4DR4K 2QWPA 3U3GA 3K9KA 1U49A 3LDLA 3FE1A 5LL6Z 3K5LA 3TWHA 3VGMA 1LCUA 3THXB 5JVGL 3EE8A 3U3YA 3VQ4A 3AVJA 4BR9A 2E20A 4LSNA 1ASWA 2YJEA 3WUHA 3DRPA 5CY4A 4YDUC 3RR8A 2P9LB 3CJ9A 3V9UA 5FROA 3WXMB 3J80O 1JLBA 5HRSA 2NLXA 3ZX2A 1T03A 1KLNA 4C8KA 4KFBA 3P31A 2YHBA 2O8BB 2GELA 4IO9L 4WQ4C 3GG4A 1OH5A 3P5JA 3V1OA 3L8BA 2PZSA 4E7IA 3ZEUA 4RG8A 2HF4A 3LL3A 4EP4A 4DTXA 3NF6A 2O4GA 4FWQA 4ICLA 4B3MK 4JEPA 3MN7A 1N6QA 2GWJA 2UYTA 3M8PA 3S41A 4MLHA 2IC3A 1HNIA 4I9LA 2QW9A 1KC8O 1C1CA 1W0HA 3OHRA 3O4WA 3VQBA 4BE0A 4NXMK 4CJPA 4DQRA 4JKGA 3CJ7A 4FLWA 3BF1A 1N34K 2OYQA 2D1KA 1BIUA 4BDYA 3AVKA 5J2QA 1S1VA 4CEAA 4JK9A 4AHVA 3A5LC 1SAZA 3AAQA 3KHYA 1DLOA 1YVUA 2P51A 1KVCA 1C6VA 1T3VA 4NCGA 5M1FA 4Z4EA 4WFAL 5J2MA 1QSLA 4J2EA 3VQ8A 2YCHA 1HRHA 4V19S 1NGDA 3CIPA 3L2RA 4DV4K 4FL9A 1Z6RA 3MK6A 3V9ZA 4FVMA 1WOQA 1LV5A 2PFUA 4CHYA 4KHNA 1DKGD 4C1NI 1KLMA 4JK8A 1BQMA 2D0BA 3MEEA 4H0TB 3BY5A 5I9EB 3OYMA 1HR0K 2ZE2A 5FPMA 4DTMA 4DG1A 2GBZA 1NGGA 2ZGYA 3SK3A 3ULDA 4CI6A 4JI0K 3QFPA 1KCFA 2DTUA 1Q7YO 2HW3A 4FCYA 1VSDA 1NK8A 5AZJB 4OPAA 1VQMN 1CLQA 2KFNA 2XY8A 1U04A 4M45A 3LPUA 4B8CA 4YOVA 4B9MA 4ID5A 4FM0A 4A61A 1L3UA 1GLEG 4E7HA 4AHRA 4KB1A 1V4TA 3FZFA 1KQSM 1SL2A 4DSIA 1BUPA 4F2RA 1WSIA 2E2PA 4CCHA 1XQSC 1OVYA 5AQYA 4JKFA 1NM1A 1D9DA 1S1TA 4BDZA 3V9WA 3JSMA 3CCEN 4Z4IA 3LDPA 2OCEA 4HUGA 2ASPA 3THXA 2YHXA 5BPMA 5EOYA 2DPNA 3KK1A 3BP8A 3LWMA 3NVKA 2E88A 4CHOA 4CEFA 1X3NA 3A5MC 4CGJA 2P9LA 1D4XA 3SI6A 3CXCM 4JD2B 3CM5A 5LMUK 1NOZA 3CERA 3DYAA 4ISFA 1H1VA 1BWFO 2O8BA 4CZEA 1FKOA 1T05A 3DJCA 3AO4A 3O1BA 2BGGA 4FK4A 1GOBA 4CIFA 1TL1A 2FXUA 4XEIA 3QB0A 3ZT0A 4EAHD 4IG0A 3CI5A 5GAEP 2A5XA 2FLOA 4KHYA 4FLYA 2XHBA 4ZTFA 1KVAA 3HSCA 3VENA 4C8NA 1XI1A 2Z1GA 1VSLA 2YHWA 3NAEA 2UU9K 5GIOA 4DFJA 1TKZA 3T7ZA 1RT4A 1RT5A 3THYB 3A8YA 4W5OA 3AGKA 3Q7BA 2BDPA 4DTRA 5GAHP 4FZYA 4E89A 4ZHRA 4M3UA 1A5WA 4KRFA 5HOOA 4DTJA 4UY8O 2QWNA 3OYFA 1ZC6A 3N4QA 1C0MA 4DTOA 4DTUA 4JI3K 4A2BA 2PY5A 2Q1NA 4X65K 2E1YA 4DR1K 1VRTA 3AVNA 3F5TA 3AVFA 3ISNC 4LSLA 4BWMA 3WT0A 2HHTA 3OYDA 3M6GA 2XO7A 3KKSA 3S3NA 2HVIA 4O5FA 1NK6A 1TKXA 3V9XA 3AO2A 1J9AA 2D0AA 1NGCA 2YI1A 4CGFA 2HVHA 4EHTA 5AZJA 3SNNA 1VQNN 1YJWN 3AO5A 3RR7A 4M41A 3QIPA 4CJRA 4CJFA 5E41A 3QDKA 3IKMA 1WSFA 3ASMA 3TTCA 4R79A 3OYCA 2GEMA 1NOYA 4IOXA 3FZMA 3OW2M 4BC3A 3ZYYX 3UE5A 3BDPA 3O4QA 3VQAA 5JS1A 1IV0A 2GX9A 1EETA 4DHYA 2NRVA 3QEIA 4H0XB 4KREA 1UA1A 3CQYA 3CPEA 2P9SB 3CPWM 1N36K 3SCXA 2ITMA 4B8AB 3NGYA 2WUSA 4BGAA 3OS0A 3OBYA 1ZBSA 4ELVA 2WONA 4DWIA 1HUXA 3HT3A 1SKSA 4JD2A 3RMAA 4EHUA 1EWRA 3I56N 5DM7L 2HNDA 3GOIA 2HHWA 4PQUA 4G9ZA 4CF8A 4J2DA 1RT3A 1EP4A 4DR7K 4CZHA 2AP1A 3BZKA 4K43A 2IGIA 4FJ8A 2RKIA 3JS6A 3A2FA 2GUPA 1NU0A 1V4SA 4K8ZA 3C65A 2FBXA 1YVNA 1ATNA 4O0JA 4CGIA 2KW4A 1NGEA 4FW1A 1E3MA 2A42A 4J8FA 3DLHA 5AZIB 2ATQA 2JGUA 2D5RA 4CECA 3SAFA 3CCQN 3HM8A 3CCRN 4H8KA 3MEGA 2HHUA 4DQ8A 1YF5L 4FK0A 4K8XA 1R0AA 1EQYA 4CJTA 4RCHA 1VQON 2FSKA 4RTFD 2IIRA 4LC9B 4M3ZA 4BRPA 3TABA 1SQKA 5H1SQ 4BRDA 1HJRA 1U47A 3THYA 5BRFA 3C94A 4Z94A 1VHXA 4JI4K 2YX6A 4Y1CA 1N8RO 1HYSA 3QETA 2V52B 3VGKA 4B1ZA 3NBPA 3HOTA 1LW0A 5BN9A 2I7PA 4IXCA 2D0PA 3ZSYA 1Z26A 3ULEB 3HZ6A 4CHPA 3O3GA 2A3ZA 4BR2A 1NJWA 3PY8A 2P5GA 2DFHA 2NZTA 4C8OA 3SJJA 2PYLA 3SBGA 1O1WA 1JCEA 1ITGA 3U9ZA 3MN6A 4BR7A 3VESA 3F9KA 3T3FA 4E7JA 3ALYA 1RTIA 3I55N 2HHHK 3KLFA 5AQQA 4CIGA 4XIUA 1TKDA 3QO9A 3EO3A 2OZSA 5BRDA 1NMDA 3GDQA 4BC4A 5FDLA 4IZ9A 1JCFA 1G99A 3IRXA 4FJ5A 3ZLJA 3VQQA 3QEVA 4IWVA 1MA9B 5AQOA 4CEOA 1SKRA 2BH1A 2HBJA 4CJUA 3KLHA 4BRGA 3Q7CA 4NLBA 1KFDA 4E3SA 4FJGA 2F4VK 1TAUA 5J1EA 4WQ5C 3TSUA 5C10A 5CZ2A 4BG9A 1OH6A 3MDQA 2UUBK 3D7EO 2CH5A 2P9SA 3CJ1A 3O8MA 4NXNK 4BRLA 2KKZA 4PL8A 4AHCA 3U8XA 2IVPA 3FFIA 3PSIA 1MDUB 2G8FA 4QAGA 4YNQA 1IG8A 2A1RA 4CJVA 1EWQA 4RW8A 3LM2A 2EX3A 5LY3A 2F96A 2A41A 3VQEA 1S6PA 3ENOA 4M3RA 1NK0A 1WAFA 3O9RA 3KWIA 2O8CB 1YITN 4PA1A 1NLVA 1NK9A 1HKCA 4FWRA 3SPZA 4BQLA 3TSQA 3PX6A 4JKBA 3N4PA 3MECA 3HXMA 1QVGM 4GY2B 4YDUA 1R59O 4B9SA 3DXMB 3K5OA 1S72N 3AARA 3KK7A 3F73A 5AZIA 2YHAA 2G8HA 4RWTA 5HP1A 4DV1K 1QSYA 2UXDK 3G6EN 4OPJA 4WQ4A 3LDOA 3VETA 4IBNA 4HTLA 1W2BM 4CBWA 2G8KA 2OPPA 4OPHA 3EN9A 3WNGA 3VEZA 3OTOK 3VF6A 4JV5K 3V1RA 4FJ9A 3DLLL 2P5OA 1S5JA 2O4IA 1CXQA 1ZBHA 5KQDA 5E26A 4IEEA 5BR8K 1QZ5A 1RTDA 1C1BA 1QS4A 5EVZA 1QHTA 3AVCA 3EE9A 3AAPA 3AY9A 3ID6A 4IO8A 4CEQA 2ETJA 3D45A 4H0OA 4PKGA 2BTFA 1BCOA 4BRHA 2XY6A 3HK2A 3HL8A 2QA4N 2JWLA 1IG9A 4O55A 3ULEA 3OYJA 