4LFAT

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lfaT00
4YY3T 2UXBT 2E5LT 1XMQT 4JYAT 4JI2T 4X62T 2HHHT 4DR2T 1HNWT 2ZM6T 4JI3T 4DV6T 2UUAT 1XNQT 4DUZT 1IBMT 5LMUT 5BR8T 4DR3T 4JI0T 4DR7T 4JI5T 4LF7T 4JI6T 2UXDT 1J5ET 4GKKT 4DV3T 4NXMT 4YHHT 2UXCT 4LF4T 4JI1T 4DUYT 4DV7T 4B3MT 3T1HT 4DV2T 1XNRT 1N34T 4OX9T 4B3RT 5IWAT 4JI7T 4DR6T 1N32T 4DR1T 4X64T 4DV1T 4X65T 2F4VT 4B3TT 4LFCT 1IBLT 4B3ST 1N33T 4DR5T 4LF6T 4K0KT 4LF5T 4DV4T 4LF9T 2UUBT 4KHPT 1IBKT 4GKJT 1HNZT 5LMNT 1FJGT 1HNXT 1HR0T 1XMOT 4LFAT 4DR4T 1N36T 3OTOT 1I94T 4NXNT 2VQFT 2VQET 4LF8T 4DV5T 4AQYT 4LFBT 4X66T 2UUCT 2UU9T 4JV5T 3T1YT 4JI4T 4DV0T 4JI8T
chains in the Genus database with same CATH superfamily
1Y64B 2JMHA 2DHRA 4F8HA 2MYSA 2MOZA 3X1DA 4ANJA 5JDLA 3H3AA 2C5JA 5DQVA 5ADXL 3E0ZA 2E8IA 4KBMB 1IAPA 2WP9A 3DP7A 5DJQC 5LB7B 5L3DB 3FXEB 4IREA 2HHHT 2BVMA 1KF6A 3ANWB 5F8PA 4ADZA 2MTQA 3HR0A 3ONJA 1V9DA 3OPCA 5DABA 3UUMA 3AEDA 1T72A 2J47A 4L0RA 2CXFA 3PUSA 3ZPOA 5L3GB 3RI5A 2XAGB 4QX8B 4AKRB 3PV0F 4DUZT 4UVAB 4EV6A 3MKDA 3RHWA 4IE7A 3BK9A 5LMUT 4HGAA 4DO0A 2A2FX 3LJCA 3PUWF 5AQGB 2Y6XA 2H7OA 4COFA 2A72A 2VASA 2YOEA 3U78A 3KVAA 3RPUA 5LXTE 1YKHB 4IE4A 4CI3B 3ESLA 2DLRA 4IL4A 1YQ3A 2XPKA 4IDNA 3ZMUB 2JQKA 2BG9C 3NWIA 5FY1A 4DR3T 3Q5XA 3H3MA 2NTYA 3PUAA 4CXYA 3ZMVB 2KINB 2L9QA 3JC6D 4IDQA 4JI0T 3ZT7A 5JREA 3CK6A 2XTLA 4KHZF 3AXJA 4JI5T 3VKHA 2EHOC 3K8PC 3LDQB 4AKIA 1JNZA 3N2OA 2D0UA 4IDPA 1MIVA 2L8KA 3D0TA 2QRXA 2EHOB 3PUXF 4O4JE 1BR1A 3TLWA 1UK5A 1YD8G 3Q5EA 5M4YA 2B1EA 2ZM0A 1UURA 4QXBB 5C3JA 5CJ5A 5FNVE 4P0AA 4KP3C 3RGLA 4FJOA 5FYMA 1Z0PA 4NPPA 4PNIA 3GMIA 1T98A 5HXCA 1W0BA 3OVUA 4H9PC 2BKOA 3AEAA 4EEDA 2X66A 4B3RT 2P9BA 5IWAT 2X0YA 2CXLA 5AQQB 2UXNB 3ZCIA 1KNZA 3AECA 3B5MA 1CHUA 1D0XA 3RIUC 1VRBA 4DR6T 5J1GA 4A98A 3N9MA 3VRAA 3AE7A 4HFBA 4I50E 1KNRA 4L5GA 4I43B 2H88A 2LM9A 3UUBA 4IE6A 4OHFA 2LSGA 4DV1T 4X65T 1NWMX 3UTKA 4PK6A 1WR6A 2F4VT 4V1Av 2CA5A 1AJ3A 3K3NA 1SE7A 4HFCA 2BZBA 3C4WA 4ZZBA 2WWUA 1N33T 4YHJA 4DR5T 5JDHA 3P4PA 4K0KT 4LF5T 3I0OA 2IUBA 3H37A 4CN4A 3AVSA 5IHYA 4DIDB 5HAXA 5LJNA 3RKOA 4DV4T 4LF9T 3RYFE 4GKJT 4KHPT 2ZM8A 4PK4A 1ZKEA 2FJEA 2OV9A 5HXHA 3SRZA 3LG7A 2XQ6A 3AE2A 3U3IA 3PUVF 4PK5A 4P1NA 1HF8A 2KNDA 3PUZF 4O2AE 2XJ7A 5FVLA 2WU5A 5J0ZA 2FJBA 2IIUA 2J62A 2VK9A 2WBLA 1HTJF 4LMKA 2NW7A 3JAEA 3RQUA 5ABFA 4JI6T 2JQHA 3AA1B 4HWCA 4JUYA 3NKZA 5AQTB 3N9OA 2YDSA 5HEUA 3CX6B 3ZYKA 2XY8B 3UU6A 4I4TE 4JEUB 3FZHB 1J1JA 1UX4A 4H9OC 4QX7B 2AE9A 2ACZA 2QA7A 4HWHA 5HEOA 1Z8UA 2VQFT 3N9NA 5AQUB 5LBMA 1OEDE 3EHZA 4QH5A 3ZMSB 3N2KE 3ZT5A 3M65A 2XSAA 3OYZA 3RYHE 3J7Yq 5JDGA 5AQMB 5JVDE 4O8SA 4YTMA 1HG5A 2LRLA 5IYZE 4DBRA 2DL1A 2YDRA 1HG2A 3JCFA 4XBFB 3GA8A 2KLQA 2BKPA 3RLFF 2WZIA 1KNPA 4C90A 3AVRA 3T1YT 3N5LA 3Q2MA 3TLVA 1W0AA 1ZP0A 4EGWA 5CGMA 3WAJA 1HCIA 4DV0T 2VKHA 3E22E 1LRZA 3FBLA 4KUMB 4QH4A 3SWHA 5JQGE 1DU2A 4H9RC 4YSYA 2UXBT 5FVKA 2IMLA 2M6BA 3OKQA 4PJJA 3AAIA 2BS2A 1IJ5A 2NW9A 5BMVE 4OYJA 2W63A 1XMQT 4ZEYA 5JRCA 4JYAT 