4LFBE

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 40
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lfbE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfbE02
3ADGA 2L3CA 1IBLE 1ZM3A 4EMDA 4LF5E 1MG7A 4LF9I 5IT9C 3LNUA 3J7AM 5LMUI 4DV7E 5CFFE 2ZM6E 1YYKA 3T1YI 3V5RA 3WU3A 2Q2EB 1KVKA 2KHXA 1Z0GA 2UXBE 2HK3A 5LMNE 2JY9A 1X47A 4WYQB 2J7KA 4URLA 1HNXE 2DEIA 4JI3I 2DIXA 4FWGA 1EI1A 4RPFA 4LF9E 2LJHA 1EA6A 4DR5I 4DUYE 4UTGA 4DPUA 2BV3A 4JI1I 1Z5CA 2LBSB 1FNMA 5FLXC 1UILA 4LF4I 4DR6I 4YY3I 2V2VA 4JI8E 2X7IA 2UXDI 4JI7E 1XNQI 4LF7I 3ZM7A 1B63A 4LFCI 4R1FA 2UUAI 4B3RI 1N32E 4DV1I 3F0NA 4DV3E 4DR3E 4KHPI 3PYEA 1Z0VA 1RREA 1QU6A 2ZITA 4X8WA 1HNZE 3ADLA 4PRXA 3H4LA 4DUZI 4B3ME 3PYFA 5LMUE 2F4VI 3J7AG 1B62A 1ZXMA 4WUCA 2R3VA 4HY1A 4WUDA 2A2DA 4OX9E 3T1HE 2HKEA 4DPWA 2X36A 2E1RA 4X66E 3M6AA 4JI7I 2RS6A 2UXBI 1XNQE 3CWVA 4DR7I 4LF6I 1ELOA 3D4JA 3WU5A 3VYXA 4FWDA 1YZ9A 2NUFA 1N0UA 1HNZI 1MU5A 2B7VA 1N0VC 1Z0EA 2MDRA 5GMDA 4JYAE 4HACB 4P7AA 1STUA 4LFBE 3B82A 1N33E 2VQEI 1N34E 2NPFA 2L33A 1J5EE 1ZM4A 4LFAE 4ED4A 4X62I 4LF4E 3QT8A 2LUPB 3J80C 4DPTA 3HTXA 2UXDE 1FJGE 5LL6R 1FKAE 2N3HA 4GKKE 4DV7I 2UUCE 2HKJA 5IWAI 3C4TA 5BR8E 2V34A 4I3HA 1Z0WA 4DV3I 4OOGC 4JI0I 3T1YE 3WU6A 1KIJA 2VQFI 2CPNA 1XNRI 4NXME 2HHHI 2NA2A 4USKA 2L2KB 5FLXQ 4KQVA 4DV2I 1K47A 3V2UC 5IT9Q 4USMA 1OJ4A 1T4NA 1J5EI 4LFAI 3JAMC 4OX9I 1RR9A 3T1HI 4M1KA 1HNWI 3QT6A 3OTOI 1IBLI 2OI2A 4JV5I 4DR2I 1H73A 4DPXA 4DUYI 2UUCI 1H7SA 3ZKBA 1PIEA 1MX0A 2A2CA 1IBMI 2L3JA 4JI8I 2E5LE 4X65I 4X64E 1FWKA 5LMNI 4LFCE 2HFSA 5GMEA 4Z7CA 4B3RE 4DV0E 2UU9I 1HNXI 1X48A 1D6TA 1J26A 4X62E 2HFUA 1HNWE 3PYDA 4YHHI 1YYOA 3HULA 3QT7A 2RSMA 4DUZE 2LUQA 4B3MI 3J81Q 4DR2E 2RS7A 4HYMA 4DV5I 2EFGA 3ADJA 4JI1E 4DR4I 3ZZTA 4DU7A 5BR8I 4NXNI 2BM0A 4UT4A 4ZVIA 1VISA 2E5LI 4FWHA 4JI5E 4X64I 1O0WA 2DEJA 1NHJA 1I94I 4LF7E 4LF6E 1XMQI 3JAMQ 1XHKA 3WU4A 2UUAE 1BKNA 4DV2E 1N32I 2R42A 1ZXNA 1WUUA 2IHR1 2BM1A 3OTOE 4DV6I 1PKPA 2HK2A 1HR0I 3QT5A 1NHHA 4JV5E 4DXLA 1H7UA 1IBKE 4B3SI 1N33I 2GS8A 4B3TI 1GQEA 1Z0TA 1S16A 4DKKA 4DU8A 5A2QQ 1DARA 2LJPA 2B3TB 1Z59A 3ZKDA 4JG4A 4M30A 1NZ0A 4AQYI 2LRSA 3J80Q 4WUBA 3ZZ0A 1PVGA 1T4LB 4JI4I 4JI0E 1A6FA 1UHZA 4WFTA 4K0KI 2VQFE 1DI2A 2UUBE 1ZM9A 4NXMI 4DV6E 1HR0E 3J7Yp 3K1JA 2UXCE 4JI2E 4FN5A 1Z0BA 1Z5AA 4B3TE 1N34I 3GONA 4DV4I 1YYWA 4NXNE 4DR6E 1T4OA 2ZBKB 4LF8E 4JI5I 2LTSA 3PYGA 4M2ZA 4DR1E 4Z7YA 1ZBTA 2VF3A 4HXZA 2N3GA 1XMOI 5IWAE 4FW9A 4MYTA 3LLHA 4KHPE 4DR3I 1WHQA 2NUGA 2B7TA 2JVAA 1FI4A 1XNRE 1ZM2A 2XEXA 4DR5E 2AJ4A 1IBKI 1H72C 2YT4A 2EZ6A 3B78A 4DV4E 1KTVA 1Z0CA 2V2QA 4JI6E 4GKJE 5L3JA 4YHHE 2LTRA 4YY3E 1NHIA 3VYYA 2CZ9A 4LF8I 4AQYE 1U2RA 1XMOE 5A2QC 4DR4E 2ZM6I 4JI4E 4GKJI 1N36E 1FWLA 1IBME 4K0KE 4P52A 3LPSA 1EKZA 1KKHA 2UUBI 2RTXA 4X65E 2WW4A 1I94E 2UXCI 4MYUA 3ADIA 4LFBI 4JI2I 1Z5BA 2F4VE 4DV0I 3J81C 4PU9A 4HACA 2UU9E 4XTJA 1X49A 1UEKA 2DB2A 2V2ZA 1QZRA 4PRVA 4X66I 1FJGI 4LF5I 4DPYA 4GKKI 1WHNA 2L2MA 4DR7E 3P1XA 4B3SE 4DV5E 4DR1I 3C4BA 1RC7A 2DMYA 1RQ0A 3K17A 1N36I 3ZZUA 2NUEA 2HHHE 1XMQE 4JYAI 3LTOA 1S4EA 4DV1E 3Q1QA 1H74A 3B8HA 2VQEE 2V8PA 2L2NA 4JI6I 4JI3E
chains in the Genus database with same CATH superfamily
2EN6A 3L7ZB 4R2EA 3ADGA 2L3CA 1IBLE 1GZ6A 1YSAC 1ZM3A 4EMDA 4LF5E 2LO3A 3KZYA 5A6BD 1MG7A 4LF9I 5IT9C 1X6EA 3LNUA 5KL3A 4MU3A 2EOQA 1P42A 1BBOA 2JEAA 3J7AM 4OO1E 1Y4SA 5LMUI 1A1HA 4DV7E 3DJWA 4NHRA 4DR4I 5CFFE 1ZBQA 4ZYEA 4F6NA 2ZM6E 2V86A 5TSEA 5IV8B 2G7HA 4N4RB 2BA1D 1YYKA 3T1YI 3C6MA 3V5RA 3WU3A 4MU4A 2Q2EB 1KVKA 2KHXA 1Z0GA 2R1FA 4FW7A 2UXBE 2HK3A 4MDTA 5LMNE 2JY9A 4ZYHA 1KJKA 2PNZA 2N8XA 1X47A 1A1JA 4WYQB 1OYSA 2Z5EA 3F6GA 2ENHA 2J7KA 4URLA 1HNXE 2DEIA 2CG9A 4JI3I 2V89A 5A6JA 2EN3A 5DNXA 2DIXA 2C39B 4Q28A 4FWGA 1EI1A 4FW5A 4RPFA 4LF9E 2LJHA 1UDNA 1EA6A 5C0XF 2UXDI 4DR5I 4DUYE 1YH8A 4UTGA 4DPUA 2BV3A 2EN4A 2C38A 4R2PA 4O24A 4JI1I 1Z5CA 4MQYA 2LBSB 1FNMA 5FLXC 1UILA 2EMKA 4LF4I 4DR6I 3OMLA 2EM9A 4AM3A 1HK7A 5DNLA 4YY3I 3P3EA 2H36X 2V2VA 4JI8E 2X7IA 5LLQA 1E3PA 4JI7E 2LCEA 5IXMB 2IESA 2NN6C 2EMLA 3BIDA 1XNQI 2EMFA 4LF7I 3ZM7A 1B63A 4LFCI 4R1FA 2HJJA 5ELWA 2UUAI 2M7QA 4ZYGA 1YUIA 4B3RI 2I9IA 1N32E 4BA1B 4DV1I 5AASA 3EPKA 3F0NA 2DLQA 4DV3E 4DR3E 4KHPI 3PYEA 1Z0VA 1RREA 1PJTA 2GO3A 1QU6A 3M85D 3HPSA 5C0XC 2ZITA 2YU5A 4X8WA 