4LFBE

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 40
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lfbE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfbE02
4YY3I 4JG4A 4FN5A 4WUCA 3J7AG 1FJGI 4I3HA 3JAMQ 3J81Q 3K1JA 1H73A 1XMOI 2EFGA 1GQEA 4X62E 4JI1I 1D6TA 2HK3A 2UUAI 4MYTA 5L3JA 1VISA 4LFCI 1Z5AA 4YHHE 4B3MI 2UXCE 1WHQA 4LF7I 1S4EA 1T4NA 1Z59A 2NPFA 4B3SE 1X48A 2ZITA 1J26A 4B3SI 4P7AA 2RS6A 4DR7E 3T1YI 1MG7A 1IBLE 4DUYI 5LMNE 4JI7E 1X47A 4LFAI 1Z0EA 5FLXC 2LTRA 4GKKI 1Z5BA 1B63A 4HYMA 4URLA 1Z5CA 4B3RE 4DR5E 4DV3I 1N34I 2X7IA 2A2CA 4DUZE 4DR4I 1PVGA 4DR1I 4LF6I 3WU3A 4WUDA 4DPWA 1KKHA 1N0VC 3ADLA 1XHKA 4X65I 4K0KI 5CFFE 2JVAA 4X65E 1WHNA 5LMNI 3C4BA 3T1HE 4JI7I 3K17A 5BR8E 4GKKE 2UUCE 2E5LE 2ZM6E 4DPTA 4KHPE 4LF4E 5GMDA 2L2KB 1XNQI 1IBME 4X64E 3QT8A 4JI4E 4LF9I 1N0UA 4HY1A 1IBKI 1ZXNA 1I94I 3B78A 1XNRE 4GKJI 1HNWE 2WW4A 5A2QC 2B7VA 3VYYA 4GKJE 4USMA 5IT9C 4KQVA 4DV6I 4HXZA 2DIXA 4XTJA 4Z7YA 2R3VA 3LTOA 1N32I 1NHIA 3LPSA 4JI0E 2NA2A 4LF7E 2GS8A 1UHZA 2LJHA 3F0NA 4MYUA 1UILA 1QZRA 2B7TA 4FWDA 4DV5E 4M2ZA 4AQYI 1IBLI 4OOGC 4LFAE 1YYOA 4DR2I 5IT9Q 3J7Yp 2HKEA 3T1YE 3VYXA 2HKJA 4OX9I 4NXME 4RPFA 5A2QQ 4DR2E 2E5LI 2L3JA 4PRVA 2RTXA 1XNQE 4DV1E 2Q2EB 2LUPB 2IHR1 1HNXE 3J80Q 1WUUA 2UXCI 2L3CA 1ZM4A 4JI6I 3J81C 1Z0WA 4DR3I 4B3TE 4HACB 2NUFA 3V5RA 1NHJA 4JV5E 4DR1E 1XMOE 1XMQI 2KHXA 2UUAE 2V2ZA 2AJ4A 3QT5A 4UT4A 2X36A 4DU8A 4FWHA 4PU9A 2ZM6I 4WUBA 1Z0CA 2EZ6A 4LF8I 1HNZE 4DR5I 1Z0BA 3QT7A 1NHHA 1J5EI 4DV7I 1PKPA 4FWGA 1H7SA 2UXBE 2MDRA 4JI4I 1UEKA 3WU4A 4LFBI 2HK2A 2V2VA 4DR4E 4DR7I 4LF6E 1FWLA 4EMDA 3J7AM 3ZKDA 4JV5I 1RC7A 1NZ0A 4DV6E 4DR6I 4JI2E 2DB2A 1N36I 4PRXA 1YZ9A 2B3TB 4LF8E 4LFCE 2DEIA 3M6AA 2UUBE 4YHHI 4JI0I 1N33E 1EKZA 4JI3E 1ZM2A 1KVKA 2V2QA 3B82A 4NXNI 1HR0E 4JYAI 2CPNA 1DARA 2HHHI 2UXBI 2YT4A 2LBSB 4DPXA 1Z0GA 2UU9I 1X49A 1XMQE 1PIEA 2HFSA 1ZM3A 2JY9A 1FI4A 4DPUA 4X66I 5LL6R 1HNWI 3ZZTA 2VQEI 1H74A 3J80C 4JI8I 2LJPA 3D4JA 3V2UC 1Z0TA 1N36E 1MU5A 1BKNA 5GMEA 4X64I 1N32E 4LF9E 2UUBI 4JI3I 4LFBE 3CWVA 4DUZI 4WYQB 2NUEA 2N3GA 2RSMA 4DPYA 4DKKA 5LMUE 4JI2I 5IWAE 2R42A 1YYWA 1KIJA 2L2MA 3Q1QA 1N33I 5BR8I 4JI5E 4DV0E 1OJ4A 2BM1A 4UTGA 2J7KA 4KHPI 1J5EE 2F4VI 2XEXA 4DU7A 4AQYE 3ZZUA 4DV5I 2F4VE 2A2DA 3PYEA 3LLHA 2DEJA 1H72C 4X66E 1I94E 1FWKA 2UXDI 3ADIA 3HULA 3LNUA 1U2RA 3WU6A 3JAMC 2RS7A 3PYDA 1FKAE 3T1HI 4DV4E 3OTOI 1ZM9A 2N3HA 4JI6E 4HACA 3B8HA 3OTOE 4B3ME 4DV0I 4B3RI 1K47A 2UU9E 1IBKE 1HR0I 2L33A 2DMYA 3PYFA 2VF3A 3PYGA 1FJGE 1RQ0A 5FLXQ 2UXDE 3ADJA 1HNZI 2V8PA 1B62A 4DV7E 4M30A 4LF5E 1EA6A 2HFUA 4LF5I 1ELOA 3WU5A 1STUA 2ZBKB 1FNMA 2VQFI 4ZVIA 4USKA 2OI2A 4NXNE 4JYAE 1A6FA 3H4LA 1T4OA 2HHHE 2NUGA 1IBMI 1QU6A 1KTVA 1S16A 2LRSA 3ZM7A 5IWAI 1XNRI 2CZ9A 4DV4I 4M1KA 4JI5I 2BV3A 4JI1E 1EI1A 4X62I 4DV1I 2BM0A 4R1FA 1RREA 2VQFE 3P1XA 4DR3E 1H7UA 3C4TA 4X8WA 3QT6A 4B3TI 4Z7CA 4YY3E 4P52A 2VQEE 2LUQA 1ZBTA 4JI8E 1RR9A 3ADGA 3HTXA 1T4LB 4K0KE 1O0WA 4DR6E 3ZZ0A 4FW9A 3GONA 1DI2A 4DUYE 3ZKBA 1ZXMA 4OX9E 4WFTA 4NXMI 4LF4I 2V34A 4ED4A 2UUCI 4DV3E 4DV2I 1N34E 4DXLA 1MX0A 5LMUI 4DV2E 1YYKA 1HNXI 2L2NA 2LTSA 2E1RA 1Z0VA
chains in the Genus database with same CATH superfamily
4YY3I 1GTKA 4JG4A 2HGHA 4FN5A 4WUCA 3J7AG 4MQYA 1FJGI 4I3HA 3JAMQ 2EPCA 3J81Q 2PNLA 3K1JA 4NBQA 3VK6A 1H73A 2EN4A 1XMOI 2PNMA 2EFGA 1GQEA 4X62E 4JI1I 1D6TA 2HK3A 2UUAI 1YSAC 4MYTA 3TQMA 2JE6A 2EM8A 4ZYGA 1XXEA 3GCMA 5JEAB 2C39B 5L3JA 3RMPA 1YUJA 5ELWA 1VISA 4BA2B 3M99B 4LFCI 1TF3A 5DRQA 1Z5AA 4YHHE 2CG9A 3P3EA 2MDGA 2YRKA 3PS2A 1JK2A 2EMBA 2BA0D 2IOQA 4B3MI 4I8OA 2UXCE 3PRYA 4HEIA 1WHQA 1A1HA 3L7ZB 1S4EA 2EQ1A 2LO3A 3DD6A 4LF7I 1T4NA 2EMLA 1A1JA 2C38A 4J3DA 1Z59A 2EMHA 2NPFA 2EOFA 3GLLA 1UBDC 2WZOA 4B3SE 1X48A 4F2JC 2ZITA 5JEAA 1WRJA 1J26A 2CT1A 4P7AA 2RS6A 4B3SI 4DR7E 3T1YI 1MG7A 3M7NG 1IBLE 2EMXA 4DUYI 1G2DC 1YFHA 5LMNE 2RSIA 4JI7E 1X47A 2PO0A 2PO2A 4LFAI 5FLXC 1AAYA 2LTRA 1Z0EA 3MSWA 2EL4A 2I13A 2WBTA 1Z5BA 2JT2A 4U3BA 4GKKI 1B63A 3H1CA 4HYMA 4BC7A 4URLA 1Z5CA 2EPNA 4B3RE 4DR5E 4LOMA 5IV8B 4DV3I 4IZJA 4R2AA 1N34I 4FW7A 2X7IA 2PNZB 2I9IA 2NABA 5A6BA 2R76A 2A2CA 2M7QA 4DUZE 5K36D 4R2CA 5C0XB 2EPMX 4AIDA 4DR4I 1PVGA 5JEAC 4DR1I 4LF6I 4M0VA 2L8TA 3WU3A 4WUDA 4L8NA 2YRHA 4DPWA 2NN6E 1KKHA 1N0VC 2MC6A 3ADLA 4LU9A 1UDSA 2DMIA 