2FUPA 1G73A 2JPFA 3LFMA 3ZMTB 4JI2T 3HKEE 1T7SA 2HN1A 1OXZA 2OA5A 3O1HA 1FIOA 3P50A 3R6NA 5ABHA 3MZKB 4DR2T 3MA9A 3LSVA 4BAYB 2E9XA 2IDOB 2JIWA 2NP9A 2V7IA 5ETWA 3VRBA 4DVDA 4GYSA 1OWAA 2HPLA 3OJAA 5AQLB 2H7VC 3JC6C 4UR9A 2VVSA 2WZHA 4EAHA 3KV4A 1SUMB 3Q5WA 2W61A 2DNXA 3L8RA 3L39A 3PTRB 5HWYA 3CX7B 2W66A 2WS3A 4FI5A 4H63H 4TNWA 5JR9B 1LVFA 1LVKA 2DWKA 2M67A 2V5DA 3ANWA 4B6XA 1HX1B 4LMJA 3P8CD 3EDUA 4U7IA 4ZI2D 2N1GA 3QK6A 4JEHB 3VU7H 4LF7T 4KMCA 4KX6A 4NUVA 5LCYA 4Z90A 1FMVA 5LG4A 4GKKT 3CKDA 3AA7B 2V6XA 5JDFA 2BS4A 4CN6A 2WU2A 4MLKA 2UXCT 2KZ7B 2XUEA 2I59A 2CCQA 2E5VA 4WZXA 4DUYT 1OEDC 3TLSA 4AKHA 3E08A 4OK0A 3PJAA 4HFEA 4JBWF 1T8BA 4YJ3E 1O3XA 4HWIB 5HXRA 3ZJ1A 4DNDA 3I1AA 2YU1A 3F57A 4IL9A 3UQ4A 2MPKA 5LHHB 3T1HT 1M62A 2WDRA 1KEYA 2VKDA 2C0SA 2LSYA 3FZMB 5AQIB 4HE8A 3UU3A 4CXXA 1XNRT 1N34T 1ZOYA 2A3DA 3MJXA 5GONE 3ZC1A 3FZKB 2VKOA 2LSIA 4AQFA 3JADA 3HKBE 4WYVA 2I6HA 4IIJE 2LSKA 5AQOB 4ERRA 3AEGA 2HN2A 4UV8B 2X9WA 3B13A 3RRWA 3QNUA 3T8OA 4BJMA 3ZT6A 3C64A 1UX5A 5L3FB 4AQFC 2CHNA 2D2SA 3V5SA 2CRBA 4KI0F 4H9QC 4P0BA 5AQVB 5JDMA 4WNKA 2LJLA 2FJAA 2C5IT 3Q9DA 3UT5E 1FMWA 3AAAB 3RYCE 4U7YA 1WFDA 3WAKA 1IBLT 1SA0E 3NRYA 3RIUA 3ZEFB 3QUJA 4B3ST 3OBVE 3C50A 4ILCA 4QXHB 4AKLA 2CMRA 4LF6T 4QH1A 2NW8A 3N9PA 3VKGA 4ILAA 5HEGA 2W62A 2XSBA 2X9HA 2LT3A 3RC3A 3RKGA 3TKLB 1HNZT 4AI6A 2XM1A 4A97A 4QKNA 2SPCA 3KFWX 3Q5DA 3QC9A 1YQ4A 2M6IA 4YXDA 5HXSA 3ETUA 2V8SV 3RYIE 1MMGA 3CIRA 5JDQA 3R84B 3IBPA 1YXRA 3UUNA 2V7JA 4JLEA 2LHNA 4U74A 3LK3B 3PUGA 5L4HA 3O9XA 3HA4A 2BBJA 2VWAA 3LK2B 3NZQA 4C91A 1R8IA 1HS7A 2LEHA 3P7IA 4LMLA 4U33A 3TLTA 1H7CA 2BS3A 1MNDA 5AQFB 3V5UA 3P4QA 1YKEB 3QOFA 4HWFA 3IA3A 4ZI3C 2DCFA 5FXVA 3AA0B 2NR4A 4CXWA 4EZHA 4AQYT 4YSXA 3MACA 1W9RA 3OYXA 2IC6A 3ZN1B 2FJDA 1HFAA 1WR0A 2VURA 2LE8A 3EDVA 4N78D 4U31A 3IHRA 4TV9E 4XZCA 5LBQB 3TLUA 5L2LA 4JV5T 2D5UA 4Z8XA 1VCSA 1ZEEA 3K1SA 4JI4T 4ZXLA 2RPAA 4MHCA 3LBXB 2CEAA 2IHR1 2CLYC 3C98B 2D9DA 3VR8A 2BG9E 2VKJA 4MFRA 3CVRA 1MIYA 2XAHB 3B57A 4ILBA 4UF0B 1X79A 2WQYA 2XAJB 4IDZA 3UFGA 2XM2A 3ZJ2A 2VL0A 2Q9QD 4HTEA 1FEWA 2CBJA 4EB6E 3AE5A 5AQHB 5LGTB 3UQ7A 3ZSTA 5AQSB 4X62T 2WDVA 1QSDA 4YJ2E 3A7MA 1XDPA 2G0UA 3O1IA 1HNWT 2XAQB 2ZM6T 4JI3T 1MMNA 5EK2A 4DV6T 3PU8A 5JRCB 4ILUA 2ZMAA 3ONLC 2QGSA 1NAFA 4GK0E 3KINB 3VR9A 1E1HB 5A1LA 2AXDS 2KWIB 1GQEA 1X9BA 1E2AA 3GWHA 2CWYA 3QB5A 2K5BB 4X1YE 5LA6E 3FZLB 5L47A 4UXNB 2V5CA 4O4IE 3CMLA 2YU2A 4GK5E 2N9DA 1QLBA 4IHJE 4WBOA 3RRCA 2ACXA 2V26A 2X9YA 2VL8A 4M1PA 4TN7B 5LOVE 4CQIA 5FL1A 4AKGA 2N2NA 4GIWA 4U3CA 2CM0A 1MMDA 4WW0A 4DMVA 5HYAA 2WWVA 3CQCB 3M3ZB 2Z6EA 2DI4A 3FBZA 3KV5A 5FY7A 3UFEA 5CA0E 2PTFA 1OEDB 3CPZA 2OLTA 1NEKA 2X68A 3GN5B 5EZYE 1D1AA 2V7KA 4EXTA 4QXCB 1J5ET 2ES0A 3N9LA 4DV3T 2E9XD 2W0GA 4NXMT 3N2GE 4XAXB 2EHOA 4YHHT 1E7PA 5LJMA 2LM2A 3HL6A 1BR0A 2XQ5A 2LOSA 4U2YA 4PJNA 5L3CB 1J5WA 2LLYA 3N9QA 3G06A 5EK3A 2X9XA 4O4HE 3PU3A 1YW0A 3KBTA 3J9X1 1UGOA 2QVAA 4GYRA 4H9SE 4U72A 2NWBA 3ZSSA 2BG9B 4YTPA 1WYBA 5LP6E 4ZHQE 