4R2DA 1HNZE 4ISAA 3ADLA 4PRXA 3NZKA 2EPLX 3L7ZA 3H4LA 3EPHA 2EPKX 2EOSA 5DRRA 4DUZI 1P47A 4MU0A 2YRHA 2L6MA 2EN7A 4B3ME 2DGCA 3PYFA 1OYPA 4MLQA 4J8ZA 3EPJA 5LMUE 3J7AG 1B62A 2MC6A 1ZXMA 2F4VI 4WUCA 4R03A 3CDIA 2EOJA 2R3VA 4HY1A 4WUDA 2A2DA 4OX9E 2YTPA 2YU8A 3T1HE 2WBTA 2HKEA 4DPWA 2O3ZA 2EL6A 2LVHA 2E1RA 2X36A 5A6KA 2YZTA 1WRJA 1PDAA 2KONA 4X66E 2EMIA 5AE1A 2WNRA 1X6FA 3M6AA 4IFDC 4JI7I 5EKWA 2RS6A 2EQ0A 1AAYA 2UXBI 1PJSA 1XNQE 4DV4I 2IOQA 3CWVA 4DR7I 2HGHA 4LF6I 1ELOA 2GLIA 3D4JA 3WU5A 2LMZA 3VYXA 2GHFA 4MLVA 2EM7A 1NEIA 4FWDA 3KZZA 2BA0G 1A1IA 5A6BA 3MSWA 3THOB 2JWOA 1YZ9A 2NUFA 2EOHA 3HQ1A 4KWYA 5EL9A 1N0UA 1HNZI 4LU9A 4BA1A 1MU5A 2B7VA 2EN8A 2EM8A 1N0VC 1Z0EA 2PO0A 5K36F 4OKGA 2MDRA 4F9CB 1A1GA 4JYAE 5GMDA 3ECRA 4BMJA 2YTIA 4HACB 1IQOA 4P7AA 1STUA 2DRPA 4LFBE 3B82A 5JEAA 1DGCA 1N33E 5KL6A 2EMAA 4BA2B 4U3DA 1N34E 4N3OA 2NPFA 2BA0D 2VQEI 2L33A 2EQ3A 5K36D 2EQ1A 2EN1A 1J5EE 1ZM4A 4LFAE 1PJQA 1TF3A 2JEBB 5DRPA 4ED4A 4LF4E 3P3CA 4GQUA 4X62I 2VRDA 2EORA 4I8OA 3QT8A 2LUPB 2CSHA 5C0XE 3F6HA 3J80C 1UDSA 2C38B 4DPTA 2EL5A 3HTXA 2M9AA 2JPAA 1FJGE 2UXDE 5LL6R 1FKAE 2N3HA 4GKKE 2PNLA 1GTKA 4WSGA 2O1VA 4OO1B 2GPIA 3EQ1A 1JK2A 4DV7I 2UUCE 2WBSA 2HKJA 3C4TA 2BR2B 5IWAI 3M7ND 5BR8E 1G2FC 2V34A 4I3HA 1Z0WA 2EPPA 1LLMC 4OOGC 4DV3I 4JI0I 3T1YE 2CVEA 3WU6A 4AIMA 1KIJA 2VQFI 2CPNA 2V87A 1XNRI 4R8OA 2MKDA 1B69A 4NXME 4AIDA 4L8NA 2HHHI 2LV2A 2NA2A 4IFDF 4MU1A 4BHBA 1X6HA 2YTJA 1WXRA 4USKA 2L2KB 2EPNA 4BA2A 5FLXQ 1R6LA 1TN9A 4KQVA 4DV2I 2M4IA 1K47A 1WJPA 2E72A 3AV0A 2EOIA 5A6AA 3V2UC 5IT9Q 4USMA 1OJ4A 2EM4A 1T4NA 4FW6A 1J5EI 3JAMC 4LFAI 4OX9I 1RR9A 3T1HI 2EPMX 4HEIA 2JXPA 4M1KA 1HNWI 2CT1A 1X3CA 3M99B 3QT6A 3IWCA 3OTOI 2YWQA 1IBLI 4WX9A 3B4TA 4F9AB 1DQ3A 2OI2A 3M7NG 4JV5I 3VHTB 4RHBB 4BCAA 4DR2I 1H73A 4DPXA 4DUYI 2CGEA 4Q35B 2UUCI 2IERA 4F54A 2YTFA 2L8TA 2YTOA 1H7SA 3ZKBA 1PIEA 2LJUA 4WXCA 4R2SA 1T38A 4R2CA 2JT2A 1MX0A 5KL5A 2A2CA 1IBMI 1MEYC 2L3JA 4LTYA 2YTEA 4JI8I 2EPZA 2E5LE 4X65I 3TQMA 4X64E 1FWKA 2IOPA 4M0VA 1A1FA 5LMNI 2PO1B 4LFCE 3AUZA 2HFSA 2PRTA 4IJDA 4LPFA 5KL4A 5GMEA 4Z7CA 4B3RE 4DV0E 4TUIA 2UU9I 1HNXI 5JEAC 3P76A 1X48A 1D6TA 1J26A 4X62E 2HFUA 1F2IG 3U1YA 5K36E 2EMZA 2J7JA 1HNWE 3PYDA 2J65A 4YHHI 3HPZA 1YYOA 2WNRB 3HULA 4O43A 3QT7A 2RSMA 4F2JC 2EMCA 4DUZE 2LUQA 4FW4A 2JR1A 2V8QB 3J81Q 4B3MI 2PO0B 4DR2E 3JU0A 2RS7A 3HXLA 4HYMA 4DV5I 2EFGA 2BA1G 2EPXA 2YSOA 3ADJA 2EMBA 4FK5C 2ODRD 2EM3A 3L00A 4X9JA 4JI1E 3ZZTA 4BC7A 4IS1C 4DU7A 2RPCA 1Z1BA 4TUGA 5AC4A 4NXNI 2BM0A 4GEQB 2BR2A 4L5NC 2BBGA 4UT4A 2MKNA 4ZVIA 2NN6E 1VISA 2EJ4A 2ENCA 2E5LI 5A69A 4FWHA 4JI5E 4X64I 1O0WA 1YUJA 2DEJA 1NHJA 1I94I 4LF7E 4IFDD 4LF6E 2ELZA 1XMQI 4GZNC 1Y4UA 3JAMQ 2PNMA 2YTGA 1XHKA 3P3GA 2UUAE 2D9HA 1BKNA 3WU4A 2NN6A 4DV2E 2B9DA 4ZYDA 1N32I 2MDGA 2YSPA 2LT7A 3KWRA 2R42A 2PO1A 3HKMA 2EP3A 2JEBA 1TF6A 1ZXNA 1WUUA 2DLKA 2IHR1 2EWLA 2BM1A 3OTOE 1EH7A 1PKPA 4P78A 1BB8A 2HK2A 4DV6I 3QT5A 1HR0I 3H09A 4JV5E 1NHHA 4DXLA 4OO1F 1H7UA 2EM5A 1IBKE 1L4SA 4B3SI 1UDOA 2F8BA 4OZEA 1N33I 2A25A 2FV4B 1ZAAC 2GS8A 3KRNA 3H1CA 4OO1C 4F6MA 2VE7C 1UBDC 2V85A 4B3TI 1GQEA 4LCFA 2EPRA 1Z0TA 1S16A 1NCSA 4O5GA 3Q6NA 5K36B 2JOBA 4DKKA 4F9BB 1USUA 3PS1A 4DU8A 3MHSC 5A2QQ 2O1WA 1BBGA 1QNTA 5KL2A 1DARA 2LJPA 2ADRA 2B3TB 1Z59A 3LMLA 2WZOA 3ZKDA 4JG4A 4M30A 1NZ0A 4AQYI 4IFDE 2LRSA 3J80Q 4WUBA 3ZZ0A 4BBYA 1PVGA 1T4LB 2R76A 3Q6MA 2C37A 1MGTA 2EOOA 2EPAA 4NZVA 4JI4I 2F1DA 4JI0E 1A6FA 2Z5BB 1IMUA 1R6MA 1UHZA 4WFTA 1JK1A 4WSPA 1UN6B 4K0KI 2VQFE 1DI2A 2I13A 5DNYA 2EPOA 2UUBE 1ZM9A 5DROA 4NXMI 1EH8A 1SFEA 4DV6E 3J7Yp 1HR0E 1ZR9A 2UXCE 3K1JA 3VK6A 2EM6A 2L92A 3BF2A 4R2RA 3THNA 4FW3A 4JI2E 2K4VA 4FN5A 5FWKA 1Z0BA 1Z5AA 2CTDA 3PS3A 2EPCA 2MC5A 3RMPA 4LOMA 4B3TE 5K36A 5F3WA 1N34I 1SR9A 4WPYA 2WP8B 3GONA 1YYWA 4IZJA 4NXNE 2WP8A 4DR6E 4IZJB 2JEAB 2EE8A 1T4OA 3K6QA 2ZBKB 1AH5A 2V88A 3QG5C 4LF8E 5C0XD 4JI5I 2EPUA 2VF1A 2LTSA 4R2AA 3PYGA 4IZJD 1A1KA 4M2ZA 2JYAA 2K7IA 1ZBTA 4DR1E 2Q8UA 2EN2A 2VF3A 4HXZA 4BHCA 2EMHA 2N3GA 5AE2A 1Y6ZA 3DD6A 4LCHA 3BGHA 5K36C 1XMOI 5IWAE 2WCC3 4FW9A 4MYTA 4U3BA 3LLHA 4KHPE 5JEAE 4DR3I 2E1MA 1WHQA 4J3DA 4R2QA 2NUGA 4IS9A 2B7TA 2JVAA 1IQSA 1FI4A 1XNRE 1ZU1A 1ZM2A 2M1SA 2XEXA 3K85A 1KYQA 2YTDA 3GLLA 4DR5E 2AJ4A 1IBKI 1H72C 1USVA 2C39A 3HJCA 1OYRA 2PO2A 2YT4A 2EZ6A 