4LFBE

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 40
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lfbE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfbE02
3WU5A 1IBLI 4DR1I 2IHR1 3ZZ0A 4DR6I 4DR4I 1NZ0A 4MYUA 4JI5E 2KHXA 2HFSA 4DPUA 1RQ0A 4JI3E 1XMQE 1STUA 1N34I 1Z0CA 2HK2A 4PRVA 3ZZUA 1Z0VA 2JY9A 4YY3E 1XHKA 4DR5I 5CFFE 4KHPE 3HTXA 3CWVA 2LRSA 2BM0A 4OX9I 2NUFA 1S16A 1J26A 1N33E 1ZM3A 1I94I 4JI6I 4DV2I 4ED4A 1MX0A 4WUCA 4DUZE 2NPFA 3ZKBA 4PRXA 1KIJA 1FKAE 3B8HA 3J7Yp 2RS6A 2LTRA 1XNRE 4LF7E 2V2VA 4B3TI 4LFCI 4JI2E 4DPTA 4PU9A 2E1RA 3WU6A 1UHZA 2B7TA 4DV3I 4LF5I 2EZ6A 4B3SI 4DKKA 3Q1QA 1H72C 4NXMI 4GKKE 4JG4A 4FWDA 2VQEI 1VISA 2UU9I 2DEJA 1ZM9A 3QT6A 4USKA 1PVGA 4M1KA 2UXDE 4DR7I 4B3ME 4GKJE 5L3JA 2MDRA 3T1HE 2BV3A 2BM1A 4RPFA 4DR3I 4JYAE 1X47A 4R1FA 4I3HA 2V2QA 1HNZI 1EKZA 1XNQE 3VYYA 1NHIA 3OTOI 4K0KI 1RR9A 4LF4E 2HFUA 3F0NA 4DPYA 4JI8E 2NUEA 4DPXA 4USMA 3H4LA 4DPWA 2L3JA 1N32E 5BR8E 2ZITA 4JI5I 1T4LB 1U2RA 4M2ZA 4JI3I 2RTXA 1XMQI 3V2UC 3K17A 3ZZTA 1XMOE 2L3CA 2N3HA 3QT7A 5GMDA 4YHHE 4YY3I 1N36E 1FI4A 4X66E 1K47A 1ZBTA 3J81C 4KHPI 5A2QC 1N33I 2L2NA 3HULA 2L2KB 3LLHA 1H73A 1WHQA 3B82A 4M30A 2DIXA 2A2CA 1NHJA 4DUZI 2UUBE 2RS7A 2J7KA 4JI4E 4Z7YA 2HKJA 1PKPA 5LL6R 2L2MA 4LF6E 2LJPA 4HXZA 2WW4A 1YZ9A 1XNRI 4LF7I 4P52A 4X64E 1ZXMA 4JI2I 4LFAE 3PYGA 4HACA 1Z59A 3LNUA 1ZM2A 4FW9A 4DR2E 4DV0E 1QU6A 4DV4E 2E5LE 4GKKI 1Z5AA 1IBME 1B63A 2JVAA 3QT5A 1J5EE 2A2DA 1ZXNA 2UXDI 1ZM4A 1D6TA 4DV6E 2AJ4A 4B3MI 3P1XA 1Z5CA 5IT9C 4GKJI 4DV7E 2OI2A 3J7AG 4DV1E 1BKNA 3T1HI 4JYAI 3WU3A 4DU7A 2LUQA 4X62E 1XNQI 1X49A 5LMUE 5LMNE 4FWGA 3J81Q 2LUPB 4JI0E 4LF4I 4URLA 2VQFE 1WUUA 4DXLA 4AQYE 1H7UA 4JI8I 4JI1E 3ADIA 3JAMQ 5A2QQ 1UEKA 2CZ9A 1T4OA 4LF8E 2UXCE 1N0VC 1N32I 1EI1A 3V5RA 5BR8I 1HNWE 4WYQB 1FNMA 3J80C 2UUAE 2F4VE 2L33A 4OOGC 2NA2A 1FJGE 1HR0E 1XMOI 1EA6A 1Z0GA 4YHHI 3PYEA 1N36I 4FN5A 4X66I 4UTGA 1MG7A 3PYDA 1YYOA 2HHHE 2HK3A 4FWHA 2YT4A 4JI7E 3T1YE 4X65E 4LFBE 1KVKA 4HACB 1FWKA 2XEXA 4DUYE 4JV5E 4HYMA 2UUBI 2LBSB 4JI4I 2UUCE 4Z7CA 1KKHA 1PIEA 2B7VA 4LF6I 5IWAE 4HY1A 4WUDA 4LF9E 1Z0WA 5IT9Q 3J7AM 3JAMC 4X64I 4P7AA 4B3RE 4NXNE 1A6FA 2UXBE 4LFAI 3VYXA 1RREA 3PYFA 3LPSA 2GS8A 2N3GA 1B62A 1DI2A 4DR2I 2CPNA 4DV0I 4WFTA 4DV4I 1HNXE 2E5LI 1UILA 1IBMI 2EFGA 1IBKE 4UT4A 1ELOA 4DV5E 3ADGA 3D4JA 2R3VA 1J5EI 2ZM6E 3J80Q 1Z0BA 4DV6I 4DV7I 4DV1I 3C4TA 2B3TB 1IBLE 4DR1E 4DR6E 4DR4E 2HKEA 3GONA 2X36A 2VF3A 1YYWA 5FLXQ 1Z5BA 4X62I 4WUBA 1YYKA 5LMUI 5LMNI 4JI0I 1QZRA 2DB2A 1S4EA 2VQFI 4AQYI 4JI1I 1N34E 1X48A 3LTOA 4LF8I 2X7IA 2UXCI 5GMEA 1RC7A 2V2ZA 1HNWI 2UUAI 2F4VI 4DR5E 1NHHA 4OX9E 2V34A 1KTVA 3ZKDA 4X8WA 2R42A 1FJGI 1I94E 3C4BA 1HR0I 4JI6E 1DARA 4DV2E 1H74A 1N0UA 2HHHI 1WHNA 4EMDA 4JI7I 3T1YI 4X65I 4LFBI 1O0WA 4DU8A 4DUYI 4B3TE 4LFCE 4JV5I 3M6AA 5FLXC 2UUCI 1MU5A 3WU4A 5IWAI 1FWLA 4LF9I 4DV3E 4LF5E 4XTJA 1Z0EA 1OJ4A 4B3SE 2V8PA 4NXME 2Q2EB 4B3RI 4NXNI 4MYTA 2VQEE 2UXBI 2UU9E 4ZVIA 1T4NA 4KQVA 3ADLA 1H7SA 2RSMA 4DR7E 3ZM7A 2DMYA 2LJHA 2LTSA 1HNXI 4DR3E 3K1JA 1IBKI 4DV5I 1Z0TA 2DEIA 1HNZE 3QT8A 3ADJA 3B78A 2ZM6I 1GQEA 2NUGA 3OTOE 4K0KE 2ZBKB
chains in the Genus database with same CATH superfamily
2EQ3A 2IERA 3WU5A 2EMIA 4HEIA 1IBLI 1UDSA 4DR1I 2IHR1 3ZZ0A 3M99B 1SFEA 4DR4I 4DR6I 1BB8A 4RH8A 1Z1BA 4TUGA 3M7ND 1NZ0A 2PO1A 2IESA 4HTGA 2CT1A 1YSAC 5KL4A 2EM8A 4MYUA 4JI5E 2KHXA 2HFSA 5ELWA 4DPUA 2ENCA 1RQ0A 2EMHA 4O43A 2EM6A 1STUA 1XMQE 4JI3E 1Y5YA 1N34I 1Y60A 1Z0CA 1YPNA 2EMWA 3P3GA 4BA2A 4O24A 4F54A 2HK2A 1KYQA 4PRVA 3ZZUA 5A6KA 2WNRB 2C37A 1Z0VA 2JY9A 4YY3E 4DMIA 1OYSA 4IFDB 1PJTA 2JPAA 2VF1A 4R03A 1XHKA 4DR5I 3THOB 4P7DA 4IZJD 4LOMA 3U1YA 1NEIA 1DGCA 5CFFE 2DSYA 4KHPE 2LMZA 3HTXA 3CWVA 1SR9A 3P76A 1DQ3A 1YFHA 2LRSA 1IQSA 2WCC3 2BM0A 1YH8A 4OX9I 2NUFA 1S16A 1J26A 1N33E 4IS9A 4FW5A 4MLVA 3THNA 1ZM3A 2F8BA 2EOYA 1I94I 5AASA 5A6BD 1USUA 3DF6A 4F9CB 2CG9A 5C0XF 4JI6I 4DV2I 2PO0A 4ED4A 2EORA 1MX0A 4WUCA 1R6LA 2EM0A 2JT2A 2EL4A 4DUZE 2NPFA 3ZKBA 5C0XD 2EM7A 5K36F 4PRXA 2YSOA 1KIJA 2WZOA 2PRTA 1FKAE 5LLQA 3B8HA 3J7Yp 3U1KA 3Q6MA 2PO2B 4FW7A 2RS6A 4IZJA 4U3DA 5K36D 2LTRA 5KL6A 1XNRE 4LF7E 2F1DA 4I8OA 2KONA 1A1JA 2V2VA 4OKGA 4B3TI 4N4RB 4LFCI 4OO1F 2D9HA 4JI2E 3RMPA 5JEAF 4DPTA 2EOXA 2EM2A 2L8TA 2YTQA 2BA0D 1T38A 4PU9A 5DRRA 