3PJAJ 2K24A 1XZYA 5KMGP 2CBIA 2PBIA 4OX9T 2JJ9A 1WRDA 5FMNA 5HEHA 4BA9A 4IGUA 4F6RC 4UV9B 1IJ6A 1MIWA 4JI7T 3NRXA 2YKSA 4QWNB 3SS1A 3ZYMA 4BJNA 1N32T 4NIQA 3FZFB 4OFZA 3P4RA 5AQKB 2XASB 1EZ3A 1BR2A 1CUNA 3AE1A 3DJBA 4PW8A 3AEEA 4YTNA 2V1DB 2K48A 5C8YE 5L3BB 1HX8A 1U5PA 5HEJA 3SOLA 4B3TT 1QUUA 4H9NC 2JQ9A 2XQ9A 3UUXB 5HWXA 1UCUA 1KK7A 3ZLIA 2IW5B 3EI0A 4TX5A 4UVBB 3F2EA 4I55E 4ISTA 3K3OA 2E9XB 2WM9A 4L9IA 1LKXA 3A5XA 1IBKT 4PFPA 2VVNA 4K0UA 4ZI3D 4OYKA 5ABFB 4DMWA 5LMNT 2UXXB 4HFHA 3AE3A 1XDOA 1XMOT 5LG3A 1HR0T 2WDQA 1S94A 2WB5A 2W67A 3UU8A 2C5KT 2XQ8A 2XQAA 4GOUA 2W00A 4HFVA 4TNVA 5F5WA 5FKYA 4IDOA 4A56A 4ZI7E 4ZS3A 5LYJE 2Y48B 1M7KA 2ZM2A 3RF1A 1JNRA 3FHNA 3AEBA 2CXDA 3SFDA 1SHZC 2YDQA 3IEEA 2ODVA 3CX8B 2YN6A 3P4SA 3PUQA 2CPTA 5H6QB 4YT0A 4I0UA 4NXNT 2VQET 4EOZB 1VCTA 2WMNA 2V7LA 3KV6A 2WY2A 2XQ7A 2WSSV 4ASKA 4ISSA 4P09A 1OEDA 4X1KE 1XWMA 3HI2A 3SFEA 4AIUA 5CA1E 1WLXA 1S35A 3ABVA 5KX5E 2XZEA 2YINA 3PURA 3LK42 2BG9A 2NTXA 2YK0A 3EAMA 2UXDT 5F3JA 2KWHA 4MBQA 2EHOD 3AE9A 5L3EB 2HH7A 4QHOA 2J4GA 4J2CA 3IF8B 2WAUA 4PJMA 3S4UA 2W2UA 2E9XC 5FL0A 4YY3T 5HCMA 2E5LT 2H3RA 2PG8A 5EK4A 4E7ZA 5AQJB 3PE0A 3K3QC 4HN9A 3NBXX 1UUSA 3AB3B 4TWDA 4UIGA 2A9UA 3PUYF 3HKDE 3BQKA 5HXEA 4HFDA 4WBNE 3DTOA 4HEAA 5FY0A 2B76A 2BDEA 4O4LE 2X0LB 2X67A 2BVLA 4UELA 4IE5A 3HKCE 4IT4A 3RIAA 5KDMC 2UUAT 2LOPA 2BKNA 1XNQT 4O2BE 2D0TA 3PDYA 2Y8DA 2I0MA 2LRKA 3A8YC 2XQ3A 2LKHA 4EYYR 1IBMT 3RX6A 1NENA 3RH3A 3AA6B 5BR8T 2K9AA 2X51A 2PJQA 3L3PA 3CQXC 3VHLA 4YLHA 3EABA 5CFBA 2IC9A 2CHOA 1D1CA 3F31A 2MBGA 1I6ZA 2ODUA 4ZI2C 2J1DG 2K3WA 5C2TA 3O4XE 2V6YA 4EYUA 3AE6A 5KXJA 4UEMA 2V7MA 3ZN0B 3NVOA 4DR7T 2JMKA 3JAFA 5JDNA 3ZC0A 5JTGA 2YEVC 2HPJA 3UU5A 4E7SA 1Y01A 2RA1A 4TV8E 4TZ4C 1IZNB 3AEFA 2JRKA 3AE4A 4PJLA 3MXZA 5E0OA 5LGNB 4G2AA 3ZMZB 4LF4T 2XQ4A 5LGUB 4HKAA 4JI1T 1L0VA 5CB4E 1B7TA 2ZLYA 5LHGB 4DV7T 4B3MT 5J2TE 2LHRA 1BR4A 3I9WA 3FB2A 3KV9A 4Z91A 2MAWA 4HFIA 4EEBA 2LKGA 4H63V 3QB5K 4DV2T 2GK9A 3BQIA 4MALA 2Q9QA 2VB6A 4CZZB 1VOMA 4HWDA 2KXPB 4Q25A 4UF0A 1WYCA 4CN1A 5AQPB 3AE8A 1WCRA 3ZCJA 5AQRB 5AFUL 2XAFB 5JR9A 2L3LA 4CI2B 3LBXA 3C4XA 3I9YA 3C51A 4AISA 4AQGA 3KBUA 4DR1T 3WI3A 4X64T 1ZV4X 3KVBA 4TWHA 3I0QA 1U4QA 1I94T 2XHEB 3EVYA 4TWFA 4PAGA 4U2ZA 3C4ZA 3UU4A 5LNKA 1D1BA 4LFCT 5TAOA 5FXXA 3GN5A 4NUUA 4EZ4A 5JR9C 4AXPA 1ZHCA 2X0HA 2KMFA 2UUBT 5FP3A 3O1JA 2IAKA 3BQLA 2Q9QC 3ETVA 4ZS2A 2FBWA 5L4EA 2R6GF 2Q9QB 1FJGT 4G63A 3RIFA 3EUHA 3P4WA 3W15B 4ZZCA 1HNXT 3RC8A 2BBHA 4LFAT 1MNEA 3CWZB 4UVCB 4A5XA 4DR4T 1N36T 3ONXA 3L09A 4TUYE 5IUXA 1D0YA 2E2AA 3OTOT 1W09A 2PFVA 4YFSA 5FXZA 4EIWA 2CWOA 2KT9A 2QYWA 3UULA 3AXJB 2NOXA 1US7B 2JQQA 2XQYA 2W4XA 2CE7A 3NZPA 4X5TA 4ZOLE 3CQGB 5ABEA 4LF8T 5J2UE 5LHIB 5HCJA 2KSRA 2RP4A 2CLYB 3RQWA 4PFOA 1MMAA 5AQNB 4DBQA 5JH7E 4DV5T 4IE0A 4LFBT 2V6YB 4X66T 4X1IE 2UUCT 2WMOA 3KDSE 1D0ZA 1KFYA 5DQWA 4JI8T 2UU9T 1G8XA 3MK7C 3FXDB 5FXWA 4CI1B 3ZKRA 2H89A 2DWGA 4YSZA 2LSJA 5ABGA 3AAEB 4X20E 2WCAA 3ZYLA 5H6RB
