4LFBE

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 40
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lfbE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfbE02
4DUYI 1MU5A 3V2UC 1X47A 2DEJA 2UU9E 1FJGI 4DUYE 1UILA 3PYDA 1IBLI 5BR8I 1FJGE 4I3HA 3ZZTA 5BR8E 1Z0GA 1FKAE 1FWLA 2HFSA 1YYWA 4DPXA 1K47A 2BV3A 2IHR1 4DV7I 3VYXA 1XNQE 4DV7E 1HNZE 3QT5A 3B82A 1PKPA 3P1XA 4UT4A 4JYAI 3K1JA 2L2NA 3B78A 4FWGA 2UUBI 2LBSB 1EI1A 3PYEA 2LRSA 3LNUA 4LF8I 3ADIA 2UUBE 3C4BA 4DR2I 4LF8E 2EFGA 4DR2E 4LF5I 4HACA 3WU4A 4LF5E 2UUAI 3QT6A 3QT8A 2DEIA 4X65E 3J81Q 2F4VI 4DR3E 2UUAE 2HK3A 4DR7E 4X66I 1S4EA 4HY1A 2BM0A 4DKKA 1A6FA 1N33I 3J7AM 1WUUA 3JAMC 2HHHI 4JI1I 1OJ4A 2UXDI 4B3SI 1IBME 2HHHE 1H72C 4JI1E 4HXZA 4X64I 4DV5E 1FI4A 1N0VC 2HK2A 5IT9C 4P7AA 1BKNA 4JI5I 5LMNI 2V2QA 4DR1I 4LFCI 2V2ZA 2MDRA 2ZITA 4DV1I 4DR1E 4R1FA 1N32I 2V2VA 3WU6A 4DV1E 2LUQA 2L3JA 1N32E 3HTXA 1J26A 2WW4A 4DUZE 4B3RI 4GKJI 1Z0TA 5LMUE 3J80C 4GKJE 2L2MA 2A2DA 1NHHA 1XMQE 2XEXA 2NA2A 2R3VA 4JI6E 1HR0E 4FWHA 1WHNA 2LUPB 4JI0E 4DXLA 3ZZ0A 4PRXA 4WFTA 1RREA 4MYTA 4JI4I 3LTOA 4JI4E 4M2ZA 1DARA 4DPYA 1Z5CA 3V5RA 1Z0BA 4HYMA 4FN5A 4YY3E 4URLA 4USKA 4JI2I 2LJPA 1IBLE 1NHJA 4JV5I 4PU9A 2HFUA 1NHIA 1J5EI 4M30A 2E5LI 4JV5E 2R42A 4LF9I 1J5EE 2E5LE 4DU8A 4LF9E 2RS6A 4DR6I 2ZM6I 4LF7I 3PYFA 4WUDA 4JYAE 4LF7E 1ZM2A 2N3GA 1S16A 3HULA 4B3MI 2L3CA 3M6AA 1H74A 2Q2EB 1STUA 4JI8I 4OX9I 2KHXA 1GQEA 3T1YI 4JI8E 4WUCA 1Z59A 4OX9E 2B7TA 3ADJA 1HNWI 2UXCI 1N36I 2CPNA 3T1YE 5FLXC 1HNWE 2F4VE 3LPSA 1N36E 4JI7I 2E1RA 4USMA 2V34A 4LFBI 4X66E 1X49A 4X8WA 1Z0VA 2LTRA 3J7Yp 1ZXMA 4LFBE 4HACB 3WU5A 1N33E 3QT7A 1QZRA 1ZM4A 3VYYA 2VF3A 4GKKI 2ZBKB 2UXDE 4Z7YA 1N34I 1T4LB 4B3SE 1PIEA 1KKHA 4KQVA 1N34E 1EA6A 3ADLA 4X64E 1FNMA 3C4TA 4UTGA 2BM1A 2DB2A 4JI5E 4FW9A 1T4OA 5LMNE 5GMDA 4LFCE 3ZZUA 3JAMQ 1H73A 1UEKA 1NZ0A 2DMYA 5A2QQ 3D4JA 4PRVA 4NXNI 2X7IA 5IT9Q 2DIXA 2N3HA 4KHPI 4B3RE 3ZKBA 4DR5I 3PYGA 1Z0WA 1ZM9A 4EMDA 1PVGA 2OI2A 3K17A 1KVKA 4MYUA 2L2KB 3J7AG 4DV4I 3J80Q 1Z0EA 4ZVIA 4DU7A 4DV4E 1YYKA 2UXBI 5IWAI 1XHKA 1DI2A 2VQFI 5IWAE 1T4NA 2VQFE 4LFAI 1ZBTA 1MX0A 4LF6I 2NPFA 4LF6E 1H7UA 5LL6R 4FWDA 2AJ4A 1Z5AA 4JI2E 1IBKI 4DV6I 1I94I 1HNXI 2YT4A 1Z5BA 2JVAA 2UU9I 1I94E 1HNXE 1ZXNA 1X48A 1YZ9A 4DR6E 2EZ6A 4LF4I 2ZM6E 1RR9A 1EKZA 1YYOA 1H7SA 4LF4E 4DV2I 1XNQI 1HNZI 3GONA 4DV2E 1ELOA 1VISA 4JG4A 4B3ME 4YHHI 2RSMA 3H4LA 4JI3I 4YHHE 2A2CA 3WU3A 4JI3E 2UXCE 3J81C 1U2RA 3B8HA 3OTOI 1D6TA 4JI7E 1MG7A 2RTXA 3OTOE 2L33A 1B63A 4RPFA 1XMOI 4OOGC 2UUCI 4X65I 2LJHA 4DR3I 1XMOE 3CWVA 1RQ0A 2UUCE 5FLXQ 2V8PA 4DR7I 1UHZA 2X36A 4WYQB 1KTVA 4M1KA 1N0UA 4GKKE 2NUFA 1WHQA 3Q1QA 4P52A 3LLHA 3F0NA 2RS7A 1IBMI 2NUEA 5GMEA 4DV3I 4DPTA 5A2QC 4DV5I 5L3JA 4DV3E 4NXNE 4Z7CA 3T1HI 4NXMI 4KHPE 2B7VA 4WUBA 3T1HE 4NXME 4DR5E 2HKJA 4DR4I 4K0KI 1O0WA 4DUZI 3ADGA 4DR4E 1Z0CA 4DV0I 4K0KE 4B3TI 5LMUI 1RC7A 2VQEI 4DPWA 4DV0E 4AQYI 2HKEA 4B3TE 1XNRI 2LTSA 2GS8A 2VQEE 4AQYE 1XMQI 2CZ9A 1XNRE 2UXBE 4JI6I 1ZM3A 1HR0I 3ZKDA 4JI0I 2NUGA 4X62I 2JY9A 4X62E 4LFAE 2B3TB 1B62A 2J7KA 5CFFE 4ED4A 1KIJA 4XTJA 1QU6A 1FWKA 1IBKE 4DPUA 4DV6E 3ZM7A 4YY3I
chains in the Genus database with same CATH superfamily
1USUA 4DUYI 2EMXA 1MU5A 2CG9A 1X47A 1NCSA 3V2UC 3M85D 2JOXA 2DEJA 2UU9E 3FIGA 1FJGI 2UXCI 1DQ3A 2EOZA 4DUYE 1UILA 2MKDA 5AE1A 3PYDA 1IBLI 5BR8I 3AUZA 2V89A 1FJGE 2GLIA 4BA1A 4I3HA 2PO1A 4R03A 2AE8A 2IERA 4FW6A 5BR8E 1Z0GA 3ZZTA 1FKAE 1LLMC 1FWLA 2HFSA 1YYWA 5A6JA 1K47A 3GLLA 4DPXA 5TSEA 4BBYA 2EPZA 2IHR1 2BV3A 1GZ6A 2EPAA 2J7JA 3VYXA 2MC5A 2PNMA 4DV7I 1XNQE 4F9AB 4X9JA 2EMZA 2A25A 4DV7E 1HNZE 3QT5A 2EOFA 4BHCA 3EPJA 2Z5CB 1PKPA 2DSYA 3B82A 3EQ1A 3MSWA 3P1XA 2PRTA 4UT4A 4JYAI 4O5GA 3K1JA 2L2NA 3B78A 4FWGA 3U1KA 2UUBI 2LBSB 4R2SA 2EPRA 1EI1A 3PYEA 2LRSA 2JYAA 3LNUA 4LF8I 5AE2A 4R8OA 4BMJA 3C4BA 2UUBE 3ADIA 4DR2I 3EPHA 2O1UA 1X5WA 4LF8E 3L7ZB 2EFGA 4AIDA 3BBGA 4DR2E 4LF5I 4HACA 4O24A 2ELYA 2JT2A 3HKMA 2EM7A 3C6MA 3WU4A 5KL5A 4LF5E 2EM0A 3KRNA 5JEAC 4I8OA 5JEAA 2UUAI 2CTDA 4WSPA 3QT6A 3QT8A 2DEIA 5LMUI 2YSOA 1IQSA 4X65E 3J81Q 4DR3E 2UUAE 2F4VI 1BBOA 2HK3A 4DMIA 1IMUA 2EOYA 4FW3A 2C37A 5C0XA 4DR7E 4L8NA 4X66I 2RSIA 1P42A 1S4EA 2EMIA 2O1TA 4HY1A 4GKKI 2M9AA 4P7DA 4O43A 5DRPA 2BM0A 4DKKA 2EOSA 5DNYA 1A6FA 1EH6A 2KONA 2IOPA 3J7AM 