1A1LA 1X5WA 5C0XC 4OO1D 4ZYDA 2E1RA 2E1MA 2Z5CA 4MU3A 5JEAD 3WU6A 1UHZA 4BHCA 2B7TA 4BBYA 4DV3I 4LF5I 5C0XA 2EZ6A 2EOHA 4B3SI 4BHBA 4DKKA 3BF2A 2EL5A 5DROA 2EN2A 3Q1QA 1H72C 4NXMI 1A1KA 4GKKE 5K36C 2DLKA 4JG4A 4FWDA 2JE6B 1VISA 2VQEI 2UU9I 2DEJA 5K36A 2EPZA 1ZM9A 2JEBA 3QT6A 4USKA 1PVGA 4MU1A 4M1KA 2UXDE 4DR7I 2EPAA 3L7ZA 4B3ME 1KJKA 4GKJE 2EN4A 4OO1C 5L3JA 4L5NC 4U3BA 3F6GA 3GCMA 5JEAC 2MDRA 3T1HE 2BV3A 2BM1A 2EOZA 2M1SA 3VK6A 2EOEA 2FV4B 4R2SA 4RPFA 2BR2A 4OO1A 5FWKA 5JEAA 4DR3I 4JYAE 1X47A 2JXPA 4R1FA 4I3HA 2V2QA 1HNZI 1EKZA 4F6NA 3EQ1A 1WJPA 1XNQE 2JOBA 2I13A 3VYYA 4R2CA 2Z5BA 2V83A 1NHIA 1A1HA 3OTOI 4K0KI 1RR9A 1ZBQA 4LF4E 2EPXA 2HFUA 3F0NA 4DPYA 4JI8E 2NUEA 4DPXA 2GLIA 3IWCA 1X6HA 4USMA 3H4LA 2BBGA 2EOOA 2J65A 4DPWA 1OYRA 2YTOA 3HPSA 3FIGA 4F9BB 2L3JA 5EKWA 1N32E 2ADRA 5BR8E 2ZITA 2EPPA 4JI5I 2CTDA 5KL3A 2DMIA 1UBDC 1USVA 1T4LB 1G2FC 4MU0A 1BBOA 1U2RA 4M2ZA 4KWYA 4MQYA 4JI3I 2RTXA 1XMQI 3V2UC 3K17A 4TUIA 3GLLA 2ENAA 3ZZTA 1WRJA 2O3ZA 2O1UA 3L00A 1Y6ZA 2ODRD 1XMOE 2L3CA 2N3HA 4L8NA 2EN8A 2YTIA 2EMXA 4YHHE 3QT7A 5GMDA 4YY3I 4O5GA 1N36E 1FI4A 2MC5A 4X66E 1ZBTA 4KZSA 1K47A 3ECRA 4J8ZA 2IOPA 5C0XE 2YRMA 3J81C 1R6MA 4KHPI 3KRNA 2WP8A 5A2QC 3BGHA 1N33I 2L2NA 4LU9A 3HULA 2NN6B 1JK2A 1NCSA 3KWRA 3LLHA 5KL2A 2GHFA 3TQMA 4NHRA 2L2KB 1H73A 5K36E 1WHQA 2Q8UA 1D6TA 4R8OA 3B82A 4M30A 2DIXA 2A2CA 3UHMA 2L92A 5DRPA 1NHJA 2K7IA 4DUZI 2UUBE 2RS7A 2J7KA 4JI4E 2GQ0A 4Z7YA 2HKJA 1PKPA 5LL6R 1YUIA 2O1TA 4ZYHA 2L2MA 3EPJA 4LF6E 4GQUA 4OO1E 2LJPA 5KL5A 4HXZA 5JEAE 3M85G 4LPFA 2EOQA 2WW4A 4R2QA 1QNTA 1EH7A 1YZ9A 1XNRI 1N3GA 4LF7I 3P3EA 1X6FA 4P52A 4X64E 1XXEA 4BC7A 2EPLX 2MKDA 1ZXMA 4JI2I 2C39B 1ZAAC 4LFAE 1PDAA 2PO1B 2EMFA 3PYGA 1UDQA 1X3CA 4ISAA 1UDOA 2JWOA 5T6JA 1Z59A 2C38A 3LNUA 4HACA 1ZM2A 4FW9A 3PS3A 4DR2E 4DV0E 3JTZA 2E72A 2NABA 2VE7C 1QU6A 2V85A 4DV4E 4LCHA 2E5LE 4GKKI 1Z5AA 2GPIA 2BA0G 2CSHA 1IBME 3MHSC 3HPZA 1B63A 3EPLA 1X6EA 2EPMX 2EMBA 2JVAA 1UN6B 1J5EE 2A2DA 1HK7A 2GO4A 1ZXNA 3QT5A 1E3HA 2YTFA 1IMUA 1ZM4A 3AV0A 2UXDI 4IZKA 4O4KA 1ZR9A 2EMZA 2KOUA 3IWBA 4DV6E 2AJ4A 5ADZA 5A6BA 3P1XA 1Z5CA 5IT9C 2NN6D 4DV7E 3J7AG 2OI2A 4BA1B 4B3MI 4GKJI 3HXLA 2AE8A 1EH8A 2PNMA 2HC5A 4DV1E 1BKNA 2PNZA 3T1HI 3EPHA 2YWQA 4LTYA 4M0VA 4IFDF 1F2IG 2M4IA 4WX9A 2G7HA 4JYAI 1G2DC 3K85A 3WU3A 2B9DA 2LUQA 2H36X 1AAYA 4DU7A 4IFDD 1MGTA 2EMLA 3HQ1A 4X62E 1JK1A 1XNQI 1X49A 3OMLA 2N8XA 5LMNE 2V89A 5LMUE 4FWGA 3IWDA 3J81Q 2LUPB 4JI0E 4LF4I 1Y4UA 4ZYEA 4BS9A 4URLA 2VQFE 1WUUA 4N3OA 4AQYE 5IXMB 2LJUA 4JI1E 2JP9A 2EPNA 3ADIA 2EJ4A 1H7UA 1UEKA 3JAMQ 2CZ9A 2WP8B 5A2QQ 2Z5EA 1GTKA 4QNJA 3EPKA 3UK3C 1T4OA 2LO3A 4LF8E 2UXCE 5F3WA 1N0VC 1A1GA 1N32I 1EI1A 3PS1A 2M9AA 3V5RA 5BR8I 1HNWE 4WYQB 3J80C 1FNMA 2UUAE 2F4VE 5A6AA 1IQOA 4IFDC 2EPKX 2L33A 5AE1A 2EOJA 2WNRA 4BA2B 4IFDA 2C37B 5DRQA 2YTNA 4OOGC 2WBSA 2EM3A 2IOQA 2NA2A 2LT7A 2JOXA 1FJGE 1A1IA 1HR0E 1XMOI 2J7JA 2CVEA 1EA6A 1Z0GA 4YHHI 2YSPA 3QG5C 3PYEA 1N36I 4FN5A 2EMCA 4X66I 4UTGA 1MG7A 2V88A 3PYDA 1YYOA 2EMKA 2HHHE 2HK3A 4FWHA 4Q28A 2EQ1A 1TF6A 2YT4A 4JI7E 5AC4A 3T1YE 4X65E 2PO0B 4LFBE 1KVKA 5DNYA 4HACB 2M7QA 2RQLA 3MHHC 1FWKA 2XEXA 4BC9A 2JEAA 2EOFA 2EWLA 2EPOA 3CDJA 4DUYE 2MKNA 4JV5E 4HYMA 2UUBI 2LBSB 4JI4I 3GMEA 2K4VA 2EE8A 2UUCE 4IZJB 4Z7CA 4WXCA 1KKHA 1PIEA 2B7VA 4LF6I 5IWAE 2YU5A 4HY1A 4WUDA 4LF9E 1Z0WA 5AE2A 1PJSA 5IT9Q 2EOSA 1VI7A 3AUZA 3J7AM 3JAMC 4X64I 3H1CA 2WBTA 4P78A 4B3RE 4FW3A 4P7AA 4NXNE 1A6FA 2MC6A 2UXBE 4F2JC 2Z5CB 4LFAI 3VYXA 4MU4A 1E3PA 5C0XB 2YRKA 1RREA 3PYFA 2YTJA 2BA1D 2ODRC 4X9JA 3LPSA 2PNLA 2GS8A 2N3GA 1L4SA 1YHCA 2JE6A 2GO3A 4AIMA 2HJJA 4MLQA 1B62A 1BBGA 1DI2A 4DR2I 2NN6E 2CPNA 1MEYC 2ELYA 4DV0I 2EMYA 1B69A 5K36B 4WFTA 2JEBB 4DV4I 2LV2A 3C6MA 1HNXE 2E5LI 1UILA 3M85D 4R2EA 2EFGA 1IBMI 3HJCA 1IBKE 2DRPA 4UT4A 2FTXB 1ELOA 4DV5E 3ADGA 3D4JA 3L7ZB 2EM9A 2R3VA 1J5EI 4WPYA 2YZTA 4IFDE 2ZM6E 3P3CA 4OO1B 3BBGA 3C6KA 1Z0BA 3J80Q 4DV6I 2BR2B 2MDGA 5JEAB 4AIDA 2EM5A 1YUJA 4DV7I 4DV1I 1TN9A 3C4TA 4BCAA 1PJQA 1RHYA 2EPUA 2FGGA 2B3TB 1IBLE 4DR1E 3H09A 4DR6E 4DR4E 2HKEA 2Z5BB 3GONA 2X36A 2YTDA 2VF3A 5IV8B 1YYWA 5FLXQ 2EMAA 1Z5BA 4X62I 4WUBA 1YYKA 3DD6A 3Q6NA 2O1VA 2I9IA 5LMUI 2VRDA 2LCEA 2YU8A 2NN6F 2YPNA 5A69A 5LMNI 2EPCA 5AC5A 4J3DA 1Y4SA 4JI0I 1QZRA 2EN7A 3CDIA 2DB2A 4M9VC 2LVHA 1S4EA 