1YFHA 3B78A 4IFDA 5DRQA 1XXEA 3GCMA 4DV4E 2ENAA 1T39A 1KTVA 1Z0CA 2V2QA 4JI6E 5ADZA 4GKJE 2HC5A 1YHCA 5L3JA 4QNJA 4RH8A 2EMXA 4YHHE 2NN6D 5JEAD 2LTRA 2JE6A 4YY3E 3ZOQB 1NHIA 3VYYA 2CZ9A 2JE6B 4LF8I 4NBQA 2NN6F 2VESA 1EH6A 2Z5CA 2PNZB 2EOZA 4AQYE 1U2RA 2DSYA 3M85G 4IZKB 2O1UA 5BR8I 5KL7A 2YTNA 3P06A 4KZSA 1XMOE 2EMWA 5A2QC 4IZKA 4DR4E 2YRMA 4OO1A 2ZM6I 2V83A 4JI4E 4GKJI 2ODRC 2EL4A 3IWBA 1N36E 3UK3C 4M9VC 1FWLA 3PS2A 1IBME 4K0KE 2Z5BA 4BS9A 4P52A 3LPSA 1EKZA 1KKHA 5JEAF 2NN6B 2UUBI 2RTXA 4X65E 2WW4A 1Y60A 2YPNA 1I94E 2UXCI 4MYUA 3ADIA 3DF6A 4IFDB 4WXDA 2PO2B 1G2DC 4LFBI 2EOFA 4JI2I 1Z5BA 2F4VE 4DV0I 2ELYA 1N3GA 3C6KA 3J81C 4PU9A 4HACA 2GO4A 2UU9E 4XTJA 1X49A 2JP9A 1UEKA 5C0XB 2DB2A 2Z5CB 2V2ZA 1QZRA 1X5WA 4PRVA 2EOMA 2GQ0A 2EOXA 3UHMA 4X66I 2EOYA 2WBUA 1FJGI 2RSIA 4LF5I 4DPYA 3CDJA 4GKKI 1WHNA 2L2MA 4DR7E 3P1XA 4B3SE 2C37B 4DV5E 2RQLA 2EM0A 1E3HA 2EM2A 3PRYA 4DR1I 3C4BA 1RC7A 3U1KA 2DMYA 1RMDA 2AE8A 2LE2A 2YTQA 1RQ0A 2O1TA 1VI7A 3K17A 3JTZA 3MHHC 1N36I 2FTXB 2EMYA 3BBGA 2EOEA 1YPNA 4O4KA 3ZZUA 2KOUA 2NUEA 3GMEA 2HHHE 3IWDA 4P7DA 4HTGA 4BC9A 5AE3A 2FGGA 5T6JA 4QNKA 2NABA 1XMQE 4JYAI 2BB8A 1Y5YA 3LTOA 2DMIA 2JOXA 2EMGA 4DMIA 1S4EA 5AC5A 4DV1E 3Q1QA 1H74A 3EPLA 4OO1D 3B8HA 1A1LA 2VQEE 1UDQA 2V8PA 4Z7YA 5JEAB 5C0XA 2L2NA 3FIGA 1RHYA 4JI6I 4JI3E 2YRKA 4LCGA
chains in the Genus database with same CATH topology
3ADGA 2L3CA 1IBLE 1GZ6A 1ZM3A 4EMDA 4LF5E 1MG7A 4LF9I 5IT9C 3LNUA 3J7AM 1Y4SA 5LMUI 4DV7E 3DJWA 5CFFE 1ZBQA 2ZM6E 2V86A 2G7HA 1YYKA 3T1YI 3V5RA 3WU3A 2Q2EB 1KVKA 2KHXA 1Z0GA 2UXBE 2HK3A 5LMNE 2JY9A 1X47A 4WYQB 2Z5EA 3F6GA 2J7KA 4URLA 1HNXE 2DEIA 2CG9A 4JI3I 2V89A 2DIXA 4FWGA 4Q28A 1EI1A 4RPFA 4LF9E 2LJHA 1EA6A 4DR5I 4DUYE 4UTGA 4DPUA 2BV3A 4JI1I 1Z5CA 2LBSB 1FNMA 5FLXC 1UILA 4LF4I 4DR6I 3OMLA 1HK7A 4YY3I 2H36X 2V2VA 4JI8E 2X7IA 2UXDI 4JI7E 1XNQI 4LF7I 3ZM7A 1B63A 4LFCI 4R1FA 2UUAI 2M7QA 4B3RI 1N32E 4DV1I 5AASA 3F0NA 4DV3E 4DR3E 4KHPI 3PYEA 1Z0VA 1RREA 1QU6A 3HPSA 2ZITA 4X8WA 1HNZE 3ADLA 4PRXA 3H4LA 4DUZI 2L6MA 4B3ME 3PYFA 4J8ZA 5LMUE 2F4VI 3J7AG 1B62A 2MC6A 1ZXMA 4WUCA 4R03A 2R3VA 4HY1A 4WUDA 2A2DA 4OX9E 3T1HE 2HKEA 4DPWA 2X36A 2E1RA 2YZTA 2KONA 4X66E 5AE1A 3M6AA 4JI7I 2RS6A 2UXBI 1XNQE 2IOQA 3CWVA 4DR7I 4LF6I 1ELOA 3D4JA 3WU5A 2LMZA 3VYXA 4FWDA 3MSWA 2JWOA 1YZ9A 2NUFA 3HQ1A 1N0UA 1HNZI 4LU9A 1MU5A 2B7VA 1N0VC 1Z0EA 2MDRA 4F9CB 5GMDA 4JYAE 4BMJA 4HACB 4P7AA 1STUA 4LFBE 3B82A 1N33E 2VQEI 1N34E 4N3OA 2NPFA 2L33A 1J5EE 1ZM4A 4LFAE 4ED4A 4X62I 4LF4E 4I8OA 3QT8A 2LUPB 3F6HA 3J80C 4DPTA 3HTXA 2UXDE 1FJGE 5LL6R 1FKAE 2N3HA 4GKKE 2PNLA 2O1VA 4DV7I 2UUCE 2HKJA 5IWAI 3C4TA 5BR8E 2V34A 4I3HA 1Z0WA 4DV3I 4OOGC 4JI0I 3T1YE 3WU6A 1KIJA 2VQFI 2CPNA 2V87A 1XNRI 4R8OA 4NXME 2HHHI 4L8NA 2NA2A 1WXRA 4USKA 2L2KB 5FLXQ 4KQVA 4DV2I 2M4IA 1K47A 3AV0A 3V2UC 5IT9Q 4USMA 1OJ4A 1T4NA 1J5EI 4LFAI 3JAMC 4OX9I 1RR9A 3T1HI 4M1KA 1HNWI 3QT6A 3IWCA 3OTOI 1IBLI 4F9AB 1DQ3A 2OI2A 4JV5I 4BCAA 4DR2I 1H73A 4DPXA 4DUYI 2CGEA 2UUCI 4F54A 2L8TA 1H7SA 3ZKBA 1PIEA 1MX0A 2A2CA 1IBMI 2L3JA 4LTYA 4JI8I 2E5LE 4X65I 4X64E 1FWKA 2IOPA 4M0VA 5LMNI 4LFCE 3AUZA 2HFSA 5GMEA 4Z7CA 4B3RE 4DV0E 4TUIA 2UU9I 1HNXI 1X48A 1D6TA 1J26A 4X62E 2HFUA 1HNWE 3PYDA 4YHHI 3HPZA 1YYOA 3HULA 3QT7A 2RSMA 4DUZE 2LUQA 2JR1A 2V8QB 3J81Q 4B3MI 4DR2E 3JU0A 2RS7A 3HXLA 4HYMA 4DV5I 2EFGA 3ADJA 2ODRD 4JI1E 4DR4I 3ZZTA 4DU7A 4BC7A 5BR8I 4TUGA 4NXNI 2BM0A 4GEQB 4L5NC 4UT4A 4ZVIA 1VISA 2E5LI 4FWHA 4JI5E 4X64I 1O0WA 2DEJA 1NHJA 1I94I 4LF7E 4LF6E 1XMQI 1Y4UA 3JAMQ 2PNMA 1XHKA 3WU4A 2UUAE 1BKNA 4DV2E 2B9DA 1N32I 3KWRA 2R42A 1ZXNA 1WUUA 2IHR1 2EWLA 2BM1A 3OTOE 4P78A 1PKPA 2HK2A 4DV6I 1HR0I 3QT5A 3H09A 4JV5E 1NHHA 4DXLA 1H7UA 1IBKE 4B3SI 2F8BA 1N33I 2FV4B 2GS8A 2VE7C 2V85A 4B3TI 1GQEA 1Z0TA 1S16A 3Q6NA 2JOBA 4DKKA 4F9BB 1USUA 4DU8A 5A2QQ 2O1WA 1DARA 2LJPA 2B3TB 1Z59A 3LMLA 2WZOA 3ZKDA 4JG4A 4M30A 1NZ0A 4AQYI 2LRSA 3J80Q 4WUBA 3ZZ0A 4BBYA 1PVGA 1T4LB 3Q6MA 4JI4I 2Z5BB 4JI0E 1A6FA 1UHZA 4WFTA 4WSPA 4K0KI 2VQFE 1DI2A 5DNYA 2UUBE 1ZM9A 4NXMI 4DV6E 1HR0E 3J7Yp 3K1JA 2UXCE 2L92A 3VK6A 4JI2E 2K4VA 4FN5A 5FWKA 1Z0BA 1Z5AA 2MC5A 3RMPA 4B3TE 5F3WA 1N34I 1SR9A 4WPYA 3GONA 4IZJA 1YYWA 4DV4I 4NXNE 4DR6E 4IZJB 1T4OA 3K6QA 2ZBKB 2V88A 4LF8E 4JI5I 2VF1A 2LTSA 3PYGA 4IZJD 4M2ZA 4DR1E 1ZBTA 4Z7YA 2VF3A 