4LFBK

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lfbK00
4JI5K 5AJ3K 1XMOK 1I94K 5LMUK 1HR0K 1XMQK 4JI6K 2ZM6K 3JAMO 4DV5K 3J80O 4DV6K 4DUYK 4YY3K 4B3TK 4B3MK 1XNRK 2UU9K 4DR3K 4K0KK 4DV4K 4DV0K 2UXCK 3T1HK 1J5EK 2HHHK 1IBKK 4OX9K 1FJGK 1N32K 4DV2K 4B3SK 4LF9K 1N36K 4DR6K 4X65K 5LMNK 4DR5K 2VQEK 1HNZK 4B3RK 4LF6K 4CVNE 4X64K 2UUBK 3T1YK 2UUAK 4LF8K 4X66K 4V19S 5A2QO 4JV5K 2UUCK 5BR8K 1XNQK 4JI2K 4YHHK 2E5LK 4DR2K 4KHPK 2VQFK 4LFBK 4JI1K 2F4VK 4LF4K 4DV3K 4JI0K 3J81O 4DR1K 4JI4K 1HNWK 1N34K 2UXBK 1N33K 5IWAK 4NXMK 4JI7K 4NXNK 1IBLK 1HNXK 3J7YP 1IBMK 4AQYK 4JYAK 4CW7B 5FLXO 3OTOK 4DUZK 4JI3K 4LF5K 2UXDK 5IT9O 4LFCK 3J7AP 4LF7K 4DR7K 4DV1K 4GKKK 4DR4K 5LL6Z 4LFAK 4DV7K 4X62K 4GKJK 4JI8K
chains in the Genus database with same CATH superfamily
2GEMA 1EP4A 3FZKA 2G8FA 3TAFA 1RILA 3KWIA 4BWJA 1S1TA 1XMOK 2ETJA 3QNNA 2KKZA 4FVMA 1JCFA 3MEDA 2G8VA 4OKJA 4QS7A 3AO3A 2FBYA 4B9VA 5JMVA 3HL8A 1YTAA 3H1VX 3LP3A 3WQTA 3IKMA 4W5QA 4CJQA 2FSNA 1N32K 4B3SK 3RRGA 2Q31A 2O8EA 3DOLA 4CHYA 3CCEN 1HNZK 3VGLA 4BRGA 5HP1A 3PIOL 1LV5A 3PX6A 2HF4A 1NGCA 3WXJA 1HKCA 1L3UA 5CYMA 1I3AA 2O8FA 3AVLA 3E9PA 4LD0A 3M5RA 1NWKA 2A1SA 3TPQA 2YNHA 4WFNL 3VQDA 4KTQA 5KGWA 2R7YA 4BROA 4BRAA 1W2BM 3MMVA 2F8SA 5AQQA 4OJRA 2HBMA 3ZT2A 3IMXA 1CZ9A 3AAQA 4CJ4A 3BUZB 3HXMA 3CFPA 4ZHRA 4ICLA 2ZJRL 5D3GA 1BWFO 3T3FA 4EP4A 4DCHA 4O8KA 1NGFA 1N6QA 1NGGA 4DQQA 1GLDG 3NH0A 4FLWA 1VSFA 1SS6A 3IDHA 4LSLA 4B1VA 3VEZA 1HYVA 4CE9A 3THVA 3VQ8A 4IJAA 3OYLA 3AO1A 3PO4A 2CGKA 1HUXA 1ATRA 3P39A 3LPTA 5IT9O 4CCHA 4CJUA 1C0MA 3NGYA 1ATSA 3A5MC 5AQKA 2X6SA 3VQ9A 5BPLA 4CJEA 1HJRA 4JAXA 2E6MA 3TAPA 3C6AA 