2VQFI 4AQYI 4JI1I 1N34E 2EPRA 1WXRA 2BB8A 1X48A 2RSIA 2JYAA 3LTOA 4LF8I 2X7IA 2UXCI 5GMEA 5A6JA 1RC7A 3ZOQB 2EOIA 4ZYGA 2V8QB 2V2ZA 3P06A 1EH6A 1HNWI 4F9AB 2UUAI 2F4VI 5KL7A 4DR5E 2JEAB 3K6QA 2ENHA 1NHHA 5DNXA 2R76A 2O1WA 4OX9E 2LE2A 2YTGA 2V34A 2YTEA 1KTVA 3ZKDA 4X8WA 2R42A 2V86A 1FJGI 4IJDA 4WSGA 1I94E 4LCFA 4OZEA 3C4BA 1HR0I 4JI6E 1DARA 2NN6C 3KZZA 4GZNC 4DV2E 2EN1A 2NN6A 1H74A 1N0UA 2HHHI 1WHNA 4EMDA 4RHBB 4R2PA 1TF3A 2EQ0A 4WSPA 2R1FA 4JI7I 3T1YI 4X65I 1LLMC 4LFBI 2L6MA 4F6MA 1O0WA 4NZVA 3F6HA 4AM3A 2JR1A 1A1FA 4WXDA 3JU0A 4DU8A 4DUYI 4B3TE 4LFCE 4JV5I 3MSWA 4R2DA 2HGHA 2EMGA 4FK5C 4GEQB 3B4TA 3M6AA 5FLXC 2UUCI 2RPCA 1MU5A 1ZU1A 2EN3A 1T39A 2EOMA 4R2RA 1OYPA 3WU4A 2C39A 2YTPA 3HKMA 5IWAI 2A25A 2V87A 1FWLA 4LF9I 4FW6A 2ELZA 4DV3E 4LF5E 4XTJA 1Z0EA 4R2AA 3PRYA 1OJ4A 4B3SE 2CGEA 2DLQA 2DGCA 2V8PA 4NXME 4LCGA 2Q2EB 3VHTB 5DNLA 5TSEA 4B3RI 4NXNI 2EP3A 4MYTA 2VQEE 2UXBI 2C38B 1RMDA 2UU9E 1UDNA 5EL9A 4ZVIA 1T4NA 4KQVA 4DXLA 3ADLA 2PO2A 4JI8I 1H7SA 2RSMA 4DR7E 3ZM7A 2DMYA 3DJWA 3BIDA 2LJHA 4QNKA 4FW4A 1GZ6A 1AH5A 2LTSA 1HNXI 3PS2A 2EL6A 2WBUA 1P42A 4BA1A 4DR3E 3K1JA 4IS1C 2BA1G 1P47A 4IZKB 1IBKI 4DV5I 4Q35B 1Z0TA 2DEIA 1HNZE 3QT8A 3LMLA 4MDTA 2EN6A 3ADJA 3B78A 1GQEA 2PNZB 3KZYA 2NUGA 2ZM6I 3NZKA 4BMJA 3M7NG 2VESA 3OTOE 4K0KE 2EM4A 2YRHA 4NBQA 5AE3A 2ZBKB
chains in the Genus database with same CATH topology
3WU5A 1IBLI 4DR1I 2IHR1 3ZZ0A 4DR6I 4DR4I 4TUGA 1NZ0A 4MYUA 4JI5E 2KHXA 2HFSA 4DPUA 1RQ0A 4JI3E 1XMQE 1STUA 1N34I 1Z0CA 2HK2A 4F54A 4PRVA 3ZZUA 1Z0VA 2JY9A 4YY3E 4DMIA 2VF1A 4R03A 1XHKA 4DR5I 4P7DA 4IZJD 5CFFE 2DSYA 4KHPE 2LMZA 3HTXA 3CWVA 1SR9A 1DQ3A 2LRSA 2BM0A 4OX9I 2NUFA 1S16A 1J26A 1N33E 1ZM3A 2F8BA 1I94I 5AASA 1USUA 3DF6A 4F9CB 2CG9A 4JI6I 4DV2I 4ED4A 1MX0A 4WUCA 4DUZE 2NPFA 3ZKBA 4PRXA 1KIJA 2WZOA 1FKAE 3B8HA 3J7Yp 3Q6MA 2RS6A 4IZJA 2LTRA 1XNRE 4LF7E 4I8OA 2KONA 2V2VA 4B3TI 4LFCI 4JI2E 3RMPA 4DPTA 2L8TA 4PU9A 2E1RA 2E1MA 2Z5CA 3WU6A 1UHZA 4BBYA 2B7TA 4DV3I 4LF5I 2EZ6A 4B3SI 4DKKA 3Q1QA 1H72C 4NXMI 4GKKE 4JG4A 4FWDA 2VQEI 1VISA 2UU9I 2DEJA 1ZM9A 3QT6A 4USKA 1PVGA 4M1KA 2UXDE 4DR7I 4B3ME 4GKJE 5L3JA 4L5NC 3F6GA 2MDRA 3T1HE 2BV3A 2BM1A 3VK6A 2M1SA 2FV4B 5FWKA 4RPFA 4DR3I 4JYAE 1X47A 4R1FA 4I3HA 2V2QA 1HNZI 1EKZA 1XNQE 2JOBA 3VYYA 2Z5BA 2V83A 1NHIA 3OTOI 4K0KI 1RR9A 1ZBQA 4LF4E 2HFUA 3F0NA 4DPYA 4JI8E 2NUEA 4DPXA 3IWCA 4USMA 3H4LA 4DPWA 3HPSA 3FIGA 4F9BB 2L3JA 1N32E 5BR8E 2ZITA 4JI5I 1USVA 1T4LB 1U2RA 4M2ZA 4JI3I 2RTXA 1XMQI 3V2UC 3K17A 4TUIA 3ZZTA 2O1UA 1Y6ZA 2ODRD 1XMOE 2L3CA 2N3HA 4L8NA 3QT7A 5GMDA 4YHHE 4YY3I 1N36E 1FI4A 2MC5A 4X66E 1ZBTA 4KZSA 1K47A 4J8ZA 2IOPA 3J81C 4KHPI 5A2QC 1N33I 2L2NA 4LU9A 3HULA 3KWRA 3LLHA 2L2KB 1H73A 1WHQA 4R8OA 3B82A 4M30A 2DIXA 2A2CA 2L92A 1NHJA 4DUZI 2UUBE 2RS7A 2J7KA 4JI4E 2GQ0A 4Z7YA 2HKJA 1PKPA 5LL6R 2O1TA 2L2MA 4LF6E 2LJPA 4HXZA 2WW4A 1YZ9A 1XNRI 4LF7I 4P52A 4X64E 4BC7A 1ZXMA 4JI2I 4LFAE 3PYGA 4HACA 2JWOA 5T6JA 1Z59A 3LNUA 1ZM2A 4FW9A 4DR2E 4DV0E 3JTZA 2VE7C 1QU6A 2V85A 4DV4E 2E5LE 4GKKI 1Z5AA 1IBME 3HPZA 1B63A 2JVAA 3QT5A 1J5EE 2A2DA 1HK7A 1ZXNA 2UXDI 1ZM4A 3AV0A 4IZKA 3IWBA 2KOUA 4DV6E 2AJ4A 1D6TA 5ADZA 4B3MI 3P1XA 1Z5CA 5IT9C 4GKJI 4DV7E 3J7AG 2OI2A 3HXLA 2PNMA 4DV1E 1BKNA 3T1HI 4LTYA 4M0VA 2M4IA 4JYAI 2G7HA 3K85A 3WU3A 2B9DA 2LUQA 2H36X 4DU7A 3HQ1A 4X62E 1XNQI 1X49A 3OMLA 5LMUE 5LMNE 2V89A 4FWGA 3IWDA 3J81Q 2LUPB 4JI0E 4LF4I 1Y4UA 4URLA 4BS9A 2VQFE 1WUUA 4N3OA 4AQYE 1H7UA 4JI8I 4JI1E 3ADIA 4DXLA 3JAMQ 5A2QQ 1UEKA 2CZ9A 2Z5EA 1T4OA 4LF8E 2UXCE 5F3WA 1N0VC 1N32I 1EI1A 3V5RA 5BR8I 1HNWE 4WYQB 3J80C 1FNMA 2UUAE 2F4VE 2L33A 5AE1A 4OOGC 2IOQA 2NA2A 2JOXA 1FJGE 1HR0E 1XMOI 1EA6A 1Z0GA 4YHHI 3PYEA 1N36I 4FN5A 4X66I 4UTGA 1MG7A 2V88A 3PYDA 1YYOA 2HHHE 2HK3A 4FWHA 4Q28A 2YT4A 4JI7E 3T1YE 4X65E 4LFBE 1KVKA 5DNYA 4HACB 2M7QA 1FWKA 2XEXA 4BC9A 2EWLA 4DUYE 4JV5E 4HYMA 2UUBI 2LBSB 4JI4I 4IZJB 2K4VA 2UUCE 4Z7CA 1KKHA 1PIEA 2B7VA 4LF6I 5IWAE 4HY1A 4WUDA 4LF9E 1Z0WA 5AE2A 5IT9Q 3AUZA 3J7AM 3JAMC 4X64I 4P78A 4B3RE 4P7AA 4NXNE 1A6FA 2MC6A 2UXBE 2Z5CB 4LFAI 3VYXA 1RREA 3PYFA 2ODRC 3LPSA 2PNLA 2GS8A 2N3GA 1B62A 1DI2A 4DR2I 2CPNA 4DV0I 4WFTA 4DV4I 1HNXE 2E5LI 1UILA 1IBMI 2EFGA 3HJCA 1IBKE 4UT4A 2FTXB 1ELOA 4DV5E 3ADGA 3D4JA 2R3VA 1J5EI 4WPYA 2YZTA 2ZM6E 3J80Q 1Z0BA 4DV6I 4DV7I 