1XHKA 1YH8A 4X65I 4K0KI 2B9DA 5CFFE 3UK3C 2JVAA 1T38A 2K4VA 2O1TA 2YTPA 2GO3A 2FTXB 4X65E 2K7IA 1WHNA 1TF6A 1Y6ZA 5LMNI 2EOXA 3C4BA 3C6MA 3T1HE 4JI7I 3K17A 2NN6B 5BR8E 2EM7A 4GKKE 2UUCE 2NN6D 2CTDA 2E5LE 1KYQA 2ZM6E 4FW4A 2EQ0A 4DPTA 4KHPE 1IQSA 4F9BB 4LF4E 2L2KB 5GMDA 1XNQI 1IBME 4X64E 2FGGA 2ODRD 4IFDC 1QNTA 3QT8A 1PDAA 4JI4E 4LF9I 4OO1B 1N0UA 4HY1A 2ELZA 1IBKI 4TUIA 1ZXNA 1SFEA 1I94I 3BBGA 5K36A 4GZNC 3B78A 1XNRE 1USVA 4GKJI 1HNWE 5A2QC 1F2IG 3HPSA 2B7VA 2WW4A 4OZEA 1Z1BA 5LLQA 4R2SA 3VYYA 2JOXA 4GKJE 4USMA 5IT9C 5DNLA 3JU0A 2EL6A 1PJQA 2ENHA 4KQVA 4MLVA 2WNRA 2WCC3 4DV6I 4NHRA 5T6JA 4HXZA 3P76A 2F8BA 3HXLA 5TSEA 2WBSA 2DIXA 4XTJA 4DMIA 5IXMB 4Z7YA 5C0XD 4R2EA 2KONA 2R3VA 3LTOA 4MU0A 1N32I 4FK5C 1BBOA 2MKNA 4O4KA 2PO1B 1N3GA 1NHIA 2JPAA 2VE7C 4WSGA 1J5EI 4IFDD 3LPSA 4JI0E 2NA2A 4LF7E 1USUA 4M9VC 1UHZA 3BF2A 2LJHA 2GS8A 3F0NA 2KOUA 4F54A 4BC9A 1ZU1A 2PO2B 4MYUA 1UILA 1QZRA 2NN6C 2B7TA 2Z5BA 4FWDA 4DV5E 4M2ZA 4AQYI 3ECRA 1IBLI 4OOGC 4OO1E 2RPCA 4BMJA 4LFAE 4IS9A 1YYOA 1PJTA 4DR2I 3J7Yp 2HKEA 5IT9Q 2EMYA 4RH8A 3T1YE 3VYXA 2HKJA 4OX9I 2IERA 4NXME 4RPFA 3Q6MA 1PJSA 4DR2E 1L4SA 1UDOA 5A2QQ 4AM3A 2E5LI 2GLIA 2BR2A 2V85A 2YSPA 2L6MA 2L3JA 4PRVA 2V89A 2RTXA 1XNQE 4DV1E 1Y60A 2IOPA 2Q2EB 1AH5A 1IQOA 5EL9A 3M7ND 2Z5CA 2LUPB 4O24A 1TN9A 2IHR1 1HNXE 2LCEA 3M85D 2GHFA 4O43A 1WUUA 3J80Q 2UXCI 2L3CA 2E1MA 1ZM4A 4ZYHA 3JTZA 3U1YA 4AIMA 4JI6I 2J7JA 3J81C 1X6HA 2C39A 1Z0WA 1DQ3A 2EPUA 4DR3I 4WX9A 2LV2A 4B3TE 4HACB 2DLKA 2NUFA 3V5RA 2LE2A 1NHJA 4JV5E 2EM4A 3OMLA 4DR1E 1XMOE 4TUGA 1XMQI 5K36B 2KHXA 3H09A 2ENAA 4R2QA 2UUAE 2AJ4A 2V2ZA 3QT5A 4BA1A 2VF1A 4MU1A 2X36A 4UT4A 5FWKA 2HJJA 4WPYA 2EJ4A 1BB8A 3HPZA 4FWHA 3F6HA 4DU8A 4IFDE 5K36E 3PS1A 3AV0A 2V86A 4PU9A 2ZM6I 4WUBA 1Z0CA 2EZ6A 4LF8I 4FW5A 4FW3A 2EOZA 3HJCA 5F3WA 1HNZE 4DR5I 2MC5A 1Z0BA 1NHHA 4KWYA 3QT7A 4ZYEA 2PNZA 4DV7I 2JEBA 1PKPA 3AUZA 2JP9A 4QNKA 2EPRA 3IWBA 4BHCA 3P06A 1P47A 4FWGA 1H7SA 5KL5A 2UXBE 2EOMA 2MDRA 1SR9A 1UEKA 3WU4A 5A69A 4JI4I 5AE1A 2EM9A 4LFBI 2J65A 2HK2A 4LCFA 3P3GA 2CGEA 2V2VA 4DR4E 3NZKA 4DR7I 4BS9A 2EMGA 4LF6E 1FWLA 2EMAA 4R2DA 4EMDA 3THOB 3L7ZA 3J7AM 4RHBB 3ZKDA 4JV5I 4F9AB 2Z5BB 2YTNA 2JR1A 3P3CA 3K6QA 1RC7A 1NZ0A 2ODRC 2EP3A 4DV6E 2EN2A 3IWCA 2YPNA 2PRTA 3UHMA 2LJUA 2EN8A 4DR6I 4R8OA 2DB2A 4JI2E 1N36I 5A6AA 4PRXA 2DLQA 1YZ9A 3PS3A 2JE6B 1OYSA 3Q6NA 1WJPA 2B3TB 3EQ1A 1ZR9A 2JEBB 2V87A 4F6MA 1BBGA 4LF8E 5JEAE 5DROA 1A1KA 4LFCE 2DEIA 3M6AA 2UUBE 5ADZA 4YHHI 3M85G 2EL5A 4BCAA 4JI0I 2BB8A 2ADRA 2YTDA 1N33E 1EKZA 4JI3E 2GQ0A 5K36C 2EM5A 5JEAF 2FV4B 2V88A 2YWQA 1ZM2A 1KVKA 2V2QA 4L5NC 3B82A 4NXNI 1HR0E 4JYAI 2O1WA 2CPNA 1DARA 2HHHI 2EOHA 2UXBI 1E3PA 2YT4A 2HC5A 2LBSB 1Z0GA 4DPXA 1X49A 1XMQE 2UU9I 3U1KA 5JEAD 1PIEA 2HFSA 4LCHA 1ZM3A 2EMIA 5C0XF 2JY9A 2YTEA 1FI4A 4DPUA 5LL6R 4X66I 1HNWI 2WNRB 3ZZTA 2VQEI 2C38B 3J80C 1H74A 2C37B 4JI8I 2EMCA 1MEYC 2O3ZA 2LJPA 3D4JA 3V2UC 1Z0TA 4BA1B 1N36E 3KRNA 1MU5A 1BKNA 2CSHA 2ENCA 4P7DA 4X9JA 1A1IA 5GMEA 4X64I 1N32E 1VI7A 4IFDA 4LF9E 1JK1A 4OO1D 1Z0VA 1T39A 2UUBI 2A25A 4F6NA 2JYAA 4JI3I 2EM2A 2N8XA 2EPLX 1MGTA 2EPOA 4LFBE 3CWVA 3HKMA 4DUZI 4WYQB 2BA1D 2EOOA 2N3GA 4NZVA 2NUEA 2YU5A 4IJDA 2YTFA 3LMLA 1OYRA 2Z5CB 1YPNA 2RSMA 2O1VA 4DPYA 2EN7A 4DKKA 2V8QB 5LMUE 5KL7A 2EMFA 2AE8A 4GQUA 4JI2I 5IWAE 1E3HA 4OO1F 2GPIA 3BGHA 2R42A 1HK7A 1YYWA 1KIJA 4GEQB 3CDJA 2YU8A 4R2RA 2R1FA 2L2MA 4J8ZA 2PO1A 2L92A 5DNYA 2BA0G 3Q1QA 1N33I 4O5GA 1X6FA 4MU4A 1EH7A 5BR8I 2EPXA 2WP8B 2EOYA 1P42A 4JI5E 2EWLA 2EPKX 4DV0E 1OJ4A 2BM1A 2J7KA 3B4TA 4UTGA 1X3CA 2YTJA 4KZSA 3KWRA 1J5EE 2F1DA 2F4VI 2XEXA 3MHHC 2YZTA 3F6GA 4HTGA 4IZKA 4DU7A 5A6BD 4AQYE 1Y4SA 4ZYDA 3ZZUA 2F4VE 2A2DA 2LMZA 4DV5I 3PYEA 3LLHA 4MLQA 2G7HA 2M4IA 2CVEA 2DEJA 2EN3A 3DJWA 4Q28A 4X66E 1I94E 1H72C 1FWKA 2UXDI 1EH8A 3ADIA 1R6LA 3HULA 3LNUA 2YTQA 4IZKB 1U2RA 3MHSC 1YHCA 2M1SA 1A1GA 3WU6A 3JAMC 2EORA 2RS7A 4N4RB 3THNA 4F9CB 1ZAAC 3PYDA 5KL3A 1A1FA 1FKAE 2EN6A 5DRPA 2JEAA 2EOEA 3T1HI 5C0XA 1X6EA 2YSOA 4DV4E 3OTOI 3EPLA 2N3HA 1ZM9A 4LTYA 4JI6E 4BA2A 4HACA 3B8HA 2NN6A 3EPKA 3OTOE 2EOJA 2EM3A 4B3ME 2M9AA 3EPHA 2EOSA 4OO1A 4DV0I 2BBGA 1K47A 4B3RI 2JEAB 1NEIA 2UU9E 2EPPA 1Y4UA 5K36F 1IMUA 1A1LA 2YRMA 1IBKE 4ISAA 1HR0I 2L33A 2DMYA 4IFDF 3PYFA 5EKWA 2JXPA 4MU3A 2IESA 2VF3A 2JOBA 5KL6A 