chains in the Genus database with same CATH topology
4YY3T 2UXBT 2E5LT 1XMQT 4JYAT 4JI2T 4X62T 2HHHT 4DR2T 1HNWT 2ZM6T 4JI3T 4DV6T 2UUAT 1XNQT 4DUZT 1IBMT 5LMUT 5BR8T 4DR3T 4JI0T 4DR7T 4JI5T 4LF7T 4JI6T 2UXDT 1J5ET 4GKKT 4DV3T 4NXMT 4YHHT 2UXCT 4LF4T 4JI1T 4DUYT 4DV7T 4B3MT 3T1HT 4DV2T 1XNRT 1N34T 4OX9T 4B3RT 5IWAT 4JI7T 4DR6T 1N32T 4DR1T 4X64T 4DV1T 4X65T 2F4VT 4B3TT 4LFCT 1IBLT 4B3ST 1N33T 4DR5T 4LF6T 4K0KT 4LF5T 4DV4T 4LF9T 2UUBT 4KHPT 1IBKT 4GKJT 1HNZT 5LMNT 1FJGT 1HNXT 1HR0T 1XMOT 4LFAT 4DR4T 1N36T 3OTOT 1I94T 4NXNT 2VQFT 2VQET 4LF8T 4DV5T 4AQYT 4LFBT 4X66T 2UUCT 2UU9T 4JV5T 3T1YT 4JI4T 4DV0T 4JI8T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 T;  2UXB T;  2E5L T;  1XMQ T;  4JYA T;  4JI2 T;  4X62 T;  2HHH T;  4DR2 T;  1HNW T;  2ZM6 T;  4JI3 T;  4DV6 T;  2UUA T;  1XNQ T;  4DUZ T;  1IBM T;  5LMU T;  5BR8 T;  4DR3 T;  4JI0 T;  4DR7 T;  4JI5 T;  4LF7 T;  4JI6 T;  2UXD T;  1J5E T;  4GKK T;  4DV3 T;  4NXM T;  4YHH T;  2UXC T;  4LF4 T;  4JI1 T;  4DUY T;  4DV7 T;  4B3M T;  3T1H T;  4DV2 T;  1XNR T;  1N34 T;  4OX9 T;  4B3R T;  5IWA T;  4JI7 T;  4DR6 T;  1N32 T;  4DR1 T;  4X64 T;  4DV1 T;  4X65 T;  2F4V T;  4B3T T;  4LFC T;  1IBL T;  4B3S T;  1N33 T;  4DR5 T;  4LF6 T;  4K0K T;  4LF5 T;  4DV4 T;  4LF9 T;  2UUB T;  4KHP T;  1IBK T;  4GKJ T;  1HNZ T;  5LMN T;  1FJG T;  1HNX T;  1HR0 T;  1XMO T;  4LFA T;  4DR4 T;  1N36 T;  3OTO T;  1I94 T;  4NXN T;  2VQF T;  2VQE T;  4LF8 T;  4DV5 T;  4AQY T;  4LFB T;  4X66 T;  2UUC T;  2UU9 T;  4JV5 T;  3T1Y T;  4JI4 T;  4DV0 T;  4JI8 T; 
#chains in the Genus database with same CATH topology
 1Y64 B;  2JMH A;  2DHR A;  4F8H A;  2MYS A;  2MOZ A;  3X1D A;  4ANJ A;  5JDL A;  3H3A A;  2C5J A;  5DQV A;  5ADX L;  3E0Z A;  2E8I A;  4KBM B;  1IAP A;  2WP9 A;  3DP7 A;  5DJQ C;  5LB7 B;  5L3D B;  3FXE B;  4IRE A;  2HHH T;  2BVM A;  1KF6 A;  3ANW B;  5F8P A;  4ADZ A;  2MTQ A;  3HR0 A;  3ONJ A;  1V9D A;  3OPC A;  5DAB A;  3UUM A;  3AED A;  1T72 A;  2J47 A;  4L0R A;  2CXF A;  3PUS A;  3ZPO A;  5L3G B;  3RI5 A;  2XAG B;  4QX8 B;  4AKR B;  3PV0 F;  4DUZ T;  4UVA B;  4EV6 A;  3MKD A;  3RHW A;  4IE7 A;  3BK9 A;  5LMU T;  4HGA A;  4DO0 A;  2A2F X;  3LJC A;  3PUW F;  5AQG B;  2Y6X A;  2H7O A;  4COF A;  2A72 A;  2VAS A;  2YOE A;  3U78 A;  3KVA A;  3RPU A;  5LXT E;  1YKH B;  4IE4 A;  4CI3 B;  3ESL A;  2DLR A;  4IL4 A;  1YQ3 A;  2XPK A;  4IDN A;  3ZMU B;  2JQK A;  2BG9 C;  3NWI A;  5FY1 A;  4DR3 T;  3Q5X A;  3H3M A;  2NTY A;  3PUA A;  4CXY A;  3ZMV B;  2KIN B;  2L9Q A;  3JC6 D;  4IDQ A;  4JI0 T;  3ZT7 A;  5JRE A;  3CK6 A;  2XTL A;  4KHZ F;  3AXJ A;  4JI5 T;  3VKH A;  2EHO C;  3K8P C;  3LDQ B;  4AKI A;  1JNZ A;  3N2O A;  2D0U A;  4IDP A;  1MIV A;  2L8K A;  3D0T A;  2QRX A;  2EHO B;  3PUX F;  4O4J E;  1BR1 A;  3TLW A;  1UK5 A;  1YD8 G;  3Q5E A;  5M4Y A;  2B1E A;  2ZM0 A;  1UUR A;  4QXB B;  5C3J A;  5CJ5 A;  5FNV E;  4P0A A;  4KP3 C;  3RGL A;  4FJO A;  5FYM A;  1Z0P A;  4NPP A;  4PNI A;  3GMI A;  1T98 A;  5HXC