4DV1I 3C4TA 4BCAA 2FGGA 2B3TB 1IBLE 4DR1E 3H09A 4DR6E 4DR4E 2HKEA 2Z5BB 3GONA 2X36A 2VF3A 1YYWA 5FLXQ 1Z5BA 4X62I 4WUBA 1YYKA 3Q6NA 2O1VA 5LMUI 5LMNI 1Y4SA 4JI0I 1QZRA 2DB2A 1S4EA 2VQFI 4AQYI 4JI1I 1N34E 1WXRA 1X48A 3LTOA 4LF8I 2X7IA 2UXCI 5GMEA 1RC7A 3ZOQB 2V8QB 2V2ZA 3P06A 1HNWI 4F9AB 2UUAI 2F4VI 4DR5E 3K6QA 1NHHA 2O1WA 4OX9E 2LE2A 2V34A 1KTVA 3ZKDA 4X8WA 2R42A 2V86A 1FJGI 1I94E 3C4BA 1HR0I 4JI6E 1DARA 4DV2E 1H74A 1N0UA 2HHHI 1WHNA 4EMDA 4WSPA 4JI7I 3T1YI 4X65I 4LFBI 2L6MA 1O0WA 3F6HA 2JR1A 3JU0A 4DU8A 4DUYI 4B3TE 4LFCE 4JV5I 3MSWA 4GEQB 3M6AA 5FLXC 2UUCI 1MU5A 3WU4A 5IWAI 1FWLA 2V87A 4LF9I 4DV3E 4LF5E 4XTJA 1Z0EA 3PRYA 1OJ4A 4B3SE 2CGEA 2V8PA 4NXME 2Q2EB 4B3RI 4NXNI 4MYTA 2VQEE 2UXBI 2UU9E 4ZVIA 1T4NA 4KQVA 3ADLA 1H7SA 2RSMA 4DR7E 3ZM7A 2DMYA 3DJWA 2LJHA 1GZ6A 2LTSA 1HNXI 4DR3E 3K1JA 4IZKB 1IBKI 4DV5I 1Z0TA 2DEIA 1HNZE 3QT8A 3LMLA 3ADJA 3B78A 2ZM6I 1GQEA 2NUGA 4BMJA 3OTOE 4K0KE 5AE3A 2ZBKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU5 A;  1IBL I;  4DR1 I;  2IHR 1;  3ZZ0 A;  4DR6 I;  4DR4 I;  1NZ0 A;  4MYU A;  4JI5 E;  2KHX A;  2HFS A;  4DPU A;  1RQ0 A;  4JI3 E;  1XMQ E;  1STU A;  1N34 I;  1Z0C A;  2HK2 A;  4PRV A;  3ZZU A;  1Z0V A;  2JY9 A;  4YY3 E;  1XHK A;  4DR5 I;  5CFF E;  4KHP E;  3HTX A;  3CWV A;  2LRS A;  2BM0 A;  4OX9 I;  2NUF A;  1S16 A;  1J26 A;  1N33 E;  1ZM3 A;  1I94 I;  4JI6 I;  4DV2 I;  4ED4 A;  1MX0 A;  4WUC A;  4DUZ E;  2NPF A;  3ZKB A;  4PRX A;  1KIJ A;  1FKA E;  3B8H A;  3J7Y p;  2RS6 A;  2LTR A;  1XNR E;  4LF7 E;  2V2V A;  4B3T I;  4LFC I;  4JI2 E;  4DPT A;  4PU9 A;  2E1R A;  3WU6 A;  1UHZ A;  2B7T A;  4DV3 I;  4LF5 I;  2EZ6 A;  4B3S I;  4DKK A;  3Q1Q A;  1H72 C;  4NXM I;  4GKK E;  4JG4 A;  4FWD A;  2VQE I;  1VIS A;  2UU9 I;  2DEJ A;  1ZM9 A;  3QT6 A;  4USK A;  1PVG A;  4M1K A;  2UXD E;  4DR7 I;  4B3M E;  4GKJ E;  5L3J A;  2MDR A;  3T1H E;  2BV3 A;  2BM1 A;  4RPF A;  4DR3 I;  4JYA E;  1X47 A;  4R1F A;  4I3H A;  2V2Q A;  1HNZ I;  1EKZ A;  1XNQ E;  3VYY A;  1NHI A;  3OTO I;  4K0K I;  1RR9 A;  4LF4 E;  2HFU A;  3F0N A;  4DPY A;  4JI8 E;  2NUE A;  4DPX A;  4USM A;  3H4L A;  4DPW A;  2L3J A;  1N32 E;  5BR8 E;  2ZIT A;  4JI5 I;  1T4L B;  1U2R A;  4M2Z A;  4JI3 I;  2RTX A;  1XMQ I;  3V2U C;  3K17 A;  3ZZT A;  1XMO E;  2L3C A;  2N3H A;  3QT7 A;  5GMD A;  4YHH E;  4YY3 I;  1N36 E;  1FI4 A;  4X66 E;  1K47 A;  1ZBT A;  3J81 C;  4KHP I;  5A2Q C;  1N33 I;  2L2N A;  3HUL A;  2L2K B;  3LLH A;  1H73 A;  1WHQ A;  3B82 A;  4M30 A;  2DIX A;  2A2C A;  1NHJ A;  4DUZ I;  2UUB E;  2RS7 A;  2J7K A;  4JI4 E;  4Z7Y A;  2HKJ A;  1PKP A;  5LL6 R;  2L2M A;  4LF6 E;  2LJP A;  4HXZ A;  2WW4 A;  1YZ9 A;  1XNR I;  4LF7 I;  4P52 A;  4X64 E;  1ZXM A;  4JI2 I;  4LFA E;  3PYG A;  4HAC A;  1Z59 A;  3LNU A;  1ZM2 A;  4FW9 A;  4DR2 E;  4DV0 E;  1QU6 A;  4DV4 E;  2E5L E;  4GKK I;  1Z5A A;  1IBM E;  1B63 A;  2JVA A;  3QT5 A;  1J5E E;  2A2D A;  1ZXN A;  2UXD I;  1ZM4 A;  1D6T A;  4DV6 E;  2AJ4 A;  4B3M I;  3P1X A;  1Z5C A;  5IT9 C;  4GKJ I;  4DV7 E;  2OI2 A;  3J7A G;  4DV1 E;  1BKN A;  3T1H I;  4JYA I;  3WU3 A;  4DU7 A;  2LUQ A;  4X62 E;  1XNQ I;  1X49 A;  5LMU E;  5LMN E;  4FWG A;  3J81 Q;  2LUP B;  4JI0 E;  4LF4 I;  4URL A;  2VQF E;  1WUU A;  4DXL A;  4AQY E;  1H7U A;  4JI8 I;  4JI1 E;  3ADI A;  3JAM Q;  5A2Q Q;  1UEK A;  2CZ9 A;  1T4O A;  4LF8 E;  2UXC E;  1N0V C;  1N32 I;  1EI1 A;  3V5R A;  5BR8 I;  1HNW E;  4WYQ B;  1FNM A;  3J80 C;  2UUA E;  2F4V E;  2L33 A;  4OOG C;  2NA2 A;  1FJG E;  1HR0 E;  1XMO I;  1EA6 A;  1Z0G A;  4YHH I;  3PYE A;  1N36 I;  4FN5 A;  4X66 I;  4UTG A;  1MG7 A;  3PYD A;  1YYO A;  2HHH E;  2HK3 A;  4FWH A;  2YT4 A;  4JI7 E;  3T1Y E;  4X65 E;  4LFB E;  1KVK A;  4HAC B;  1FWK A;  2XEX A;  4DUY E;  4JV5 E;  4HYM A;  2UUB I;  2LBS B;  4JI4 I;  2UUC E;  4Z7C A;  1KKH A;  1PIE A;  2B7V A;  4LF6 I;  5IWA E;  4HY1 A;  4WUD A;  4LF9 E;  1Z0W A;  5IT9 Q;  3J7A M;  3JAM C;  4X64 I;  4P7A A;  4B3R E;  4NXN E;  1A6F A;  2UXB E;  4LFA I;  3VYX A;  1RRE A;  3PYF A;  3LPS A;  2GS8 A;  2N3G A;  1B62 A;  1DI2 A;  4DR2 I;  2CPN A;  4DV0 I;  4WFT A;  4DV4 I;  1HNX E;  2E5L I;  1UIL A;  1IBM I;  2EFG A;  1IBK E;  4UT4 A;  1ELO A;  4DV5 E;  3ADG A;  3D4J A;  2R3V A;  1J5E I;  2ZM6 E;  3J80 Q;  1Z0B A;  4DV6 I;  