4IXCA 4RWTA 4C8LA 3MWTA 3L0QA 3NBPA 3A5LC 4NCBA 3OYNA 4DF4A 2IAJA 1I94K 2NUBA 4LY7A 2CH6A 2H3GX 4DF8A 4NLCA 4E1MA 3JAMO 4FK0A 1XUPO 4AHCA 2ZJQL 5BR9A 4K42A 2WTUA 1LWCA 4BG9A 4EFHA 5FPNA 1YI2N 5CY4A 3SPYA 2BUPA 2AJQA 1X9JA 3JXUA 4DV0K 2E1YA 1JXEA 4Z4HA 4QOZB 3ZETB 3F9KA 2ZWHA 3HP6A 1NJWA 1JCEA 2HSTA 1MA9B 2NRWA 2P9LB 4FCYA 4O55A 3KD1E 3HP9A 4DWIA 2YHYA 1C6VA 4M3WA 2KFZA 1WBDA 4C1NI 2HNYA 3A2FA 1TYQA 3ZSYA 1VQ9N 1S3XA 3H08A 4FWQA 4CF1A 3HI0A 4PKIA 4HHTA 2Z1JA 1YVNA 4JKEA 3VF2A 3NF7A 4H0VB 3CQYA 2QA4N 1LCUA 3EEQA 3IFRA 1OH6A 1VQ7N 5C42A 1M90O 4DR1K 1LWFA 1N34K 3LM9A 4I2QA 1T03A 1RT4A 3QEVA 3MN6A 4NXNK 2YJEA 1RTIA 1F21A 2F7TA 3E1YA 2YX6A 3UB5A 3HPGA 2OA8A 5AQFA 4KAZA 3C94A 1VRUA 4HWIA 2ASOA 4TSXA 3V1OA 3VTIA 1VQ4N 3D2FB 3PO5A 4EAHD 1EETA 2P51A 1QZ6A 4JKGB 4WYBA 1EKEA 4ISGA 4CI6A 3CETA 2FXUA 3THWA 4H5VA 2Q97A 3DLKA 2OYQA 1T6DA 3RR7A 1CXUA 2VG7A 3HZ6A 3KIOA 3ZETA 4CFDA 3CM6A 4CF8A 1IKWA 3WXKA 5KQDA 4BR0A 4W5TA 1KC8O 2NRVA 4FJ7A 5ADXA 1G99A 1BCOA 4GV6A 5AQHA 1C1CA 4F4KA 3A5NC 1B92A 3V81A 4JN4A 3ITHA 2WOMA 1SQKA 4CGJA 2DTUA 4E89A 1WSHA 4NYFA 1REVA 3GDQA 1IKVA 1NLVA 5EY4A 3ZEUB 4IKFA 4FJKA 5GADP 4PWDA 2O8BB 3OBWA 5AQNA 1Z26A 4E1NA 2HW3A 4BACA 4PL8A 2IIRA 3CHWA 5EX5A 4CJWA 4CJKA 5LY3A 1Q18A 4FPAA 1N36K 4M3RA 1YJWN 4WQ5A 4DR5K 4AHRA 5F0XA 4EHTA 4E0DA 3LAKA 1WOQA 4CEOA 3ZT4A 3T1YK 3L6QA 1W97L 4DTPA 4CIEA 4KI6A 2P5OA 4IO9L 3NDKA 2QXLA 1J6ZA 2UUCK 4FWPA 4KI4A 2WONA 3CFRA 3D2FA 1IKYA 5LJVA 3IS9A 4CGGA 2A42A 3K9JA 4CEDA 4CJ5A 3F73A 3RMCA 1TK0A 4CBUA 3J81O 3K2PA 2A1RA 4IOAL 1HNWK 4PHTX 1JXBA 2RHKA 1RDWX 4CD3A 4A2AA 1X9MA 2KZZA 1UAXA 4IJNA 3KLFA 5CE3A 1NGJA 4AQYK 