1N33I 3H09A 1A1FA 1XXEA 1WUUA 2NN6D 4MQYA 3JAMC 3U1YA 2HHHI 4JI1I 1OJ4A 2UXDI 5AC5A 4B3SI 1JK2A 1IBME 2EMCA 1A1LA 2EN3A 2HHHE 2YTEA 4JI1E 1H72C 2EMHA 2EQ3A 5JEAB 4HXZA 4X64I 4DV5E 3VHTB 1FI4A 1N0VC 5IT9C 1ZU1A 1USVA 2HK2A 4P7AA 1BKNA 2PO2A 4FK5C 4JI5I 5LMNI 2V2QA 1N3GA 4DR1I 2CGEA 2Z5BB 2EL6A 2C37B 4LFCI 5C0XB 2V2ZA 5AC4A 2MDRA 2ZITA 5DNLA 4DV1I 4DR1E 4R1FA 1N32I 2V2VA 2EM5A 2YTJA 3WU6A 2WZOA 3EPKA 4DV1E 2EPXA 2LUQA 2V88A 2YTPA 2ENHA 2L3JA 1N32E 3M7NG 3HTXA 1J26A 2WW4A 4DUZE 2H36X 2EL4A 4KWYA 4B3RI 4GKJI 3EPLA 1Z0TA 3M7ND 5LMUE 3J80C 4GKJE 2L2MA 2RQLA 1BBGA 2BA0G 2YWQA 2EN1A 1NHHA 4WSGA 2A2DA 1XMQE 5DRQA 5DRRA 5EKWA 2XEXA 2YTGA 4IZKA 2YTIA 2BA0D 2NA2A 2R3VA 4JI6E 4OO1B 2O3ZA 2YTQA 4AIMA 2EE8A 1HR0E 4FWHA 1WHNA 2LUPB 2EMWA 4JI0E 4DXLA 5IXMB 3ZZ0A 2NABA 3C6KA 4PRXA 4WFTA 2NN6C 2V85A 1RREA 4MYTA 5A6BD 2M7QA 2NN6A 2BA1G 3ECRA 4JI4I 2EM6A 3LTOA 2EM3A 2BBGA 4ZYHA 2M1SA 4JI4E 4M2ZA 2BA1D 4FW7A 5IV8B 1DARA 3Q6MA 4DPYA 2EQ0A 2DRPA 2LO3A 1OYPA 1Z5CA 1YUJA 2LV2A 1A1JA 2IESA 4QNKA 4IFDC 3V5RA 4IFDA 2IOQA 1Z0BA 4AM3A 2YSPA 5K36C 2G7HA 2I9IA 4HYMA 4FN5A 4IZKB 5K36A 1QNTA 2LT7A 3P3GA 4YY3E 2Q8UA 4URLA 4USKA 1X6FA 4BCAA 3DD6A 2M4IA 4JI2I 2LJPA 2WCC3 1IBLE 1A1IA 1NHJA 4JV5I 4PU9A 2HFUA 1NHIA 2C39B 1J5EI 4M30A 2EOEA 2WP8B 2EL5A 5KL3A 2E5LI 3P3CA 4JV5E 1P47A 2R42A 4OZEA 3UHMA 4LF9I 1J5EE 3IWBA 2BR2A 2E5LE 3K6QA 1SR9A 2PNLA 2Z5EA 4DU8A 4LF9E 2EOQA 2RS6A 2YTFA 1UN6B 4DR6I 2ZM6I 1YH8A 4IFDB 3CDIA 1Y60A 5DROA 5KL4A 1RMDA 1R6LA 1UDSA 3PYFA 4JYAE 1GTKA 4WUDA 4LF7I 5K36B 2EM2A 4LF7E 3F6GA 1YFHA 1ZM2A 2N3GA 2YRKA 4QNJA 1S16A 2ODRC 3HULA 1JK1A 4B3MI 5JEAF 4BA1B 2PO1B 1YUIA 1R6MA 2L3CA 2JEBA 3M6AA 2VE7C 4L5NC 1UDNA 4J8ZA 4MU4A 1H74A 2EP3A 2Q2EB 1STUA 2EPNA 2V86A 3HQ1A 4GQUA 4JI8I 1DGCA 5C0XF 4OX9I 1A1HA 4OO1F 2KHXA 1OYRA 2BR2B 1GQEA 3T1YI 3ZOQB 1RHYA 4JI8E 4IZJD 1Z59A 4OX9E 1AH5A 2B7TA 3ADJA 4WUCA 1N36I 1HNWI 2CPNA 4TUIA 5A6KA 3T1YE 5FLXC 1HNWE 2F4VE 4N4RB 3LPSA 1N36E 4JI7I 2E1RA 4USMA 2V34A 2GO3A 4LCHA 4LFBI 4X66E 1X49A 2ENCA 3M99B 4X8WA 3TQMA 2LTRA 4WXDA 1Z0VA 3THOB 2D9HA 3J7Yp 1ZXMA 4LFBE 4NHRA 4R2DA 4HACB 4OKGA 3WU5A 2YTNA 4MU0A 5JEAE 1N33E 3QT7A 2C38A 1QZRA 1ZM4A 2WBTA 3VYYA 4N3OA 2VF3A 2EQ1A 2ZBKB 4GZNC 2UXDE 4Z7YA 3HJCA 1T4LB 4B3SE 5C0XE 1N34I 2CT1A 2R76A 1PIEA 1KKHA 4KQVA 1N34E 1EA6A 3ADLA 4X64E 1FNMA 3C4TA 4MU3A 4UTGA 2DLQA 2BM1A 2DB2A 4BA2A 2GHFA 4JI5E 1T4OA 4FW9A 5LMNE 5GMDA 4LFCE 3ZZUA 3JAMQ 1H73A 1BB8A 1UEKA 1NZ0A 2DMYA 1G2FC 1ZR9A 4KZSA 3GCMA 2JR1A 5A2QQ 5FWKA 2YRMA 2GO4A 3D4JA 2YZTA 2JE6A 4PRVA 3HPSA 1MGTA 4NXNI 4F6NA 2X7IA 5KL6A 5IT9Q 3JU0A 1A1KA 2EMAA 2DIXA 2N3HA 3MHHC 4MLVA 2C38B 4KHPI 2EPKX 3KZYA 3UK3C 4B3RE 2MKNA 3P3EA 4IZJA 3ZKBA 4DR5I 3PYGA 3IWDA 2JEAA 4OO1E 1Z0WA 1ZM9A 3THNA 2YU5A 4WPYA 4EMDA 1PVGA 2OI2A 2PO2B 2B9DA 3K17A 2NN6F 4M9VC 4RH8A 2EN4A 3RMPA 1KVKA 4BHBA 1TF6A 2JP9A 4MYUA 2L2KB 5DNXA 1F2IG 1ZBQA 3J7AG 3LMLA 2YRHA 5KL2A 4DV4I 1TN9A 3J80Q 1Z0EA 2EMBA 1UDOA 2J65A 2EWLA 4IS1C 4ZVIA 4DU7A 2HC5A 4DV4E 5T6JA 1YYKA 1AAYA 2UXBI 4MDTA 4IFDF 5AE3A 5IWAI 4ZYDA 1XHKA 4R2PA 5K36F 1DI2A 2VQFI 5IWAE 1YHCA 4U3DA 1WJPA 1T4NA 2JXPA 2JEAB 2MC6A 2VQFE 2EOHA 4LFAI 1KJKA 1ZBTA 3PS3A 1MX0A 2FV4B 2V83A 4MU1A 2RPCA 4ZYEA 4LF6I 1ZAAC 2NPFA 1Z1BA 2LVHA 4LF6E 2EM4A 1H7UA 1OYSA 3P06A 2EJ4A 5LL6R 3K85A 4FWDA 2AJ4A 1X6HA 2EN7A 1Z5AA 4LU9A 2NN6B 1EH7A 2E72A 2HJJA 4F54A 4JI2E 3P76A 1X3CA 1IBKI 2Z5CA 4HEIA 2EPCA 4DV6I 5JEAD 1I94I 3L00A 3PS2A 4WXCA 2L8TA 4IFDE 2EMYA 2YT4A 1HNXI 2EOMA 1Z5BA 2JVAA 4FW4A 2UU9I 4NZVA 5K36E 2EN8A 1I94E 2JPAA 3PRYA 1X6EA 1HNXE 5C0XD 4F9BB 1ZXNA 2EPUA 4LPFA 1X48A 2EN2A 2EM9A 2JOBA 1YZ9A 4DR6E 2CVEA 2GPIA 2EZ6A 3L7ZA 3IWCA 2ZM6E 1RR9A 1EKZA 2YU8A 2K7IA 4LF4I 1G2DC 1YYOA 1H7SA 3QG5C 4LF4E 4DV2I 2DLKA 1XNQI 5A6BA 4P78A 4BS9A 1HNZI 3HXLA 2EMKA 3JTZA 3GONA 2CSHA 4DV2E 1ELOA 1VISA 4JG4A 4B3ME 3KWRA 2WBSA 1HK7A 4YHHI 2RSMA 3H4LA 4F2JC 2EORA 4JI3I 2MDGA 3B4TA 4R2RA 4YHHE 2WNRA 2A2CA 3WU3A 4JI3E 2VF1A 4U3BA 5A6AA 1SFEA 2LCEA 4BC7A 4F9CB 4OO1D 2UXCE 2EN6A 3J81C 4BC9A 1U2RA 2DGCA 3B8HA 3OTOI 1D6TA 2PO0A 2YPNA 2EPLX 4JI7E 3GMEA 1MG7A 3F6HA 4F6MA 2RTXA 3OTOE 2L33A 1B63A 4HTGA 5ELWA 1YSAC 2I13A 4RPFA 1XMOI 4OOGC 2VRDA 4LCGA 2UUCI 2JEBB 4X65I 2LJHA 3KZZA 5EL9A 4R2EA 4DR3I 1KYQA 5F3WA 1XMOE 1UDQA 1RQ0A 2F1DA 2EOIA 3CWVA 