4DV7 I;  4DV1 I;  3C4T A;  2B3T B;  1IBL E;  4DR1 E;  4DR6 E;  4DR4 E;  2HKE A;  3GON A;  2X36 A;  2VF3 A;  1YYW A;  5FLX Q;  1Z5B A;  4X62 I;  4WUB A;  1YYK A;  5LMU I;  5LMN I;  4JI0 I;  1QZR A;  2DB2 A;  1S4E A;  2VQF I;  4AQY I;  4JI1 I;  1N34 E;  1X48 A;  3LTO A;  4LF8 I;  2X7I A;  2UXC I;  5GME A;  1RC7 A;  2V2Z A;  1HNW I;  2UUA I;  2F4V I;  4DR5 E;  1NHH A;  4OX9 E;  2V34 A;  1KTV A;  3ZKD A;  4X8W A;  2R42 A;  1FJG I;  1I94 E;  3C4B A;  1HR0 I;  4JI6 E;  1DAR A;  4DV2 E;  1H74 A;  1N0U A;  2HHH I;  1WHN A;  4EMD A;  4JI7 I;  3T1Y I;  4X65 I;  4LFB I;  1O0W A;  4DU8 A;  4DUY I;  4B3T E;  4LFC E;  4JV5 I;  3M6A A;  5FLX C;  2UUC I;  1MU5 A;  3WU4 A;  5IWA I;  1FWL A;  4LF9 I;  4DV3 E;  4LF5 E;  4XTJ A;  1Z0E A;  1OJ4 A;  4B3S E;  2V8P A;  4NXM E;  2Q2E B;  4B3R I;  4NXN I;  4MYT A;  2VQE E;  2UXB I;  2UU9 E;  4ZVI A;  1T4N A;  4KQV A;  3ADL A;  1H7S A;  2RSM A;  4DR7 E;  3ZM7 A;  2DMY A;  2LJH A;  2LTS A;  1HNX I;  4DR3 E;  3K1J A;  1IBK I;  4DV5 I;  1Z0T A;  2DEI A;  1HNZ E;  3QT8 A;  3ADJ A;  3B78 A;  2ZM6 I;  1GQE A;  2NUG A;  3OTO E;  4K0K E;  2ZBK B; 
#chains in the Genus database with same CATH topology
 2EQ3 A;  2IER A;  3WU5 A;  2EMI A;  4HEI A;  1IBL I;  1UDS A;  4DR1 I;  2IHR 1;  3ZZ0 A;  3M99 B;  1SFE A;  4DR4 I;  4DR6 I;  1BB8 A;  4RH8 A;  1Z1B A;  4TUG A;  3M7N D;  1NZ0 A;  2PO1 A;  2IES A;  4HTG A;  2CT1 A;  1YSA C;  5KL4 A;  2EM8 A;  4MYU A;  4JI5 E;  2KHX A;  2HFS A;  5ELW A;  4DPU A;  2ENC A;  1RQ0 A;  2EMH A;  4O43 A;  2EM6 A;  1STU A;  1XMQ E;  4JI3 E;  1Y5Y A;  1N34 I;  1Y60 A;  1Z0C A;  1YPN A;  2EMW A;  3P3G A;  4BA2 A;  4O24 A;  4F54 A;  2HK2 A;  1KYQ A;  4PRV A;  3ZZU A;  5A6K A;  2WNR B;  2C37 A;  1Z0V A;  2JY9 A;  4YY3 E;  4DMI A;  1OYS A;  4IFD B;  1PJT A;  2JPA A;  2VF1 A;  4R03 A;  1XHK A;  4DR5 I;  3THO B;  4P7D A;  4IZJ D;  4LOM A;  3U1Y A;  1NEI A;  1DGC A;  5CFF E;  2DSY A;  4KHP E;  2LMZ A;  3HTX A;  3CWV A;  1SR9 A;  3P76 A;  1DQ3 A;  1YFH A;  2LRS A;  1IQS A;  2WCC 3;  2BM0 A;  1YH8 A;  4OX9 I;  2NUF A;  1S16 A;  1J26 A;  1N33 E;  4IS9 A;  4FW5 A;  4MLV A;  3THN A;  1ZM3 A;  2F8B A;  2EOY A;  1I94 I;  5AAS A;  5A6B D;  1USU A;  3DF6 A;  4F9C B;  2CG9 A;  5C0X F;  4JI6 I;  4DV2 I;  2PO0 A;  4ED4 A;  2EOR A;  1MX0 A;  4WUC A;  1R6L A;  2EM0 A;  2JT2 A;  2EL4 A;  4DUZ E;  2NPF A;  3ZKB A;  5C0X D;  2EM7 A;  5K36 F;  4PRX A;  2YSO A;  1KIJ A;  2WZO A;  2PRT A;  1FKA E;  5LLQ A;  3B8H A;  3J7Y p;  3U1K A;  3Q6M A;  2PO2 B;  4FW7 A;  2RS6 A;  4IZJ A;  4U3D A;  5K36 D;  2LTR A;  5KL6 A;  1XNR E;  4LF7 E;  2F1D A;  4I8O A;  2KON A;  1A1J A;  2V2V A;  4OKG A;  4B3T I;  4N4R B;  4LFC I;  4OO1 F;  2D9H A;  4JI2 E;  3RMP A;  5JEA F;  4DPT A;  2EOX A;  2EM2 A;  2L8T A;  2YTQ A;  2BA0 D;  1T38 A;  4PU9 A;  5DRR A;  1A1L A;  1X5W A;  5C0X C;  4OO1 D;  4ZYD A;  2E1R A;  2E1M A;  2Z5C A;  4MU3 A;  5JEA D;  3WU6 A;  1UHZ A;  4BHC A;  2B7T A;  4BBY A;  4DV3 I;  4LF5 I;  5C0X A;  2EZ6 A;  2EOH A;  4B3S I;  4BHB A;  4DKK A;  3BF2 A;  2EL5 A;  5DRO A;  2EN2 A;  3Q1Q A;  1H72 C;  4NXM I;  1A1K A;  4GKK E;  5K36 C;  2DLK A;  4JG4 A;  4FWD A;  2JE6 B;  1VIS A;  2VQE I;  2UU9 I;  2DEJ A;  5K36 A;  2EPZ A;  1ZM9 A;  2JEB A;  3QT6 A;  4USK A;  1PVG A;  4MU1 A;  4M1K A;  2UXD E;  4DR7 I;  2EPA A;  3L7Z A;  4B3M E;  1KJK A;  4GKJ E;  2EN4 A;  4OO1 C;  5L3J A;  4L5N C;  4U3B A;  3F6G A;  3GCM A;  5JEA C;  2MDR A;  3T1H E;  2BV3 A;  2BM1 A;  2EOZ A;  2M1S A;  3VK6 A;  2EOE A;  2FV4 B;  4R2S A;  4RPF A;  2BR2 A;  4OO1 A;  5FWK A;  5JEA A;  4DR3 I;  4JYA E;  1X47 A;  2JXP A;  4R1F A;  4I3H A;  2V2Q A;  1HNZ I;  1EKZ A;  4F6N A;  3EQ1 A;  1WJP A;  1XNQ E;  2JOB A;  2I13 A;  3VYY A;  4R2C A;  2Z5B A;  2V83 A;  1NHI A;  1A1H A;  3OTO I;  4K0K I;  1RR9 A;  1ZBQ A;  4LF4 E;  2EPX A;  2HFU A;  3F0N A;  4DPY A;  4JI8 E;  2NUE A;  4DPX A;  2GLI A;  3IWC A;  1X6H A;  4USM A;  3H4L A;  2BBG A;  2EOO A;  2J65 A;  4DPW A;  1OYR A;  2YTO A;  3HPS A;  3FIG A;  4F9B B;  2L3J A;  5EKW A;  1N32 E;  2ADR A;  5BR8 E;  2ZIT A;  2EPP A;  4JI5 I;  2CTD A;  5KL3 A;  2DMI A;  1UBD C;  1USV A;  1T4L B;  1G2F C;  4MU0 A;  1BBO A;  1U2R A;  4M2Z A;  4KWY A;  4MQY A;  4JI3 I;  2RTX A;  1XMQ I;  3V2U C;  3K17 A;  4TUI