3O9RA 4CW7B 1XQSC 5F1XA 1QE1A 3WNFA 4KKOA 5ADXH 5KGXA 3CQXA 3OYAA 2FF3B 5AQRA 3EO3A 3I33A 3OJSA 1TKTA 4C8OA 3FLCO 4DSFA 2G8IA 1RDAA 2HHQA 2D0OA 4CFBA 5DMRA 3QIOA 3TTCA 4JEPA 1IH7A 4GKJK 4ISEA 2XY8A 3LDOA 4GV9A 1OVQA 4YDUC 2GWJA 3MX5A 1DKGD 3DJCA 1YT3A 3I0RA 3SUOA 1XMQK 5C0YA 2E6LA 3OS2A 3LAMA 1EO1A 1YHQN 2QWQA 3LPUA 4KTZA 4CESA 4FM1A 1K73O 3VF4A 4E7JA 2VYPA 2HB5A 2Q3SA 1XNRK 1DGKN 3OYGA 1RDDA 3NH1A 4DQSA 4ZTFA 1NOZA 3WXIA 1QQNA 2OTLN 3H3OB 1WBBA 3OJUA 1BIZA 4B1UB 3LDNA 4FJXA 3HVTA 4FWNA 3ZSZA 1C1AA 3UKRB 3S3OA 4FLVA 3AVMA 4BVPA 1SKWA 3VTHA 4FJ5A 1BQMA 4LF8K 4H0YB 4DTJA 5GAHP 3U4LA 1KXPA 5KI6A 3GBTA 2RN2A 3M1FA 2VWBA 2W6KA 4NB4A 2D0AA 5HOOA 1W9HA 3CC7N 3WNGA 3QMLA 3ZX0A 3EZ5A 3SLCA 2PZSA 3F2KA 2QI2A 3NFAA 3U6FA 1Z6RA 3QO9A 3SBGA 2GBZA 3UE5A 2D4WA 1K8AO 3TAGA 1HNXK 4M41A 3K58A 5AQJA 1D5AA 4NCAA 4DFMA 1WSJA 3SV3A 3LP1A 3TWHA 5CZ2A 2VGMA 1VQLN 3VEWA 3LP0A 4DS4A 1OH5A 3WEEB 1Z25A 4LSNA 3CMAN 4HUEA 3L2UA 1SV5A 4CGDA 2VWKA 2KLAA 4O0IA 1BU6O 4DHYA 3O4QA 3OY9A 1WN7A 3DXKB 3V9XA 1BCMA 1E3MA 2E2OA 3KK2A 1P8ZA 1VQ5N 2NNWA 1NOYA 2Y1IA 4E1JA 4CIFA 3SPZA 4N5SA 3UIQA 3VQBA 2NRRA 3LWMA 1JLQA 4PKHA 4JKCA 3ZLJA 1I39A 4AF1A 1RDBA 3AVAA 3ENHA 4BQLA 1BOTO 2VGNA 3RSEB 4DUYK 2XO7A 2ASPA 1S1WA 2HHTA 3O9TA 3VQ6A 2P9UB 4U67L 4DR3K 1RGIA 1FXXA 4DV4K 4E7IA 4AHUA 4FWMA 3Q7CA 2QK9A 2CH5A 5KTQA 3VA3A 3ASMA 3QIPA 3HVRA 2D5RA 4AHTA 5M1PA 3OYCA 3SQ4A 3TSPA 1NJYA 1GLLO 3PSFA 3AO2A 3RMBA 4H4OA 4OLBA 5E84A 1U4BA 2FSKA 3O6WA 2ZD1A 3FFKB 3ZT0A 1N8RO 3LDQA 5BN9A 4YOTA 1U2VB 1GOBA 2W6LA 3OYJA 3VETA 3THXB 4ELTA 2F4VK 4JKHA 4CECA 4BE0A 4K25A 2GTDA 2QKBA 1RTHA 3DLRA 5AQXA 4NXMK 4BR9A 5BRHA 3OYMA 