3DF6A 2UUCE 5FLXQ 1L4SA 2V8PA 1PJQA 4DR7I 5C0XC 1UHZA 2X36A 4WYQB 5A69A 2WNRB 2Z5BA 1KTVA 5ADZA 2LMZA 4M1KA 1N0UA 4GKKE 2NUFA 5KL7A 1T39A 1WHQA 3Q1QA 2YTDA 1E3HA 2YTOA 2PNZA 4P52A 4TUGA 3BIDA 4IS9A 2PO0B 1Y5YA 3LLHA 3F0NA 2RS7A 1IBMI 2FTXB 4WX9A 1B69A 2V8QB 4M0VA 3VK6A 2R1FA 2EPPA 1PJSA 2WBUA 2NUEA 5GMEA 3BF2A 1TF3A 1Y4SA 5A2QC 3DJWA 4DPTA 4DV3I 4DV5I 5L3JA 2ADRA 4DV3E 2ENAA 4NXNE 4Z7CA 2L6MA 2EMGA 2GQ0A 3T1HI 1WXRA 4NXMI 2JWOA 1IQOA 1PDAA 3MHSC 2E1MA 2K4VA 4OO1C 1Y6ZA 4KHPE 4IFDD 4OO1A 2B7VA 4WUBA 3T1HE 4NXME 4DR5E 2HKJA 4ISAA 5LLQA 5K36D 4LOMA 2VESA 4DR4I 2PNZB 1E3PA 4K0KI 1O0WA 3ZM7A 4BA2B 2F8BA 4R2QA 1Y4UA 1YPNA 4O4KA 4DUZI 3ADGA 4DR4E 1Z0CA 3Q6NA 1NEIA 4K0KE 2O1WA 4DV0I 4IJDA 4B3TI 4LCFA 4Q35B 1RC7A 1A1GA 3H1CA 4J3DA 4NBQA 4DV0E 4DPWA 2EOXA 2HKEA 2VQEI 4AQYI 4GEQB 4B3TE 2JE6B 1XNRI 2LTSA 2EM8A 4LTYA 2N8XA 2GS8A 1WRJA 2VQEE 4AQYE 1XMQI 2CZ9A 3BGHA 1XNRE 4Q28A 3AV0A 1VI7A 2UXBE 3PS1A 4JI6I 4IZJB 2EPMX 2BB8A 2KOUA 1ZM3A 1HR0I 3ZKDA 2EPOA 2V87A 2NUGA 4JI0I 4X62I 2EMLA 2HGHA 5AASA 2JY9A 2O1VA 2EOOA 4X62E 2EOJA 3NZKA 4LFAE 2B3TB 1PJTA 4RHBB 3OMLA 2ELZA 1T38A 1B62A 2NN6E 4R2CA 2ODRD 1UBDC 2C39A 2J7KA 1EH8A 2LE2A 2WP8A 5CFFE 4FW5A 4ED4A 1MEYC 4R2AA 2LJUA 4ZYGA 1KIJA 4XTJA 2L92A 2DMIA 3CDJA 3HPZA 1QU6A 2EMFA 2FGGA 1IBKE 1FWKA 3M85G 4DPUA 4DV6E 4MLQA 4YY3I
chains in the Genus database with same CATH topology
1USUA 4DUYI 1MU5A 3V2UC 2CG9A 1X47A 2JOXA 2DEJA 2UU9E 3FIGA 1FJGI 1DQ3A 4DUYE 1UILA 5AE1A 3PYDA 1IBLI 5BR8I 3AUZA 2V89A 1FJGE 4I3HA 4R03A 3ZZTA 5BR8E 1Z0GA 1FKAE 1FWLA 2HFSA 1YYWA 4DPXA 1K47A 4BBYA 2BV3A 2IHR1 4DV7I 1GZ6A 2PNMA 3VYXA 2MC5A 1XNQE 4F9AB 4DV7E 1HNZE 3QT5A 3B82A 2Z5CB 1PKPA 2DSYA 3MSWA 3P1XA 4UT4A 4JYAI 3K1JA 2L2NA 3B78A 4FWGA 2UUBI 2LBSB 1EI1A 3PYEA 2LRSA 3LNUA 4LF8I 5AE2A 4R8OA 4BMJA 3C4BA 2UUBE 3ADIA 4DR2I 2O1UA 4LF8E 2EFGA 4DR2E 4LF5I 4HACA 3WU4A 4LF5E 4I8OA 2UUAI 4WSPA 3QT6A 3QT8A 2DEIA 4X65E 3J81Q 2F4VI 4DR3E 2UUAE 2HK3A 4DMIA 4DR7E 4L8NA 4X66I 1S4EA 2O1TA 4HY1A 4P7DA 2BM0A 4DKKA 5DNYA 1A6FA 2KONA 2IOPA 1N33I 3J7AM 3H09A 1WUUA 3JAMC 2HHHI 4JI1I 1OJ4A 2UXDI 4B3SI 1IBME 2HHHE 1H72C 4JI1E 4HXZA 4X64I 4DV5E 1FI4A 1N0VC 5IT9C 2HK2A 1USVA 4P7AA 1BKNA 4JI5I 5LMNI 2V2QA 4DR1I 2CGEA 2Z5BB 4LFCI 2V2ZA 2MDRA 2ZITA 4DV1I 4DR1E 4R1FA 1N32I 2V2VA 3WU6A 2WZOA 4DV1E 2LUQA 2V88A 2L3JA 1N32E 3HTXA 1J26A 2WW4A 4DUZE 2H36X 4B3RI 4GKJI 1Z0TA 5LMUE 3J80C 4GKJE 2L2MA 2A2DA 1NHHA 1XMQE 2XEXA 4IZKA 2NA2A 2R3VA 4JI6E 1HR0E 4FWHA 1WHNA 2LUPB 4JI0E 4DXLA 3ZZ0A 4PRXA 4WFTA 2V85A 1RREA 4MYTA 2M7QA 4JI4I 3LTOA 2M1SA 4JI4E 4M2ZA 1DARA 3Q6MA 4DPYA 1Z5CA 3V5RA 2IOQA 1Z0BA 2G7HA 4HYMA 4FN5A 4IZKB 4YY3E 4URLA 4USKA 4BCAA 2M4IA 4JI2I 2LJPA 1IBLE 1NHJA 4JV5I 4PU9A 2HFUA 1NHIA 1J5EI 4M30A 2E5LI 4JV5E 2R42A 4LF9I 1J5EE 3IWBA 2E5LE 3K6QA 1SR9A 2PNLA 2Z5EA 4DU8A 4LF9E 2RS6A 4DR6I 2ZM6I 4LF7I 3PYFA 4WUDA 4JYAE 4LF7E 3F6GA 1ZM2A 2N3GA 1S16A 2ODRC 3HULA 4B3MI 2L3CA 3M6AA 2VE7C 4L5NC 4J8ZA 1H74A 2Q2EB 1STUA 4JI8I 2V86A 3HQ1A 4OX9I 2KHXA 1GQEA 3T1YI 3ZOQB 4JI8E 4IZJD 1Z59A 4OX9E 2B7TA 3ADJA 4WUCA 1HNWI 1N36I 2UXCI 2CPNA 4TUIA 3T1YE 5FLXC 1HNWE 2F4VE 3LPSA 1N36E 4JI7I 2E1RA 4USMA 2V34A 4LFBI 4X66E 1X49A 4X8WA 1Z0VA 2LTRA 3J7Yp 1ZXMA 4LFBE 4HACB 3WU5A 1N33E 3QT7A 1QZRA 1ZM4A 3VYYA 4N3OA 2VF3A 4GKKI 2ZBKB 2UXDE 4Z7YA 1N34I 3HJCA 1T4LB 4B3SE 1PIEA 1KKHA 4KQVA 1N34E 1EA6A 3ADLA 4X64E 1FNMA 3C4TA 4UTGA 2BM1A 2DB2A 4JI5E 4FW9A 1T4OA 5LMNE 5GMDA 4LFCE 3ZZUA 3JAMQ 1H73A 1UEKA 1NZ0A 2DMYA 4KZSA 5A2QQ 2JR1A 5FWKA 3D4JA 2YZTA 4PRVA 3HPSA 4NXNI 2X7IA 5IT9Q 3JU0A 2DIXA 2N3HA 4KHPI 4B3RE 4IZJA 3ZKBA 4DR5I 3PYGA 3IWDA 1Z0WA 1ZM9A 4WPYA 4EMDA 1PVGA 2OI2A 2B9DA 3K17A 3RMPA 1KVKA 4MYUA 2L2KB 3J7AG 1ZBQA 3LMLA 4DV4I 3J80Q 1Z0EA 2EWLA 4ZVIA 4DU7A 4DV4E 5T6JA 1YYKA 2UXBI 5AE3A 5IWAI 1XHKA 1DI2A 2VQFI 5IWAE 1T4NA 2MC6A 2VQFE 4LFAI 1ZBTA 1MX0A 2FV4B 2V83A 4LF6I 2NPFA 4LF6E 1H7UA 3P06A 5LL6R 3K85A 4FWDA 2AJ4A 1Z5AA 4LU9A 4F54A 4JI2E 1IBKI 2Z5CA 4DV6I 1I94I 2L8TA 1HNXI 2YT4A 1Z5BA 2JVAA 2UU9I 1I94E 3PRYA 1HNXE 4F9BB 1ZXNA 1X48A 2JOBA 1YZ9A 4DR6E 2EZ6A 4LF4I 3IWCA 2ZM6E 1RR9A 1EKZA 1YYOA 1H7SA 4LF4E 4DV2I 1XNQI 4P78A 4BS9A 1HNZI 3HXLA 3GONA 3JTZA 4DV2E 1ELOA 1VISA 4JG4A 4B3ME 3KWRA 1HK7A 4YHHI 2RSMA 3H4LA 4JI3I 4YHHE 2A2CA 3WU3A 4JI3E 2VF1A 4BC7A 4F9CB 