4HXZA 1Y6ZA 2N3GA 5AE2A 1XMOI 5IWAE 4FW9A 4MYTA 3LLHA 4KHPE 4DR3I 2E1MA 1WHQA 2NUGA 2B7TA 2JVAA 1FI4A 1XNRE 1ZM2A 2M1SA 2XEXA 3K85A 4DR5E 2AJ4A 1IBKI 1H72C 1USVA 3HJCA 2YT4A 2EZ6A 3B78A 4DV4E 1KTVA 1Z0CA 2V2QA 4JI6E 5ADZA 4GKJE 5L3JA 4YHHE 2LTRA 4YY3E 3ZOQB 1NHIA 3VYYA 2CZ9A 4LF8I 2Z5CA 4AQYE 1U2RA 2DSYA 4IZKB 2O1UA 3P06A 4KZSA 1XMOE 5A2QC 4IZKA 4DR4E 2ZM6I 2V83A 4JI4E 4GKJI 2ODRC 3IWBA 1N36E 1FWLA 1IBME 4K0KE 2Z5BA 4BS9A 4P52A 3LPSA 1EKZA 1KKHA 2UUBI 2RTXA 4X65E 2WW4A 1I94E 2UXCI 4MYUA 3ADIA 3DF6A 4LFBI 4JI2I 1Z5BA 2F4VE 4DV0I 3J81C 4PU9A 4HACA 2UU9E 4XTJA 1X49A 1UEKA 2DB2A 2Z5CB 2V2ZA 1QZRA 4PRVA 2GQ0A 4X66I 1FJGI 4LF5I 4DPYA 4GKKI 1WHNA 2L2MA 4DR7E 3P1XA 4B3SE 4DV5E 4DR1I 3PRYA 3C4BA 1RC7A 2DMYA 2LE2A 1RQ0A 2O1TA 3K17A 3JTZA 1N36I 2FTXB 3ZZUA 2KOUA 2NUEA 2HHHE 3IWDA 4P7DA 4BC9A 5AE3A 2FGGA 5T6JA 1XMQE 4JYAI 3LTOA 2JOXA 4DMIA 1S4EA 4DV1E 3Q1QA 1H74A 3B8HA 2VQEE 2V8PA 2L2NA 3FIGA 4JI6I 4JI3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADG A;  2L3C A;  1IBL E;  1ZM3 A;  4EMD A;  4LF5 E;  1MG7 A;  4LF9 I;  5IT9 C;  3LNU A;  3J7A M;  5LMU I;  4DV7 E;  5CFF E;  2ZM6 E;  1YYK A;  3T1Y I;  3V5R A;  3WU3 A;  2Q2E B;  1KVK A;  2KHX A;  1Z0G A;  2UXB E;  2HK3 A;  5LMN E;  2JY9 A;  1X47 A;  4WYQ B;  2J7K A;  4URL A;  1HNX E;  2DEI A;  4JI3 I;  2DIX A;  4FWG A;  1EI1 A;  4RPF A;  4LF9 E;  2LJH A;  1EA6 A;  4DR5 I;  4DUY E;  4UTG A;  4DPU A;  2BV3 A;  4JI1 I;  1Z5C A;  2LBS B;  1FNM A;  5FLX C;  1UIL A;  4LF4 I;  4DR6 I;  4YY3 I;  2V2V A;  4JI8 E;  2X7I A;  2UXD I;  4JI7 E;  1XNQ I;  4LF7 I;  3ZM7 A;  1B63 A;  4LFC I;  4R1F A;  2UUA I;  4B3R I;  1N32 E;  4DV1 I;  3F0N A;  4DV3 E;  4DR3 E;  4KHP I;  3PYE A;  1Z0V A;  1RRE A;  1QU6 A;  2ZIT A;  4X8W A;  1HNZ E;  3ADL A;  4PRX A;  3H4L A;  4DUZ I;  4B3M E;  3PYF A;  5LMU E;  2F4V I;  3J7A G;  1B62 A;  1ZXM A;  4WUC A;  2R3V A;  4HY1 A;  4WUD A;  2A2D A;  4OX9 E;  3T1H E;  2HKE A;  4DPW A;  2X36 A;  2E1R A;  4X66 E;  3M6A A;  4JI7 I;  2RS6 A;  2UXB I;  1XNQ E;  3CWV A;  4DR7 I;  4LF6 I;  1ELO A;  3D4J A;  3WU5 A;  3VYX A;  4FWD A;  1YZ9 A;  2NUF A;  1N0U A;  1HNZ I;  1MU5 A;  2B7V A;  1N0V C;  1Z0E A;  2MDR A;  5GMD A;  4JYA E;  4HAC B;  4P7A A;  1STU A;  4LFB E;  3B82 A;  1N33 E;  2VQE I;  1N34 E;  2NPF A;  2L33 A;  1J5E E;  1ZM4 A;  4LFA E;  4ED4 A;  4X62 I;  4LF4 E;  3QT8 A;  2LUP B;  3J80 C;  4DPT A;  3HTX A;  2UXD E;  1FJG E;  5LL6 R;  1FKA E;  2N3H A;  4GKK E;  4DV7 I;  2UUC E;  2HKJ A;  5IWA I;  3C4T A;  5BR8 E;  2V34 A;  4I3H A;  1Z0W A;  4DV3 I;  4OOG C;  4JI0 I;  3T1Y E;  3WU6 A;  1KIJ A;  2VQF I;  2CPN A;  1XNR I;  4NXM E;  2HHH I;  2NA2 A;  4USK A;  2L2K B;  5FLX Q;  4KQV A;  4DV2 I;  1K47 A;  3V2U C;  5IT9 Q;  4USM A;  1OJ4 A;  1T4N A;  1J5E I;  4LFA I;  3JAM C;  4OX9 I;  1RR9 A;  3T1H I;  4M1K A;  1HNW I;  3QT6 A;  3OTO I;  1IBL I;  2OI2 A;  4JV5 I;  4DR2 I;  1H73 A;  4DPX A;  4DUY I;  2UUC I;  1H7S A;  3ZKB A;  1PIE A;  1MX0 A;  2A2C A;  1IBM I;  2L3J A;  4JI8 I;  2E5L E;  4X65 I;  4X64 E;  1FWK A;  5LMN I;  4LFC E;  2HFS A;  5GME A;  4Z7C A;  4B3R E;  4DV0 E;  2UU9 I;  1HNX I;  1X48 A;  1D6T A;  1J26 A;  4X62 E;  2HFU A;  1HNW E;  3PYD A;  4YHH I;  1YYO A;  3HUL A;  3QT7 A;  2RSM A;  4DUZ E;  2LUQ A;  4B3M I;  3J81 Q;  4DR2 E;  2RS7 A;  4HYM A;  4DV5 I;  2EFG A;  3ADJ A;  4JI1 E;  4DR4 I;  3ZZT A;  4DU7 A;  5BR8 I;  4NXN I;  2BM0 A;  4UT4 A;  4ZVI A;  1VIS A;  2E5L I;  4FWH A;  4JI5 E;  4X64 I;  1O0W A;  2DEJ A;  1NHJ A;  1I94 I;  4LF7 E;  4LF6 E;  1XMQ I;  3JAM Q;  1XHK A;  3WU4 A;  2UUA E;  1BKN A;  4DV2 E;  1N32 I;  2R42 A;  1ZXN A;  1WUU A;  2IHR 1;  2BM1 A;  3OTO E;  4DV6 I;  1PKP A;  2HK2 A;  1HR0 I;  3QT5 A;  1NHH A;  4JV5 E;  4DXL A;  1H7U A;  1IBK E;  4B3S I;  1N33 I;  2GS8 A;  4B3T I;  1GQE A;  1Z0T A;  1S16 A;  4DKK A;  4DU8 A;  5A2Q Q;  1DAR A;  2LJP A;  2B3T B;  1Z59 A;  3ZKD A;  4JG4 A;  4M30 A;  1NZ0 A;  4AQY I;  2LRS A;  3J80 Q;  4WUB A;  3ZZ0 A;  1PVG A;  1T4L B;  4JI4 I;  4JI0 E;  1A6F A;  1UHZ A;  4WFT A;  4K0K I;  2VQF E;  1DI2 A;  2UUB E;  1ZM9 A;  4NXM I;  4DV6 E;  1HR0 E;  3J7Y p;  3K1J A;  2UXC E;  4JI2 E;  4FN5 A;  1Z0B A;  1Z5A A;  4B3T E;  1N34 I;  3GON A;  4DV4 I;  1YYW A;  4NXN E;  4DR6 E;  1T4O A;  2ZBK B;  4LF8 