3PYGA 1DGCA 1FJGE 1RQ0A 3FIGA 5FLXQ 3VHTB 1UN6B 2UXDE 4WXCA 4Q35B 3ADJA 2EOQA 5C0XC 1HNZI 2V8PA 4MDTA 2V83A 5A6JA 4M30A 4DV7E 4LF5E 1B62A 1EA6A 2EPAA 3EPJA 2HFUA 3QG5C 4OKGA 5AASA 2DRPA 5AC4A 4LF5I 2EM0A 2D9HA 1ELOA 3WU5A 1STUA 5AC5A 2ZBKB 1FNMA 3KZYA 2VQFI 4ZVIA 4USKA 2VRDA 3HQ1A 1EH6A 2OI2A 5A6KA 4NXNE 5KL4A 2LT7A 1ZBQA 4N3OA 4JYAE 1A6FA 3H4LA 1T4OA 2HHHE 2NUGA 1IBMI 3BIDA 4KHPI 1QU6A 4R2PA 5C0XE 1KTVA 2EMKA 2EE8A 5AE3A 2YTGA 1S16A 2LRSA 2EPZA 2NN6F 2PO0B 3ZM7A 5IWAI 4LPFA 1XNRI 3L00A 2CZ9A 4DV4I 4OO1C 4M1KA 3DF6A 1RHYA 1GZ6A 2BR2B 4JI5I 2EM6A 2YTIA 2BV3A 4JI1E 1EI1A 4X62I 2YTOA 4R03A 2DSYA 2EMZA 4DV1I 1X5WA 3IWDA 4BHBA 1KJKA 2LVHA 2BM0A 2WP8A 2BA1G 4R1FA 1RREA 2VQFE 5AE2A 3P1XA 2EN1A 4DR3E 1H7UA 2MKDA 3C4TA 2C37A 1LLMC 3CDIA 4X8WA 3QT6A 4B3TI 1Y5YA 4Z7CA 4YY3E 4P52A 2VQEE 4QNJA 2LUQA 2WBUA 1ZBTA 2EOIA 4JI8E 1RR9A 3ADGA 3HTXA 1T4LB 2O1UA 4K0KE 5DRRA 2GO4A 5DNXA 1O0WA 4WSPA 4WXDA 4DR6E 3ZZ0A 4IFDB 4FW9A 3K85A 2JWOA 1OYPA 3GONA 1DI2A 4U3DA 4DUYE 1WXRA 3GMEA 4FW6A 3ZKBA 1ZXMA 4OX9E 1R6MA 4WFTA 3ZOQB 4NXMI 2EQ3A 1NCSA 4IZJD 2VESA 2H36X 4LF4I 4LCGA 3C6KA 1B69A 2V34A 4ED4A 2Q8UA 2UUCI 2ELYA 4DV3E 4DV2I 4P78A 1N34E 2DGCA 1UDNA 4DXLA 3KZZA 2RQLA 5KL2A 1MX0A 5LMUI 1RMDA 4BBYA 4DV2E 2EMWA 1YUIA 1YYKA 2L2NA 2LTSA 4IZJB 2E72A 2E1RA 2Z5EA 1HNXI 4IS1C 1G2FC 1UDQA
chains in the Genus database with same CATH topology
4YY3I 4JG4A 4FN5A 4WUCA 3J7AG 1FJGI 4I3HA 3JAMQ 3J81Q 2PNLA 3K1JA 3VK6A 1H73A 1XMOI 2PNMA 2EFGA 1GQEA 4X62E 4JI1I 1D6TA 2HK3A 2UUAI 4MYTA 5L3JA 3RMPA 1VISA 4LFCI 1Z5AA 4YHHE 2CG9A 2IOQA 4B3MI 4I8OA 2UXCE 3PRYA 1WHQA 4LF7I 1S4EA 1T4NA 1Z59A 2NPFA 2WZOA 4B3SE 1X48A 2ZITA 1J26A 4B3SI 4P7AA 2RS6A 4DR7E 3T1YI 1MG7A 1IBLE 4DUYI 5LMNE 4JI7E 1X47A 4LFAI 5FLXC 1Z0EA 2LTRA 3MSWA 4GKKI 1Z5BA 1B63A 4HYMA 4BC7A 4URLA 1Z5CA 4B3RE 4DR5E 4DV3I 4IZJA 1N34I 2X7IA 2A2CA 2M7QA 4DUZE 4DR4I 1PVGA 4DR1I 4LF6I 4M0VA 2L8TA 3WU3A 4WUDA 4L8NA 4DPWA 1N0VC 1KKHA 2MC6A 3ADLA 4LU9A 1XHKA 4X65I 4K0KI 2B9DA 5CFFE 2JVAA 2K4VA 2O1TA 2FTXB 4X65E 1WHNA 1Y6ZA 5LMNI 3C4BA 3T1HE 4JI7I 3K17A 5BR8E 4GKKE 2UUCE 2E5LE 2ZM6E 4DPTA 4KHPE 4F9BB 4LF4E 2L2KB 5GMDA 1XNQI 1IBME 4X64E 2FGGA 2ODRD 3QT8A 4JI4E 4LF9I 1N0UA 4HY1A 1IBKI 4TUIA 1ZXNA 1I94I 3B78A 1XNRE 1USVA 4GKJI 1HNWE 5A2QC 2WW4A 3HPSA 2B7VA 3VYYA 4GKJE 2JOXA 4USMA 5IT9C 3JU0A 4KQVA 4DV6I 5T6JA 4HXZA 2F8BA 3HXLA 2DIXA 4XTJA 4DMIA 4Z7YA 2KONA 2R3VA 3LTOA 1N32I 1NHIA 2VE7C 3LPSA 4JI0E 2NA2A 4LF7E 1USUA 2GS8A 1UHZA 2LJHA 3F0NA 2KOUA 4F54A 4BC9A 4MYUA 1UILA 1QZRA 2B7TA 2Z5BA 4FWDA 4DV5E 4M2ZA 4AQYI 1IBLI 4OOGC 4BMJA 4LFAE 1YYOA 4DR2I 5IT9Q 3J7Yp 2HKEA 3T1YE 3VYXA 2HKJA 4OX9I 4NXME 4RPFA 3Q6MA 4DR2E 5A2QQ 2E5LI 2V85A 2L6MA 2L3JA 4PRVA 2V89A 2RTXA 1XNQE 4DV1E 2IOPA 2Q2EB 2Z5CA 2LUPB 2IHR1 1HNXE 3J80Q 1WUUA 2UXCI 2L3CA 2E1MA 1ZM4A 4JI6I 3JTZA 3J81C 1Z0WA 1DQ3A 4DR3I 4B3TE 4HACB 2NUFA 3V5RA 2LE2A 1NHJA 4JV5E 3OMLA 4DR1E 1XMOE 4TUGA 1XMQI 2KHXA 3H09A 2UUAE 2V2ZA 2AJ4A 3QT5A 4UT4A 2VF1A 2X36A 5FWKA 4DU8A 4WPYA 3HPZA 4FWHA 3F6HA 3AV0A 2V86A 4PU9A 2ZM6I 4WUBA 1Z0CA 2EZ6A 4LF8I 3HJCA 5F3WA 1HNZE 4DR5I 2MC5A 1Z0BA 1NHHA 3QT7A 1J5EI 4DV7I 1PKPA 3AUZA 3IWBA 3P06A 4FWGA 1H7SA 2UXBE 2MDRA 1SR9A 1UEKA 3WU4A 4JI4I 5AE1A 4LFBI 2HK2A 2CGEA 2V2VA 4DR4E 4DR7I 4BS9A 4LF6E 1FWLA 4EMDA 3J7AM 3ZKDA 4JV5I 4F9AB 2Z5BB 2JR1A 3K6QA 1RC7A 1NZ0A 2ODRC 4DV6E 3IWCA 4DR6I 4R8OA 2DB2A 4JI2E 1N36I 4PRXA 1YZ9A 3Q6NA 2B3TB 2V87A 4LF8E 4LFCE 2DEIA 3M6AA 2UUBE 5ADZA 4YHHI 4BCAA 4JI0I 1N33E 1EKZA 4JI3E 2GQ0A 2FV4B 2V88A 1ZM2A 1KVKA 2V2QA 4L5NC 3B82A 4NXNI 1HR0E 4JYAI 2O1WA 2CPNA 1DARA 2HHHI 2UXBI 2YT4A 2LBSB 4DPXA 1Z0GA 2UU9I 1X49A 1XMQE 1PIEA 2HFSA 1ZM3A 2JY9A 1FI4A 4DPUA 4X66I 5LL6R 1HNWI 3ZZTA 2VQEI 3J80C 1H74A 4JI8I 2LJPA 3D4JA 3V2UC 1Z0TA 1N36E 1MU5A 1BKNA 4P7DA 5GMEA 4X64I 1N32E 4LF9E 2UUBI 4JI3I 4LFBE 3CWVA 4DUZI 4WYQB 2NUEA 2N3GA 3LMLA 2Z5CB 2RSMA 2O1VA 4DPYA 4DKKA 2V8QB 5LMUE 4JI2I 5IWAE 2R42A 1HK7A 1YYWA 1KIJA 4GEQB 2L2MA 4J8ZA 2L92A 5DNYA 3Q1QA 1N33I 5BR8I 4JI5E 2EWLA 4DV0E 1OJ4A 2BM1A 2J7KA 4UTGA 4KHPI 1J5EE 4KZSA 3KWRA 2F4VI 2XEXA 4IZKA 2YZTA 3F6GA 4DU7A 4AQYE 1Y4SA 3ZZUA 4DV5I 2F4VE 2A2DA 2LMZA 3PYEA 3LLHA 2G7HA 2M4IA 2DEJA 1H72C 3DJWA 4Q28A 4X66E 1I94E 1FWKA 2UXDI 3ADIA 3HULA 3LNUA 4IZKB 1U2RA 2M1SA 3WU6A 3JAMC 2RS7A 