3HPGA 4WCEL 4ISEA 3VOVA 2W40A 3KJVA 3VERA 2QWLA 5KTQA 2G8WA 2HOEA 2YHYA 4AQYK 3HVTA 3B6PA 1WSJA 1IH7A 3CCLN 4QS7A 2KQ2A 3SQ1A 2HNYA 1Y97A 1W7AA 2RE2A 1S9EA 4PY5A 3J7AP 4HCCA 4LFAK 4PKIA 5BR9A 3QFUA 1TUYA 3WQTA 4H0VB 3JYTA 1KAXA 4JAXA 3IG1A 4CHQA 1VQ5N 4FJXA 4H5WA 2P9NB 3CCVN 1QQMA 4BY9C 4DFMA 2QWRA 3OYKA 1HNWK 3H08A 5DM6L 2ZJQL 1XC3A 4BE1A 3CCUN 1YHQN 3RMDA 3B6OA 1C1AA 4CBUA 1NK7A 1I94K 3TAMA 4FWMA 2IVOA 4FJKA 4I2QA 2B5JA 3QICA 1FKPA 4CGDA 4AILC 3OBWA 1I3AA 1QQOA 2A6AA 3MN9A 5C2FA 3CFRA 2ASMA 2A40A 3JXUA 4FJLA 1RILA 4NLCA 1NGJA 4FPAA 3ZSXA 4E7LA 2NRWA 4FOIA 3VTIA 3V1QA 3E9OA 4KHSA 4JK7A 1XNQK 1TV6A 4FWKA 1RT7A 4BRFA 4LD0A 4FJMA 3SV3A 1VSIA 1IKXA 3RMCA 3L6QA 3MX2A 2RHKA 4FXDA 5AQKA 3DXKB 1TGOA 2BE2A 2O8CA 1BG3A 4FZXC 3VEOA 2VG6A 4LH4A 1DT9A 4WF9L 4BVOA 1WSHA 4H5RA 2Q2RA 2ZJRL 4IG3A 4CVNE 3VQ5A 3CYMA 2AJQA 4KTZA 3DXMA 5FRNA 2IS3A 4HHTA 4DS4A 4B9VA 4K42A 4LF7K 2YNIA 3RRHA 1BCMA 2OTLN 3L4QA 1N5YA 4CFDA 5AQTA 5HL7L 3VF2A 3THVA 3DI6A 3PLAA 2R7YA 4K25A 5A2QO 1X9MA 4FW2A 4JKEA 1KFSA 5ELZA 1CZBA 3FZHA 4FJ7A 4B9UA 4DKWA 2ZGZA 3L3VA 4CZLA 3R8EA 3P83D 3E9LA 1ZBLA 5JMVA 3EEQA 2O8FB 3TSPA 5AQJA 4CHZA 4BDPA 3S3MA 3PIOL 2B6AA 2QK9A 5J2NA 1DEJA 5IT9O 4ILHA 5KGXA 3ZSOA 2P9KB 5EX5A 2HNZA 2OPSA 3HOSA 2A1SA 4TSXA 1Q86O 1GLLO 4F3TA 3CJCA 1YTAA 3SMPA 4H0PA 3I8BA 5AQGA 2V7ZA 2Q97A 3O9QA 5JLFA 4N56A 2F9TA 1T6CA 3C95A 4OX9K 1TKTA 2P9NA 5AQIA 1XMOK 1IKYA 3M8QA 5AFUA 3U9DA 3SZ2A 4Y1DA 4M3YA 4X64K 4BVPA 1EXQA 1S22A 1JXBA 1RBVA 3ZX0A 4DB3A 2O8EB 3SQ4A 5GADP 4E7KA 3LPTA 3HTVA 2NRZA 3WNHA 3ZT1A 4RW4A 1MU2A 4C1NK 3D2EB 3FZKA 4E1JA 3CMEN 3HYFA 3WXIA 3O9SA 2P9IB 2HF3A 3MN5A 4BRIA 1QSSA 1Z05A 4JN4A 3U6FA 4FWSA 4WYBA 1HQUA 2WBNA 5KRSA 3QLHA 4B1UB 3DXKA 5SWMA 3DWLA 1VQ9N 4Z4FA 4GVMA 1E4GT 3CJAA 3L3UA 3V6DA 4DR5K 3TAQA 4ILGB 4CFAA 4DR3K 2W42A 4HCBA 4GW6A 2YKMA 3NMUA 3O3FA 2NRTA 1ZBUA 4JI1K 4DFPA 4NB4A 3PSFA 1TYQB 5CE3A 3WXJA 5AJ3K 2LSNA 4C8MA 1L3VA 1JXEA 1BU6O 1RDCA 4E1NA 5EXWA 3OYGA 1L3SA 3EZ5A 4BREA 5HBMA 1SKWA 3TTDA 1JLAA 4QS8A 4IJAA 1K6YA 1UOCA 1LWCA 1VQ7N 2NNWA 3OVNA 1T6DA 4H03B 1LWFA 1VSKA 1Q9YA 3IMXA 2O8FA 4UQGA 3VEXA 3PUFA 4CZJA 4B3RK 3OYAA 1REVA 2PBDA 1A5VA 2IDOA 3UKRB 3CG7A 3SV4A 1CZAN 3NGIA 3LAKA 5M1QA 1BA0A 1JLQA 1NBWA 3SAHA 3U4LA 4R5PA 2P9KA 3NH0A 4OJRA 5AQSA 5KGWA 3CCJN 4Y0WA 4X66K 2VWJA 4F8RA 5AQRA 4CD3A 2NUBA 3WQUA 2GUIA 3E9PA 2W41A 4CFBA 5LJWA 1JL1A 4W5TA 4CGHA 3L2QA 3ITHA 3LDQA 3VQ9A 4GMJB 2EWSA 2QXFA 3FLCO 4B1YB 1XHZA 1W9HA 3AVIA 1YAGA 4YOYA 2UXCK 3CQ8A 5BREA 4I2PA 4LH5A 4WE1A 1X9WA 2F9WA 4GV3A 5ADXH 4M42A 4DV3K 3KVGA 1IBMK 5GIPA 3H3NO 3VGLA 3F9MA 3SUQA 5FRMA 1HJOA 1HKBA 4IDHA 2O8EA 3QEXA 1X9SA 3O9TA 1BO5O 1Q9XA 1YJ9N 3O4NA 2V51B 5GINA 4AM6A 4CK1A 4KI6A 3D2EA 4DU3A 2D4WA 4DQPA 3QNNA 3R6MA 3R9PA 1EO1A 3FFKB 1WB9A 2P9IA 3CCSN 1J5EK 5KI6A 3H6EA 2X6SA 4BRQA 4I6MB 4NCBA 4FLXA 1ZYQA 4Z4HA 4DSFA 4CD1A 1HYVA 3EL2A 2QM1A 4B1XB 4WQ5A 3VEWA 2RF2A 4O8KA 4LF9K 2E4LA 5C0YA 2FBTA 4E19A 4CIEA 1RGIA 5KPTA 2D0OA 1SL0A 1IKWA 2JWKA 3NF9A 4DV6K 3TARA 3I0SA 5C15A 1U2VB 3RMBA 1E4FT 1QQNA 1RT2A 4BR0A 2JLEA 4BR5A 2Z1IA 4KKOA 2YNFA 3PO4A 3VF4A 1TYQA 1Q8IA 3VEYA 1X1PA 2QI2A 3E01A 2WOMA 4FJNA 4B9QA 3A5NC 1UWBA 3SQ2A 3SMSA 4DTPA 1TK8A 3MCAB 4B3OA 4AM7A 3CC7N 2YJFA 4DR6K 2I7NA 4WFBL 4PWDA 5IWAK 1KD1O 1J5OA 1C0GA 3ENBA 3KD5E 2NRXA 4LY7A 4GV6A 1ZXOA 2HHXA 5HRPA 3PO5A 1Q82O 4LFCK 2WFBA 4FJIA 3VN5A 1VQPN 4OGCA 1O13A 2KTQA 3TAPA 4KAZA 3KD1E 1XNRK 3MMVA 4H5VA 4J2BA 4FZZA 4IOAL 4FYDA 3UKRA 2QXLA 3ATVA 4O0IA 4FLVA 3VQCA 1VQKN 4N76A 4OO1J 5AQHA 5KPZA 1NGIA 3A0IX 4YOTA 5JLHA 1QE1A 3EY1A 3WEEB 3NGZA 2VGMA 5I3UA 3NE6A 1GLJO 4JI8K 1Q81O 5CZ1A 2B4JA 2PYJA 1KAYA 4CF2A 4KB0A 2FSNA 2OANA 4HUFA 4JI6K 2Y1IA 4KO0A 2J4RA 4EZ6A 4FVUA 3VQ7A 4EIAA 2ZF5O 3LANA 3V4IA 2EHGA 3C6AA 3RTVA 4KBOA 3BGRA 5HROA 4DV7K 4DSLA 4JI7K 4LFBK 3FGUA 4IFYA 4CZGA 3IFRA 3HPHA 3HI0A 1NGFA 1B92A 1YUWA 5HRNA 2AA4A 1YJNN 3WXKA 2Y1JA 4JYAK 3W0LA 2E5LK 3BEXA 3KKRA 2E2NA 5BPLA 4Q0BA 4M7XA 1HLUA 1WSEA 2FBVA 2QWQA 2ZQBA 1K73O 4OVLA 2P9UB 1S6QA 2ZJPL 1RTHA 4I6MA 4XH4A 1JLFA 1ASUA 2CH6A 5DMRA 4H0YB 3HO1A 4YFUA 5D3GA 3T1AA 3DMJA 1M90O 4DQSA 1CXUA 4JKAA 1VQ4N 4BGBA 3SQ0A 4GKJK 3C7NB 1U48A 3BF3A 4KV8A 5C2DA 3SPYA 4JI5K 2X78A 4KTWA 1U2VA 1OVQA 1KVBA 1HNZK 3ID8A 4NYNA 2RPIA 3K2PA 2E1ZA 4JHDB 3LAMA 4EFHA 3T19A 1UAXA 1HNXK 2Q31A 1BGXT 1NWKA 4FWLA 5K14A 2E8AA 3SUPA 3LM9A 4DMNA 3DOLA 1GLFO 1KXPA 1SS6A 5TKYA 3RRGA 3TI0A 1BQNA 3P1GA 4FSVA 4RW9A 2ZD1A 3D0PA 4HTUA 2IAJA 