E;  4JI5 I;  2LTS A;  3PYG A;  4M2Z A;  4DR1 E;  4Z7Y A;  1ZBT A;  2VF3 A;  4HXZ A;  2N3G A;  1XMO I;  5IWA E;  4FW9 A;  4MYT A;  3LLH A;  4KHP E;  4DR3 I;  1WHQ A;  2NUG A;  2B7T A;  2JVA A;  1FI4 A;  1XNR E;  1ZM2 A;  2XEX A;  4DR5 E;  2AJ4 A;  1IBK I;  1H72 C;  2YT4 A;  2EZ6 A;  3B78 A;  4DV4 E;  1KTV A;  1Z0C A;  2V2Q A;  4JI6 E;  4GKJ E;  5L3J A;  4YHH E;  2LTR A;  4YY3 E;  1NHI A;  3VYY A;  2CZ9 A;  4LF8 I;  4AQY E;  1U2R A;  1XMO E;  5A2Q C;  4DR4 E;  2ZM6 I;  4JI4 E;  4GKJ I;  1N36 E;  1FWL A;  1IBM E;  4K0K E;  4P52 A;  3LPS A;  1EKZ A;  1KKH A;  2UUB I;  2RTX A;  4X65 E;  2WW4 A;  1I94 E;  2UXC I;  4MYU A;  3ADI A;  4LFB I;  4JI2 I;  1Z5B A;  2F4V E;  4DV0 I;  3J81 C;  4PU9 A;  4HAC A;  2UU9 E;  4XTJ A;  1X49 A;  1UEK A;  2DB2 A;  2V2Z A;  1QZR A;  4PRV A;  4X66 I;  1FJG I;  4LF5 I;  4DPY A;  4GKK I;  1WHN A;  2L2M A;  4DR7 E;  3P1X A;  4B3S E;  4DV5 E;  4DR1 I;  3C4B A;  1RC7 A;  2DMY A;  1RQ0 A;  3K17 A;  1N36 I;  3ZZU A;  2NUE A;  2HHH E;  1XMQ E;  4JYA I;  3LTO A;  1S4E A;  4DV1 E;  3Q1Q A;  1H74 A;  3B8H A;  2VQE E;  2V8P A;  2L2N A;  4JI6 I;  4JI3 E; 
#chains in the Genus database with same CATH topology
 2EN6 A;  3L7Z B;  4R2E A;  3ADG A;  2L3C A;  1IBL E;  1GZ6 A;  1YSA C;  1ZM3 A;  4EMD A;  4LF5 E;  2LO3 A;  3KZY A;  5A6B D;  1MG7 A;  4LF9 I;  5IT9 C;  1X6E A;  3LNU A;  5KL3 A;  4MU3 A;  2EOQ A;  1P42 A;  1BBO A;  2JEA A;  3J7A M;  4OO1 E;  1Y4S A;  5LMU I;  1A1H A;  4DV7 E;  3DJW A;  4NHR A;  4DR4 I;  5CFF E;  1ZBQ A;  4ZYE A;  4F6N A;  2ZM6 E;  2V86 A;  5TSE A;  5IV8 B;  2G7H A;  4N4R B;  2BA1 D;  1YYK A;  3T1Y I;  3C6M A;  3V5R A;  3WU3 A;  4MU4 A;  2Q2E B;  1KVK A;  2KHX A;  1Z0G A;  2R1F A;  4FW7 A;  2UXB E;  2HK3 A;  4MDT A;  5LMN E;  2JY9 A;  4ZYH A;  1KJK A;  2PNZ A;  2N8X A;  1X47 A;  1A1J A;  4WYQ B;  1OYS A;  2Z5E A;  3F6G A;  2ENH A;  2J7K A;  4URL A;  1HNX E;  2DEI A;  2CG9 A;  4JI3 I;  2V89 A;  5A6J A;  2EN3 A;  5DNX A;  2DIX A;  2C39 B;  4Q28 A;  4FWG A;  1EI1 A;  4FW5 A;  4RPF A;  4LF9 E;  2LJH A;  1UDN A;  1EA6 A;  5C0X F;  2UXD I;  4DR5 I;  4DUY E;  1YH8 A;  4UTG A;  4DPU A;  2BV3 A;  2EN4 A;  2C38 A;  4R2P A;  4O24 A;  4JI1 I;  1Z5C A;  4MQY A;  2LBS B;  1FNM A;  5FLX C;  1UIL A;  2EMK A;  4LF4 I;  4DR6 I;  3OML A;  2EM9 A;  4AM3 A;  1HK7 A;  5DNL A;  4YY3 I;  3P3E A;  2H36 X;  2V2V A;  4JI8 E;  2X7I A;  5LLQ A;  1E3P A;  4JI7 E;  2LCE A;  5IXM B;  2IES A;  2NN6 C;  2EML A;  3BID A;  1XNQ I;  2EMF A;  4LF7 I;  3ZM7 A;  1B63 A;  4LFC I;  4R1F A;  2HJJ A;  5ELW A;  2UUA I;  2M7Q A;  4ZYG A;  1YUI A;  4B3R I;  2I9I A;  1N32 E;  4BA1 B;  4DV1 I;  5AAS A;  3EPK A;  3F0N A;  2DLQ A;  4DV3 E;  4DR3 E;  4KHP I;  3PYE A;  1Z0V A;  1RRE A;  1PJT A;  2GO3 A;  1QU6 A;  3M85 D;  3HPS A;  5C0X C;  2ZIT A;  2YU5 A;  4X8W A;  4R2D A;  1HNZ E;  4ISA A;  3ADL A;  4PRX A;  3NZK A;  2EPL X;  3L7Z A;  3H4L A;  3EPH A;  2EPK X;  2EOS A;  5DRR A;  4DUZ I;  1P47 A;  4MU0 A;  2YRH A;  2L6M A;  2EN7 A;  4B3M E;  2DGC A;  3PYF A;  1OYP A;  4MLQ A;  4J8Z A;  3EPJ A;  5LMU E;  3J7A G;  1B62 A;  2MC6 A;  1ZXM A;  2F4V I;  4WUC A;  4R03 A;  3CDI A;  2EOJ A;  2R3V A;  4HY1 A;  4WUD A;  2A2D A;  4OX9 E;  2YTP A;  2YU8 A;  3T1H E;  2WBT A;  2HKE A;  4DPW A;  2O3Z A;  2EL6 A;  2LVH A;  2E1R A;  2X36 A;  5A6K A;  2YZT A;  1WRJ A;  1PDA A;  2KON A;  4X66 E;  2EMI A;  5AE1 A;  2WNR A;  1X6F A;  3M6A A;  4IFD C;  4JI7 I;  5EKW A;  2RS6 A;  2EQ0 A;  1AAY A;  2UXB I;  1PJS A;  1XNQ E;  4DV4 I;  2IOQ A;  3CWV A;  4DR7 I;  2HGH A;  4LF6 I;  1ELO A;  2GLI A;  3D4J A;  3WU5 A;  2LMZ A;  3VYX A;  2GHF A;  4MLV A;  2EM7 A;  1NEI A;  4FWD A;  3KZZ A;  2BA0 G;  1A1I A;  5A6B A;  3MSW A;  3THO B;  2JWO A;  1YZ9 A;  2NUF A;  2EOH A;  3HQ1 A;  4KWY A;  5EL9 A;  1N0U A;  1HNZ I;  4LU9 A;  4BA1 A;  1MU5 A;  2B7V A;  2EN8 A;  2EM8 A;  1N0V C;  1Z0E A;  2PO0 A;  5K36 F;  4OKG A;  2MDR A;  4F9C B;  1A1G A;  4JYA E;  5GMD A;  3ECR A;  4BMJ A;  2YTI A;  4HAC B;  1IQO A;  4P7A A;  1STU A;  2DRP A;  4LFB E;  3B82 A;  5JEA A;  1DGC A;  1N33 E;  5KL6 A;  2EMA A;  4BA2 B;  4U3D A;  1N34 E;  4N3O A;  2NPF A;  2BA0 D;  2VQE I;  2L33 A;  2EQ3 A;  5K36 D;  2EQ1 A;  2EN1 A;  1J5E E;  1ZM4 A;  4LFA E;  1PJQ A;  1TF3 A;  2JEB B;  5DRP