A;  3GLL A;  2ENA A;  3ZZT A;  1WRJ A;  2O3Z A;  2O1U A;  3L00 A;  1Y6Z A;  2ODR D;  1XMO E;  2L3C A;  2N3H A;  4L8N A;  2EN8 A;  2YTI A;  2EMX A;  4YHH E;  3QT7 A;  5GMD A;  4YY3 I;  4O5G A;  1N36 E;  1FI4 A;  2MC5 A;  4X66 E;  1ZBT A;  4KZS A;  1K47 A;  3ECR A;  4J8Z A;  2IOP A;  5C0X E;  2YRM A;  3J81 C;  1R6M A;  4KHP I;  3KRN A;  2WP8 A;  5A2Q C;  3BGH A;  1N33 I;  2L2N A;  4LU9 A;  3HUL A;  2NN6 B;  1JK2 A;  1NCS A;  3KWR A;  3LLH A;  5KL2 A;  2GHF A;  3TQM A;  4NHR A;  2L2K B;  1H73 A;  5K36 E;  1WHQ A;  2Q8U A;  1D6T A;  4R8O A;  3B82 A;  4M30 A;  2DIX A;  2A2C A;  3UHM A;  2L92 A;  5DRP A;  1NHJ A;  2K7I A;  4DUZ I;  2UUB E;  2RS7 A;  2J7K A;  4JI4 E;  2GQ0 A;  4Z7Y A;  2HKJ A;  1PKP A;  5LL6 R;  1YUI A;  2O1T A;  4ZYH A;  2L2M A;  3EPJ A;  4LF6 E;  4GQU A;  4OO1 E;  2LJP A;  5KL5 A;  4HXZ A;  5JEA E;  3M85 G;  4LPF A;  2EOQ A;  2WW4 A;  4R2Q A;  1QNT A;  1EH7 A;  1YZ9 A;  1XNR I;  1N3G A;  4LF7 I;  3P3E A;  1X6F A;  4P52 A;  4X64 E;  1XXE A;  4BC7 A;  2EPL X;  2MKD A;  1ZXM A;  4JI2 I;  2C39 B;  1ZAA C;  4LFA E;  1PDA A;  2PO1 B;  2EMF A;  3PYG A;  1UDQ A;  1X3C A;  4ISA A;  1UDO A;  2JWO A;  5T6J A;  1Z59 A;  2C38 A;  3LNU A;  4HAC A;  1ZM2 A;  4FW9 A;  3PS3 A;  4DR2 E;  4DV0 E;  3JTZ A;  2E72 A;  2NAB A;  2VE7 C;  1QU6 A;  2V85 A;  4DV4 E;  4LCH A;  2E5L E;  4GKK I;  1Z5A A;  2GPI A;  2BA0 G;  2CSH A;  1IBM E;  3MHS C;  3HPZ A;  1B63 A;  3EPL A;  1X6E A;  2EPM X;  2EMB A;  2JVA A;  1UN6 B;  1J5E E;  2A2D A;  1HK7 A;  2GO4 A;  1ZXN A;  3QT5 A;  1E3H A;  2YTF A;  1IMU A;  1ZM4 A;  3AV0 A;  2UXD I;  4IZK A;  4O4K A;  1ZR9 A;  2EMZ A;  2KOU A;  3IWB A;  4DV6 E;  2AJ4 A;  5ADZ A;  5A6B A;  3P1X A;  1Z5C A;  5IT9 C;  2NN6 D;  4DV7 E;  3J7A G;  2OI2 A;  4BA1 B;  4B3M I;  4GKJ I;  3HXL A;  2AE8 A;  1EH8 A;  2PNM A;  2HC5 A;  4DV1 E;  1BKN A;  2PNZ A;  3T1H I;  3EPH A;  2YWQ A;  4LTY A;  4M0V A;  4IFD F;  1F2I G;  2M4I A;  4WX9 A;  2G7H A;  4JYA I;  1G2D C;  3K85 A;  3WU3 A;  2B9D A;  2LUQ A;  2H36 X;  1AAY A;  4DU7 A;  4IFD D;  1MGT A;  2EML A;  3HQ1 A;  4X62 E;  1JK1 A;  1XNQ I;  1X49 A;  3OML A;  2N8X A;  5LMN E;  2V89 A;  5LMU E;  4FWG A;  3IWD A;  3J81 Q;  2LUP B;  4JI0 E;  4LF4 I;  1Y4U A;  4ZYE A;  4BS9 A;  4URL A;  2VQF E;  1WUU A;  4N3O A;  4AQY E;  5IXM B;  2LJU A;  4JI1 E;  2JP9 A;  2EPN A;  3ADI A;  2EJ4 A;  1H7U A;  1UEK A;  3JAM Q;  2CZ9 A;  2WP8 B;  5A2Q Q;  2Z5E A;  1GTK A;  4QNJ A;  3EPK A;  3UK3 C;  1T4O A;  2LO3 A;  4LF8 E;  2UXC E;  5F3W A;  1N0V C;  1A1G A;  1N32 I;  1EI1 A;  3PS1 A;  2M9A A;  3V5R A;  5BR8 I;  1HNW E;  4WYQ B;  3J80 C;  1FNM A;  2UUA E;  2F4V E;  5A6A A;  1IQO A;  4IFD C;  2EPK X;  2L33 A;  5AE1 A;  2EOJ A;  2WNR A;  4BA2 B;  4IFD A;  2C37 B;  5DRQ A;  2YTN A;  4OOG C;  2WBS A;  2EM3 A;  2IOQ A;  2NA2 A;  2LT7 A;  2JOX A;  1FJG E;  1A1I A;  1HR0 E;  1XMO I;  2J7J A;  2CVE A;  1EA6 A;  1Z0G A;  4YHH I;  2YSP A;  3QG5 C;  3PYE A;  1N36 I;  4FN5 A;  2EMC A;  4X66 I;  4UTG A;  1MG7 A;  2V88 A;  3PYD A;  1YYO A;  2EMK A;  2HHH E;  2HK3 A;  4FWH A;  4Q28 A;  2EQ1 A;  1TF6 A;  2YT4 A;  4JI7 E;  5AC4 A;  3T1Y E;  4X65 E;  2PO0 B;  4LFB E;  1KVK A;  5DNY A;  4HAC B;  2M7Q A;  2RQL A;  3MHH C;  1FWK A;  2XEX A;  4BC9 A;  2JEA A;  2EOF A;  2EWL A;  2EPO A;  3CDJ A;  4DUY E;  2MKN A;  4JV5 E;  4HYM A;  2UUB I;  2LBS B;  4JI4 I;  3GME A;  2K4V A;  2EE8 A;  2UUC E;  4IZJ B;  4Z7C A;  4WXC A;  1KKH A;  1PIE A;  2B7V A;  4LF6 I;  5IWA E;  2YU5 A;  4HY1 A;  4WUD A;  4LF9 E;  1Z0W A;  5AE2 A;  1PJS A;  5IT9 Q;  2EOS A;  1VI7 A;  3AUZ A;  3J7A M;  3JAM C;  4X64 I;  3H1C A;  2WBT A;  4P78 A;  4B3R E;  4FW3 A;  4P7A A;  4NXN E;  1A6F A;  2MC6 A;  2UXB E;  4F2J C;  2Z5C B;  4LFA I;  3VYX A;  4MU4 A;  1E3P A;  5C0X B;  2YRK A;  1RRE A;  3PYF A;  2YTJ A;  2BA1 D;  2ODR C;  4X9J A;  3LPS A;  2PNL A;  2GS8 A;  2N3G A;  1L4S A;  1YHC A;  2JE6 A;  2GO3 A;  4AIM A;  2HJJ A;  4MLQ A;  1B62 A;  1BBG A;  1DI2 A;  4DR2 I;  2NN6 E;  2CPN A;  1MEY C;  2ELY A;  4DV0 I;  2EMY A;  1B69 A;  5K36 B;  4WFT A;  2JEB B;  4DV4 I;  2LV2 A;  3C6M A;  1HNX E;  2E5L I;  1UIL A;  3M85 D;  4R2E A;  2EFG A;  1IBM I;  3HJC A;  1IBK E;  2DRP A;  4UT4 A;  2FTX B;  1ELO A;  4DV5 E;  3ADG A;  3D4J A;  3L7Z B;  