4CJSA 1C0UA 5FLXO 1WBBA 3ZCMA 3EKSA 1OKJA 4CEBA 1WLJA 1VSMA 3MXJA 3FR0A 2UXBK 3DM2A 1EX4A 1TUUA 3I8DA 2HBMA 4FM2A 1HYZA 3CJBA 2IOCA 3R3LA 3K5NA 3TAFA 4F9OA 5J2PA 1G15A 1Q18A 3OYEA 1W97L 3LZIA 3OA9A 5HLFA 4JS5A 3H3OB 4JKDA 3WEEA 5AQMA 3HSTB 3T1HK 3DOKA 3J7YP 4FLTA 2W6LA 2VQFK 4LF4K 3AGRA 3OYLA 2BANA 1ZBIA 3NVMA 1N33K 1IJJA 4BRCA 3SUNA 3IUCA 3CD6N 2YKNA 4IFVA 1IKVA 2XY7A 1FK9A 3THWB 1TVRA 5E84A 3NF8A 4HUEA 4MDAA 2FBYA 3LP3A 4CE9A 1RBSA 3O6WA 3P4IA 4DU4A 4ELUA 3K57A 1T44A 3LP0A 2KLAA 3EYZA 4L8RB 1M1KO 5JICA 3ENHA 2DFEA 1QQCA 2GV9A 4CZMA 5C12A 4FWPA 4K0KK 1VQ8N 3HVRA 2F8TA 2OA8A 3MWTA 4QS9A 1QHAA 4AHSA 2P9PB 1X9JA 4KPYA 1VSHA 3SBTA 1SV5A 4CJ3A 4DUYK 3S3OA 2P9UA 1VQLN 3ZSZA 4KI4A 1BHLA 3AA3A 4JRQA 5FPNA 3KZBA 4GVEA 4B3SK 1HQEA 2DFFA 3G4SN 3AVLA 3RVCA 4B08A 4CHNA 1K8KB 3C7NA 3CM6A 5F0XA 3G71N 3QEPA 2ZM6K 3QMLA 4DS5A 2PAVA 1WSGA 2VQEK 4MLEA 2VCPA 4ILJA 4CW7B 1S1UA 4JHDA 4B1VA 1NJIO 4U67L 4N5SA 3AV9A 4CJWA 4LF5K 5C25A 4DLGA 4CF9A 4W5RA 3S9HA 1QVFM 1IO2A 3M8SA 4OKKA 3OS2A 3C6UA 3CHWA 4CJQA 3SJHA 3CF5L 3J7ZO 4C8LA 1LAVA 1ATRA 4CF1A 3TANA 3M8RA 4OKEA 1HKGA 3LDSA 1NGHA 3CQXA 3RSEB 3VQ6A 1GLAG 1MWMA 4BRMA 3IAYA 4IKFA 1X3MA 5AQNA 1GLCG 1VQ6N 1CZ9A 4AH9A 5AQZA 3A5OC 1NJXA 3MEDA 4MFBA 4A57A 4BRKA 3T69A 3WNFA 1FJGK 5M1NA 2HSTA 3C6HA 1UA0A 3GL1A 1L5UA 1WNSA 3KLGA 4JKHA 3ZT2A 3BZCA 4DV5K 4XH5A 2E6LA 5AQVA 4DTNA 3PX0A 3O5BA 3WXLA 5M1OA 4CBXA 3DLRA 1NGAA 4ID1A 1TK5A 4A5BA 2HMIA 1SL1A 3KLIA 3QNOA 1KTQA 1XHXA 5AQXA 1D9FA 3BUZB 1XMQK 1RDAA 4CJEA 4H5TA 3ZX3A 3M1FA 4F3OA 1U6ZA 4JNEA 4FO0A 4O5BA 3NHGA 4KH4A 5AQFA 3ZT3A 4CEEA 2ZWHA 4M3WA 4KTQA 4Z0UA 1WBDA 3THWA 4BQZA 5KRTA 2GWKA 3DLKA 4AHUA 4WFNL 5T7BA 3QBXA 1QZ6A 2G8VA 2DY4A 4Q5VA 2VWBA 3M5RA 2FF3B 1NJYA 3P39A 4PUOA 4N41A 4KHWA 1ILYA 1LWEA 4ISGA 4BROA 3KWGA 3K58A 2W6KA 3K0SA 4QOZB 1GOCA 2P9PA 4A62A 2RN2A 1LW2A 3QEWA 2CGLA 3PIPL 5F2RA 3G0ZA 3ZSRA 4LF8K 4HVJA 4FOEA 3OYIA 4YOUA 4NCAA 3RWUA 5FPDA 5KQ8A 4BWJA 1GLBG 3O08A 2D0CA 3EKUA 3P38A 4BACA 4PKHA 1K8KA 3AVBA 5B8HA 4C23A 4H4MA 2KZZA 1YXQA 3VMFB 4YORA 4B9TA 1J54A 2IVNA 1JL2A 1T7PA 4HWIA 2UUCK 1HNVA 5M1PA 3O80A 4M7YA 4CGGA 4BRNA 1DTTA 3KLEA 1WAJA 3LALA 4B9NA 3VQDA 4FWOA 1RCHA 3HPOA 3E66A 3G25A 1YI2N 3O9UA 4LF6K 4YHHK 3IS9A 1ZBFA 1D8YA 3D6RA 2WTUA 3OJUA 4FLUA 4XH1A 2KFZA 4B9LA 4PL7A 1D5AA 1NK5A 3TPQA 3RSEA 3L2WA 3CC4N 3DLGA 3OYBA 2KHOA 4FWNA 4IFEA 4DUZK 3H1VX 4CK2A 2Q36A 2ASOA 3OJSA 5JS2A 5AQLA 1RNHA 2Q3SA 4Z4CA 3DAWA 4DR2K 4I9QA 4CJLA 1S1XA 3VA3A 4CESA 1S9GA 5CYMA 1RTJA 1TK0A 4BC2A 3L0QA 2QTDA 3VA0A 3L2VA 3HRGA 4DCHA 3DLBA 2P1JA 4E1MA 4F2SA 1WN7A 5CR4A 3H46O 4BE2A 4M3TA 3CC2N 3C0BA 1RDDA 2XRIA 4AF1A 3NF7A 4H5NA 1NKEA 4M63C 4IDKA 2VWKA 4KHUA 2OPRA
chains in the Genus database with same CATH topology
2UUBK 4DR3K 2UXBK 4JI0K 3J7AP 4CW7B 4JI6K 1IBLK 4LFAK 4NXNK 4JI1K 4LF8K 1J5EK 4LF5K 5AJ3K 5LMNK 4DV7K 4JI7K 3J80O 4DV0K 1HNWK 4LFBK 4JI3K 4LF9K 2UUAK 5IT9O 4YY3K 1I94K 4X65K 4DR1K 4KHPK 3T1YK 3T1HK 1N32K 3J7YP 4JYAK 4DV6K 2VQFK 2E5LK 4LF4K 2UUCK 1N33K 4JI4K 4B3MK 1FJGK 3JAMO 3J81O 4B3RK 4OX9K 1XNQK 1XMOK 4DV1K 4B3TK 4LF6K 4DV5K 4YHHK 4GKKK 2UXDK 1IBKK 5LMUK 4X64K 4NXMK 4GKJK 4DR6K 4K0KK 3OTOK 4JV5K 5IWAK 4X62K 4X66K 1N34K 1XMQK 4JI5K 4DUZK 1HNZK 5BR8K 2HHHK 4JI2K 4CVNE 1N36K 4LFCK 2UXCK 4DUYK 4DR2K 1HNXK 4LF7K 1XNRK 4V19S 4DV3K 4DV4K 1IBMK 4B3SK 4DV2K 4DR4K 2UU9K 2F4VK 1HR0K 4DR7K 2ZM6K 5LL6Z 4DR5K 5FLXO 4AQYK 4JI8K 5A2QO 2VQEK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB K;  4DR3 K;  2UXB K;  4JI0 K;  3J7A P;  4CW7 B;  4JI6 K;  1IBL K;  4LFA K;  4NXN K;  4JI1 K;  4LF8 K;  1J5E K;  4LF5 K;  5AJ3 K;  5LMN K;  4DV7 K;  4JI7 K;  3J80 O;  4DV0 K;  1HNW K;  4LFB K;  4JI3 K;  4LF9 K;  2UUA K;  5IT9 O;  4YY3 K;  1I94 K;  4X65 K;  4DR1 K;  4KHP K;  3T1Y K;  3T1H K;  1N32 K;  3J7Y P;  4JYA K;  4DV6 K;  2VQF K;  2E5L K;  4LF4 K;  2UUC K;  1N33 K;  4JI4 K;  4B3M K;  1FJG K;  3JAM O;  3J81 O;  4B3R K;  4OX9 K;  1XNQ K;  1XMO K;  4DV1 K;  4B3T K;  4LF6 K;  4DV5 K;  4YHH K;  4GKK K;  2UXD K;  1IBK K;  5LMU K;  4X64 K;  4NXM K;  4GKJ K;  4DR6 K;  4K0K K;  3OTO K;  4JV5 K;  5IWA K;  4X62 K;  4X66 K;  1N34 K;  1XMQ K;  4JI5 K;  4DUZ K;  1HNZ K;  5BR8 K;  2HHH K;  4JI2 K;  4CVN E;  1N36 K;  4LFC K;  2UXC K;  4DUY K;  4DR2 K;  1HNX K;  4LF7 K;  1XNR K;  4V19 S;  4DV3 K;  4DV4 K;  1IBM K;  4B3S K;  4DV2 K;  4DR4 K;  2UU9 K;  2F4V K;  1HR0 K;  4DR7 K;  2ZM6 K;  5LL6 Z;  4DR5 K;  5FLX O;  4AQY K;  4JI8 K;  5A2Q O;  2VQE K; 