A;  4ED4 A;  4LF4 E;  3P3C A;  4GQU A;  4X62 I;  2VRD A;  2EOR A;  4I8O A;  3QT8 A;  2LUP B;  2CSH A;  5C0X E;  3F6H A;  3J80 C;  1UDS A;  2C38 B;  4DPT A;  2EL5 A;  3HTX A;  2M9A A;  2JPA A;  1FJG E;  2UXD E;  5LL6 R;  1FKA E;  2N3H A;  4GKK E;  2PNL A;  1GTK A;  4WSG A;  2O1V A;  4OO1 B;  2GPI A;  3EQ1 A;  1JK2 A;  4DV7 I;  2UUC E;  2WBS A;  2HKJ A;  3C4T A;  2BR2 B;  5IWA I;  3M7N D;  5BR8 E;  1G2F C;  2V34 A;  4I3H A;  1Z0W A;  2EPP A;  1LLM C;  4OOG C;  4DV3 I;  4JI0 I;  3T1Y E;  2CVE A;  3WU6 A;  4AIM A;  1KIJ A;  2VQF I;  2CPN A;  2V87 A;  1XNR I;  4R8O A;  2MKD A;  1B69 A;  4NXM E;  4AID A;  4L8N A;  2HHH I;  2LV2 A;  2NA2 A;  4IFD F;  4MU1 A;  4BHB A;  1X6H A;  2YTJ A;  1WXR A;  4USK A;  2L2K B;  2EPN A;  4BA2 A;  5FLX Q;  1R6L A;  1TN9 A;  4KQV A;  4DV2 I;  2M4I A;  1K47 A;  1WJP A;  2E72 A;  3AV0 A;  2EOI A;  5A6A A;  3V2U C;  5IT9 Q;  4USM A;  1OJ4 A;  2EM4 A;  1T4N A;  4FW6 A;  1J5E I;  3JAM C;  4LFA I;  4OX9 I;  1RR9 A;  3T1H I;  2EPM X;  4HEI A;  2JXP A;  4M1K A;  1HNW I;  2CT1 A;  1X3C A;  3M99 B;  3QT6 A;  3IWC A;  3OTO I;  2YWQ A;  1IBL I;  4WX9 A;  3B4T A;  4F9A B;  1DQ3 A;  2OI2 A;  3M7N G;  4JV5 I;  3VHT B;  4RHB B;  4BCA A;  4DR2 I;  1H73 A;  4DPX A;  4DUY I;  2CGE A;  4Q35 B;  2UUC I;  2IER A;  4F54 A;  2YTF A;  2L8T A;  2YTO A;  1H7S A;  3ZKB A;  1PIE A;  2LJU A;  4WXC A;  4R2S A;  1T38 A;  4R2C A;  2JT2 A;  1MX0 A;  5KL5 A;  2A2C A;  1IBM I;  1MEY C;  2L3J A;  4LTY A;  2YTE A;  4JI8 I;  2EPZ A;  2E5L E;  4X65 I;  3TQM A;  4X64 E;  1FWK A;  2IOP A;  4M0V A;  1A1F A;  5LMN I;  2PO1 B;  4LFC E;  3AUZ A;  2HFS A;  2PRT A;  4IJD A;  4LPF A;  5KL4 A;  5GME A;  4Z7C A;  4B3R E;  4DV0 E;  4TUI A;  2UU9 I;  1HNX I;  5JEA C;  3P76 A;  1X48 A;  1D6T A;  1J26 A;  4X62 E;  2HFU A;  1F2I G;  3U1Y A;  5K36 E;  2EMZ A;  2J7J A;  1HNW E;  3PYD A;  2J65 A;  4YHH I;  3HPZ A;  1YYO A;  2WNR B;  3HUL A;  4O43 A;  3QT7 A;  2RSM A;  4F2J C;  2EMC A;  4DUZ E;  2LUQ A;  4FW4 A;  2JR1 A;  2V8Q B;  3J81 Q;  4B3M I;  2PO0 B;  4DR2 E;  3JU0 A;  2RS7 A;  3HXL A;  4HYM A;  4DV5 I;  2EFG A;  2BA1 G;  2EPX A;  2YSO A;  3ADJ A;  2EMB A;  4FK5 C;  2ODR D;  2EM3 A;  3L00 A;  4X9J A;  4JI1 E;  3ZZT A;  4BC7 A;  4IS1 C;  4DU7 A;  2RPC A;  1Z1B A;  4TUG A;  5AC4 A;  4NXN I;  2BM0 A;  4GEQ B;  2BR2 A;  4L5N C;  2BBG A;  4UT4 A;  2MKN A;  4ZVI A;  2NN6 E;  1VIS A;  2EJ4 A;  2ENC A;  2E5L I;  5A69 A;  4FWH A;  4JI5 E;  4X64 I;  1O0W A;  1YUJ A;  2DEJ A;  1NHJ A;  1I94 I;  4LF7 E;  4IFD D;  4LF6 E;  2ELZ A;  1XMQ I;  4GZN C;  1Y4U A;  3JAM Q;  2PNM A;  2YTG A;  1XHK A;  3P3G A;  2UUA E;  2D9H A;  1BKN A;  3WU4 A;  2NN6 A;  4DV2 E;  2B9D A;  4ZYD A;  1N32 I;  2MDG A;  2YSP A;  2LT7 A;  3KWR A;  2R42 A;  2PO1 A;  3HKM A;  2EP3 A;  2JEB A;  1TF6 A;  1ZXN A;  1WUU A;  2DLK A;  2IHR 1;  2EWL A;  2BM1 A;  3OTO E;  1EH7 A;  1PKP A;  4P78 A;  1BB8 A;  2HK2 A;  4DV6 I;  3QT5 A;  1HR0 I;  3H09 A;  4JV5 E;  1NHH A;  4DXL A;  4OO1 F;  1H7U A;  2EM5 A;  1IBK E;  1L4S A;  4B3S I;  1UDO A;  2F8B A;  4OZE A;  1N33 I;  2A25 A;  2FV4 B;  1ZAA C;  2GS8 A;  3KRN A;  3H1C A;  4OO1 C;  4F6M A;  2VE7 C;  1UBD C;  2V85 A;  4B3T I;  1GQE A;  4LCF A;  2EPR A;  1Z0T A;  1S16 A;  1NCS A;  4O5G A;  3Q6N A;  5K36 B;  2JOB A;  4DKK A;  4F9B B;  1USU A;  3PS1 A;  4DU8 A;  3MHS C;  5A2Q Q;  2O1W A;  1BBG A;  1QNT A;  5KL2 A;  1DAR A;  2LJP A;  2ADR A;  2B3T B;  1Z59 A;  3LML A;  2WZO A;  3ZKD A;  4JG4 A;  4M30 A;  1NZ0 A;  4AQY I;  4IFD E;  2LRS A;  3J80 Q;  4WUB A;  3ZZ0 A;  4BBY A;  1PVG A;  1T4L B;  2R76 A;  3Q6M A;  2C37 A;  1MGT A;  2EOO A;  2EPA A;  4NZV A;  4JI4 I;  2F1D A;  4JI0 E;  1A6F A;  2Z5B B;  1IMU A;  1R6M A;  1UHZ A;  4WFT A;  1JK1 A;  4WSP A;  1UN6 B;  4K0K I;  2VQF E;  1DI2 A;  2I13 A;  5DNY A;  2EPO A;  2UUB E;  1ZM9 A;  5DRO A;  4NXM I;  1EH8 A;  1SFE A;  4DV6 E;  3J7Y p;  1HR0 E;  1ZR9 A;  2UXC E;  3K1J A;  3VK6 A;  2EM6 A;  2L92 A;  3BF2 A;  4R2R A;  3THN A;  4FW3 A;  4JI2 E;  2K4V A;  4FN5 A;  5FWK A;  1Z0B A;  1Z5A A;  2CTD A;  3PS3 A;  2EPC A;  2MC5 A;  3RMP A;  4LOM A;  4B3T E;  5K36 A;  5F3W A;  1N34 I;  1SR9 A;  4WPY A;  2WP8 B;  3GON A;  1YYW A;  4IZJ A;  4NXN E;  2WP8 A;  4DR6 E;  4IZJ B;  2JEA B;  2EE8 A;  1T4O A;  