1UA1A 3EN9A 1HKBA 4CERA 1KVCA 3TARA 2NLXA 5HLFA 1L3VA 2P9IA 2Q1NA 1OH7A 3OTOK 2ZF5O 3ZT3A 2I7NA 4FK2A 1NMNA 3L2RA 2E20A 3MXMA 3A8YA 3V9WA 4DV1K 3TR8A 2XY7A 3CJ7A 3VMFB 2O8EB 4BRKA 1G15A 3NF9A 1ZC6A 1DTQA 1S22A 1VRTA 3DYAA 5JICA 4CJLA 4CJVA 3D0PA 3QEPA 5JVGL 2V51B 3RMAA 2O8FB 4QAGA 1HJOA 4FWLA 2A41A 4B9MA 5BPNA 3HPOA 1QTMA 1HR0K 2V52B 4DSKA 3J80O 1SL2A 1QZ5A 1TAQA 4FLTA 4CZIA 1N5YA 1TL1A 4CF2A 3SCXA 3O9SA 4JKAA 3QLHA 3L4IA 4B1YB 4QS8A 2VWJA 3THXA 3CJBA 1T05A 3WQUA 3S3NA 2QEXN 4JK9A 1TUUA 2E2PA 1FJGK 3ATUA 4IO8A 3ZSWA 4KV8A 3L3VA 3VQ5A 4A61A 3CYMA 2VQEK 1Q7YO 5EU7A 4B3RK 3KKRA 1KCFA 3O3FA 3IUCA 3C0BA 5EXWA 3M8QA 4FJGA 1FK9A 3TAEA 4CZMA 1JLEA 1KTQA 2Z1GA 3QDKA 1RFQA 1VQPN 1NK8A 1XI1A 2VQFK 2AA4A 3CFOA 1Q86O 5KPRA 5E26A 4BRCA 4CK3A 3LL3A 1QQCA 4JI0K 2HF3A 1Q9XA 4MDBA 3EZWA 5CZ1A 3VQCA 2F9WA 1KLMA 4G9ZA 4H5RA 4JS4A 2FBTA 1HQUA 3DM2A 4WF9L 4FWSA 4CF9A 4JKFA 5AQMA 5JS2A 3RMDA 3I8DA 4KREA 1NJZA 1LAVA 4FJ9A 4DFKA 3OA9A 3ISNC 3WXLA 2OANA 1WSIA 3KWGA 2IS3A 1NU0A 4BRQA 3NH2A 1HQEA 3CCVN 2IC3A 1BI4A 1NJIO 1TYQB 3MDQA 1RT5A 4I7FA 1NM1A 1B9DA 3C6HA 4OPHA 3OS1A 3RWUA 1RT2A 3P31A 3WXMB 3CCRN 3DAWA 3BZCA 4DSLA 1IO2A 3O9QA 4IFEA 4L8RB 4M7XA 3MEGA 3D45A 3QBXA 1ZBLA 1VSKA 3M3ZA 4GMJB 4B1WB 1GOAA 1T6CA 4CJ3A 4K0KK 4DG1A 1FW6A 3KK3A 4IEEA 4F9OA 3QEIA 1J5EK 2YCHA 3Q7BA 4GV3A 2OPQA 1TK5A 3LANA 1ZBFA 3SQ0A 5I42A 3FE1A 2IDOA 3KHYA 1HYZA 3KD5E 1VSDA 4CGFA 3IAYA 4CVNE 3HSCA 4H0PA 4E19A 3SQ2A 1RTDA 3K5OA 2X74A 3CF5L 5AQWA 1HKGA 3THWB 3HO1A 3VQPA 1KD1O 4DTNA 1KVAA 3ZX3A 4BRNA 1S9EA 3PIPL 3O3HA 4DS5A 1WAJA 2YNFA 4JKBA 4KHWA 1BISA 2P9PB 1VQON 4FK4A 3C6UA 5AQUA 4LH4A 3R1XA 3SK3A 