#chains in the Genus database with same CATH topology
 1RBR A;  1HMV A;  1JKH A;  4NYF A;  1XC9 A;  4FJH A;  2WC9 A;  1VSJ A;  3PV8 A;  1IBL K;  1OH8 A;  1BOT O;  4JLH A;  2NRR A;  4O8U A;  4DF8 A;  3AO3 A;  2OZM A;  5SZT A;  3UKU B;  3TR8 A;  5LMN K;  3HBT A;  5LJV A;  3C6T A;  2Q0U A;  2HMP A;  3TAE A;  4CFC A;  2HHS A;  4CJK A;  3KIO A;  4KHP K;  4OLB A;  4L3Q A;  1P8Z A;  1NKC A;  2YV0 X;  2X74 A;  1JLC A;  5M1K A;  1ESV A;  3SAG A;  3CFP A;  4JRP A;  3WNE A;  2VGN A;  2YNH A;  1TAQ A;  4OGE A;  5EU7 A;  2V7Y A;  4IOC L;  2E6M A;  4J2A A;  4A2A A;  5AQW A;  4GKK K;  2VG5 A;  1NGB A;  2GTD A;  2G8I A;  1XWL A;  5BPN A;  4B1W B;  3GE1 A;  1HX1 A;  3VPZ A;  1LOT B;  1BIS A;  1NKB A;  1LAW A;  1YT3 A;  3DRR A;  3NDK A;  5GAG P;  4CEZ A;  3MWP A;  4FK2 A;  1P90 A;  4IEI A;  4OKJ A;  4YOW A;  1XUP O;  1ATS A;  3ZET B;  3OY9 A;  3KK2 A;  1BIZ A;  4JKC A;  1S1W A;  4F4K A;  2VG7 A;  4MQ3 A;  4I7F A;  4DF4 A;  1RDW X;  4MO4 A;  2X6N A;  3O3H A;  3HP9 A;  4Z4G A;  3OS1 A;  5AQP A;  5CHI A;  1EKE A;  1DTQ A;  4A5A A;  1K9M O;  2O8D B;  3F2K A;  1RDU A;  4AHT A;  1KRP A;  2NRH A;  4H4O A;  3VTH A;  1JLE A;  1B9D A;  4GNI A;  1T8E A;  4CK3 A;  3EZW A;  1NNE A;  3CFO A;  3D2F B;  3QIN A;  1J53 A;  4DSK A;  2HHV A;  4DSJ A;  3TTF A;  1GOA A;  2HBK A;  5AQU A;  3ZSQ A;  3TAG A;  1BI4 B;  3V9S A;  1RT1 A;  3LDN A;  2CGK A;  4MO5 A;  1Z25 A;  1JCG A;  4O44 A;  4DV0 K;  5I42 A;  4CJ7 A;  2QKB A;  1K8A O;  4CF0 A;  2VYP A;  2UUA K;  3DRS A;  3PX4 A;  1NK4 A;  4FM1 A;  1ASV A;  1HPZ A;  4KH6 A;  3ZSW A;  1KAZ A;  4EZ9 A;  5BN8 A;  4W5Q A;  3E1Y A;  3L2U A;  3T1Y K;  1DGK N;  1I39 A;  2HHQ A;  1C0F A;  3DLE A;  3ZT4 A;  3SUO A;  1JLG A;  5EY4 A;  1BL3 A;  4RW7 A;  5KPR A;  3OYH A;  3HM9 A;  1A5X A;  2F7T A;  2Z1H A;  2I5J A;  3TU5 A;  1MWK A;  4A59 A;  4NO7 A;  1KSP A;  2F8S A;  3UKU A;  4W5N A;  2HBL A;  3JAM O;  2E2Q A;  2Q0R A;  1U4B A;  5DK5 A;  5TKW A;  4DLE A;  1FW6 A;  5MLC Q;  4B3T K;  3ZSV A;  3NCI A;  1VK0 A;  3R1X A;  1L3T A;  1TL3 A;  4DQQ A;  3LP1 A;  1QTM A;  3FZL A;  3IDH A;  1JJ2 M;  2ITG A;  1VSE A;  3SLC A;  3MX5 A;  4QCL A;  4CZF A;  3KTQ A;  2QWM A;  4N47 A;  4CJ4 A;  4DU1 A;  3G10 A;  1U45 A;  4CED A;  1J6Z A;  2OPQ A;  1RFQ A;  1C0T A;  2XY5 A;  2Z1J A;  5AR0 A;  3AVG A;  5HRR A;  3CMA N;  3I33 A;  3CCM N;  3V81 A;  2QWO A;  3OYN A;  5C42 A;  3SYZ A;  4KHQ A;  3MXI A;  4GV9 A;  4DTS A;  4DV2 K;  3MCP A;  1VSF A;  5JVH L;  5FPE A;  2CGJ A;  4IJN A;  3M3Z A;  3HP6 A;  4ZTJ A;  4FPB A;  3HJF A;  3QBW A;  4FLZ A;  3O1W A;  4E0D A;  1HPM A;  1YIJ N;  4O4G A;  3VEV A;  3ZEU B;  3K9J A;  1RT6 A;  4EP5 A;  4ELT A;  1OH7 A;  3GBT A;  3I0R A;  3ZET A;  3UIQ A;  4BC5 A;  5ADX A;  3CET A;  3NFA A;  4FJJ A;  3AA2 A;  3LP2 A;  3MAQ A;  4DSE A;  1NG9 A;  2BUP A;  1YTU A;  1RDB A;  5AFU H;  1B9F A;  3AA5 X;  4YY3 K;  2O8D A;  2FSJ A;  5C24 A;  4JKG B;  3LWL A;  4BR4 A;  3L4I A;  3LZJ A;  1SZ2 A;  4OLA A;  1N32 K;  2FC0 A;  3AVM A;  3K59 A;  1Y64 A;  4CZI A;  3D2F A;  5BRH A;  3B8A X;  3UB5 A;  4CJ5 A;  4OPK A;  1WUA A;  3AO1 A;  1GLD G;  1BA1 A;  1BI4 A;  3QIO A;  3J81 O;  2H3G X;  4RW6 A;  2YNG A;  1F21 A;  4U7B A;  5F1X A;  4PHT X;  3AVH A;  2QKK A;  1NMN A;  2KZM A;  3H45 C;  3VQP A;  1IBK K;  4CER A;  1VRU A;  1SUQ A;  2HB5 A;  4G1Q A;  4DFK A;  2QEX N;  4CZK A;  3AVA A;  3K5M A;  4M3X A;  1BDG A;  3QES A;  4X62 K;  4JS4 A;  4K41 A;  3NH1 A;  3H1Q A;  5CYQ A;  4BG8 A;  3MXM A;  4DQI A;  2G8U A;  4JI2 K;  3NH2 A;  2FF6 A;  1RBT A;  3ATU A;  3AA4 A;  4BRA A;  2E2O A;  3KK3 A;  3QER A;  1RBU A;  2OTJ N;  3J8A A;  1VAZ A;  4KH5 A;  1S3X A;  3W3D A;  1NJZ A;  1FXX A;  4MDB A;  4YOX A;  4DR4 K;  2QWP A;  3U3G A;  3K9K A;  1U49 A;  3LDL A;  3FE1 A;  5LL6 Z;  3K5L A;  3TWH A;  3VGM A;  1LCU A;  3THX B;  5JVG L;  3EE8 A;  3U3Y A;  3VQ4 A;  3AVJ A;  4BR9 A;  2E20 A;  4LSN A;  1ASW A;  2YJE A;  3WUH A;  3DRP A;  5CY4 A;  4YDU C;  3RR8 A;  2P9L B;  3CJ9 A;  3V9U A;  5FRO A;  3WXM B;  3J80 O;  1JLB A;  5HRS A;  2NLX A;  3ZX2 A;  1T03 A;  1KLN A;  4C8K A;  4KFB A;  3P31 A;  2YHB A;  2O8B B;  2GEL A;  4IO9 L;  4WQ4 C;  3GG4 A;  1OH5 A;  3P5J A;  3V1O A;  3L8B A;  2PZS A;  4E7I A;  3ZEU A;  4RG8 A;  2HF4 A;  3LL3 A;  4EP4 A;  4DTX A;  3NF6 A;  2O4G A;  4FWQ A;  4ICL A;  4B3M K;  4JEP A;  3MN7 A;  1N6Q A;  2GWJ A;  2UYT A;  3M8P A;  3S41 A;  4MLH A;  2IC3 