2EM9 A;  2R3V A;  1J5E I;  4WPY A;  2YZT A;  4IFD E;  2ZM6 E;  3P3C A;  4OO1 B;  3BBG A;  3C6K A;  1Z0B A;  3J80 Q;  4DV6 I;  2BR2 B;  2MDG A;  5JEA B;  4AID A;  2EM5 A;  1YUJ A;  4DV7 I;  4DV1 I;  1TN9 A;  3C4T A;  4BCA A;  1PJQ A;  1RHY A;  2EPU A;  2FGG A;  2B3T B;  1IBL E;  4DR1 E;  3H09 A;  4DR6 E;  4DR4 E;  2HKE A;  2Z5B B;  3GON A;  2X36 A;  2YTD A;  2VF3 A;  5IV8 B;  1YYW A;  5FLX Q;  2EMA A;  1Z5B A;  4X62 I;  4WUB A;  1YYK A;  3DD6 A;  3Q6N A;  2O1V A;  2I9I A;  5LMU I;  2VRD A;  2LCE A;  2YU8 A;  2NN6 F;  2YPN A;  5A69 A;  5LMN I;  2EPC A;  5AC5 A;  4J3D A;  1Y4S A;  4JI0 I;  1QZR A;  2EN7 A;  3CDI A;  2DB2 A;  4M9V C;  2LVH A;  1S4E A;  2VQF I;  4AQY I;  4JI1 I;  1N34 E;  2EPR A;  1WXR A;  2BB8 A;  1X48 A;  2RSI A;  2JYA A;  3LTO A;  4LF8 I;  2X7I A;  2UXC I;  5GME A;  5A6J A;  1RC7 A;  3ZOQ B;  2EOI A;  4ZYG A;  2V8Q B;  2V2Z A;  3P06 A;  1EH6 A;  1HNW I;  4F9A B;  2UUA I;  2F4V I;  5KL7 A;  4DR5 E;  2JEA B;  3K6Q A;  2ENH A;  1NHH A;  5DNX A;  2R76 A;  2O1W A;  4OX9 E;  2LE2 A;  2YTG A;  2V34 A;  2YTE A;  1KTV A;  3ZKD A;  4X8W A;  2R42 A;  2V86 A;  1FJG I;  4IJD A;  4WSG A;  1I94 E;  4LCF A;  4OZE A;  3C4B A;  1HR0 I;  4JI6 E;  1DAR A;  2NN6 C;  3KZZ A;  4GZN C;  4DV2 E;  2EN1 A;  2NN6 A;  1H74 A;  1N0U A;  2HHH I;  1WHN A;  4EMD A;  4RHB B;  4R2P A;  1TF3 A;  2EQ0 A;  4WSP A;  2R1F A;  4JI7 I;  3T1Y I;  4X65 I;  1LLM C;  4LFB I;  2L6M A;  4F6M A;  1O0W A;  4NZV A;  3F6H A;  4AM3 A;  2JR1 A;  1A1F A;  4WXD A;  3JU0 A;  4DU8 A;  4DUY I;  4B3T E;  4LFC E;  4JV5 I;  3MSW A;  4R2D A;  2HGH A;  2EMG A;  4FK5 C;  4GEQ B;  3B4T A;  3M6A A;  5FLX C;  2UUC I;  2RPC A;  1MU5 A;  1ZU1 A;  2EN3 A;  1T39 A;  2EOM A;  4R2R A;  1OYP A;  3WU4 A;  2C39 A;  2YTP A;  3HKM A;  5IWA I;  2A25 A;  2V87 A;  1FWL A;  4LF9 I;  4FW6 A;  2ELZ A;  4DV3 E;  4LF5 E;  4XTJ A;  1Z0E A;  4R2A A;  3PRY A;  1OJ4 A;  4B3S E;  2CGE A;  2DLQ A;  2DGC A;  2V8P A;  4NXM E;  4LCG A;  2Q2E B;  3VHT B;  5DNL A;  5TSE A;  4B3R I;  4NXN I;  2EP3 A;  4MYT A;  2VQE E;  2UXB I;  2C38 B;  1RMD A;  2UU9 E;  1UDN A;  5EL9 A;  4ZVI A;  1T4N A;  4KQV A;  4DXL A;  3ADL A;  2PO2 A;  4JI8 I;  1H7S A;  2RSM A;  4DR7 E;  3ZM7 A;  2DMY A;  3DJW A;  3BID A;  2LJH A;  4QNK A;  4FW4 A;  1GZ6 A;  1AH5 A;  2LTS A;  1HNX I;  3PS2 A;  2EL6 A;  2WBU A;  1P42 A;  4BA1 A;  4DR3 E;  3K1J A;  4IS1 C;  2BA1 G;  1P47 A;  4IZK B;  1IBK I;  4DV5 I;  4Q35 B;  1Z0T A;  2DEI A;  1HNZ E;  3QT8 A;  3LML A;  4MDT A;  2EN6 A;  3ADJ A;  3B78 A;  1GQE A;  2PNZ B;  3KZY A;  2NUG A;  2ZM6 I;  3NZK A;  4BMJ A;  3M7N G;  2VES A;  3OTO E;  4K0K E;  2EM4 A;  2YRH A;  4NBQ A;  5AE3 A;  2ZBK B; 
#chains in the Genus database with same CATH homology
 3WU5 A;  1IBL I;  4DR1 I;  2IHR 1;  3ZZ0 A;  4DR6 I;  4DR4 I;  4TUG A;  1NZ0 A;  4MYU A;  4JI5 E;  2KHX A;  2HFS A;  4DPU A;  1RQ0 A;  4JI3 E;  1XMQ E;  1STU A;  1N34 I;  1Z0C A;  2HK2 A;  4F54 A;  4PRV A;  3ZZU A;  1Z0V A;  2JY9 A;  4YY3 E;  4DMI A;  2VF1 A;  4R03 A;  1XHK A;  4DR5 I;  4P7D A;  4IZJ D;  5CFF E;  2DSY A;  4KHP E;  2LMZ A;  3HTX A;  3CWV A;  1SR9 A;  1DQ3 A;  2LRS A;  2BM0 A;  4OX9 I;  2NUF A;  1S16 A;  1J26 A;  1N33 E;  1ZM3 A;  2F8B A;  1I94 I;  5AAS A;  1USU A;  3DF6 A;  4F9C B;  2CG9 A;  4JI6 I;  4DV2 I;  4ED4 A;  1MX0 A;  4WUC A;  4DUZ E;  2NPF A;  3ZKB A;  4PRX A;  1KIJ A;  2WZO A;  1FKA E;  3B8H A;  3J7Y p;  3Q6M A;  2RS6 A;  4IZJ A;  2LTR A;  1XNR E;  4LF7 E;  4I8O A;  2KON A;  2V2V A;  4B3T I;  4LFC I;  4JI2 E;  3RMP A;  4DPT A;  2L8T A;  4PU9 A;  2E1R A;  2E1M A;  2Z5C A;  3WU6 A;  1UHZ A;  4BBY A;  2B7T A;  4DV3 I;  4LF5 I;  2EZ6 A;  4B3S I;  4DKK A;  3Q1Q A;  1H72 C;  4NXM I;  4GKK E;  4JG4 A;  4FWD A;  2VQE I;  1VIS A;  2UU9 I;  2DEJ A;  1ZM9 A;  3QT6 A;  4USK A;  1PVG A;  4M1K A;  2UXD E;  4DR7 I;  4B3M E;  4GKJ E;  5L3J A;  4L5N C;  3F6G A;  2MDR A;  3T1H E;  2BV3 A;  2BM1 A;  3VK6 A;  2M1S A;  2FV4 B;  5FWK A;  4RPF A;  4DR3 I;  4JYA E;  1X47 A;  4R1F A;  4I3H A;  2V2Q A;  1HNZ I;  1EKZ A;  1XNQ E;  2JOB A;  3VYY A;  2Z5B A;  2V83 A;  1NHI A;  3OTO I;  4K0K I;  1RR9 A;  1ZBQ A;  4LF4 E;  2HFU A;  3F0N A;  4DPY A;  4JI8 E;  2NUE A;  4DPX A;  3IWC A;  4USM A;  3H4L A;  4DPW A;  3HPS A;  3FIG A;  4F9B B;  