A;  1W0B A;  3OVU A;  4H9P C;  2BKO A;  3AEA A;  4EED A;  2X66 A;  4B3R T;  2P9B A;  5IWA T;  2X0Y A;  2CXL A;  5AQQ B;  2UXN B;  3ZCI A;  1KNZ A;  3AEC A;  3B5M A;  1CHU A;  1D0X A;  3RIU C;  1VRB A;  4DR6 T;  5J1G A;  4A98 A;  3N9M A;  3VRA A;  3AE7 A;  4HFB A;  4I50 E;  1KNR A;  4L5G A;  4I43 B;  2H88 A;  2LM9 A;  3UUB A;  4IE6 A;  4OHF A;  2LSG A;  4DV1 T;  4X65 T;  1NWM X;  3UTK A;  4PK6 A;  1WR6 A;  2F4V T;  4V1A v;  2CA5 A;  1AJ3 A;  3K3N A;  1SE7 A;  4HFC A;  2BZB A;  3C4W A;  4ZZB A;  2WWU A;  1N33 T;  4YHJ A;  4DR5 T;  5JDH A;  3P4P A;  4K0K T;  4LF5 T;  3I0O A;  2IUB A;  3H37 A;  4CN4 A;  3AVS A;  5IHY A;  4DID B;  5HAX A;  5LJN A;  3RKO A;  4DV4 T;  4LF9 T;  3RYF E;  4GKJ T;  4KHP T;  2ZM8 A;  4PK4 A;  1ZKE A;  2FJE A;  2OV9 A;  5HXH A;  3SRZ A;  3LG7 A;  2XQ6 A;  3AE2 A;  3U3I A;  3PUV F;  4PK5 A;  4P1N A;  1HF8 A;  2KND A;  3PUZ F;  4O2A E;  2XJ7 A;  5FVL A;  2WU5 A;  5J0Z A;  2FJB A;  2IIU A;  2J62 A;  2VK9 A;  2WBL A;  1HTJ F;  4LMK A;  2NW7 A;  3JAE A;  3RQU A;  5ABF A;  4JI6 T;  2JQH A;  3AA1 B;  4HWC A;  4JUY A;  3NKZ A;  5AQT B;  3N9O A;  2YDS A;  5HEU A;  3CX6 B;  3ZYK A;  2XY8 B;  3UU6 A;  4I4T E;  4JEU B;  3FZH B;  1J1J A;  1UX4 A;  4H9O C;  4QX7 B;  2AE9 A;  2ACZ A;  2QA7 A;  4HWH A;  5HEO A;  1Z8U A;  2VQF T;  3N9N A;  5AQU B;  5LBM A;  1OED E;  3EHZ A;  4QH5 A;  3ZMS B;  3N2K E;  3ZT5 A;  3M65 A;  2XSA A;  3OYZ A;  3RYH E;  3J7Y q;  5JDG A;  5AQM B;  5JVD E;  4O8S A;  4YTM A;  1HG5 A;  2LRL A;  5IYZ E;  4DBR A;  2DL1 A;  2YDR A;  1HG2 A;  3JCF A;  4XBF B;  3GA8 A;  2KLQ A;  2BKP A;  3RLF F;  2WZI A;  1KNP A;  4C90 A;  3AVR A;  3T1Y T;  3N5L A;  3Q2M A;  3TLV A;  1W0A A;  1ZP0 A;  4EGW A;  5CGM A;  3WAJ A;  1HCI A;  4DV0 T;  2VKH A;  3E22 E;  1LRZ A;  3FBL A;  4KUM B;  4QH4 A;  3SWH A;  5JQG E;  1DU2 A;  4H9R C;  4YSY A;  2UXB T;  5FVK A;  2IML A;  2M6B A;  3OKQ A;  4PJJ A;  3AAI A;  2BS2 A;  1IJ5 A;  2NW9 A;  5BMV E;  4OYJ A;  2W63 A;  1XMQ T;  4ZEY A;  5JRC A;  4JYA T;  2FUP A;  1G73 A;  2JPF A;  3LFM A;  3ZMT B;  4JI2 T;  3HKE E;  1T7S A;  2HN1 A;  1OXZ A;  2OA5 A;  3O1H A;  1FIO A;  3P50 A;  3R6N A;  5ABH A;  3MZK B;  4DR2 T;  3MA9 A;  3LSV A;  4BAY B;  2E9X A;  2IDO B;  2JIW A;  2NP9 A;  2V7I A;  5ETW A;  3VRB A;  4DVD A;  4GYS A;  1OWA A;  2HPL A;  3OJA A;  5AQL B;  2H7V C;  3JC6 C;  4UR9 A;  2VVS A;  2WZH A;  4EAH A;  3KV4 A;  1SUM B;  3Q5W A;  2W61 A;  2DNX A;  3L8R A;  3L39 A;  3PTR B;  5HWY A;  3CX7 B;  2W66 A;  2WS3 A;  4FI5 A;  4H63 H;  4TNW A;  5JR9 B;  1LVF A;  1LVK A;  2DWK A;  2M67 A;  2V5D A;  3ANW A;  4B6X A;  1HX1 B;  4LMJ A;  3P8C D;  3EDU A;  4U7I A;  4ZI2 D;  2N1G A;  3QK6 A;  4JEH B;  3VU7 H;  4LF7 T;  4KMC A;  4KX6 A;  4NUV A;  5LCY A;  4Z90 A;  1FMV A;  5LG4 A;  4GKK T;  3CKD A;  3AA7 B;  2V6X A;  5JDF A;  2BS4 A;  4CN6 A;  2WU2 A;  4MLK A;  2UXC T;  2KZ7 B;  2XUE A;  2I59 A;  2CCQ A;  2E5V A;  4WZX A;  4DUY T;  1OED C;  3TLS A;  4AKH A;  3E08 A;  