A;  1HNI A;  4I9L A;  2QW9 A;  1KC8 O;  1C1C A;  1W0H A;  3OHR A;  3O4W A;  3VQB A;  4BE0 A;  4NXM K;  4CJP A;  4DQR A;  4JKG A;  3CJ7 A;  4FLW A;  3BF1 A;  1N34 K;  2OYQ A;  2D1K A;  1BIU A;  4BDY A;  3AVK A;  5J2Q A;  1S1V A;  4CEA A;  4JK9 A;  4AHV A;  3A5L C;  1SAZ A;  3AAQ A;  3KHY A;  1DLO A;  1YVU A;  2P51 A;  1KVC A;  1C6V A;  1T3V A;  4NCG A;  5M1F A;  4Z4E A;  4WFA L;  5J2M A;  1QSL A;  4J2E A;  3VQ8 A;  2YCH A;  1HRH A;  4V19 S;  1NGD A;  3CIP A;  3L2R A;  4DV4 K;  4FL9 A;  1Z6R A;  3MK6 A;  3V9Z A;  4FVM A;  1WOQ A;  1LV5 A;  2PFU A;  4CHY A;  4KHN A;  1DKG D;  4C1N I;  1KLM A;  4JK8 A;  1BQM A;  2D0B A;  3MEE A;  4H0T B;  3BY5 A;  5I9E B;  3OYM A;  1HR0 K;  2ZE2 A;  5FPM A;  4DTM A;  4DG1 A;  2GBZ A;  1NGG A;  2ZGY A;  3SK3 A;  3ULD A;  4CI6 A;  4JI0 K;  3QFP A;  1KCF A;  2DTU A;  1Q7Y O;  2HW3 A;  4FCY A;  1VSD A;  1NK8 A;  5AZJ B;  4OPA A;  1VQM N;  1CLQ A;  2KFN A;  2XY8 A;  1U04 A;  4M45 A;  3LPU A;  4B8C A;  4YOV A;  4B9M A;  4ID5 A;  4FM0 A;  4A61 A;  1L3U A;  1GLE G;  4E7H A;  4AHR A;  4KB1 A;  1V4T A;  3FZF A;  1KQS M;  1SL2 A;  4DSI A;  1BUP A;  4F2R A;  1WSI A;  2E2P A;  4CCH A;  1XQS C;  1OVY A;  5AQY A;  4JKF A;  1NM1 A;  1D9D A;  1S1T A;  4BDZ A;  3V9W A;  3JSM A;  3CCE N;  4Z4I A;  3LDP A;  2OCE A;  4HUG A;  2ASP A;  3THX A;  2YHX A;  5BPM A;  5EOY A;  2DPN A;  3KK1 A;  3BP8 A;  3LWM A;  3NVK A;  2E88 A;  4CHO A;  4CEF A;  1X3N A;  3A5M C;  4CGJ A;  2P9L A;  1D4X A;  3SI6 A;  3CXC M;  4JD2 B;  3CM5 A;  5LMU K;  1NOZ A;  3CER A;  3DYA A;  4ISF A;  1H1V A;  1BWF O;  2O8B A;  4CZE A;  1FKO A;  1T05 A;  3DJC A;  3AO4 A;  3O1B A;  2BGG A;  4FK4 A;  1GOB A;  4CIF A;  1TL1 A;  2FXU A;  4XEI A;  3QB0 A;  3ZT0 A;  4EAH D;  4IG0 A;  3CI5 A;  5GAE P;  2A5X A;  2FLO A;  4KHY A;  4FLY A;  2XHB A;  4ZTF A;  1KVA A;  3HSC A;  3VEN A;  4C8N A;  1XI1 A;  2Z1G A;  1VSL A;  2YHW A;  3NAE A;  2UU9 K;  5GIO A;  4DFJ A;  1TKZ A;  3T7Z A;  1RT4 A;  1RT5 A;  3THY B;  3A8Y A;  4W5O A;  3AGK A;  3Q7B A;  2BDP A;  4DTR A;  5GAH P;  4FZY A;  4E89 A;  4ZHR A;  4M3U A;  1A5W A;  4KRF A;  5HOO A;  4DTJ A;  4UY8 O;  2QWN A;  3OYF A;  1ZC6 A;  3N4Q A;  1C0M A;  4DTO A;  4DTU A;  4JI3 K;  4A2B A;  2PY5 A;  2Q1N A;  4X65 K;  2E1Y A;  4DR1 K;  1VRT A;  3AVN A;  3F5T A;  3AVF A;  3ISN C;  4LSL A;  4BWM A;  3WT0 A;  2HHT A;  3OYD A;  3M6G A;  2XO7 A;  3KKS A;  3S3N A;  2HVI A;  4O5F A;  1NK6 A;  1TKX A;  3V9X A;  3AO2 A;  1J9A A;  2D0A A;  1NGC A;  2YI1 A;  4CGF A;  2HVH A;  4EHT A;  5AZJ A;  3SNN A;  1VQN N;  1YJW N;  3AO5 A;  3RR7 A;  4M41 A;  3QIP A;  4CJR A;  4CJF A;  5E41 A;  3QDK A;  3IKM A;  1WSF A;  3ASM A;  3TTC A;  4R79 A;  3OYC A;  2GEM A;  1NOY A;  4IOX A;  3FZM A;  3OW2 M;  4BC3 A;  3ZYY X;  3UE5 A;  3BDP A;  3O4Q A;  3VQA A;  5JS1 A;  1IV0 A;  2GX9 A;  1EET A;  4DHY A;  2NRV A;  3QEI A;  4H0X B;  4KRE A;  1UA1 A;  3CQY A;  3CPE A;  2P9S B;  3CPW M;  1N36 K;  3SCX A;  2ITM A;  4B8A B;  3NGY A;  2WUS A;  4BGA A;  3OS0 A;  3OBY A;  1ZBS A;  4ELV A;  2WON A;  4DWI A;  1HUX A;  3HT3 A;  1SKS A;  4JD2 A;  3RMA A;  4EHU A;  1EWR A;  3I56 N;  5DM7 L;  2HND A;  3GOI A;  2HHW A;  4PQU A;  4G9Z A;  4CF8 A;  4J2D A;  1RT3 A;  1EP4 A;  4DR7 K;  4CZH A;  2AP1 A;  3BZK A;  4K43 A;  2IGI A;  4FJ8 A;  2RKI A;  3JS6 A;  3A2F A;  2GUP A;  1NU0 A;  1V4S A;  4K8Z A;  3C65 A;  2FBX A;  1YVN A;  1ATN A;  4O0J A;  4CGI A;  2KW4 A;  1NGE A;  4FW1 A;  1E3M A;  2A42 A;  4J8F A;  3DLH A;  5AZI B;  2ATQ A;  2JGU A;  2D5R A;  4CEC A;  3SAF A;  3CCQ N;  3HM8 A;  3CCR N;  4H8K A;  3MEG A;  2HHU A;  4DQ8 A;  1YF5 L;  4FK0 A;  4K8X A;  1R0A A;  1EQY A;  4CJT A;  4RCH A;  1VQO N;  2FSK A;  4RTF D;  2IIR A;  4LC9 B;  4M3Z A;  4BRP A;  3TAB A;  1SQK A;  5H1S Q;  4BRD A;  1HJR A;  1U47 A;  3THY A;  5BRF A;  3C94 A;  4Z94 A;  1VHX A;  4JI4 K;  2YX6 A;  4Y1C A;  1N8R O;  1HYS A;  3QET A;  2V52 B;  3VGK A;  4B1Z A;  3NBP A;  3HOT A;  1LW0 A;  5BN9 A;  2I7P A;  4IXC A;  2D0P A;  3ZSY A;  1Z26 A;  3ULE B;  3HZ6 A;  4CHP A;  3O3G A;  2A3Z A;  4BR2 A;  1NJW A;  3PY8 A;  2P5G A;  2DFH A;  2NZT A;  4C8O A;  3SJJ A;  2PYL A;  3SBG A;  1O1W A;  1JCE A;  1ITG A;  3U9Z A;  3MN6 A;  4BR7 A;  3VES A;  3F9K A;  3T3F A;  4E7J A;  3ALY A;  1RTI A;  3I55 N;  2HHH K;  3KLF A;  5AQQ A;  4CIG A;  4XIU A;  1TKD A;  3QO9 A;  3EO3 A;  2OZS A;  5BRD A;  1NMD A;  3GDQ A;  4BC4 A;  5FDL A;  4IZ9 A;  1JCF A;  1G99 