2L3J A;  1N32 E;  5BR8 E;  2ZIT A;  4JI5 I;  1USV A;  1T4L B;  1U2R A;  4M2Z A;  4JI3 I;  2RTX A;  1XMQ I;  3V2U C;  3K17 A;  4TUI A;  3ZZT A;  2O1U A;  1Y6Z A;  2ODR D;  1XMO E;  2L3C A;  2N3H A;  4L8N A;  3QT7 A;  5GMD A;  4YHH E;  4YY3 I;  1N36 E;  1FI4 A;  2MC5 A;  4X66 E;  1ZBT A;  4KZS A;  1K47 A;  4J8Z A;  2IOP A;  3J81 C;  4KHP I;  5A2Q C;  1N33 I;  2L2N A;  4LU9 A;  3HUL A;  3KWR A;  3LLH A;  2L2K B;  1H73 A;  1WHQ A;  4R8O A;  3B82 A;  4M30 A;  2DIX A;  2A2C A;  2L92 A;  1NHJ A;  4DUZ I;  2UUB E;  2RS7 A;  2J7K A;  4JI4 E;  2GQ0 A;  4Z7Y A;  2HKJ A;  1PKP A;  5LL6 R;  2O1T A;  2L2M A;  4LF6 E;  2LJP A;  4HXZ A;  2WW4 A;  1YZ9 A;  1XNR I;  4LF7 I;  4P52 A;  4X64 E;  4BC7 A;  1ZXM A;  4JI2 I;  4LFA E;  3PYG A;  4HAC A;  2JWO A;  5T6J A;  1Z59 A;  3LNU A;  1ZM2 A;  4FW9 A;  4DR2 E;  4DV0 E;  3JTZ A;  2VE7 C;  1QU6 A;  2V85 A;  4DV4 E;  2E5L E;  4GKK I;  1Z5A A;  1IBM E;  3HPZ A;  1B63 A;  2JVA A;  3QT5 A;  1J5E E;  2A2D A;  1HK7 A;  1ZXN A;  2UXD I;  1ZM4 A;  3AV0 A;  4IZK A;  3IWB A;  2KOU A;  4DV6 E;  2AJ4 A;  1D6T A;  5ADZ A;  4B3M I;  3P1X A;  1Z5C A;  5IT9 C;  4GKJ I;  4DV7 E;  3J7A G;  2OI2 A;  3HXL A;  2PNM A;  4DV1 E;  1BKN A;  3T1H I;  4LTY A;  4M0V A;  2M4I A;  4JYA I;  2G7H A;  3K85 A;  3WU3 A;  2B9D A;  2LUQ A;  2H36 X;  4DU7 A;  3HQ1 A;  4X62 E;  1XNQ I;  1X49 A;  3OML A;  5LMU E;  5LMN E;  2V89 A;  4FWG A;  3IWD A;  3J81 Q;  2LUP B;  4JI0 E;  4LF4 I;  1Y4U A;  4URL A;  4BS9 A;  2VQF E;  1WUU A;  4N3O A;  4AQY E;  1H7U A;  4JI8 I;  4JI1 E;  3ADI A;  4DXL A;  3JAM Q;  5A2Q Q;  1UEK A;  2CZ9 A;  2Z5E A;  1T4O A;  4LF8 E;  2UXC E;  5F3W A;  1N0V C;  1N32 I;  1EI1 A;  3V5R A;  5BR8 I;  1HNW E;  4WYQ B;  3J80 C;  1FNM A;  2UUA E;  2F4V E;  2L33 A;  5AE1 A;  4OOG C;  2IOQ A;  2NA2 A;  2JOX A;  1FJG E;  1HR0 E;  1XMO I;  1EA6 A;  1Z0G A;  4YHH I;  3PYE A;  1N36 I;  4FN5 A;  4X66 I;  4UTG A;  1MG7 A;  2V88 A;  3PYD A;  1YYO A;  2HHH E;  2HK3 A;  4FWH A;  4Q28 A;  2YT4 A;  4JI7 E;  3T1Y E;  4X65 E;  4LFB E;  1KVK A;  5DNY A;  4HAC B;  2M7Q A;  1FWK A;  2XEX A;  4BC9 A;  2EWL A;  4DUY E;  4JV5 E;  4HYM A;  2UUB I;  2LBS B;  4JI4 I;  4IZJ B;  2K4V A;  2UUC E;  4Z7C A;  1KKH A;  1PIE A;  2B7V A;  4LF6 I;  5IWA E;  4HY1 A;  4WUD A;  4LF9 E;  1Z0W A;  5AE2 A;  5IT9 Q;  3AUZ A;  3J7A M;  3JAM C;  4X64 I;  4P78 A;  4B3R E;  4P7A A;  4NXN E;  1A6F A;  2MC6 A;  2UXB E;  2Z5C B;  4LFA I;  3VYX A;  1RRE A;  3PYF A;  2ODR C;  3LPS A;  2PNL A;  2GS8 A;  2N3G A;  1B62 A;  1DI2 A;  4DR2 I;  2CPN A;  4DV0 I;  4WFT A;  4DV4 I;  1HNX E;  2E5L I;  1UIL A;  1IBM I;  2EFG A;  3HJC A;  1IBK E;  4UT4 A;  2FTX B;  1ELO A;  4DV5 E;  3ADG A;  3D4J A;  2R3V A;  1J5E I;  4WPY A;  2YZT A;  2ZM6 E;  3J80 Q;  1Z0B A;  4DV6 I;  4DV7 I;  4DV1 I;  3C4T A;  4BCA A;  2FGG A;  2B3T B;  1IBL E;  4DR1 E;  3H09 A;  4DR6 E;  4DR4 E;  2HKE A;  2Z5B B;  3GON A;  2X36 A;  2VF3 A;  1YYW A;  5FLX Q;  1Z5B A;  4X62 I;  4WUB A;  1YYK A;  3Q6N A;  2O1V A;  5LMU I;  5LMN I;  1Y4S A;  4JI0 I;  1QZR A;  2DB2 A;  1S4E A;  2VQF I;  4AQY I;  4JI1 I;  1N34 E;  1WXR A;  1X48 A;  3LTO A;  4LF8 I;  2X7I A;  2UXC I;  5GME A;  1RC7 A;  3ZOQ B;  2V8Q B;  2V2Z A;  3P06 A;  1HNW I;  4F9A B;  2UUA I;  2F4V I;  4DR5 E;  3K6Q A;  1NHH A;  2O1W A;  4OX9 E;  2LE2 A;  2V34 A;  1KTV A;  3ZKD A;  4X8W A;  2R42 A;  2V86 A;  1FJG I;  1I94 E;  3C4B A;  1HR0 I;  4JI6 E;  1DAR A;  4DV2 E;  1H74 A;  1N0U A;  2HHH I;  1WHN A;  4EMD A;  4WSP A;  4JI7 I;  3T1Y I;  4X65 I;  4LFB I;  2L6M A;  1O0W A;  3F6H A;  2JR1 A;  3JU0 A;  4DU8 A;  4DUY I;  4B3T E;  4LFC E;  4JV5 I;  3MSW A;  4GEQ B;  3M6A A;  5FLX C;  2UUC I;  1MU5 A;  3WU4 A;  5IWA I;  1FWL A;  2V87 A;  4LF9 I;  4DV3 E;  4LF5 E;  4XTJ A;  1Z0E A;  3PRY A;  1OJ4 A;  4B3S E;  2CGE A;  2V8P A;  4NXM E;  2Q2E B;  4B3R I;  4NXN I;  4MYT A;  2VQE E;  2UXB I;  2UU9 E;  4ZVI A;  1T4N A;  4KQV A;  3ADL A;  1H7S A;  2RSM A;  4DR7 E;  3ZM7 A;  2DMY A;  3DJW A;  2LJH A;  1GZ6 A;  2LTS A;  1HNX I;  4DR3 E;  3K1J A;  4IZK B;  1IBK I;  4DV5 I;  1Z0T A;  2DEI A;  1HNZ E;  3QT8 A;  3LML A;  3ADJ A;  3B78 A;  2ZM6 I;  1GQE A;  2NUG A;  4BMJ A;  3OTO E;  4K0K E;  5AE3 A;  2ZBK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...