4OK0 A;  3PJA A;  4HFE A;  4JBW F;  1T8B A;  4YJ3 E;  1O3X A;  4HWI B;  5HXR A;  3ZJ1 A;  4DND A;  3I1A A;  2YU1 A;  3F57 A;  4IL9 A;  3UQ4 A;  2MPK A;  5LHH B;  3T1H T;  1M62 A;  2WDR A;  1KEY A;  2VKD A;  2C0S A;  2LSY A;  3FZM B;  5AQI B;  4HE8 A;  3UU3 A;  4CXX A;  1XNR T;  1N34 T;  1ZOY A;  2A3D A;  3MJX A;  5GON E;  3ZC1 A;  3FZK B;  2VKO A;  2LSI A;  4AQF A;  3JAD A;  3HKB E;  4WYV A;  2I6H A;  4IIJ E;  2LSK A;  5AQO B;  4ERR A;  3AEG A;  2HN2 A;  4UV8 B;  2X9W A;  3B13 A;  3RRW A;  3QNU A;  3T8O A;  4BJM A;  3ZT6 A;  3C64 A;  1UX5 A;  5L3F B;  4AQF C;  2CHN A;  2D2S A;  3V5S A;  2CRB A;  4KI0 F;  4H9Q C;  4P0B A;  5AQV B;  5JDM A;  4WNK A;  2LJL A;  2FJA A;  2C5I T;  3Q9D A;  3UT5 E;  1FMW A;  3AAA B;  3RYC E;  4U7Y A;  1WFD A;  3WAK A;  1IBL T;  1SA0 E;  3NRY A;  3RIU A;  3ZEF B;  3QUJ A;  4B3S T;  3OBV E;  3C50 A;  4ILC A;  4QXH B;  4AKL A;  2CMR A;  4LF6 T;  4QH1 A;  2NW8 A;  3N9P A;  3VKG A;  4ILA A;  5HEG A;  2W62 A;  2XSB A;  2X9H A;  2LT3 A;  3RC3 A;  3RKG A;  3TKL B;  1HNZ T;  4AI6 A;  2XM1 A;  4A97 A;  4QKN A;  2SPC A;  3KFW X;  3Q5D A;  3QC9 A;  1YQ4 A;  2M6I A;  4YXD A;  5HXS A;  3ETU A;  2V8S V;  3RYI E;  1MMG A;  3CIR A;  5JDQ A;  3R84 B;  3IBP A;  1YXR A;  3UUN A;  2V7J A;  4JLE A;  2LHN A;  4U74 A;  3LK3 B;  3PUG A;  5L4H A;  3O9X A;  3HA4 A;  2BBJ A;  2VWA A;  3LK2 B;  3NZQ A;  4C91 A;  1R8I A;  1HS7 A;  2LEH A;  3P7I A;  4LML A;  4U33 A;  3TLT A;  1H7C A;  2BS3 A;  1MND A;  5AQF B;  3V5U A;  3P4Q A;  1YKE B;  3QOF A;  4HWF A;  3IA3 A;  4ZI3 C;  2DCF A;  5FXV A;  3AA0 B;  2NR4 A;  4CXW A;  4EZH A;  4AQY T;  4YSX A;  3MAC A;  1W9R A;  3OYX A;  2IC6 A;  3ZN1 B;  2FJD A;  1HFA A;  1WR0 A;  2VUR A;  2LE8 A;  3EDV A;  4N78 D;  4U31 A;  3IHR A;  4TV9 E;  4XZC A;  5LBQ B;  3TLU A;  5L2L A;  4JV5 T;  2D5U A;  4Z8X A;  1VCS A;  1ZEE A;  3K1S A;  4JI4 T;  4ZXL A;  2RPA A;  4MHC A;  3LBX B;  2CEA A;  2IHR 1;  2CLY C;  3C98 B;  2D9D A;  3VR8 A;  2BG9 E;  2VKJ A;  4MFR A;  3CVR A;  1MIY A;  2XAH B;  3B57 A;  4ILB A;  4UF0 B;  1X79 A;  2WQY A;  2XAJ B;  4IDZ A;  3UFG A;  2XM2 A;  3ZJ2 A;  2VL0 A;  2Q9Q D;  4HTE A;  1FEW A;  2CBJ A;  4EB6 E;  3AE5 A;  5AQH B;  5LGT B;  3UQ7 A;  3ZST A;  5AQS B;  4X62 T;  2WDV A;  1QSD A;  4YJ2 E;  3A7M A;  1XDP A;  2G0U A;  3O1I A;  1HNW T;  2XAQ B;  2ZM6 T;  4JI3 T;  1MMN A;  5EK2 A;  4DV6 T;  3PU8 A;  5JRC B;  4ILU A;  2ZMA A;  3ONL C;  2QGS A;  1NAF A;  4GK0 E;  3KIN B;  3VR9 A;  1E1H B;  5A1L A;  2AXD S;  2KWI B;  1GQE A;  1X9B A;  1E2A A;  3GWH A;  2CWY A;  3QB5 A;  2K5B B;  4X1Y E;  5LA6 E;  3FZL B;  5L47 A;  4UXN B;  2V5C A;  4O4I E;  3CML A;  2YU2 A;  4GK5 E;  2N9D A;  1QLB A;  4IHJ E;  4WBO A;  3RRC A;  2ACX A;  2V26 A;  2X9Y A;  2VL8 A;  4M1P A;  4TN7 B;  5LOV E;  4CQI A;  5FL1 A;  4AKG A;  2N2N A;  4GIW A;  4U3C A;  2CM0 A;  1MMD A;  4WW0 A;  4DMV A;  5HYA A;  2WWV A;  3CQC B;  3M3Z B;  2Z6E A;  2DI4 A;  3FBZ A;  3KV5 A;  5FY7 A;  3UFE A;  5CA0 