2UXCE 3J81C 4BC9A 1U2RA 3B8HA 3OTOI 1D6TA 4JI7E 1MG7A 3F6HA 2RTXA 3OTOE 2L33A 1B63A 4RPFA 1XMOI 4OOGC 2UUCI 4X65I 2LJHA 4DR3I 1XMOE 5F3WA 3CWVA 1RQ0A 3DF6A 2UUCE 5FLXQ 2V8PA 4DR7I 1UHZA 2X36A 4WYQB 2Z5BA 1KTVA 5ADZA 2LMZA 4M1KA 1N0UA 4GKKE 2NUFA 1WHQA 3Q1QA 4P52A 4TUGA 3LLHA 3F0NA 2RS7A 1IBMI 2FTXB 2V8QB 4M0VA 3VK6A 2NUEA 5GMEA 4DV3I 1Y4SA 4DPTA 5A2QC 3DJWA 4DV5I 5L3JA 4DV3E 4NXNE 4Z7CA 2L6MA 2GQ0A 3T1HI 1WXRA 4NXMI 2JWOA 2K4VA 2E1MA 1Y6ZA 4KHPE 2B7VA 4WUBA 3T1HE 4NXME 4DR5E 2HKJA 4DR4I 4K0KI 1O0WA 2F8BA 1Y4UA 4DUZI 3ADGA 4DR4E 1Z0CA 3Q6NA 2O1WA 4K0KE 4DV0I 4B3TI 5LMUI 1RC7A 2VQEI 4DPWA 4DV0E 4AQYI 2HKEA 4GEQB 4B3TE 1XNRI 2LTSA 4LTYA 2GS8A 2VQEE 4AQYE 1XMQI 2CZ9A 1XNRE 4Q28A 3AV0A 2UXBE 4JI6I 4IZJB 2KOUA 1ZM3A 1HR0I 3ZKDA 4JI0I 2V87A 2NUGA 4X62I 5AASA 2JY9A 2O1VA 4X62E 4LFAE 2B3TB 3OMLA 1B62A 2ODRD 2J7KA 2LE2A 5CFFE 4ED4A 1KIJA 4XTJA 2L92A 3HPZA 1QU6A 2FGGA 1IBKE 1FWKA 4DPUA 4DV6E 3ZM7A 4YY3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY I;  1MU5 A;  3V2U C;  1X47 A;  2DEJ A;  2UU9 E;  1FJG I;  4DUY E;  1UIL A;  3PYD A;  1IBL I;  5BR8 I;  1FJG E;  4I3H A;  3ZZT A;  5BR8 E;  1Z0G A;  1FKA E;  1FWL A;  2HFS A;  1YYW A;  4DPX A;  1K47 A;  2BV3 A;  2IHR 1;  4DV7 I;  3VYX A;  1XNQ E;  4DV7 E;  1HNZ E;  3QT5 A;  3B82 A;  1PKP A;  3P1X A;  4UT4 A;  4JYA I;  3K1J A;  2L2N A;  3B78 A;  4FWG A;  2UUB I;  2LBS B;  1EI1 A;  3PYE A;  2LRS A;  3LNU A;  4LF8 I;  3ADI A;  2UUB E;  3C4B A;  4DR2 I;  4LF8 E;  2EFG A;  4DR2 E;  4LF5 I;  4HAC A;  3WU4 A;  4LF5 E;  2UUA I;  3QT6 A;  3QT8 A;  2DEI A;  4X65 E;  3J81 Q;  2F4V I;  4DR3 E;  2UUA E;  2HK3 A;  4DR7 E;  4X66 I;  1S4E A;  4HY1 A;  2BM0 A;  4DKK A;  1A6F A;  1N33 I;  3J7A M;  1WUU A;  3JAM C;  2HHH I;  4JI1 I;  1OJ4 A;  2UXD I;  4B3S I;  1IBM E;  2HHH E;  1H72 C;  4JI1 E;  4HXZ A;  4X64 I;  4DV5 E;  1FI4 A;  1N0V C;  2HK2 A;  5IT9 C;  4P7A A;  1BKN A;  4JI5 I;  5LMN I;  2V2Q A;  4DR1 I;  4LFC I;  2V2Z A;  2MDR A;  2ZIT A;  4DV1 I;  4DR1 E;  4R1F A;  1N32 I;  2V2V A;  3WU6 A;  4DV1 E;  2LUQ A;  2L3J A;  1N32 E;  3HTX A;  1J26 A;  2WW4 A;  4DUZ E;  4B3R I;  4GKJ I;  1Z0T A;  5LMU E;  3J80 C;  4GKJ E;  2L2M A;  2A2D A;  1NHH A;  1XMQ E;  2XEX A;  2NA2 A;  2R3V A;  4JI6 E;  1HR0 E;  4FWH A;  1WHN A;  2LUP B;  4JI0 E;  4DXL A;  3ZZ0 A;  4PRX A;  4WFT A;  1RRE A;  4MYT A;  4JI4 I;  3LTO A;  4JI4 E;  4M2Z A;  1DAR A;  4DPY A;  1Z5C A;  3V5R A;  1Z0B A;  4HYM A;  4FN5 A;  4YY3 E;  4URL A;  4USK A;  4JI2 I;  2LJP A;  1IBL E;  1NHJ A;  4JV5 I;  4PU9 A;  2HFU A;  1NHI A;  1J5E I;  4M30 A;  2E5L I;  4JV5 E;  2R42 A;  4LF9 I;  1J5E E;  2E5L E;  4DU8 A;  4LF9 E;  2RS6 A;  4DR6 I;  2ZM6 I;  4LF7 I;  3PYF A;  4WUD A;  4JYA E;  4LF7 E;  1ZM2 A;  2N3G A;  1S16 A;  3HUL A;  4B3M I;  2L3C A;  3M6A A;  1H74 A;  2Q2E B;  1STU A;  4JI8 I;  4OX9 I;  2KHX A;  1GQE A;  3T1Y I;  4JI8 E;  4WUC A;  1Z59 A;  4OX9 E;  2B7T A;  3ADJ A;  1HNW I;  2UXC I;  1N36 I;  2CPN A;  3T1Y E;  5FLX C;  1HNW E;  2F4V E;  3LPS A;  1N36 E;  4JI7 I;  2E1R A;  4USM A;  2V34 A;  4LFB I;  4X66 E;  1X49 A;  4X8W A;  1Z0V A;  2LTR A;  3J7Y p;  1ZXM A;  4LFB E;  4HAC B;  3WU5 A;  1N33 E;  3QT7 A;  1QZR A;  1ZM4 A;  3VYY A;  2VF3 A;  4GKK I;  2ZBK B;  2UXD E;  4Z7Y A;  1N34 I;  1T4L B;  4B3S E;  1PIE A;  1KKH A;  4KQV A;  1N34 E;  1EA6 A;  3ADL A;  4X64 E;  1FNM A;  3C4T A;  4UTG A;  2BM1 A;  2DB2 A;  4JI5 E;  4FW9 A;  1T4O A;  5LMN E;  5GMD A;  4LFC E;  3ZZU A;  3JAM Q;  1H73 A;  1UEK A;  1NZ0 A;  2DMY A;  5A2Q Q;  3D4J A;  4PRV A;  4NXN I;  2X7I A;  5IT9 Q;  2DIX A;  2N3H A;  4KHP I;  4B3R E;  3ZKB A;  4DR5 I;  3PYG A;  1Z0W A;  1ZM9 A;  4EMD A;  1PVG A;  2OI2 A;  3K17 A;  1KVK A;  4MYU A;  2L2K B;  3J7A G;  4DV4 I;  3J80 Q;  1Z0E A;  4ZVI A;  4DU7 A;  4DV4 E;  1YYK A;  2UXB I;  5IWA I;  1XHK A;  1DI2 A;  2VQF I;  5IWA E;  1T4N A;  2VQF E;  4LFA I;  1ZBT A;  1MX0 A;  4LF6 I;  2NPF A;  4LF6 E;  1H7U A;  5LL6 R;  4FWD A;  2AJ4 A;  1Z5A A;  4JI2 E;  1IBK I;  4DV6 I;  1I94 I;  1HNX I;  2YT4 A;  1Z5B A;  2JVA A;  2UU9 I;  1I94 E;  1HNX E;  1ZXN A;  1X48 A;  1YZ9 A;  4DR6 E;  2EZ6 A;  4LF4 I;  2ZM6 E;  1RR9 A;  1EKZ A;  1YYO A;  1H7S A;  4LF4 E;  4DV2 I;  1XNQ I;  1HNZ I;  3GON A;  4DV2 E;  1ELO A;  1VIS A;  4JG4 A;  