A;  3IRX A;  4FJ5 A;  3ZLJ A;  3VQQ A;  3QEV A;  4IWV A;  1MA9 B;  5AQO A;  4CEO A;  1SKR A;  2BH1 A;  2HBJ A;  4CJU A;  3KLH A;  4BRG A;  3Q7C A;  4NLB A;  1KFD A;  4E3S A;  4FJG A;  2F4V K;  1TAU A;  5J1E A;  4WQ5 C;  3TSU A;  5C10 A;  5CZ2 A;  4BG9 A;  1OH6 A;  3MDQ A;  2UUB K;  3D7E O;  2CH5 A;  2P9S A;  3CJ1 A;  3O8M A;  4NXN K;  4BRL A;  2KKZ A;  4PL8 A;  4AHC A;  3U8X A;  2IVP A;  3FFI A;  3PSI A;  1MDU B;  2G8F A;  4QAG A;  4YNQ A;  1IG8 A;  2A1R A;  4CJV A;  1EWQ A;  4RW8 A;  3LM2 A;  2EX3 A;  5LY3 A;  2F96 A;  2A41 A;  3VQE A;  1S6P A;  3ENO A;  4M3R A;  1NK0 A;  1WAF A;  3O9R A;  3KWI A;  2O8C B;  1YIT N;  4PA1 A;  1NLV A;  1NK9 A;  1HKC A;  4FWR A;  3SPZ A;  4BQL A;  3TSQ A;  3PX6 A;  4JKB A;  3N4P A;  3MEC A;  3HXM A;  1QVG M;  4GY2 B;  4YDU A;  1R59 O;  4B9S A;  3DXM B;  3K5O A;  1S72 N;  3AAR A;  3KK7 A;  3F73 A;  5AZI A;  2YHA A;  2G8H A;  4RWT A;  5HP1 A;  4DV1 K;  1QSY A;  2UXD K;  3G6E N;  4OPJ A;  4WQ4 A;  3LDO A;  3VET A;  4IBN A;  4HTL A;  1W2B M;  4CBW A;  2G8K A;  2OPP A;  4OPH A;  3EN9 A;  3WNG A;  3VEZ A;  3OTO K;  3VF6 A;  4JV5 K;  3V1R A;  4FJ9 A;  3DLL L;  2P5O A;  1S5J A;  2O4I A;  1CXQ A;  1ZBH A;  5KQD A;  5E26 A;  4IEE A;  5BR8 K;  1QZ5 A;  1RTD A;  1C1B A;  1QS4 A;  5EVZ A;  1QHT A;  3AVC A;  3EE9 A;  3AAP A;  3AY9 A;  3ID6 A;  4IO8 A;  4CEQ A;  2ETJ A;  3D45 A;  4H0O A;  4PKG A;  2BTF A;  1BCO A;  4BRH A;  2XY6 A;  3HK2 A;  3HL8 A;  2QA4 N;  2JWL A;  1IG9 A;  4O55 A;  3ULE A;  3OYJ A;  3HPG A;  4WCE L;  4ISE A;  3VOV A;  2W40 A;  3KJV A;  3VER A;  2QWL A;  5KTQ A;  2G8W A;  2HOE A;  2YHY A;  4AQY K;  3HVT A;  3B6P A;  1WSJ A;  1IH7 A;  3CCL N;  4QS7 A;  2KQ2 A;  3SQ1 A;  2HNY A;  1Y97 A;  1W7A A;  2RE2 A;  1S9E A;  4PY5 A;  3J7A P;  4HCC A;  4LFA K;  4PKI A;  5BR9 A;  3QFU A;  1TUY A;  3WQT A;  4H0V B;  3JYT A;  1KAX A;  4JAX A;  3IG1 A;  4CHQ A;  1VQ5 N;  4FJX A;  4H5W A;  2P9N B;  3CCV N;  1QQM A;  4BY9 C;  4DFM A;  2QWR A;  3OYK A;  1HNW K;  3H08 A;  5DM6 L;  2ZJQ L;  1XC3 A;  4BE1 A;  3CCU N;  1YHQ N;  3RMD A;  3B6O A;  1C1A A;  4CBU A;  1NK7 A;  1I94 K;  3TAM A;  4FWM A;  2IVO A;  4FJK A;  4I2Q A;  2B5J A;  3QIC A;  1FKP A;  4CGD A;  4AIL C;  3OBW A;  1I3A A;  1QQO A;  2A6A A;  3MN9 A;  5C2F A;  3CFR A;  2ASM A;  2A40 A;  3JXU A;  4FJL A;  1RIL A;  4NLC A;  1NGJ A;  4FPA A;  3ZSX A;  4E7L A;  2NRW A;  4FOI A;  3VTI A;  3V1Q A;  3E9O A;  4KHS A;  4JK7 A;  1XNQ K;  1TV6 A;  4FWK A;  1RT7 A;  4BRF A;  4LD0 A;  4FJM A;  3SV3 A;  1VSI A;  1IKX A;  3RMC A;  3L6Q A;  3MX2 A;  2RHK A;  4FXD A;  5AQK A;  3DXK B;  1TGO A;  2BE2 A;  2O8C A;  1BG3 A;  4FZX C;  3VEO A;  2VG6 A;  4LH4 A;  1DT9 A;  4WF9 L;  4BVO A;  1WSH A;  4H5R A;  2Q2R A;  2ZJR L;  4IG3 A;  4CVN E;  3VQ5 A;  3CYM A;  2AJQ A;  4KTZ A;  3DXM A;  5FRN A;  2IS3 A;  4HHT A;  4DS4 A;  4B9V A;  4K42 A;  4LF7 K;  2YNI A;  3RRH A;  1BCM A;  2OTL N;  3L4Q A;  1N5Y A;  4CFD A;  5AQT A;  5HL7 L;  3VF2 A;  3THV A;  3DI6 A;  3PLA A;  2R7Y A;  4K25 A;  5A2Q O;  1X9M A;  4FW2 A;  4JKE A;  1KFS A;  5ELZ A;  1CZB A;  3FZH A;  4FJ7 A;  4B9U A;  4DKW A;  2ZGZ A;  3L3V A;  4CZL A;  3R8E A;  3P83 D;  3E9L A;  1ZBL A;  5JMV A;  3EEQ A;  2O8F B;  3TSP A;  5AQJ A;  4CHZ A;  4BDP A;  3S3M A;  3PIO L;  2B6A A;  2QK9 A;  5J2N A;  1DEJ A;  5IT9 O;  4ILH A;  5KGX A;  3ZSO A;  2P9K B;  5EX5 A;  2HNZ A;  2OPS A;  3HOS A;  2A1S A;  4TSX A;  1Q86 O;  1GLL O;  4F3T A;  3CJC A;  1YTA A;  3SMP A;  4H0P A;  3I8B A;  5AQG A;  2V7Z A;  2Q97 A;  3O9Q A;  5JLF A;  4N56 A;  2F9T A;  1T6C A;  3C95 A;  4OX9 K;  1TKT A;  2P9N A;  5AQI A;  1XMO K;  1IKY A;  3M8Q A;  5AFU A;  3U9D A;  3SZ2 A;  4Y1D A;  4M3Y A;  4X64 K;  4BVP A;  1EXQ A;  1S22 A;  1JXB A;  1RBV A;  3ZX0 A;  4DB3 A;  2O8E B;  3SQ4 A;  5GAD P;  4E7K A;  3LPT A;  3HTV A;  2NRZ A;  3WNH A;  3ZT1 A;  4RW4 A;  1MU2 A;  4C1N K;  3D2E B;  3FZK A;  4E1J A;  3CME N;  3HYF A;  3WXI A;  3O9S A;  2P9I B;  2HF3 A;  3MN5 A;  4BRI A;  1QSS A;  1Z05 A;  4JN4 A;  3U6F A;  4FWS A;  4WYB A;  1HQU A;  2WBN A;  5KRS A;  3QLH A;  4B1U B;  3DXK A;  5SWM A;  3DWL A;  1VQ9 N;  4Z4F A;  4GVM A;  1E4G T;  3CJA A;  3L3U A;  3V6D A;  4DR5 K;  3TAQ A;  4ILG B;  4CFA A;  4DR3 K;  2W42 A;  4HCB A;  4GW6 A;  2YKM A;  3NMU A;  3O3F A;  2NRT A;  1ZBU A;  4JI1 K;  4DFP A;  4NB4 A;  3PSF A;  1TYQ B;  5CE3 A;  3WXJ A;  5AJ3 K;  2LSN A;  4C8M A;  1L3V A;  1JXE A;  1BU6 O;  1RDC A;  