4F9CB 3PYDA 1FKAE 3T1HI 4DV4E 3OTOI 1ZM9A 2N3HA 4LTYA 4JI6E 4HACA 3B8HA 3OTOE 4B3ME 4DV0I 4B3RI 1K47A 2UU9E 1Y4UA 1IBKE 1HR0I 2L33A 2DMYA 3PYFA 2VF3A 2JOBA 3PYGA 1FJGE 1RQ0A 3FIGA 5FLXQ 2UXDE 3ADJA 1HNZI 2V8PA 1B62A 2V83A 4M30A 4DV7E 4LF5E 1EA6A 2HFUA 5AASA 4LF5I 1ELOA 3WU5A 1STUA 2ZBKB 1FNMA 2VQFI 4ZVIA 4USKA 3HQ1A 2OI2A 4NXNE 1ZBQA 4N3OA 4JYAE 1A6FA 3H4LA 1T4OA 2HHHE 2NUGA 1IBMI 1QU6A 1KTVA 5AE3A 1S16A 2LRSA 3ZM7A 5IWAI 1XNRI 2CZ9A 4DV4I 4M1KA 3DF6A 1GZ6A 4JI5I 2BV3A 4JI1E 1EI1A 4X62I 4R03A 4DV1I 2DSYA 3IWDA 2BM0A 4R1FA 1RREA 2VQFE 5AE2A 3P1XA 4DR3E 1H7UA 3C4TA 4X8WA 3QT6A 4B3TI 4Z7CA 4YY3E 4P52A 2VQEE 2LUQA 1ZBTA 4JI8E 1RR9A 3ADGA 3HTXA 1T4LB 2O1UA 4K0KE 1O0WA 4WSPA 4DR6E 3ZZ0A 4FW9A 3K85A 2JWOA 3GONA 1DI2A 4DUYE 1WXRA 3ZKBA 1ZXMA 4OX9E 4WFTA 3ZOQB 4NXMI 4IZJD 2H36X 4LF4I 2V34A 4ED4A 2UUCI 4DV3E 4DV2I 4P78A 1N34E 4DXLA 1MX0A 5LMUI 4BBYA 4DV2E 1YYKA 1HNXI 2L2NA 2LTSA 4IZJB 2Z5EA 2E1RA 1Z0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 I;  4JG4 A;  4FN5 A;  4WUC A;  3J7A G;  1FJG I;  4I3H A;  3JAM Q;  3J81 Q;  3K1J A;  1H73 A;  1XMO I;  2EFG A;  1GQE A;  4X62 E;  4JI1 I;  1D6T A;  2HK3 A;  2UUA I;  4MYT A;  5L3J A;  1VIS A;  4LFC I;  1Z5A A;  4YHH E;  4B3M I;  2UXC E;  1WHQ A;  4LF7 I;  1S4E A;  1T4N A;  1Z59 A;  2NPF A;  4B3S E;  1X48 A;  2ZIT A;  1J26 A;  4B3S I;  4P7A A;  2RS6 A;  4DR7 E;  3T1Y I;  1MG7 A;  1IBL E;  4DUY I;  5LMN E;  4JI7 E;  1X47 A;  4LFA I;  1Z0E A;  5FLX C;  2LTR A;  4GKK I;  1Z5B A;  1B63 A;  4HYM A;  4URL A;  1Z5C A;  4B3R E;  4DR5 E;  4DV3 I;  1N34 I;  2X7I A;  2A2C A;  4DUZ E;  4DR4 I;  1PVG A;  4DR1 I;  4LF6 I;  3WU3 A;  4WUD A;  4DPW A;  1KKH A;  1N0V C;  3ADL A;  1XHK A;  4X65 I;  4K0K I;  5CFF E;  2JVA A;  4X65 E;  1WHN A;  5LMN I;  3C4B A;  3T1H E;  4JI7 I;  3K17 A;  5BR8 E;  4GKK E;  2UUC E;  2E5L E;  2ZM6 E;  4DPT A;  4KHP E;  4LF4 E;  5GMD A;  2L2K B;  1XNQ I;  1IBM E;  4X64 E;  3QT8 A;  4JI4 E;  4LF9 I;  1N0U A;  4HY1 A;  1IBK I;  1ZXN A;  1I94 I;  3B78 A;  1XNR E;  4GKJ I;  1HNW E;  2WW4 A;  5A2Q C;  2B7V A;  3VYY A;  4GKJ E;  4USM A;  5IT9 C;  4KQV A;  4DV6 I;  4HXZ A;  2DIX A;  4XTJ A;  4Z7Y A;  2R3V A;  3LTO A;  1N32 I;  1NHI A;  3LPS A;  4JI0 E;  2NA2 A;  4LF7 E;  2GS8 A;  1UHZ A;  2LJH A;  3F0N A;  4MYU A;  1UIL A;  1QZR A;  2B7T A;  4FWD A;  4DV5 E;  4M2Z A;  4AQY I;  1IBL I;  4OOG C;  4LFA E;  1YYO A;  4DR2 I;  5IT9 Q;  3J7Y p;  2HKE A;  3T1Y E;  3VYX A;  2HKJ A;  4OX9 I;  4NXM E;  4RPF A;  5A2Q Q;  4DR2 E;  2E5L I;  2L3J A;  4PRV A;  2RTX A;  1XNQ E;  4DV1 E;  2Q2E B;  2LUP B;  2IHR 1;  1HNX E;  3J80 Q;  1WUU A;  2UXC I;  2L3C A;  1ZM4 A;  4JI6 I;  3J81 C;  1Z0W A;  4DR3 I;  4B3T E;  4HAC B;  2NUF A;  3V5R A;  1NHJ A;  4JV5 E;  4DR1 E;  1XMO E;  1XMQ I;  2KHX A;  2UUA E;  2V2Z A;  2AJ4 A;  3QT5 A;  4UT4 A;  2X36 A;  4DU8 A;  4FWH A;  4PU9 A;  2ZM6 I;  4WUB A;  1Z0C A;  2EZ6 A;  4LF8 I;  1HNZ E;  4DR5 I;  1Z0B A;  3QT7 A;  1NHH A;  1J5E I;  4DV7 I;  1PKP A;  4FWG A;  1H7S A;  2UXB E;  2MDR A;  4JI4 I;  1UEK A;  3WU4 A;  4LFB I;  2HK2 A;  2V2V A;  4DR4 E;  4DR7 I;  4LF6 E;  1FWL A;  4EMD A;  3J7A M;  3ZKD A;  4JV5 I;  1RC7 A;  1NZ0 A;  4DV6 E;  4DR6 I;  4JI2 E;  2DB2 A;  1N36 I;  4PRX A;  1YZ9 A;  2B3T B;  4LF8 E;  4LFC E;  2DEI A;  3M6A A;  2UUB E;  4YHH I;  4JI0 I;  1N33 E;  1EKZ A;  4JI3 E;  1ZM2 A;  1KVK A;  2V2Q A;  3B82 A;  4NXN I;  1HR0 E;  4JYA I;  2CPN A;  1DAR A;  2HHH I;  2UXB I;  2YT4 A;  2LBS B;  4DPX A;  1Z0G A;  2UU9 I;  1X49 A;  1XMQ E;  1PIE A;  2HFS A;  1ZM3 A;  2JY9 A;  1FI4 A;  4DPU A;  4X66 I;  5LL6 R;  1HNW I;  3ZZT A;  2VQE I;  1H74 A;  3J80 C;  4JI8 I;  2LJP A;  3D4J A;  3V2U C;  1Z0T A;  1N36 E;  1MU5 A;  1BKN A;  5GME A;  4X64 I;  1N32 E;  4LF9 E;  2UUB I;  4JI3 I;  4LFB E;  3CWV A;  4DUZ I;  4WYQ B;  2NUE A;  2N3G A;  2RSM A;  4DPY A;  4DKK A;  5LMU E;  4JI2 I;  5IWA E;  2R42 A;  1YYW A;  1KIJ A;  2L2M A;  3Q1Q A;  1N33 I;  5BR8 I;  4JI5 E;  4DV0 E;  1OJ4 A;  2BM1 A;  4UTG A;  2J7K A;  4KHP I;  1J5E E;  2F4V I;  2XEX A;  4DU7 A;  4AQY E;  3ZZU A;  4DV5 I;  2F4V E;  2A2D A;  3PYE A;  3LLH A;  2DEJ A;  1H72 C;  4X66 E;  1I94 E;  1FWK A;  2UXD I;  3ADI A;  3HUL A;  3LNU A;  1U2R A;  3WU6 A;  3JAM C;  2RS7 A;  3PYD A;  1FKA E;  