3K6Q A;  2ZBK B;  1AH5 A;  2V88 A;  3QG5 C;  4LF8 E;  5C0X D;  4JI5 I;  2EPU A;  2VF1 A;  2LTS A;  4R2A A;  3PYG A;  4IZJ D;  1A1K A;  4M2Z A;  2JYA A;  2K7I A;  1ZBT A;  4DR1 E;  2Q8U A;  2EN2 A;  2VF3 A;  4HXZ A;  4BHC A;  2EMH A;  2N3G A;  5AE2 A;  1Y6Z A;  3DD6 A;  4LCH A;  3BGH A;  5K36 C;  1XMO I;  5IWA E;  2WCC 3;  4FW9 A;  4MYT A;  4U3B A;  3LLH A;  4KHP E;  5JEA E;  4DR3 I;  2E1M A;  1WHQ A;  4J3D A;  4R2Q A;  2NUG A;  4IS9 A;  2B7T A;  2JVA A;  1IQS A;  1FI4 A;  1XNR E;  1ZU1 A;  1ZM2 A;  2M1S A;  2XEX A;  3K85 A;  1KYQ A;  2YTD A;  3GLL A;  4DR5 E;  2AJ4 A;  1IBK I;  1H72 C;  1USV A;  2C39 A;  3HJC A;  1OYR A;  2PO2 A;  2YT4 A;  2EZ6 A;  1YFH A;  3B78 A;  4IFD A;  5DRQ A;  1XXE A;  3GCM A;  4DV4 E;  2ENA A;  1T39 A;  1KTV A;  1Z0C A;  2V2Q A;  4JI6 E;  5ADZ A;  4GKJ E;  2HC5 A;  1YHC A;  5L3J A;  4QNJ A;  4RH8 A;  2EMX A;  4YHH E;  2NN6 D;  5JEA D;  2LTR A;  2JE6 A;  4YY3 E;  3ZOQ B;  1NHI A;  3VYY A;  2CZ9 A;  2JE6 B;  4LF8 I;  4NBQ A;  2NN6 F;  2VES A;  1EH6 A;  2Z5C A;  2PNZ B;  2EOZ A;  4AQY E;  1U2R A;  2DSY A;  3M85 G;  4IZK B;  2O1U A;  5BR8 I;  5KL7 A;  2YTN A;  3P06 A;  4KZS A;  1XMO E;  2EMW A;  5A2Q C;  4IZK A;  4DR4 E;  2YRM A;  4OO1 A;  2ZM6 I;  2V83 A;  4JI4 E;  4GKJ I;  2ODR C;  2EL4 A;  3IWB A;  1N36 E;  3UK3 C;  4M9V C;  1FWL A;  3PS2 A;  1IBM E;  4K0K E;  2Z5B A;  4BS9 A;  4P52 A;  3LPS A;  1EKZ A;  1KKH A;  5JEA F;  2NN6 B;  2UUB I;  2RTX A;  4X65 E;  2WW4 A;  1Y60 A;  2YPN A;  1I94 E;  2UXC I;  4MYU A;  3ADI A;  3DF6 A;  4IFD B;  4WXD A;  2PO2 B;  1G2D C;  4LFB I;  2EOF A;  4JI2 I;  1Z5B A;  2F4V E;  4DV0 I;  2ELY A;  1N3G A;  3C6K A;  3J81 C;  4PU9 A;  4HAC A;  2GO4 A;  2UU9 E;  4XTJ A;  1X49 A;  2JP9 A;  1UEK A;  5C0X B;  2DB2 A;  2Z5C B;  2V2Z A;  1QZR A;  1X5W A;  4PRV A;  2EOM A;  2GQ0 A;  2EOX A;  3UHM A;  4X66 I;  2EOY A;  2WBU A;  1FJG I;  2RSI A;  4LF5 I;  4DPY A;  3CDJ A;  4GKK I;  1WHN A;  2L2M A;  4DR7 E;  3P1X A;  4B3S E;  2C37 B;  4DV5 E;  2RQL A;  2EM0 A;  1E3H A;  2EM2 A;  3PRY A;  4DR1 I;  3C4B A;  1RC7 A;  3U1K A;  2DMY A;  1RMD A;  2AE8 A;  2LE2 A;  2YTQ A;  1RQ0 A;  2O1T A;  1VI7 A;  3K17 A;  3JTZ A;  3MHH C;  1N36 I;  2FTX B;  2EMY A;  3BBG A;  2EOE A;  1YPN A;  4O4K A;  3ZZU A;  2KOU A;  2NUE A;  3GME A;  2HHH E;  3IWD A;  4P7D A;  4HTG A;  4BC9 A;  5AE3 A;  2FGG A;  5T6J A;  4QNK A;  2NAB A;  1XMQ E;  4JYA I;  2BB8 A;  1Y5Y A;  3LTO A;  2DMI A;  2JOX A;  2EMG A;  4DMI A;  1S4E A;  5AC5 A;  4DV1 E;  3Q1Q A;  1H74 A;  3EPL A;  4OO1 D;  3B8H A;  1A1L A;  2VQE E;  1UDQ A;  2V8P A;  4Z7Y A;  5JEA B;  5C0X A;  2L2N A;  3FIG A;  1RHY A;  4JI6 I;  4JI3 E;  2YRK A;  4LCG A; 
#chains in the Genus database with same CATH homology
 3ADG A;  2L3C A;  1IBL E;  1GZ6 A;  1ZM3 A;  4EMD A;  4LF5 E;  1MG7 A;  4LF9 I;  5IT9 C;  3LNU A;  3J7A M;  1Y4S A;  5LMU I;  4DV7 E;  3DJW A;  5CFF E;  1ZBQ A;  2ZM6 E;  2V86 A;  2G7H A;  1YYK A;  3T1Y I;  3V5R A;  3WU3 A;  2Q2E B;  1KVK A;  2KHX A;  1Z0G A;  2UXB E;  2HK3 A;  5LMN E;  2JY9 A;  1X47 A;  4WYQ B;  2Z5E A;  3F6G A;  2J7K A;  4URL A;  1HNX E;  2DEI A;  2CG9 A;  4JI3 I;  2V89 A;  2DIX A;  4FWG A;  4Q28 A;  1EI1 A;  4RPF A;  4LF9 E;  2LJH A;  1EA6 A;  4DR5 I;  4DUY E;  4UTG A;  4DPU A;  2BV3 A;  4JI1 I;  1Z5C A;  2LBS B;  1FNM A;  5FLX C;  1UIL A;  4LF4 I;  4DR6 I;  3OML A;  1HK7 A;  4YY3 I;  2H36 X;  2V2V A;  4JI8 E;  2X7I A;  2UXD I;  4JI7 E;  1XNQ I;  4LF7 I;  3ZM7 A;  1B63 A;  4LFC I;  4R1F A;  2UUA I;  2M7Q A;  4B3R I;  1N32 E;  4DV1 I;  5AAS A;  3F0N A;  4DV3 E;  4DR3 E;  4KHP I;  3PYE A;  1Z0V A;  1RRE A;  1QU6 A;  3HPS A;  2ZIT A;  4X8W A;  1HNZ E;  3ADL A;  4PRX A;  3H4L A;  4DUZ I;  2L6M A;  4B3M E;  3PYF A;  4J8Z A;  5LMU E;  2F4V I;  3J7A G;  1B62 A;  2MC6 A;  1ZXM A;  4WUC A;  4R03 A;  2R3V A;  4HY1 A;  4WUD A;  2A2D A;  4OX9 E;  3T1H E;  2HKE A;  4DPW A;  2X36 A;  2E1R A;  2YZT A;  2KON A;  4X66 E;  5AE1 A;  3M6A A;  4JI7 I;  2RS6 A;  2UXB I;  1XNQ E;  2IOQ A;  3CWV A;  4DR7 I;  4LF6 I;  1ELO A;  3D4J A;  3WU5 A;  2LMZ A;  3VYX A;  4FWD A;  3MSW A;  2JWO A;  1YZ9 A;  2NUF A;  3HQ1 A;  1N0U A;  1HNZ I;  4LU9 A;  1MU5 A;  2B7V A;  1N0V C;  1Z0E A;  2MDR A;  4F9C B;  5GMD A;  4JYA E;  4BMJ A;  4HAC B;  4P7A A;  