4B3M E;  4YHH I;  2RSM A;  3H4L A;  4JI3 I;  4YHH E;  2A2C A;  3WU3 A;  4JI3 E;  2UXC E;  3J81 C;  1U2R A;  3B8H A;  3OTO I;  1D6T A;  4JI7 E;  1MG7 A;  2RTX A;  3OTO E;  2L33 A;  1B63 A;  4RPF A;  1XMO I;  4OOG C;  2UUC I;  4X65 I;  2LJH A;  4DR3 I;  1XMO E;  3CWV A;  1RQ0 A;  2UUC E;  5FLX Q;  2V8P A;  4DR7 I;  1UHZ A;  2X36 A;  4WYQ B;  1KTV A;  4M1K A;  1N0U A;  4GKK E;  2NUF A;  1WHQ A;  3Q1Q A;  4P52 A;  3LLH A;  3F0N A;  2RS7 A;  1IBM I;  2NUE A;  5GME A;  4DV3 I;  4DPT A;  5A2Q C;  4DV5 I;  5L3J A;  4DV3 E;  4NXN E;  4Z7C A;  3T1H I;  4NXM I;  4KHP E;  2B7V A;  4WUB A;  3T1H E;  4NXM E;  4DR5 E;  2HKJ A;  4DR4 I;  4K0K I;  1O0W A;  4DUZ I;  3ADG A;  4DR4 E;  1Z0C A;  4DV0 I;  4K0K E;  4B3T I;  5LMU I;  1RC7 A;  2VQE I;  4DPW A;  4DV0 E;  4AQY I;  2HKE A;  4B3T E;  1XNR I;  2LTS A;  2GS8 A;  2VQE E;  4AQY E;  1XMQ I;  2CZ9 A;  1XNR E;  2UXB E;  4JI6 I;  1ZM3 A;  1HR0 I;  3ZKD A;  4JI0 I;  2NUG A;  4X62 I;  2JY9 A;  4X62 E;  4LFA E;  2B3T B;  1B62 A;  2J7K A;  5CFF E;  4ED4 A;  1KIJ A;  4XTJ A;  1QU6 A;  1FWK A;  1IBK E;  4DPU A;  4DV6 E;  3ZM7 A;  4YY3 I; 
#chains in the Genus database with same CATH topology
 1USU A;  4DUY I;  2EMX A;  1MU5 A;  2CG9 A;  1X47 A;  1NCS A;  3V2U C;  3M85 D;  2JOX A;  2DEJ A;  2UU9 E;  3FIG A;  1FJG I;  2UXC I;  1DQ3 A;  2EOZ A;  4DUY E;  1UIL A;  2MKD A;  5AE1 A;  3PYD A;  1IBL I;  5BR8 I;  3AUZ A;  2V89 A;  1FJG E;  2GLI A;  4BA1 A;  4I3H A;  2PO1 A;  4R03 A;  2AE8 A;  2IER A;  4FW6 A;  5BR8 E;  1Z0G A;  3ZZT A;  1FKA E;  1LLM C;  1FWL A;  2HFS A;  1YYW A;  5A6J A;  1K47 A;  3GLL A;  4DPX A;  5TSE A;  4BBY A;  2EPZ A;  2IHR 1;  2BV3 A;  1GZ6 A;  2EPA A;  2J7J A;  3VYX A;  2MC5 A;  2PNM A;  4DV7 I;  1XNQ E;  4F9A B;  4X9J A;  2EMZ A;  2A25 A;  4DV7 E;  1HNZ E;  3QT5 A;  2EOF A;  4BHC A;  3EPJ A;  2Z5C B;  1PKP A;  2DSY A;  3B82 A;  3EQ1 A;  3MSW A;  3P1X A;  2PRT A;  4UT4 A;  4JYA I;  4O5G A;  3K1J A;  2L2N A;  3B78 A;  4FWG A;  3U1K A;  2UUB I;  2LBS B;  4R2S A;  2EPR A;  1EI1 A;  3PYE A;  2LRS A;  2JYA A;  3LNU A;  4LF8 I;  5AE2 A;  4R8O A;  4BMJ A;  3C4B A;  2UUB E;  3ADI A;  4DR2 I;  3EPH A;  2O1U A;  1X5W A;  4LF8 E;  3L7Z B;  2EFG A;  4AID A;  3BBG A;  4DR2 E;  4LF5 I;  4HAC A;  4O24 A;  2ELY A;  2JT2 A;  3HKM A;  2EM7 A;  3C6M A;  3WU4 A;  5KL5 A;  4LF5 E;  2EM0 A;  3KRN A;  5JEA C;  4I8O A;  5JEA A;  2UUA I;  2CTD A;  4WSP A;  3QT6 A;  3QT8 A;  2DEI A;  5LMU I;  2YSO A;  1IQS A;  4X65 E;  3J81 Q;  4DR3 E;  2UUA E;  2F4V I;  1BBO A;  2HK3 A;  4DMI A;  1IMU A;  2EOY A;  4FW3 A;  2C37 A;  5C0X A;  4DR7 E;  4L8N A;  4X66 I;  2RSI A;  1P42 A;  1S4E A;  2EMI A;  2O1T A;  4HY1 A;  4GKK I;  2M9A A;  4P7D A;  4O43 A;  5DRP A;  2BM0 A;  4DKK A;  2EOS A;  5DNY A;  1A6F A;  1EH6 A;  2KON A;  2IOP A;  3J7A M;  1N33 I;  3H09 A;  1A1F A;  1XXE A;  1WUU A;  2NN6 D;  4MQY A;  3JAM C;  3U1Y A;  2HHH I;  4JI1 I;  1OJ4 A;  2UXD I;  5AC5 A;  4B3S I;  1JK2 A;  1IBM E;  2EMC A;  1A1L A;  2EN3 A;  2HHH E;  2YTE A;  4JI1 E;  1H72 C;  2EMH A;  2EQ3 A;  5JEA B;  4HXZ A;  4X64 I;  4DV5 E;  3VHT B;  1FI4 A;  1N0V C;  5IT9 C;  1ZU1 A;  1USV A;  2HK2 A;  4P7A A;  1BKN A;  2PO2 A;  4FK5 C;  4JI5 I;  5LMN I;  2V2Q A;  1N3G A;  4DR1 I;  2CGE A;  2Z5B B;  2EL6 A;  2C37 B;  4LFC I;  5C0X B;  2V2Z A;  5AC4 A;  2MDR A;  2ZIT A;  5DNL A;  4DV1 I;  4DR1 E;  4R1F A;  1N32 I;  2V2V A;  2EM5 A;  2YTJ A;  3WU6 A;  2WZO A;  3EPK A;  4DV1 E;  2EPX A;  2LUQ A;  2V88 A;  2YTP A;  2ENH A;  2L3J A;  1N32 E;  3M7N G;  3HTX A;  1J26 A;  2WW4 A;  4DUZ E;  2H36 X;  2EL4 A;  4KWY A;  4B3R I;  4GKJ I;  3EPL A;  1Z0T A;  3M7N D;  5LMU E;  3J80 C;  4GKJ E;  2L2M A;  2RQL A;  1BBG A;  2BA0 G;  2YWQ A;  2EN1 A;  1NHH A;  4WSG A;  2A2D A;  1XMQ E;  5DRQ A;  5DRR A;  5EKW A;  2XEX A;  2YTG A;  4IZK A;  2YTI A;  2BA0 D;  2NA2 A;  2R3V A;  4JI6 E;  4OO1 B;  2O3Z A;  2YTQ A;  4AIM A;  2EE8 A;  1HR0 E;  4FWH A;  1WHN A;  2LUP B;  2EMW A;  4JI0 E;  4DXL A;  5IXM B;  3ZZ0 A;  2NAB A;  3C6K A;  4PRX A;  4WFT A;  2NN6 C;  2V85 A;  1RRE A;  4MYT A;  5A6B D;  2M7Q A;  2NN6 A;  2BA1 G;  3ECR A;  4JI4 I;  2EM6 A;  3LTO A;  2EM3 A;  2BBG A;  4ZYH A;  2M1S A;  4JI4 E;  4M2Z A;  2BA1 D;  4FW7 A;  5IV8 B;  1DAR A;  3Q6M A;  4DPY