3T1H I;  4DV4 E;  3OTO I;  1ZM9 A;  2N3H A;  4JI6 E;  4HAC A;  3B8H A;  3OTO E;  4B3M E;  4DV0 I;  4B3R I;  1K47 A;  2UU9 E;  1IBK E;  1HR0 I;  2L33 A;  2DMY A;  3PYF A;  2VF3 A;  3PYG A;  1FJG E;  1RQ0 A;  5FLX Q;  2UXD E;  3ADJ A;  1HNZ I;  2V8P A;  1B62 A;  4DV7 E;  4M30 A;  4LF5 E;  1EA6 A;  2HFU A;  4LF5 I;  1ELO A;  3WU5 A;  1STU A;  2ZBK B;  1FNM A;  2VQF I;  4ZVI A;  4USK A;  2OI2 A;  4NXN E;  4JYA E;  1A6F A;  3H4L A;  1T4O A;  2HHH E;  2NUG A;  1IBM I;  1QU6 A;  1KTV A;  1S16 A;  2LRS A;  3ZM7 A;  5IWA I;  1XNR I;  2CZ9 A;  4DV4 I;  4M1K A;  4JI5 I;  2BV3 A;  4JI1 E;  1EI1 A;  4X62 I;  4DV1 I;  2BM0 A;  4R1F A;  1RRE A;  2VQF E;  3P1X A;  4DR3 E;  1H7U A;  3C4T A;  4X8W A;  3QT6 A;  4B3T I;  4Z7C A;  4YY3 E;  4P52 A;  2VQE E;  2LUQ A;  1ZBT A;  4JI8 E;  1RR9 A;  3ADG A;  3HTX A;  1T4L B;  4K0K E;  1O0W A;  4DR6 E;  3ZZ0 A;  4FW9 A;  3GON A;  1DI2 A;  4DUY E;  3ZKB A;  1ZXM A;  4OX9 E;  4WFT A;  4NXM I;  4LF4 I;  2V34 A;  4ED4 A;  2UUC I;  4DV3 E;  4DV2 I;  1N34 E;  4DXL A;  1MX0 A;  5LMU I;  4DV2 E;  1YYK A;  1HNX I;  2L2N A;  2LTS A;  2E1R A;  1Z0V A; 
#chains in the Genus database with same CATH topology
 4YY3 I;  1GTK A;  4JG4 A;  2HGH A;  4FN5 A;  4WUC A;  3J7A G;  4MQY A;  1FJG I;  4I3H A;  3JAM Q;  2EPC A;  3J81 Q;  2PNL A;  3K1J A;  4NBQ A;  3VK6 A;  1H73 A;  2EN4 A;  1XMO I;  2PNM A;  2EFG A;  1GQE A;  4X62 E;  4JI1 I;  1D6T A;  2HK3 A;  2UUA I;  1YSA C;  4MYT A;  3TQM A;  2JE6 A;  2EM8 A;  4ZYG A;  1XXE A;  3GCM A;  5JEA B;  2C39 B;  5L3J A;  3RMP A;  1YUJ A;  5ELW A;  1VIS A;  4BA2 B;  3M99 B;  4LFC I;  1TF3 A;  5DRQ A;  1Z5A A;  4YHH E;  2CG9 A;  3P3E A;  2MDG A;  2YRK A;  3PS2 A;  1JK2 A;  2EMB A;  2BA0 D;  2IOQ A;  4B3M I;  4I8O A;  2UXC E;  3PRY A;  4HEI A;  1WHQ A;  1A1H A;  3L7Z B;  1S4E A;  2EQ1 A;  2LO3 A;  3DD6 A;  4LF7 I;  1T4N A;  2EML A;  1A1J A;  2C38 A;  4J3D A;  1Z59 A;  2EMH A;  2NPF A;  2EOF A;  3GLL A;  1UBD C;  2WZO A;  4B3S E;  1X48 A;  4F2J C;  2ZIT A;  5JEA A;  1WRJ A;  1J26 A;  2CT1 A;  4P7A A;  2RS6 A;  4B3S I;  4DR7 E;  3T1Y I;  1MG7 A;  3M7N G;  1IBL E;  2EMX A;  4DUY I;  1G2D C;  1YFH A;  5LMN E;  2RSI A;  4JI7 E;  1X47 A;  2PO0 A;  2PO2 A;  4LFA I;  5FLX C;  1AAY A;  2LTR A;  1Z0E A;  3MSW A;  2EL4 A;  2I13 A;  2WBT A;  1Z5B A;  2JT2 A;  4U3B A;  4GKK I;  1B63 A;  3H1C A;  4HYM A;  4BC7 A;  4URL A;  1Z5C A;  2EPN A;  4B3R E;  4DR5 E;  4LOM A;  5IV8 B;  4DV3 I;  4IZJ A;  4R2A A;  1N34 I;  4FW7 A;  2X7I A;  2PNZ B;  2I9I A;  2NAB A;  5A6B A;  2R76 A;  2A2C A;  2M7Q A;  4DUZ E;  5K36 D;  4R2C A;  5C0X B;  2EPM X;  4AID A;  4DR4 I;  1PVG A;  5JEA C;  4DR1 I;  4LF6 I;  4M0V A;  2L8T A;  3WU3 A;  4WUD A;  4L8N A;  2YRH A;  4DPW A;  2NN6 E;  1KKH A;  1N0V C;  2MC6 A;  3ADL A;  4LU9 A;  1UDS A;  2DMI A;  1XHK A;  1YH8 A;  4X65 I;  4K0K I;  2B9D A;  5CFF E;  3UK3 C;  2JVA A;  1T38 A;  2K4V A;  2O1T A;  2YTP A;  2GO3 A;  2FTX B;  4X65 E;  2K7I A;  1WHN A;  1TF6 A;  1Y6Z A;  5LMN I;  2EOX A;  3C4B A;  3C6M A;  3T1H E;  4JI7 I;  3K17 A;  2NN6 B;  5BR8 E;  2EM7 A;  4GKK E;  2UUC E;  2NN6 D;  2CTD A;  2E5L E;  1KYQ A;  2ZM6 E;  4FW4 A;  2EQ0 A;  4DPT A;  4KHP E;  1IQS A;  4F9B B;  4LF4 E;  2L2K B;  5GMD A;  1XNQ I;  1IBM E;  4X64 E;  2FGG A;  2ODR D;  4IFD C;  1QNT A;  3QT8 A;  1PDA A;  4JI4 E;  4LF9 I;  4OO1 B;  1N0U A;  4HY1 A;  2ELZ A;  1IBK I;  4TUI A;  1ZXN A;  1SFE A;  1I94 I;  3BBG A;  5K36 A;  4GZN C;  3B78 A;  1XNR E;  1USV A;  4GKJ I;  1HNW E;  5A2Q C;  1F2I G;  3HPS A;  2B7V A;  2WW4 A;  4OZE A;  1Z1B A;  5LLQ A;  4R2S A;  3VYY A;  2JOX A;  4GKJ E;  4USM A;  5IT9 C;  5DNL A;  3JU0 A;  2EL6 A;  1PJQ A;  2ENH A;  4KQV A;  4MLV A;  2WNR A;  2WCC 3;  4DV6 I;  4NHR A;  5T6J A;  4HXZ A;  3P76 A;  2F8B A;  3HXL A;  5TSE A;  2WBS A;  2DIX A;  4XTJ A;  4DMI A;  5IXM B;  4Z7Y A;  5C0X D;  4R2E A;  2KON A;  2R3V A;  3LTO A;  4MU0 A;  1N32 I;  4FK5 C;  1BBO A;  2MKN A;  4O4K A;  2PO1 B;  1N3G A;  1NHI A;  2JPA A;  2VE7 C;  4WSG A;  1J5E I;  4IFD D;  3LPS A;  4JI0 E;  2NA2 A;  4LF7 E;  1USU A;  4M9V C;  1UHZ A;  3BF2 A;  2LJH A;  2GS8 A;  3F0N A;  2KOU A;  4F54 A;  4BC9 A;  1ZU1 A;  2PO2 B;  4MYU A;  1UIL A;  1QZR A;  2NN6 C;  2B7T A;  2Z5B A;  4FWD A;  4DV5 E;  4M2Z