4E1N A;  5EXW A;  3OYG A;  1L3S A;  3EZ5 A;  4BRE A;  5HBM A;  1SKW A;  3TTD A;  1JLA A;  4QS8 A;  4IJA A;  1K6Y A;  1UOC A;  1LWC A;  1VQ7 N;  2NNW A;  3OVN A;  1T6D A;  4H03 B;  1LWF A;  1VSK A;  1Q9Y A;  3IMX A;  2O8F A;  4UQG A;  3VEX A;  3PUF A;  4CZJ A;  4B3R K;  3OYA A;  1REV A;  2PBD A;  1A5V A;  2IDO A;  3UKR B;  3CG7 A;  3SV4 A;  1CZA N;  3NGI A;  3LAK A;  5M1Q A;  1BA0 A;  1JLQ A;  1NBW A;  3SAH A;  3U4L A;  4R5P A;  2P9K A;  3NH0 A;  4OJR A;  5AQS A;  5KGW A;  3CCJ N;  4Y0W A;  4X66 K;  2VWJ A;  4F8R A;  5AQR A;  4CD3 A;  2NUB A;  3WQU A;  2GUI A;  3E9P A;  2W41 A;  4CFB A;  5LJW A;  1JL1 A;  4W5T A;  4CGH A;  3L2Q A;  3ITH A;  3LDQ A;  3VQ9 A;  4GMJ B;  2EWS A;  2QXF A;  3FLC O;  4B1Y B;  1XHZ A;  1W9H A;  3AVI A;  1YAG A;  4YOY A;  2UXC K;  3CQ8 A;  5BRE A;  4I2P A;  4LH5 A;  4WE1 A;  1X9W A;  2F9W A;  4GV3 A;  5ADX H;  4M42 A;  4DV3 K;  3KVG A;  1IBM K;  5GIP A;  3H3N O;  3VGL A;  3F9M A;  3SUQ A;  5FRM A;  1HJO A;  1HKB A;  4IDH A;  2O8E A;  3QEX A;  1X9S A;  3O9T A;  1BO5 O;  1Q9X A;  1YJ9 N;  3O4N A;  2V51 B;  5GIN A;  4AM6 A;  4CK1 A;  4KI6 A;  3D2E A;  4DU3 A;  2D4W A;  4DQP A;  3QNN A;  3R6M A;  3R9P A;  1EO1 A;  3FFK B;  1WB9 A;  2P9I A;  3CCS N;  1J5E K;  5KI6 A;  3H6E A;  2X6S A;  4BRQ A;  4I6M B;  4NCB A;  4FLX A;  1ZYQ A;  4Z4H A;  4DSF A;  4CD1 A;  1HYV A;  3EL2 A;  2QM1 A;  4B1X B;  4WQ5 A;  3VEW A;  2RF2 A;  4O8K A;  4LF9 K;  2E4L A;  5C0Y A;  2FBT A;  4E19 A;  4CIE A;  1RGI A;  5KPT A;  2D0O A;  1SL0 A;  1IKW A;  2JWK A;  3NF9 A;  4DV6 K;  3TAR A;  3I0S A;  5C15 A;  1U2V B;  3RMB A;  1E4F T;  1QQN A;  1RT2 A;  4BR0 A;  2JLE A;  4BR5 A;  2Z1I A;  4KKO A;  2YNF A;  3PO4 A;  3VF4 A;  1TYQ A;  1Q8I A;  3VEY A;  1X1P A;  2QI2 A;  3E01 A;  2WOM A;  4FJN A;  4B9Q A;  3A5N C;  1UWB A;  3SQ2 A;  3SMS A;  4DTP A;  1TK8 A;  3MCA B;  4B3O A;  4AM7 A;  3CC7 N;  2YJF A;  4DR6 K;  2I7N A;  4WFB L;  4PWD A;  5IWA K;  1KD1 O;  1J5O A;  1C0G A;  3ENB A;  3KD5 E;  2NRX A;  4LY7 A;  4GV6 A;  1ZXO A;  2HHX A;  5HRP A;  3PO5 A;  1Q82 O;  4LFC K;  2WFB A;  4FJI A;  3VN5 A;  1VQP N;  4OGC A;  1O13 A;  2KTQ A;  3TAP A;  4KAZ A;  3KD1 E;  1XNR K;  3MMV A;  4H5V A;  4J2B A;  4FZZ A;  4IOA L;  4FYD A;  3UKR A;  2QXL A;  3ATV A;  4O0I A;  4FLV A;  3VQC A;  1VQK N;  4N76 A;  4OO1 J;  5AQH A;  5KPZ A;  1NGI A;  3A0I X;  4YOT A;  5JLH A;  1QE1 A;  3EY1 A;  3WEE B;  3NGZ A;  2VGM A;  5I3U A;  3NE6 A;  1GLJ O;  4JI8 K;  1Q81 O;  5CZ1 A;  2B4J A;  2PYJ A;  1KAY A;  4CF2 A;  4KB0 A;  2FSN A;  2OAN A;  4HUF A;  4JI6 K;  2Y1I A;  4KO0 A;  2J4R A;  4EZ6 A;  4FVU A;  3VQ7 A;  4EIA A;  2ZF5 O;  3LAN A;  3V4I A;  2EHG A;  3C6A A;  3RTV A;  4KBO A;  3BGR A;  5HRO A;  4DV7 K;  4DSL A;  4JI7 K;  4LFB K;  3FGU A;  4IFY A;  4CZG A;  3IFR A;  3HPH A;  3HI0 A;  1NGF A;  1B92 A;  1YUW A;  5HRN A;  2AA4 A;  1YJN N;  3WXK A;  2Y1J A;  4JYA K;  3W0L A;  2E5L K;  3BEX A;  3KKR A;  2E2N A;  5BPL A;  4Q0B A;  4M7X A;  1HLU A;  1WSE A;  2FBV A;  2QWQ A;  2ZQB A;  1K73 O;  4OVL A;  2P9U B;  1S6Q A;  2ZJP L;  1RTH A;  4I6M A;  4XH4 A;  1JLF A;  1ASU A;  2CH6 A;  5DMR A;  4H0Y B;  3HO1 A;  4YFU A;  5D3G A;  3T1A A;  3DMJ A;  1M90 O;  4DQS A;  1CXU A;  4JKA A;  1VQ4 N;  4BGB A;  3SQ0 A;  4GKJ K;  3C7N B;  1U48 A;  3BF3 A;  4KV8 A;  5C2D A;  3SPY A;  4JI5 K;  2X78 A;  4KTW A;  1U2V A;  1OVQ A;  1KVB A;  1HNZ K;  3ID8 A;  4NYN A;  2RPI A;  3K2P A;  2E1Z A;  4JHD B;  3LAM A;  4EFH A;  3T19 A;  1UAX A;  1HNX K;  2Q31 A;  1BGX T;  1NWK A;  4FWL A;  5K14 A;  2E8A A;  3SUP A;  3LM9 A;  4DMN A;  3DOL A;  1GLF O;  1KXP A;  1SS6 A;  5TKY A;  3RRG A;  3TI0 A;  1BQN A;  3P1G A;  4FSV A;  4RW9 A;  2ZD1 A;  3D0P A;  4HTU A;  2IAJ A;  4CJS A;  1C0U A;  5FLX O;  1WBB A;  3ZCM A;  3EKS A;  1OKJ A;  4CEB A;  1WLJ A;  1VSM A;  3MXJ A;  3FR0 A;  2UXB K;  3DM2 A;  1EX4 A;  1TUU A;  3I8D A;  2HBM A;  4FM2 A;  1HYZ A;  3CJB A;  2IOC A;  3R3L A;  3K5N A;  3TAF A;  4F9O A;  5J2P A;  1G15 A;  1Q18 A;  3OYE A;  1W97 L;  3LZI A;  3OA9 A;  5HLF A;  4JS5 A;  3H3O B;  4JKD A;  3WEE A;  5AQM A;  3HST B;  3T1H K;  3DOK A;  3J7Y P;  4FLT A;  2W6L A;  2VQF K;  4LF4 K;  3AGR A;  3OYL A;  2BAN A;  1ZBI A;  3NVM A;  1N33 K;  1IJJ A;  4BRC A;  3SUN A;  3IUC A;  3CD6 N;  2YKN A;  4IFV A;  1IKV A;  2XY7 A;  1FK9 A;  3THW B;  1TVR A;  5E84 A;  3NF8 A;  4HUE A;  4MDA A;  2FBY A;  3LP3 A;  4CE9 A;  1RBS A;  3O6W A;  3P4I A;  