A;  2EQ0 A;  2DRP A;  2LO3 A;  1OYP A;  1Z5C A;  1YUJ A;  2LV2 A;  1A1J A;  2IES A;  4QNK A;  4IFD C;  3V5R A;  4IFD A;  2IOQ A;  1Z0B A;  4AM3 A;  2YSP A;  5K36 C;  2G7H A;  2I9I A;  4HYM A;  4FN5 A;  4IZK B;  5K36 A;  1QNT A;  2LT7 A;  3P3G A;  4YY3 E;  2Q8U A;  4URL A;  4USK A;  1X6F A;  4BCA A;  3DD6 A;  2M4I A;  4JI2 I;  2LJP A;  2WCC 3;  1IBL E;  1A1I A;  1NHJ A;  4JV5 I;  4PU9 A;  2HFU A;  1NHI A;  2C39 B;  1J5E I;  4M30 A;  2EOE A;  2WP8 B;  2EL5 A;  5KL3 A;  2E5L I;  3P3C A;  4JV5 E;  1P47 A;  2R42 A;  4OZE A;  3UHM A;  4LF9 I;  1J5E E;  3IWB A;  2BR2 A;  2E5L E;  3K6Q A;  1SR9 A;  2PNL A;  2Z5E A;  4DU8 A;  4LF9 E;  2EOQ A;  2RS6 A;  2YTF A;  1UN6 B;  4DR6 I;  2ZM6 I;  1YH8 A;  4IFD B;  3CDI A;  1Y60 A;  5DRO A;  5KL4 A;  1RMD A;  1R6L A;  1UDS A;  3PYF A;  4JYA E;  1GTK A;  4WUD A;  4LF7 I;  5K36 B;  2EM2 A;  4LF7 E;  3F6G A;  1YFH A;  1ZM2 A;  2N3G A;  2YRK A;  4QNJ A;  1S16 A;  2ODR C;  3HUL A;  1JK1 A;  4B3M I;  5JEA F;  4BA1 B;  2PO1 B;  1YUI A;  1R6M A;  2L3C A;  2JEB A;  3M6A A;  2VE7 C;  4L5N C;  1UDN A;  4J8Z A;  4MU4 A;  1H74 A;  2EP3 A;  2Q2E B;  1STU A;  2EPN A;  2V86 A;  3HQ1 A;  4GQU A;  4JI8 I;  1DGC A;  5C0X F;  4OX9 I;  1A1H A;  4OO1 F;  2KHX A;  1OYR A;  2BR2 B;  1GQE A;  3T1Y I;  3ZOQ B;  1RHY A;  4JI8 E;  4IZJ D;  1Z59 A;  4OX9 E;  1AH5 A;  2B7T A;  3ADJ A;  4WUC A;  1N36 I;  1HNW I;  2CPN A;  4TUI A;  5A6K A;  3T1Y E;  5FLX C;  1HNW E;  2F4V E;  4N4R B;  3LPS A;  1N36 E;  4JI7 I;  2E1R A;  4USM A;  2V34 A;  2GO3 A;  4LCH A;  4LFB I;  4X66 E;  1X49 A;  2ENC A;  3M99 B;  4X8W A;  3TQM A;  2LTR A;  4WXD A;  1Z0V A;  3THO B;  2D9H A;  3J7Y p;  1ZXM A;  4LFB E;  4NHR A;  4R2D A;  4HAC B;  4OKG A;  3WU5 A;  2YTN A;  4MU0 A;  5JEA E;  1N33 E;  3QT7 A;  2C38 A;  1QZR A;  1ZM4 A;  2WBT A;  3VYY A;  4N3O A;  2VF3 A;  2EQ1 A;  2ZBK B;  4GZN C;  2UXD E;  4Z7Y A;  3HJC A;  1T4L B;  4B3S E;  5C0X E;  1N34 I;  2CT1 A;  2R76 A;  1PIE A;  1KKH A;  4KQV A;  1N34 E;  1EA6 A;  3ADL A;  4X64 E;  1FNM A;  3C4T A;  4MU3 A;  4UTG A;  2DLQ A;  2BM1 A;  2DB2 A;  4BA2 A;  2GHF A;  4JI5 E;  1T4O A;  4FW9 A;  5LMN E;  5GMD A;  4LFC E;  3ZZU A;  3JAM Q;  1H73 A;  1BB8 A;  1UEK A;  1NZ0 A;  2DMY A;  1G2F C;  1ZR9 A;  4KZS A;  3GCM A;  2JR1 A;  5A2Q Q;  5FWK A;  2YRM A;  2GO4 A;  3D4J A;  2YZT A;  2JE6 A;  4PRV A;  3HPS A;  1MGT A;  4NXN I;  4F6N A;  2X7I A;  5KL6 A;  5IT9 Q;  3JU0 A;  1A1K A;  2EMA A;  2DIX A;  2N3H A;  3MHH C;  4MLV A;  2C38 B;  4KHP I;  2EPK X;  3KZY A;  3UK3 C;  4B3R E;  2MKN A;  3P3E A;  4IZJ A;  3ZKB A;  4DR5 I;  3PYG A;  3IWD A;  2JEA A;  4OO1 E;  1Z0W A;  1ZM9 A;  3THN A;  2YU5 A;  4WPY A;  4EMD A;  1PVG A;  2OI2 A;  2PO2 B;  2B9D A;  3K17 A;  2NN6 F;  4M9V C;  4RH8 A;  2EN4 A;  3RMP A;  1KVK A;  4BHB A;  1TF6 A;  2JP9 A;  4MYU A;  2L2K B;  5DNX A;  1F2I G;  1ZBQ A;  3J7A G;  3LML A;  2YRH A;  5KL2 A;  4DV4 I;  1TN9 A;  3J80 Q;  1Z0E A;  2EMB A;  1UDO A;  2J65 A;  2EWL A;  4IS1 C;  4ZVI A;  4DU7 A;  2HC5 A;  4DV4 E;  5T6J A;  1YYK A;  1AAY A;  2UXB I;  4MDT A;  4IFD F;  5AE3 A;  5IWA I;  4ZYD A;  1XHK A;  4R2P A;  5K36 F;  1DI2 A;  2VQF I;  5IWA E;  1YHC A;  4U3D A;  1WJP A;  1T4N A;  2JXP A;  2JEA B;  2MC6 A;  2VQF E;  2EOH A;  4LFA I;  1KJK A;  1ZBT A;  3PS3 A;  1MX0 A;  2FV4 B;  2V83 A;  4MU1 A;  2RPC A;  4ZYE A;  4LF6 I;  1ZAA C;  2NPF A;  1Z1B A;  2LVH A;  4LF6 E;  2EM4 A;  1H7U A;  1OYS A;  3P06 A;  2EJ4 A;  5LL6 R;  3K85 A;  4FWD A;  2AJ4 A;  1X6H A;  2EN7 A;  1Z5A A;  4LU9 A;  2NN6 B;  1EH7 A;  2E72 A;  2HJJ A;  4F54 A;  4JI2 E;  3P76 A;  1X3C A;  1IBK I;  2Z5C A;  4HEI A;  2EPC A;  4DV6 I;  5JEA D;  1I94 I;  3L00 A;  3PS2 A;  4WXC A;  2L8T A;  4IFD E;  2EMY A;  2YT4 A;  1HNX I;  2EOM A;  1Z5B A;  2JVA A;  4FW4 A;  2UU9 I;  4NZV A;  5K36 E;  2EN8 A;  1I94 E;  2JPA A;  3PRY A;  1X6E A;  1HNX E;  5C0X D;  4F9B B;  1ZXN A;  2EPU A;  4LPF A;  1X48 A;  2EN2 A;  2EM9 A;  2JOB A;  1YZ9 A;  4DR6 E;  2CVE A;  2GPI A;  2EZ6 A;  3L7Z A;  3IWC A;  2ZM6 E;  1RR9 A;  1EKZ A;  2YU8 A;  2K7I A;  4LF4 I;  1G2D C;  1YYO A;  1H7S A;  3QG5 C;  4LF4 E;  4DV2 I;  2DLK A;  1XNQ I;  5A6B A;  4P78 A;  4BS9 A;  1HNZ I;  3HXL A;  2EMK A;  3JTZ A;  3GON A;  2CSH A;  4DV2 E;  1ELO A;  1VIS A;  