A;  4AQY I;  3ECR A;  1IBL I;  4OOG C;  4OO1 E;  2RPC A;  4BMJ A;  4LFA E;  4IS9 A;  1YYO A;  1PJT A;  4DR2 I;  3J7Y p;  2HKE A;  5IT9 Q;  2EMY A;  4RH8 A;  3T1Y E;  3VYX A;  2HKJ A;  4OX9 I;  2IER A;  4NXM E;  4RPF A;  3Q6M A;  1PJS A;  4DR2 E;  1L4S A;  1UDO A;  5A2Q Q;  4AM3 A;  2E5L I;  2GLI A;  2BR2 A;  2V85 A;  2YSP A;  2L6M A;  2L3J A;  4PRV A;  2V89 A;  2RTX A;  1XNQ E;  4DV1 E;  1Y60 A;  2IOP A;  2Q2E B;  1AH5 A;  1IQO A;  5EL9 A;  3M7N D;  2Z5C A;  2LUP B;  4O24 A;  1TN9 A;  2IHR 1;  1HNX E;  2LCE A;  3M85 D;  2GHF A;  4O43 A;  1WUU A;  3J80 Q;  2UXC I;  2L3C A;  2E1M A;  1ZM4 A;  4ZYH A;  3JTZ A;  3U1Y A;  4AIM A;  4JI6 I;  2J7J A;  3J81 C;  1X6H A;  2C39 A;  1Z0W A;  1DQ3 A;  2EPU A;  4DR3 I;  4WX9 A;  2LV2 A;  4B3T E;  4HAC B;  2DLK A;  2NUF A;  3V5R A;  2LE2 A;  1NHJ A;  4JV5 E;  2EM4 A;  3OML A;  4DR1 E;  1XMO E;  4TUG A;  1XMQ I;  5K36 B;  2KHX A;  3H09 A;  2ENA A;  4R2Q A;  2UUA E;  2AJ4 A;  2V2Z A;  3QT5 A;  4BA1 A;  2VF1 A;  4MU1 A;  2X36 A;  4UT4 A;  5FWK A;  2HJJ A;  4WPY A;  2EJ4 A;  1BB8 A;  3HPZ A;  4FWH A;  3F6H A;  4DU8 A;  4IFD E;  5K36 E;  3PS1 A;  3AV0 A;  2V86 A;  4PU9 A;  2ZM6 I;  4WUB A;  1Z0C A;  2EZ6 A;  4LF8 I;  4FW5 A;  4FW3 A;  2EOZ A;  3HJC A;  5F3W A;  1HNZ E;  4DR5 I;  2MC5 A;  1Z0B A;  1NHH A;  4KWY A;  3QT7 A;  4ZYE A;  2PNZ A;  4DV7 I;  2JEB A;  1PKP A;  3AUZ A;  2JP9 A;  4QNK A;  2EPR A;  3IWB A;  4BHC A;  3P06 A;  1P47 A;  4FWG A;  1H7S A;  5KL5 A;  2UXB E;  2EOM A;  2MDR A;  1SR9 A;  1UEK A;  3WU4 A;  5A69 A;  4JI4 I;  5AE1 A;  2EM9 A;  4LFB I;  2J65 A;  2HK2 A;  4LCF A;  3P3G A;  2CGE A;  2V2V A;  4DR4 E;  3NZK A;  4DR7 I;  4BS9 A;  2EMG A;  4LF6 E;  1FWL A;  2EMA A;  4R2D A;  4EMD A;  3THO B;  3L7Z A;  3J7A M;  4RHB B;  3ZKD A;  4JV5 I;  4F9A B;  2Z5B B;  2YTN A;  2JR1 A;  3P3C A;  3K6Q A;  1RC7 A;  1NZ0 A;  2ODR C;  2EP3 A;  4DV6 E;  2EN2 A;  3IWC A;  2YPN A;  2PRT A;  3UHM A;  2LJU A;  2EN8 A;  4DR6 I;  4R8O A;  2DB2 A;  4JI2 E;  1N36 I;  5A6A A;  4PRX A;  2DLQ A;  1YZ9 A;  3PS3 A;  2JE6 B;  1OYS A;  3Q6N A;  1WJP A;  2B3T B;  3EQ1 A;  1ZR9 A;  2JEB B;  2V87 A;  4F6M A;  1BBG A;  4LF8 E;  5JEA E;  5DRO A;  1A1K A;  4LFC E;  2DEI A;  3M6A A;  2UUB E;  5ADZ A;  4YHH I;  3M85 G;  2EL5 A;  4BCA A;  4JI0 I;  2BB8 A;  2ADR A;  2YTD A;  1N33 E;  1EKZ A;  4JI3 E;  2GQ0 A;  5K36 C;  2EM5 A;  5JEA F;  2FV4 B;  2V88 A;  2YWQ A;  1ZM2 A;  1KVK A;  2V2Q A;  4L5N C;  3B82 A;  4NXN I;  1HR0 E;  4JYA I;  2O1W A;  2CPN A;  1DAR A;  2HHH I;  2EOH A;  2UXB I;  1E3P A;  2YT4 A;  2HC5 A;  2LBS B;  1Z0G A;  4DPX A;  1X49 A;  1XMQ E;  2UU9 I;  3U1K A;  5JEA D;  1PIE A;  2HFS A;  4LCH A;  1ZM3 A;  2EMI A;  5C0X F;  2JY9 A;  2YTE A;  1FI4 A;  4DPU A;  5LL6 R;  4X66 I;  1HNW I;  2WNR B;  3ZZT A;  2VQE I;  2C38 B;  3J80 C;  1H74 A;  2C37 B;  4JI8 I;  2EMC A;  1MEY C;  2O3Z A;  2LJP A;  3D4J A;  3V2U C;  1Z0T A;  4BA1 B;  1N36 E;  3KRN A;  1MU5 A;  1BKN A;  2CSH A;  2ENC A;  4P7D A;  4X9J A;  1A1I A;  5GME A;  4X64 I;  1N32 E;  1VI7 A;  4IFD A;  4LF9 E;  1JK1 A;  4OO1 D;  1Z0V A;  1T39 A;  2UUB I;  2A25 A;  4F6N A;  2JYA A;  4JI3 I;  2EM2 A;  2N8X A;  2EPL X;  1MGT A;  2EPO A;  4LFB E;  3CWV A;  3HKM A;  4DUZ I;  4WYQ B;  2BA1 D;  2EOO A;  2N3G A;  4NZV A;  2NUE A;  2YU5 A;  4IJD A;  2YTF A;  3LML A;  1OYR A;  2Z5C B;  1YPN A;  2RSM A;  2O1V A;  4DPY A;  2EN7 A;  4DKK A;  2V8Q B;  5LMU E;  5KL7 A;  2EMF A;  2AE8 A;  4GQU A;  4JI2 I;  5IWA E;  1E3H A;  4OO1 F;  2GPI A;  3BGH A;  2R42 A;  1HK7 A;  1YYW A;  1KIJ A;  4GEQ B;  3CDJ A;  2YU8 A;  4R2R A;  2R1F A;  2L2M A;  4J8Z A;  2PO1 A;  2L92 A;  5DNY A;  2BA0 G;  3Q1Q A;  1N33 I;  4O5G A;  1X6F A;  4MU4 A;  1EH7 A;  5BR8 I;  2EPX A;  2WP8 B;  2EOY A;  1P42 A;  4JI5 E;  2EWL A;  2EPK X;  4DV0 E;  1OJ4 A;  2BM1 A;  2J7K A;  3B4T A;  4UTG A;  1X3C A;  2YTJ A;  4KZS A;  3KWR A;  1J5E E;  2F1D A;  2F4V I;  2XEX A;  3MHH C;  2YZT A;  3F6G A;  4HTG A;  4IZK A;  4DU7 A;  5A6B D;  4AQY E;  1Y4S A;  4ZYD A;  3ZZU A;  2F4V E;  2A2D A;  2LMZ A;  4DV5 I;  3PYE A;  3LLH A;  4MLQ A;  2G7H A;  2M4I A;  2CVE A;  2DEJ A;  2EN3 A;  3DJW A;  4Q28 A;  4X66 E;  1I94 E;  1H72 C;  1FWK A;  2UXD I;  1EH8 A;  3ADI A;  1R6L A;  3HUL A;  3LNU A;  2YTQ A;  