4DU4 A;  4ELU A;  3K57 A;  1T44 A;  3LP0 A;  2KLA A;  3EYZ A;  4L8R B;  1M1K O;  5JIC A;  3ENH A;  2DFE A;  1QQC A;  2GV9 A;  4CZM A;  5C12 A;  4FWP A;  4K0K K;  1VQ8 N;  3HVR A;  2F8T A;  2OA8 A;  3MWT A;  4QS9 A;  1QHA A;  4AHS A;  2P9P B;  1X9J A;  4KPY A;  1VSH A;  3SBT A;  1SV5 A;  4CJ3 A;  4DUY K;  3S3O A;  2P9U A;  1VQL N;  3ZSZ A;  4KI4 A;  1BHL A;  3AA3 A;  4JRQ A;  5FPN A;  3KZB A;  4GVE A;  4B3S K;  1HQE A;  2DFF A;  3G4S N;  3AVL A;  3RVC A;  4B08 A;  4CHN A;  1K8K B;  3C7N A;  3CM6 A;  5F0X A;  3G71 N;  3QEP A;  2ZM6 K;  3QML A;  4DS5 A;  2PAV A;  1WSG A;  2VQE K;  4MLE A;  2VCP A;  4ILJ A;  4CW7 B;  1S1U A;  4JHD A;  4B1V A;  1NJI O;  4U67 L;  4N5S A;  3AV9 A;  4CJW A;  4LF5 K;  5C25 A;  4DLG A;  4CF9 A;  4W5R A;  3S9H A;  1QVF M;  1IO2 A;  3M8S A;  4OKK A;  3OS2 A;  3C6U A;  3CHW A;  4CJQ A;  3SJH A;  3CF5 L;  3J7Z O;  4C8L A;  1LAV A;  1ATR A;  4CF1 A;  3TAN A;  3M8R A;  4OKE A;  1HKG A;  3LDS A;  1NGH A;  3CQX A;  3RSE B;  3VQ6 A;  1GLA G;  1MWM A;  4BRM A;  3IAY A;  4IKF A;  1X3M A;  5AQN A;  1GLC G;  1VQ6 N;  1CZ9 A;  4AH9 A;  5AQZ A;  3A5O C;  1NJX A;  3MED A;  4MFB A;  4A57 A;  4BRK A;  3T69 A;  3WNF A;  1FJG K;  5M1N A;  2HST A;  3C6H A;  1UA0 A;  3GL1 A;  1L5U A;  1WNS A;  3KLG A;  4JKH A;  3ZT2 A;  3BZC A;  4DV5 K;  4XH5 A;  2E6L A;  5AQV A;  4DTN A;  3PX0 A;  3O5B A;  3WXL A;  5M1O A;  4CBX A;  3DLR A;  1NGA A;  4ID1 A;  1TK5 A;  4A5B A;  2HMI A;  1SL1 A;  3KLI A;  3QNO A;  1KTQ A;  1XHX A;  5AQX A;  1D9F A;  3BUZ B;  1XMQ K;  1RDA A;  4CJE A;  4H5T A;  3ZX3 A;  3M1F A;  4F3O A;  1U6Z A;  4JNE A;  4FO0 A;  4O5B A;  3NHG A;  4KH4 A;  5AQF A;  3ZT3 A;  4CEE A;  2ZWH A;  4M3W A;  4KTQ A;  4Z0U A;  1WBD A;  3THW A;  4BQZ A;  5KRT A;  2GWK A;  3DLK A;  4AHU A;  4WFN L;  5T7B A;  3QBX A;  1QZ6 A;  2G8V A;  2DY4 A;  4Q5V A;  2VWB A;  3M5R A;  2FF3 B;  1NJY A;  3P39 A;  4PUO A;  4N41 A;  4KHW A;  1ILY A;  1LWE A;  4ISG A;  4BRO A;  3KWG A;  3K58 A;  2W6K A;  3K0S A;  4QOZ B;  1GOC A;  2P9P A;  4A62 A;  2RN2 A;  1LW2 A;  3QEW A;  2CGL A;  3PIP L;  5F2R A;  3G0Z A;  3ZSR A;  4LF8 K;  4HVJ A;  4FOE A;  3OYI A;  4YOU A;  4NCA A;  3RWU A;  5FPD A;  5KQ8 A;  4BWJ A;  1GLB G;  3O08 A;  2D0C A;  3EKU A;  3P38 A;  4BAC A;  4PKH A;  1K8K A;  3AVB A;  5B8H A;  4C23 A;  4H4M A;  2KZZ A;  1YXQ A;  3VMF B;  4YOR A;  4B9T A;  1J54 A;  2IVN A;  1JL2 A;  1T7P A;  4HWI A;  2UUC K;  1HNV A;  5M1P A;  3O80 A;  4M7Y A;  4CGG A;  4BRN A;  1DTT A;  3KLE A;  1WAJ A;  3LAL A;  4B9N A;  3VQD A;  4FWO A;  1RCH A;  3HPO A;  3E66 A;  3G25 A;  1YI2 N;  3O9U A;  4LF6 K;  4YHH K;  3IS9 A;  1ZBF A;  1D8Y A;  3D6R A;  2WTU A;  3OJU A;  4FLU A;  4XH1 A;  2KFZ A;  4B9L A;  4PL7 A;  1D5A A;  1NK5 A;  3TPQ A;  3RSE A;  3L2W A;  3CC4 N;  3DLG A;  3OYB A;  2KHO A;  4FWN A;  4IFE A;  4DUZ K;  3H1V X;  4CK2 A;  2Q36 A;  2ASO A;  3OJS A;  5JS2 A;  5AQL A;  1RNH A;  2Q3S A;  4Z4C A;  3DAW A;  4DR2 K;  4I9Q A;  4CJL A;  1S1X A;  3VA3 A;  4CES A;  1S9G A;  5CYM A;  1RTJ A;  1TK0 A;  4BC2 A;  3L0Q A;  2QTD A;  3VA0 A;  3L2V A;  3HRG A;  4DCH A;  3DLB A;  2P1J A;  4E1M A;  4F2S A;  1WN7 A;  5CR4 A;  3H46 O;  4BE2 A;  4M3T A;  3CC2 N;  3C0B A;  1RDD A;  2XRI A;  4AF1 A;  3NF7 A;  4H5N A;  1NKE A;  4M63 C;  4IDK A;  2VWK A;  4KHU A;  2OPR A; 
#chains in the Genus database with same CATH homology
 2UUB K;  4DR3 K;  2UXB K;  4JI0 K;  3J7A P;  4CW7 B;  4JI6 K;  1IBL K;  4LFA K;  4NXN K;  4JI1 K;  4LF8 K;  1J5E K;  4LF5 K;  5AJ3 K;  5LMN K;  4DV7 K;  4JI7 K;  3J80 O;  4DV0 K;  1HNW K;  4LFB K;  4JI3 K;  4LF9 K;  2UUA K;  5IT9 O;  4YY3 K;  1I94 K;  4X65 K;  4DR1 K;  4KHP K;  3T1Y K;  3T1H K;  1N32 K;  3J7Y P;  4JYA K;  4DV6 K;  2VQF K;  2E5L K;  4LF4 K;  2UUC K;  1N33 K;  4JI4 K;  4B3M K;  1FJG K;  3JAM O;  3J81 O;  4B3R K;  4OX9 K;  1XNQ K;  1XMO K;  4DV1 K;  4B3T K;  4LF6 K;  4DV5 K;  4YHH K;  4GKK K;  2UXD K;  1IBK K;  5LMU K;  4X64 K;  4NXM K;  4GKJ K;  4DR6 K;  4K0K K;  3OTO K;  4JV5 K;  5IWA K;  4X62 K;  4X66 K;  1N34 K;  1XMQ K;  4JI5 K;  4DUZ K;  1HNZ K;  5BR8 K;  2HHH K;  4JI2 K;  4CVN E;  1N36 K;  4LFC K;  2UXC K;  4DUY K;  4DR2 K;  1HNX K;  4LF7 K;  1XNR K;  4V19 S;  4DV3 K;  4DV4 K;  1IBM K;  4B3S K;  4DV2 K;  4DR4 K;  2UU9 K;  2F4V K;  1HR0 K;  4DR7 K;  2ZM6 K;  5LL6 Z;  4DR5 K;  5FLX O;  4AQY K;  4JI8 K;  5A2Q O;  2VQE K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...