1STU A;  4LFB E;  3B82 A;  1N33 E;  2VQE I;  1N34 E;  4N3O A;  2NPF A;  2L33 A;  1J5E E;  1ZM4 A;  4LFA E;  4ED4 A;  4X62 I;  4LF4 E;  4I8O A;  3QT8 A;  2LUP B;  3F6H A;  3J80 C;  4DPT A;  3HTX A;  2UXD E;  1FJG E;  5LL6 R;  1FKA E;  2N3H A;  4GKK E;  2PNL A;  2O1V A;  4DV7 I;  2UUC E;  2HKJ A;  5IWA I;  3C4T A;  5BR8 E;  2V34 A;  4I3H A;  1Z0W A;  4DV3 I;  4OOG C;  4JI0 I;  3T1Y E;  3WU6 A;  1KIJ A;  2VQF I;  2CPN A;  2V87 A;  1XNR I;  4R8O A;  4NXM E;  2HHH I;  4L8N A;  2NA2 A;  1WXR A;  4USK A;  2L2K B;  5FLX Q;  4KQV A;  4DV2 I;  2M4I A;  1K47 A;  3AV0 A;  3V2U C;  5IT9 Q;  4USM A;  1OJ4 A;  1T4N A;  1J5E I;  4LFA I;  3JAM C;  4OX9 I;  1RR9 A;  3T1H I;  4M1K A;  1HNW I;  3QT6 A;  3IWC A;  3OTO I;  1IBL I;  4F9A B;  1DQ3 A;  2OI2 A;  4JV5 I;  4BCA A;  4DR2 I;  1H73 A;  4DPX A;  4DUY I;  2CGE A;  2UUC I;  4F54 A;  2L8T A;  1H7S A;  3ZKB A;  1PIE A;  1MX0 A;  2A2C A;  1IBM I;  2L3J A;  4LTY A;  4JI8 I;  2E5L E;  4X65 I;  4X64 E;  1FWK A;  2IOP A;  4M0V A;  5LMN I;  4LFC E;  3AUZ A;  2HFS A;  5GME A;  4Z7C A;  4B3R E;  4DV0 E;  4TUI A;  2UU9 I;  1HNX I;  1X48 A;  1D6T A;  1J26 A;  4X62 E;  2HFU A;  1HNW E;  3PYD A;  4YHH I;  3HPZ A;  1YYO A;  3HUL A;  3QT7 A;  2RSM A;  4DUZ E;  2LUQ A;  2JR1 A;  2V8Q B;  3J81 Q;  4B3M I;  4DR2 E;  3JU0 A;  2RS7 A;  3HXL A;  4HYM A;  4DV5 I;  2EFG A;  3ADJ A;  2ODR D;  4JI1 E;  4DR4 I;  3ZZT A;  4DU7 A;  4BC7 A;  5BR8 I;  4TUG A;  4NXN I;  2BM0 A;  4GEQ B;  4L5N C;  4UT4 A;  4ZVI A;  1VIS A;  2E5L I;  4FWH A;  4JI5 E;  4X64 I;  1O0W A;  2DEJ A;  1NHJ A;  1I94 I;  4LF7 E;  4LF6 E;  1XMQ I;  1Y4U A;  3JAM Q;  2PNM A;  1XHK A;  3WU4 A;  2UUA E;  1BKN A;  4DV2 E;  2B9D A;  1N32 I;  3KWR A;  2R42 A;  1ZXN A;  1WUU A;  2IHR 1;  2EWL A;  2BM1 A;  3OTO E;  4P78 A;  1PKP A;  2HK2 A;  4DV6 I;  1HR0 I;  3QT5 A;  3H09 A;  4JV5 E;  1NHH A;  4DXL A;  1H7U A;  1IBK E;  4B3S I;  2F8B A;  1N33 I;  2FV4 B;  2GS8 A;  2VE7 C;  2V85 A;  4B3T I;  1GQE A;  1Z0T A;  1S16 A;  3Q6N A;  2JOB A;  4DKK A;  4F9B B;  1USU A;  4DU8 A;  5A2Q Q;  2O1W A;  1DAR A;  2LJP A;  2B3T B;  1Z59 A;  3LML A;  2WZO A;  3ZKD A;  4JG4 A;  4M30 A;  1NZ0 A;  4AQY I;  2LRS A;  3J80 Q;  4WUB A;  3ZZ0 A;  4BBY A;  1PVG A;  1T4L B;  3Q6M A;  4JI4 I;  2Z5B B;  4JI0 E;  1A6F A;  1UHZ A;  4WFT A;  4WSP A;  4K0K I;  2VQF E;  1DI2 A;  5DNY A;  2UUB E;  1ZM9 A;  4NXM I;  4DV6 E;  1HR0 E;  3J7Y p;  3K1J A;  2UXC E;  2L92 A;  3VK6 A;  4JI2 E;  2K4V A;  4FN5 A;  5FWK A;  1Z0B A;  1Z5A A;  2MC5 A;  3RMP A;  4B3T E;  5F3W A;  1N34 I;  1SR9 A;  4WPY A;  3GON A;  4IZJ A;  1YYW A;  4DV4 I;  4NXN E;  4DR6 E;  4IZJ B;  1T4O A;  3K6Q A;  2ZBK B;  2V88 A;  4LF8 E;  4JI5 I;  2VF1 A;  2LTS A;  3PYG A;  4IZJ D;  4M2Z A;  4DR1 E;  1ZBT A;  4Z7Y A;  2VF3 A;  4HXZ A;  1Y6Z A;  2N3G A;  5AE2 A;  1XMO I;  5IWA E;  4FW9 A;  4MYT A;  3LLH A;  4KHP E;  4DR3 I;  2E1M A;  1WHQ A;  2NUG A;  2B7T A;  2JVA A;  1FI4 A;  1XNR E;  1ZM2 A;  2M1S A;  2XEX A;  3K85 A;  4DR5 E;  2AJ4 A;  1IBK I;  1H72 C;  1USV A;  3HJC A;  2YT4 A;  2EZ6 A;  3B78 A;  4DV4 E;  1KTV A;  1Z0C A;  2V2Q A;  4JI6 E;  5ADZ A;  4GKJ E;  5L3J A;  4YHH E;  2LTR A;  4YY3 E;  3ZOQ B;  1NHI A;  3VYY A;  2CZ9 A;  4LF8 I;  2Z5C A;  4AQY E;  1U2R A;  2DSY A;  4IZK B;  2O1U A;  3P06 A;  4KZS A;  1XMO E;  5A2Q C;  4IZK A;  4DR4 E;  2ZM6 I;  2V83 A;  4JI4 E;  4GKJ I;  2ODR C;  3IWB A;  1N36 E;  1FWL A;  1IBM E;  4K0K E;  2Z5B A;  4BS9 A;  4P52 A;  3LPS A;  1EKZ A;  1KKH A;  2UUB I;  2RTX A;  4X65 E;  2WW4 A;  1I94 E;  2UXC I;  4MYU A;  3ADI A;  3DF6 A;  4LFB I;  4JI2 I;  1Z5B A;  2F4V E;  4DV0 I;  3J81 C;  4PU9 A;  4HAC A;  2UU9 E;  4XTJ A;  1X49 A;  1UEK A;  2DB2 A;  2Z5C B;  2V2Z A;  1QZR A;  4PRV A;  2GQ0 A;  4X66 I;  1FJG I;  4LF5 I;  4DPY A;  4GKK I;  1WHN A;  2L2M A;  4DR7 E;  3P1X A;  4B3S E;  4DV5 E;  4DR1 I;  3PRY A;  3C4B A;  1RC7 A;  2DMY A;  2LE2 A;  1RQ0 A;  2O1T A;  3K17 A;  3JTZ A;  1N36 I;  2FTX B;  3ZZU A;  2KOU A;  2NUE A;  2HHH E;  3IWD A;  4P7D A;  4BC9 A;  5AE3 A;  2FGG A;  5T6J A;  1XMQ E;  4JYA I;  3LTO A;  2JOX A;  4DMI A;  1S4E A;  4DV1 E;  3Q1Q A;  1H74 A;  3B8H A;  2VQE E;  2V8P A;  2L2N A;  3FIG A;  4JI6 I;  4JI3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...