4IZK B;  1U2R A;  3MHS C;  1YHC A;  2M1S A;  1A1G A;  3WU6 A;  3JAM C;  2EOR A;  2RS7 A;  4N4R B;  3THN A;  4F9C B;  1ZAA C;  3PYD A;  5KL3 A;  1A1F A;  1FKA E;  2EN6 A;  5DRP A;  2JEA A;  2EOE A;  3T1H I;  5C0X A;  1X6E A;  2YSO A;  4DV4 E;  3OTO I;  3EPL A;  2N3H A;  1ZM9 A;  4LTY A;  4JI6 E;  4BA2 A;  4HAC A;  3B8H A;  2NN6 A;  3EPK A;  3OTO E;  2EOJ A;  2EM3 A;  4B3M E;  2M9A A;  3EPH A;  2EOS A;  4OO1 A;  4DV0 I;  2BBG A;  1K47 A;  4B3R I;  2JEA B;  1NEI A;  2UU9 E;  2EPP A;  1Y4U A;  5K36 F;  1IMU A;  1A1L A;  2YRM A;  1IBK E;  4ISA A;  1HR0 I;  2L33 A;  2DMY A;  4IFD F;  3PYF A;  5EKW A;  2JXP A;  4MU3 A;  2IES A;  2VF3 A;  2JOB A;  5KL6 A;  3PYG A;  1DGC A;  1FJG E;  1RQ0 A;  3FIG A;  5FLX Q;  3VHT B;  1UN6 B;  2UXD E;  4WXC A;  4Q35 B;  3ADJ A;  2EOQ A;  5C0X C;  1HNZ I;  2V8P A;  4MDT A;  2V83 A;  5A6J A;  4M30 A;  4DV7 E;  4LF5 E;  1B62 A;  1EA6 A;  2EPA A;  3EPJ A;  2HFU A;  3QG5 C;  4OKG A;  5AAS A;  2DRP A;  5AC4 A;  4LF5 I;  2EM0 A;  2D9H A;  1ELO A;  3WU5 A;  1STU A;  5AC5 A;  2ZBK B;  1FNM A;  3KZY A;  2VQF I;  4ZVI A;  4USK A;  2VRD A;  3HQ1 A;  1EH6 A;  2OI2 A;  5A6K A;  4NXN E;  5KL4 A;  2LT7 A;  1ZBQ A;  4N3O A;  4JYA E;  1A6F A;  3H4L A;  1T4O A;  2HHH E;  2NUG A;  1IBM I;  3BID A;  4KHP I;  1QU6 A;  4R2P A;  5C0X E;  1KTV A;  2EMK A;  2EE8 A;  5AE3 A;  2YTG A;  1S16 A;  2LRS A;  2EPZ A;  2NN6 F;  2PO0 B;  3ZM7 A;  5IWA I;  4LPF A;  1XNR I;  3L00 A;  2CZ9 A;  4DV4 I;  4OO1 C;  4M1K A;  3DF6 A;  1RHY A;  1GZ6 A;  2BR2 B;  4JI5 I;  2EM6 A;  2YTI A;  2BV3 A;  4JI1 E;  1EI1 A;  4X62 I;  2YTO A;  4R03 A;  2DSY A;  2EMZ A;  4DV1 I;  1X5W A;  3IWD A;  4BHB A;  1KJK A;  2LVH A;  2BM0 A;  2WP8 A;  2BA1 G;  4R1F A;  1RRE A;  2VQF E;  5AE2 A;  3P1X A;  2EN1 A;  4DR3 E;  1H7U A;  2MKD A;  3C4T A;  2C37 A;  1LLM C;  3CDI A;  4X8W A;  3QT6 A;  4B3T I;  1Y5Y A;  4Z7C A;  4YY3 E;  4P52 A;  2VQE E;  4QNJ A;  2LUQ A;  2WBU A;  1ZBT A;  2EOI A;  4JI8 E;  1RR9 A;  3ADG A;  3HTX A;  1T4L B;  2O1U A;  4K0K E;  5DRR A;  2GO4 A;  5DNX A;  1O0W A;  4WSP A;  4WXD A;  4DR6 E;  3ZZ0 A;  4IFD B;  4FW9 A;  3K85 A;  2JWO A;  1OYP A;  3GON A;  1DI2 A;  4U3D A;  4DUY E;  1WXR A;  3GME A;  4FW6 A;  3ZKB A;  1ZXM A;  4OX9 E;  1R6M A;  4WFT A;  3ZOQ B;  4NXM I;  2EQ3 A;  1NCS A;  4IZJ D;  2VES A;  2H36 X;  4LF4 I;  4LCG A;  3C6K A;  1B69 A;  2V34 A;  4ED4 A;  2Q8U A;  2UUC I;  2ELY A;  4DV3 E;  4DV2 I;  4P78 A;  1N34 E;  2DGC A;  1UDN A;  4DXL A;  3KZZ A;  2RQL A;  5KL2 A;  1MX0 A;  5LMU I;  1RMD A;  4BBY A;  4DV2 E;  2EMW A;  1YUI A;  1YYK A;  2L2N A;  2LTS A;  4IZJ B;  2E72 A;  2E1R A;  2Z5E A;  1HNX I;  4IS1 C;  1G2F C;  1UDQ A; 
#chains in the Genus database with same CATH homology
 4YY3 I;  4JG4 A;  4FN5 A;  4WUC A;  3J7A G;  1FJG I;  4I3H A;  3JAM Q;  3J81 Q;  2PNL A;  3K1J A;  3VK6 A;  1H73 A;  1XMO I;  2PNM A;  2EFG A;  1GQE A;  4X62 E;  4JI1 I;  1D6T A;  2HK3 A;  2UUA I;  4MYT A;  5L3J A;  3RMP A;  1VIS A;  4LFC I;  1Z5A A;  4YHH E;  2CG9 A;  2IOQ A;  4B3M I;  4I8O A;  2UXC E;  3PRY A;  1WHQ A;  4LF7 I;  1S4E A;  1T4N A;  1Z59 A;  2NPF A;  2WZO A;  4B3S E;  1X48 A;  2ZIT A;  1J26 A;  4B3S I;  4P7A A;  2RS6 A;  4DR7 E;  3T1Y I;  1MG7 A;  1IBL E;  4DUY I;  5LMN E;  4JI7 E;  1X47 A;  4LFA I;  5FLX C;  1Z0E A;  2LTR A;  3MSW A;  4GKK I;  1Z5B A;  1B63 A;  4HYM A;  4BC7 A;  4URL A;  1Z5C A;  4B3R E;  4DR5 E;  4DV3 I;  4IZJ A;  1N34 I;  2X7I A;  2A2C A;  2M7Q A;  4DUZ E;  4DR4 I;  1PVG A;  4DR1 I;  4LF6 I;  4M0V A;  2L8T A;  3WU3 A;  4WUD A;  4L8N A;  4DPW A;  1N0V C;  1KKH A;  2MC6 A;  3ADL A;  4LU9 A;  1XHK A;  4X65 I;  4K0K I;  2B9D A;  5CFF E;  2JVA A;  2K4V A;  2O1T A;  2FTX B;  4X65 E;  1WHN A;  1Y6Z A;  5LMN I;  3C4B A;  3T1H E;  4JI7 I;  3K17 A;  5BR8 E;  4GKK E;  2UUC E;  2E5L E;  2ZM6 E;  4DPT A;  4KHP E;  4F9B B;  4LF4 E;  2L2K B;  5GMD A;  1XNQ I;  1IBM E;  4X64 E;  2FGG A;  2ODR D;  3QT8 A;  4JI4 E;  4LF9 I;  1N0U A;  4HY1 A;  1IBK I;  4TUI A;  1ZXN A;  1I94 I;  3B78 A;  1XNR E;  1USV A;  4GKJ I;  1HNW E;  5A2Q C;  2WW4 A;  3HPS A;  2B7V A;  3VYY A;  4GKJ E;  2JOX A;  4USM A;  5IT9 C;  3JU0 A;  4KQV A;  4DV6 I;  5T6J A;  4HXZ A;  2F8B A;  3HXL A;  2DIX A;  4XTJ A;  4DMI A;  4Z7Y A;  2KON A;  2R3V A;  