E;  2PTF A;  1OED B;  3CPZ A;  2OLT A;  1NEK A;  2X68 A;  3GN5 B;  5EZY E;  1D1A A;  2V7K A;  4EXT A;  4QXC B;  1J5E T;  2ES0 A;  3N9L A;  4DV3 T;  2E9X D;  2W0G A;  4NXM T;  3N2G E;  4XAX B;  2EHO A;  4YHH T;  1E7P A;  5LJM A;  2LM2 A;  3HL6 A;  1BR0 A;  2XQ5 A;  2LOS A;  4U2Y A;  4PJN A;  5L3C B;  1J5W A;  2LLY A;  3N9Q A;  3G06 A;  5EK3 A;  2X9X A;  4O4H E;  3PU3 A;  1YW0 A;  3KBT A;  3J9X 1;  1UGO A;  2QVA A;  4GYR A;  4H9S E;  4U72 A;  2NWB A;  3ZSS A;  2BG9 B;  4YTP A;  1WYB A;  5LP6 E;  4ZHQ E;  3PJA J;  2K24 A;  1XZY A;  5KMG P;  2CBI A;  2PBI A;  4OX9 T;  2JJ9 A;  1WRD A;  5FMN A;  5HEH A;  4BA9 A;  4IGU A;  4F6R C;  4UV9 B;  1IJ6 A;  1MIW A;  4JI7 T;  3NRX A;  2YKS A;  4QWN B;  3SS1 A;  3ZYM A;  4BJN A;  1N32 T;  4NIQ A;  3FZF B;  4OFZ A;  3P4R A;  5AQK B;  2XAS B;  1EZ3 A;  1BR2 A;  1CUN A;  3AE1 A;  3DJB A;  4PW8 A;  3AEE A;  4YTN A;  2V1D B;  2K48 A;  5C8Y E;  5L3B B;  1HX8 A;  1U5P A;  5HEJ A;  3SOL A;  4B3T T;  1QUU A;  4H9N C;  2JQ9 A;  2XQ9 A;  3UUX B;  5HWX A;  1UCU A;  1KK7 A;  3ZLI A;  2IW5 B;  3EI0 A;  4TX5 A;  4UVB B;  3F2E A;  4I55 E;  4IST A;  3K3O A;  2E9X B;  2WM9 A;  4L9I A;  1LKX A;  3A5X A;  1IBK T;  4PFP A;  2VVN A;  4K0U A;  4ZI3 D;  4OYK A;  5ABF B;  4DMW A;  5LMN T;  2UXX B;  4HFH A;  3AE3 A;  1XDO A;  1XMO T;  5LG3 A;  1HR0 T;  2WDQ A;  1S94 A;  2WB5 A;  2W67 A;  3UU8 A;  2C5K T;  2XQ8 A;  2XQA A;  4GOU A;  2W00 A;  4HFV A;  4TNV A;  5F5W A;  5FKY A;  4IDO A;  4A56 A;  4ZI7 E;  4ZS3 A;  5LYJ E;  2Y48 B;  1M7K A;  2ZM2 A;  3RF1 A;  1JNR A;  3FHN A;  3AEB A;  2CXD A;  3SFD A;  1SHZ C;  2YDQ A;  3IEE A;  2ODV A;  3CX8 B;  2YN6 A;  3P4S A;  3PUQ A;  2CPT A;  5H6Q B;  4YT0 A;  4I0U A;  4NXN T;  2VQE T;  4EOZ B;  1VCT A;  2WMN A;  2V7L A;  3KV6 A;  2WY2 A;  2XQ7 A;  2WSS V;  4ASK A;  4ISS A;  4P09 A;  1OED A;  4X1K E;  1XWM A;  3HI2 A;  3SFE A;  4AIU A;  5CA1 E;  1WLX A;  1S35 A;  3ABV A;  5KX5 E;  2XZE A;  2YIN A;  3PUR A;  3LK4 2;  2BG9 A;  2NTX A;  2YK0 A;  3EAM A;  2UXD T;  5F3J A;  2KWH A;  4MBQ A;  2EHO D;  3AE9 A;  5L3E B;  2HH7 A;  4QHO A;  2J4G A;  4J2C A;  3IF8 B;  2WAU A;  4PJM A;  3S4U A;  2W2U A;  2E9X C;  5FL0 A;  4YY3 T;  5HCM A;  2E5L T;  2H3R A;  2PG8 A;  5EK4 A;  4E7Z A;  5AQJ B;  3PE0 A;  3K3Q C;  4HN9 A;  3NBX X;  1UUS A;  3AB3 B;  4TWD A;  4UIG A;  2A9U A;  3PUY F;  3HKD E;  3BQK A;  5HXE A;  4HFD A;  4WBN E;  3DTO A;  4HEA A;  5FY0 A;  2B76 A;  2BDE A;  4O4L E;  2X0L B;  2X67 A;  2BVL A;  4UEL A;  4IE5 A;  3HKC E;  4IT4 A;  3RIA A;  5KDM C;  2UUA T;  2LOP A;  2BKN A;  1XNQ T;  4O2B E;  2D0T A;  3PDY A;  2Y8D A;  2I0M A;  2LRK A;  3A8Y C;  2XQ3 A;  2LKH A;  4EYY R;  1IBM T;  3RX6 A;  1NEN A;  3RH3 A;  3AA6 B;  5BR8 T;  2K9A A;  2X51 A;  2PJQ A;  3L3P A;  3CQX C;  3VHL A;  4YLH A;  3EAB A;  5CFB A;  2IC9 A;  2CHO A;  1D1C A;  3F31 A;  2MBG A;  1I6Z A;  2ODU A;  4ZI2 C;  2J1D G;  2K3W A;  5C2T A;  3O4X E;  2V6Y A;  4EYU A;  3AE6 A;  5KXJ A;  4UEM A;  