4JG4 A;  4B3M E;  3KWR A;  2WBS A;  1HK7 A;  4YHH I;  2RSM A;  3H4L A;  4F2J C;  2EOR A;  4JI3 I;  2MDG A;  3B4T A;  4R2R A;  4YHH E;  2WNR A;  2A2C A;  3WU3 A;  4JI3 E;  2VF1 A;  4U3B A;  5A6A A;  1SFE A;  2LCE A;  4BC7 A;  4F9C B;  4OO1 D;  2UXC E;  2EN6 A;  3J81 C;  4BC9 A;  1U2R A;  2DGC A;  3B8H A;  3OTO I;  1D6T A;  2PO0 A;  2YPN A;  2EPL X;  4JI7 E;  3GME A;  1MG7 A;  3F6H A;  4F6M A;  2RTX A;  3OTO E;  2L33 A;  1B63 A;  4HTG A;  5ELW A;  1YSA C;  2I13 A;  4RPF A;  1XMO I;  4OOG C;  2VRD A;  4LCG A;  2UUC I;  2JEB B;  4X65 I;  2LJH A;  3KZZ A;  5EL9 A;  4R2E A;  4DR3 I;  1KYQ A;  5F3W A;  1XMO E;  1UDQ A;  1RQ0 A;  2F1D A;  2EOI A;  3CWV A;  3DF6 A;  2UUC E;  5FLX Q;  1L4S A;  2V8P A;  1PJQ A;  4DR7 I;  5C0X C;  1UHZ A;  2X36 A;  4WYQ B;  5A69 A;  2WNR B;  2Z5B A;  1KTV A;  5ADZ A;  2LMZ A;  4M1K A;  1N0U A;  4GKK E;  2NUF A;  5KL7 A;  1T39 A;  1WHQ A;  3Q1Q A;  2YTD A;  1E3H A;  2YTO A;  2PNZ A;  4P52 A;  4TUG A;  3BID A;  4IS9 A;  2PO0 B;  1Y5Y A;  3LLH A;  3F0N A;  2RS7 A;  1IBM I;  2FTX B;  4WX9 A;  1B69 A;  2V8Q B;  4M0V A;  3VK6 A;  2R1F A;  2EPP A;  1PJS A;  2WBU A;  2NUE A;  5GME A;  3BF2 A;  1TF3 A;  1Y4S A;  5A2Q C;  3DJW A;  4DPT A;  4DV3 I;  4DV5 I;  5L3J A;  2ADR A;  4DV3 E;  2ENA A;  4NXN E;  4Z7C A;  2L6M A;  2EMG A;  2GQ0 A;  3T1H I;  1WXR A;  4NXM I;  2JWO A;  1IQO A;  1PDA A;  3MHS C;  2E1M A;  2K4V A;  4OO1 C;  1Y6Z A;  4KHP E;  4IFD D;  4OO1 A;  2B7V A;  4WUB A;  3T1H E;  4NXM E;  4DR5 E;  2HKJ A;  4ISA A;  5LLQ A;  5K36 D;  4LOM A;  2VES A;  4DR4 I;  2PNZ B;  1E3P A;  4K0K I;  1O0W A;  3ZM7 A;  4BA2 B;  2F8B A;  4R2Q A;  1Y4U A;  1YPN A;  4O4K A;  4DUZ I;  3ADG A;  4DR4 E;  1Z0C A;  3Q6N A;  1NEI A;  4K0K E;  2O1W A;  4DV0 I;  4IJD A;  4B3T I;  4LCF A;  4Q35 B;  1RC7 A;  1A1G A;  3H1C A;  4J3D A;  4NBQ A;  4DV0 E;  4DPW A;  2EOX A;  2HKE A;  2VQE I;  4AQY I;  4GEQ B;  4B3T E;  2JE6 B;  1XNR I;  2LTS A;  2EM8 A;  4LTY A;  2N8X A;  2GS8 A;  1WRJ A;  2VQE E;  4AQY E;  1XMQ I;  2CZ9 A;  3BGH A;  1XNR E;  4Q28 A;  3AV0 A;  1VI7 A;  2UXB E;  3PS1 A;  4JI6 I;  4IZJ B;  2EPM X;  2BB8 A;  2KOU A;  1ZM3 A;  1HR0 I;  3ZKD A;  2EPO A;  2V87 A;  2NUG A;  4JI0 I;  4X62 I;  2EML A;  2HGH A;  5AAS A;  2JY9 A;  2O1V A;  2EOO A;  4X62 E;  2EOJ A;  3NZK A;  4LFA E;  2B3T B;  1PJT A;  4RHB B;  3OML A;  2ELZ A;  1T38 A;  1B62 A;  2NN6 E;  4R2C A;  2ODR D;  1UBD C;  2C39 A;  2J7K A;  1EH8 A;  2LE2 A;  2WP8 A;  5CFF E;  4FW5 A;  4ED4 A;  1MEY C;  4R2A A;  2LJU A;  4ZYG A;  1KIJ A;  4XTJ A;  2L92 A;  2DMI A;  3CDJ A;  3HPZ A;  1QU6 A;  2EMF A;  2FGG A;  1IBK E;  1FWK A;  3M85 G;  4DPU A;  4DV6 E;  4MLQ A;  4YY3 I; 
#chains in the Genus database with same CATH homology
 1USU A;  4DUY I;  1MU5 A;  3V2U C;  2CG9 A;  1X47 A;  2JOX A;  2DEJ A;  2UU9 E;  3FIG A;  1FJG I;  1DQ3 A;  4DUY E;  1UIL A;  5AE1 A;  3PYD A;  1IBL I;  5BR8 I;  3AUZ A;  2V89 A;  1FJG E;  4I3H A;  4R03 A;  3ZZT A;  5BR8 E;  1Z0G A;  1FKA E;  1FWL A;  2HFS A;  1YYW A;  4DPX A;  1K47 A;  4BBY A;  2BV3 A;  2IHR 1;  4DV7 I;  1GZ6 A;  2PNM A;  3VYX A;  2MC5 A;  1XNQ E;  4F9A B;  4DV7 E;  1HNZ E;  3QT5 A;  3B82 A;  2Z5C B;  1PKP A;  2DSY A;  3MSW A;  3P1X A;  4UT4 A;  4JYA I;  3K1J A;  2L2N A;  3B78 A;  4FWG A;  2UUB I;  2LBS B;  1EI1 A;  3PYE A;  2LRS A;  3LNU A;  4LF8 I;  5AE2 A;  4R8O A;  4BMJ A;  3C4B A;  2UUB E;  3ADI A;  4DR2 I;  2O1U A;  4LF8 E;  2EFG A;  4DR2 E;  4LF5 I;  4HAC A;  3WU4 A;  4LF5 E;  4I8O A;  2UUA I;  4WSP A;  3QT6 A;  3QT8 A;  2DEI A;  4X65 E;  3J81 Q;  2F4V I;  4DR3 E;  2UUA E;  2HK3 A;  4DMI A;  4DR7 E;  4L8N A;  4X66 I;  1S4E A;  2O1T A;  4HY1 A;  4P7D A;  2BM0 A;  4DKK A;  5DNY A;  1A6F A;  2KON A;  2IOP A;  1N33 I;  3J7A M;  3H09 A;  1WUU A;  3JAM C;  2HHH I;  4JI1 I;  1OJ4 A;  2UXD I;  4B3S I;  1IBM E;  2HHH E;  1H72 C;  4JI1 E;  4HXZ A;  4X64 I;  4DV5 E;  1FI4 A;  1N0V C;  5IT9 C;  2HK2 A;  1USV A;  4P7A A;  1BKN A;  4JI5 I;  5LMN I;  2V2Q A;  4DR1 I;  2CGE A;  2Z5B B;  4LFC I;  2V2Z A;  2MDR A;  2ZIT A;  4DV1 I;  4DR1 E;  4R1F A;  1N32 I;  2V2V A;  3WU6 A;  2WZO A;  4DV1 E;  2LUQ A;  2V88 A;  2L3J A;  1N32 E;  3HTX A;  1J26 A;  2WW4 A;  4DUZ E;  2H36 X;  4B3R I;  4GKJ I;  1Z0T A;  5LMU E;  3J80 C;  4GKJ E;  