3LTO A;  1N32 I;  1NHI A;  2VE7 C;  3LPS A;  4JI0 E;  2NA2 A;  4LF7 E;  1USU A;  2GS8 A;  1UHZ A;  2LJH A;  3F0N A;  2KOU A;  4F54 A;  4BC9 A;  4MYU A;  1UIL A;  1QZR A;  2B7T A;  2Z5B A;  4FWD A;  4DV5 E;  4M2Z A;  4AQY I;  1IBL I;  4OOG C;  4BMJ A;  4LFA E;  1YYO A;  4DR2 I;  5IT9 Q;  3J7Y p;  2HKE A;  3T1Y E;  3VYX A;  2HKJ A;  4OX9 I;  4NXM E;  4RPF A;  3Q6M A;  4DR2 E;  5A2Q Q;  2E5L I;  2V85 A;  2L6M A;  2L3J A;  4PRV A;  2V89 A;  2RTX A;  1XNQ E;  4DV1 E;  2IOP A;  2Q2E B;  2Z5C A;  2LUP B;  2IHR 1;  1HNX E;  3J80 Q;  1WUU A;  2UXC I;  2L3C A;  2E1M A;  1ZM4 A;  4JI6 I;  3JTZ A;  3J81 C;  1Z0W A;  1DQ3 A;  4DR3 I;  4B3T E;  4HAC B;  2NUF A;  3V5R A;  2LE2 A;  1NHJ A;  4JV5 E;  3OML A;  4DR1 E;  1XMO E;  4TUG A;  1XMQ I;  2KHX A;  3H09 A;  2UUA E;  2V2Z A;  2AJ4 A;  3QT5 A;  4UT4 A;  2VF1 A;  2X36 A;  5FWK A;  4DU8 A;  4WPY A;  3HPZ A;  4FWH A;  3F6H A;  3AV0 A;  2V86 A;  4PU9 A;  2ZM6 I;  4WUB A;  1Z0C A;  2EZ6 A;  4LF8 I;  3HJC A;  5F3W A;  1HNZ E;  4DR5 I;  2MC5 A;  1Z0B A;  1NHH A;  3QT7 A;  1J5E I;  4DV7 I;  1PKP A;  3AUZ A;  3IWB A;  3P06 A;  4FWG A;  1H7S A;  2UXB E;  2MDR A;  1SR9 A;  1UEK A;  3WU4 A;  4JI4 I;  5AE1 A;  4LFB I;  2HK2 A;  2CGE A;  2V2V A;  4DR4 E;  4DR7 I;  4BS9 A;  4LF6 E;  1FWL A;  4EMD A;  3J7A M;  3ZKD A;  4JV5 I;  4F9A B;  2Z5B B;  2JR1 A;  3K6Q A;  1RC7 A;  1NZ0 A;  2ODR C;  4DV6 E;  3IWC A;  4DR6 I;  4R8O A;  2DB2 A;  4JI2 E;  1N36 I;  4PRX A;  1YZ9 A;  3Q6N A;  2B3T B;  2V87 A;  4LF8 E;  4LFC E;  2DEI A;  3M6A A;  2UUB E;  5ADZ A;  4YHH I;  4BCA A;  4JI0 I;  1N33 E;  1EKZ A;  4JI3 E;  2GQ0 A;  2FV4 B;  2V88 A;  1ZM2 A;  1KVK A;  2V2Q A;  4L5N C;  3B82 A;  4NXN I;  1HR0 E;  4JYA I;  2O1W A;  2CPN A;  1DAR A;  2HHH I;  2UXB I;  2YT4 A;  2LBS B;  4DPX A;  1Z0G A;  2UU9 I;  1X49 A;  1XMQ E;  1PIE A;  2HFS A;  1ZM3 A;  2JY9 A;  1FI4 A;  4DPU A;  4X66 I;  5LL6 R;  1HNW I;  3ZZT A;  2VQE I;  3J80 C;  1H74 A;  4JI8 I;  2LJP A;  3D4J A;  3V2U C;  1Z0T A;  1N36 E;  1MU5 A;  1BKN A;  4P7D A;  5GME A;  4X64 I;  1N32 E;  4LF9 E;  2UUB I;  4JI3 I;  4LFB E;  3CWV A;  4DUZ I;  4WYQ B;  2NUE A;  2N3G A;  3LML A;  2Z5C B;  2RSM A;  2O1V A;  4DPY A;  4DKK A;  2V8Q B;  5LMU E;  4JI2 I;  5IWA E;  2R42 A;  1HK7 A;  1YYW A;  1KIJ A;  4GEQ B;  2L2M A;  4J8Z A;  2L92 A;  5DNY A;  3Q1Q A;  1N33 I;  5BR8 I;  4JI5 E;  2EWL A;  4DV0 E;  1OJ4 A;  2BM1 A;  2J7K A;  4UTG A;  4KHP I;  1J5E E;  4KZS A;  3KWR A;  2F4V I;  2XEX A;  4IZK A;  2YZT A;  3F6G A;  4DU7 A;  4AQY E;  1Y4S A;  3ZZU A;  4DV5 I;  2F4V E;  2A2D A;  2LMZ A;  3PYE A;  3LLH A;  2G7H A;  2M4I A;  2DEJ A;  1H72 C;  3DJW A;  4Q28 A;  4X66 E;  1I94 E;  1FWK A;  2UXD I;  3ADI A;  3HUL A;  3LNU A;  4IZK B;  1U2R A;  2M1S A;  3WU6 A;  3JAM C;  2RS7 A;  4F9C B;  3PYD A;  1FKA E;  3T1H I;  4DV4 E;  3OTO I;  1ZM9 A;  2N3H A;  4LTY A;  4JI6 E;  4HAC A;  3B8H A;  3OTO E;  4B3M E;  4DV0 I;  4B3R I;  1K47 A;  2UU9 E;  1Y4U A;  1IBK E;  1HR0 I;  2L33 A;  2DMY A;  3PYF A;  2VF3 A;  2JOB A;  3PYG A;  1FJG E;  1RQ0 A;  3FIG A;  5FLX Q;  2UXD E;  3ADJ A;  1HNZ I;  2V8P A;  1B62 A;  2V83 A;  4M30 A;  4DV7 E;  4LF5 E;  1EA6 A;  2HFU A;  5AAS A;  4LF5 I;  1ELO A;  3WU5 A;  1STU A;  2ZBK B;  1FNM A;  2VQF I;  4ZVI A;  4USK A;  3HQ1 A;  2OI2 A;  4NXN E;  1ZBQ A;  4N3O A;  4JYA E;  1A6F A;  3H4L A;  1T4O A;  2HHH E;  2NUG A;  1IBM I;  1QU6 A;  1KTV A;  5AE3 A;  1S16 A;  2LRS A;  3ZM7 A;  5IWA I;  1XNR I;  2CZ9 A;  4DV4 I;  4M1K A;  3DF6 A;  1GZ6 A;  4JI5 I;  2BV3 A;  4JI1 E;  1EI1 A;  4X62 I;  4R03 A;  4DV1 I;  2DSY A;  3IWD A;  2BM0 A;  4R1F A;  1RRE A;  2VQF E;  5AE2 A;  3P1X A;  4DR3 E;  1H7U A;  3C4T A;  4X8W A;  3QT6 A;  4B3T I;  4Z7C A;  4YY3 E;  4P52 A;  2VQE E;  2LUQ A;  1ZBT A;  4JI8 E;  1RR9 A;  3ADG A;  3HTX A;  1T4L B;  2O1U A;  4K0K E;  1O0W A;  4WSP A;  4DR6 E;  3ZZ0 A;  4FW9 A;  3K85 A;  2JWO A;  3GON A;  1DI2 A;  4DUY E;  1WXR A;  3ZKB A;  1ZXM A;  4OX9 E;  4WFT A;  3ZOQ B;  4NXM I;  4IZJ D;  2H36 X;  4LF4 I;  2V34 A;  4ED4 A;  2UUC I;  4DV3 E;  4DV2 I;  4P78 A;  1N34 E;  4DXL A;  1MX0 A;  5LMU I;  4BBY A;  4DV2 E;  1YYK A;  1HNX I;  2L2N A;  2LTS A;  4IZJ B;  2Z5E A;  2E1R A;  1Z0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...