2V7M A;  3ZN0 B;  3NVO A;  4DR7 T;  2JMK A;  3JAF A;  5JDN A;  3ZC0 A;  5JTG A;  2YEV C;  2HPJ A;  3UU5 A;  4E7S A;  1Y01 A;  2RA1 A;  4TV8 E;  4TZ4 C;  1IZN B;  3AEF A;  2JRK A;  3AE4 A;  4PJL A;  3MXZ A;  5E0O A;  5LGN B;  4G2A A;  3ZMZ B;  4LF4 T;  2XQ4 A;  5LGU B;  4HKA A;  4JI1 T;  1L0V A;  5CB4 E;  1B7T A;  2ZLY A;  5LHG B;  4DV7 T;  4B3M T;  5J2T E;  2LHR A;  1BR4 A;  3I9W A;  3FB2 A;  3KV9 A;  4Z91 A;  2MAW A;  4HFI A;  4EEB A;  2LKG A;  4H63 V;  3QB5 K;  4DV2 T;  2GK9 A;  3BQI A;  4MAL A;  2Q9Q A;  2VB6 A;  4CZZ B;  1VOM A;  4HWD A;  2KXP B;  4Q25 A;  4UF0 A;  1WYC A;  4CN1 A;  5AQP B;  3AE8 A;  1WCR A;  3ZCJ A;  5AQR B;  5AFU L;  2XAF B;  5JR9 A;  2L3L A;  4CI2 B;  3LBX A;  3C4X A;  3I9Y A;  3C51 A;  4AIS A;  4AQG A;  3KBU A;  4DR1 T;  3WI3 A;  4X64 T;  1ZV4 X;  3KVB A;  4TWH A;  3I0Q A;  1U4Q A;  1I94 T;  2XHE B;  3EVY A;  4TWF A;  4PAG A;  4U2Z A;  3C4Z A;  3UU4 A;  5LNK A;  1D1B A;  4LFC T;  5TAO A;  5FXX A;  3GN5 A;  4NUU A;  4EZ4 A;  5JR9 C;  4AXP A;  1ZHC A;  2X0H A;  2KMF A;  2UUB T;  5FP3 A;  3O1J A;  2IAK A;  3BQL A;  2Q9Q C;  3ETV A;  4ZS2 A;  2FBW A;  5L4E A;  2R6G F;  2Q9Q B;  1FJG T;  4G63 A;  3RIF A;  3EUH A;  3P4W A;  3W15 B;  4ZZC A;  1HNX T;  3RC8 A;  2BBH A;  4LFA T;  1MNE A;  3CWZ B;  4UVC B;  4A5X A;  4DR4 T;  1N36 T;  3ONX A;  3L09 A;  4TUY E;  5IUX A;  1D0Y A;  2E2A A;  3OTO T;  1W09 A;  2PFV A;  4YFS A;  5FXZ A;  4EIW A;  2CWO A;  2KT9 A;  2QYW A;  3UUL A;  3AXJ B;  2NOX A;  1US7 B;  2JQQ A;  2XQY A;  2W4X A;  2CE7 A;  3NZP A;  4X5T A;  4ZOL E;  3CQG B;  5ABE A;  4LF8 T;  5J2U E;  5LHI B;  5HCJ A;  2KSR A;  2RP4 A;  2CLY B;  3RQW A;  4PFO A;  1MMA A;  5AQN B;  4DBQ A;  5JH7 E;  4DV5 T;  4IE0 A;  4LFB T;  2V6Y B;  4X66 T;  4X1I E;  2UUC T;  2WMO A;  3KDS E;  1D0Z A;  1KFY A;  5DQW A;  4JI8 T;  2UU9 T;  1G8X A;  3MK7 C;  3FXD B;  5FXW A;  4CI1 B;  3ZKR A;  2H89 A;  2DWG A;  4YSZ A;  2LSJ A;  5ABG A;  3AAE B;  4X20 E;  2WCA A;  3ZYL A;  5H6R B; 
#chains in the Genus database with same CATH homology
 4YY3 T;  2UXB T;  2E5L T;  1XMQ T;  4JYA T;  4JI2 T;  4X62 T;  2HHH T;  4DR2 T;  1HNW T;  2ZM6 T;  4JI3 T;  4DV6 T;  2UUA T;  1XNQ T;  4DUZ T;  1IBM T;  5LMU T;  5BR8 T;  4DR3 T;  4JI0 T;  4DR7 T;  4JI5 T;  4LF7 T;  4JI6 T;  2UXD T;  1J5E T;  4GKK T;  4DV3 T;  4NXM T;  4YHH T;  2UXC T;  4LF4 T;  4JI1 T;  4DUY T;  4DV7 T;  4B3M T;  3T1H T;  4DV2 T;  1XNR T;  1N34 T;  4OX9 T;  4B3R T;  5IWA T;  4JI7 T;  4DR6 T;  1N32 T;  4DR1 T;  4X64 T;  4DV1 T;  4X65 T;  2F4V T;  4B3T T;  4LFC T;  1IBL T;  4B3S T;  1N33 T;  4DR5 T;  4LF6 T;  4K0K T;  4LF5 T;  4DV4 T;  4LF9 T;  2UUB T;  4KHP T;  1IBK T;  4GKJ T;  1HNZ T;  5LMN T;  1FJG T;  1HNX T;  1HR0 T;  1XMO T;  4LFA T;  4DR4 T;  1N36 T;  3OTO T;  1I94 T;  4NXN T;  2VQF T;  2VQE T;  4LF8 T;  4DV5 T;  4AQY T;  4LFB T;  4X66 T;  2UUC T;  2UU9 T;  4JV5 T;  3T1Y T;  4JI4 T;  4DV0 T;  4JI8 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...