2L2M A;  2A2D A;  1NHH A;  1XMQ E;  2XEX A;  4IZK A;  2NA2 A;  2R3V A;  4JI6 E;  1HR0 E;  4FWH A;  1WHN A;  2LUP B;  4JI0 E;  4DXL A;  3ZZ0 A;  4PRX A;  4WFT A;  2V85 A;  1RRE A;  4MYT A;  2M7Q A;  4JI4 I;  3LTO A;  2M1S A;  4JI4 E;  4M2Z A;  1DAR A;  3Q6M A;  4DPY A;  1Z5C A;  3V5R A;  2IOQ A;  1Z0B A;  2G7H A;  4HYM A;  4FN5 A;  4IZK B;  4YY3 E;  4URL A;  4USK A;  4BCA A;  2M4I A;  4JI2 I;  2LJP A;  1IBL E;  1NHJ A;  4JV5 I;  4PU9 A;  2HFU A;  1NHI A;  1J5E I;  4M30 A;  2E5L I;  4JV5 E;  2R42 A;  4LF9 I;  1J5E E;  3IWB A;  2E5L E;  3K6Q A;  1SR9 A;  2PNL A;  2Z5E A;  4DU8 A;  4LF9 E;  2RS6 A;  4DR6 I;  2ZM6 I;  4LF7 I;  3PYF A;  4WUD A;  4JYA E;  4LF7 E;  3F6G A;  1ZM2 A;  2N3G A;  1S16 A;  2ODR C;  3HUL A;  4B3M I;  2L3C A;  3M6A A;  2VE7 C;  4L5N C;  4J8Z A;  1H74 A;  2Q2E B;  1STU A;  4JI8 I;  2V86 A;  3HQ1 A;  4OX9 I;  2KHX A;  1GQE A;  3T1Y I;  3ZOQ B;  4JI8 E;  4IZJ D;  1Z59 A;  4OX9 E;  2B7T A;  3ADJ A;  4WUC A;  1HNW I;  1N36 I;  2UXC I;  2CPN A;  4TUI A;  3T1Y E;  5FLX C;  1HNW E;  2F4V E;  3LPS A;  1N36 E;  4JI7 I;  2E1R A;  4USM A;  2V34 A;  4LFB I;  4X66 E;  1X49 A;  4X8W A;  1Z0V A;  2LTR A;  3J7Y p;  1ZXM A;  4LFB E;  4HAC B;  3WU5 A;  1N33 E;  3QT7 A;  1QZR A;  1ZM4 A;  3VYY A;  4N3O A;  2VF3 A;  4GKK I;  2ZBK B;  2UXD E;  4Z7Y A;  1N34 I;  3HJC A;  1T4L B;  4B3S E;  1PIE A;  1KKH A;  4KQV A;  1N34 E;  1EA6 A;  3ADL A;  4X64 E;  1FNM A;  3C4T A;  4UTG A;  2BM1 A;  2DB2 A;  4JI5 E;  4FW9 A;  1T4O A;  5LMN E;  5GMD A;  4LFC E;  3ZZU A;  3JAM Q;  1H73 A;  1UEK A;  1NZ0 A;  2DMY A;  4KZS A;  5A2Q Q;  2JR1 A;  5FWK A;  3D4J A;  2YZT A;  4PRV A;  3HPS A;  4NXN I;  2X7I A;  5IT9 Q;  3JU0 A;  2DIX A;  2N3H A;  4KHP I;  4B3R E;  4IZJ A;  3ZKB A;  4DR5 I;  3PYG A;  3IWD A;  1Z0W A;  1ZM9 A;  4WPY A;  4EMD A;  1PVG A;  2OI2 A;  2B9D A;  3K17 A;  3RMP A;  1KVK A;  4MYU A;  2L2K B;  3J7A G;  1ZBQ A;  3LML A;  4DV4 I;  3J80 Q;  1Z0E A;  2EWL A;  4ZVI A;  4DU7 A;  4DV4 E;  5T6J A;  1YYK A;  2UXB I;  5AE3 A;  5IWA I;  1XHK A;  1DI2 A;  2VQF I;  5IWA E;  1T4N A;  2MC6 A;  2VQF E;  4LFA I;  1ZBT A;  1MX0 A;  2FV4 B;  2V83 A;  4LF6 I;  2NPF A;  4LF6 E;  1H7U A;  3P06 A;  5LL6 R;  3K85 A;  4FWD A;  2AJ4 A;  1Z5A A;  4LU9 A;  4F54 A;  4JI2 E;  1IBK I;  2Z5C A;  4DV6 I;  1I94 I;  2L8T A;  1HNX I;  2YT4 A;  1Z5B A;  2JVA A;  2UU9 I;  1I94 E;  3PRY A;  1HNX E;  4F9B B;  1ZXN A;  1X48 A;  2JOB A;  1YZ9 A;  4DR6 E;  2EZ6 A;  4LF4 I;  3IWC A;  2ZM6 E;  1RR9 A;  1EKZ A;  1YYO A;  1H7S A;  4LF4 E;  4DV2 I;  1XNQ I;  4P78 A;  4BS9 A;  1HNZ I;  3HXL A;  3GON A;  3JTZ A;  4DV2 E;  1ELO A;  1VIS A;  4JG4 A;  4B3M E;  3KWR A;  1HK7 A;  4YHH I;  2RSM A;  3H4L A;  4JI3 I;  4YHH E;  2A2C A;  3WU3 A;  4JI3 E;  2VF1 A;  4BC7 A;  4F9C B;  2UXC E;  3J81 C;  4BC9 A;  1U2R A;  3B8H A;  3OTO I;  1D6T A;  4JI7 E;  1MG7 A;  3F6H A;  2RTX A;  3OTO E;  2L33 A;  1B63 A;  4RPF A;  1XMO I;  4OOG C;  2UUC I;  4X65 I;  2LJH A;  4DR3 I;  1XMO E;  5F3W A;  3CWV A;  1RQ0 A;  3DF6 A;  2UUC E;  5FLX Q;  2V8P A;  4DR7 I;  1UHZ A;  2X36 A;  4WYQ B;  2Z5B A;  1KTV A;  5ADZ A;  2LMZ A;  4M1K A;  1N0U A;  4GKK E;  2NUF A;  1WHQ A;  3Q1Q A;  4P52 A;  4TUG A;  3LLH A;  3F0N A;  2RS7 A;  1IBM I;  2FTX B;  2V8Q B;  4M0V A;  3VK6 A;  2NUE A;  5GME A;  4DV3 I;  1Y4S A;  4DPT A;  5A2Q C;  3DJW A;  4DV5 I;  5L3J A;  4DV3 E;  4NXN E;  4Z7C A;  2L6M A;  2GQ0 A;  3T1H I;  1WXR A;  4NXM I;  2JWO A;  2K4V A;  2E1M A;  1Y6Z A;  4KHP E;  2B7V A;  4WUB A;  3T1H E;  4NXM E;  4DR5 E;  2HKJ A;  4DR4 I;  4K0K I;  1O0W A;  2F8B A;  1Y4U A;  4DUZ I;  3ADG A;  4DR4 E;  1Z0C A;  3Q6N A;  2O1W A;  4K0K E;  4DV0 I;  4B3T I;  5LMU I;  1RC7 A;  2VQE I;  4DPW A;  4DV0 E;  4AQY I;  2HKE A;  4GEQ B;  4B3T E;  1XNR I;  2LTS A;  4LTY A;  2GS8 A;  2VQE E;  4AQY E;  1XMQ I;  2CZ9 A;  1XNR E;  4Q28 A;  3AV0 A;  2UXB E;  4JI6 I;  4IZJ B;  2KOU A;  1ZM3 A;  1HR0 I;  3ZKD A;  4JI0 I;  2V87 A;  2NUG A;  4X62 I;  5AAS A;  2JY9 A;  2O1V A;  4X62 E;  4LFA E;  2B3T B;  3OML A;  1B62 A;  2ODR D;  2J7K A;  2LE2 A;  5CFF E;  4ED4 A;  1KIJ A;  4XTJ A;  2L92 A;  3HPZ A;  1QU6 A;  2FGG A;  1IBK E;  1FWK A;  4DPU A;  4DV6 E;  3ZM7 A;  4YY3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...