1BA1A 1N33K 4JK7A 5AQVA 1UA0A 3O4WA 3HJFA 1NKBA 4JS5A 2ZE2A 3HK2A 3BDPA 1GLBG 2FLOA 1FKOA 4CFAA 5AQSA 1JLBA 4NYNA 4CK2A 4DQRA 1HLUA 3AVFA 2HVIA 1JLFA 1OVYA 3W0LA 1C0FA 2F8TA 1YF5L 2IOCA 4GKKK 4ILGB 4LFAK 4O4GA 1K8KB 1YJNN 1SKRA 4CJTA 2ZQBA 5H1SQ 2EX3A 1A5WA 1YUWA 1BG3A 1ZXOA 1YJ9N 1T8EA 3PLAA 2QWNA 4K8ZA 4W5OA 2OPRA 3CCUN 3FFIA 4JI5K 3BF1A 3CM5A 4CIGA 4M3ZA 3D2EA 1E4GT 4BE2A 4CZEA 3NMUA 5JLHA 2W40A 3AO4A 1YITN 4L3QA 1IG9A 3O1WA 4BE1A 4DV6K 1YAGA 5EVZA 1LAWA 1XC9A 4G1QA 3VEVA 3NAEA 3AA5X 1NKCA 4FW1A 3CCJN 5J2PA 2O8DA 2P9PA 4GW6A 3T1HK 1XWLA 4DTOA 2X6NA 2KTQA 4I9LA 4WQ5C 2D1KA 2HHHK 3MX2A 1H1VA 3ULEA 1K6YA 3W3DA 4CJSA 1WAFA 3ZSVA 3ZSQA 4JK8A 2EHGA 3MK6A 3E66A 3KTQA 3OYDA 2UUBK 4CHNA 3P83D 1WNSA 4C23A 3KVGA 4OVLA 4KHYA 2HMIA 4F8RA 4V19S 4N76A 3WNEA 2Q2RA 3DLEA 4H5NA 5C12A 4PL7A 3QFPA 3DRSA 4FL9A 4RW7A 1NK5A 3M8SA 4C1NK 5AFUA 1EWRA 4RW6A 1ATNA 3SAGA 1NGDA 1K8KA 2JWLA 4FW2A 1J53A 2PYJA 5SWMA 1TV6A 4FOEA 3G10A 3OS0A 3SYZA 4OGCA 3LWLA 2A5XA 3NVKA 1WSGA 5FRMA 1SL1A 3WNHA 5K14A 4UQGA 4H5WA 4E7HA 3L4QA 1TK8A 1ZBSA 4DB3A 3H6EA 3HTVA 3LZJA 2QWMA 1C0TA 2E8AA 1GLFO 3U3YA 1YVUA 4FJIA 3SNNA 5CHIA 4YOUA 5J2QA 4CEFA 4DFPA 3JYTA 2OPSA 3PY8A 5GAGP 3SI6A 5B8HA 1K9MO 3MCPA 4B8AB 4DTSA 1LW2A 4JI6K 1NK6A 4DU3A 3EKUA 4ID1A 3R3LA 1VK0A 3MXIA 1U49A 4M3YA 1BUPA 3VEYA 2P9NB 3O08A 4ID5A 3QNOA 2XHBA 4FZYA 3AVGA 2BE2A 1BL3A 1JL2A 5BRDA 3JSMA 2FBXA 1U45A 1UWBA 1E4FT 3MN9A 3J8AA 5M1NA 3VGMA 1ZYQA 2QKKA 5SZTA 2HHXA 1NK9A 4LF9K 4YORA 1TUYA 3AARA 5LMNK 4DTMA 5AFUH 4FVUA 4O44A 4GY2B 1RDCA 5HRPA 4J8FA 3DI6A 4E7KA 3P5JA 3G4SN 2BDPA 3B6PA 2OPPA 1U6ZA 2YHBA 4RW9A 4FJNA 1WSEA 3CI5A 3V9UA 3PV8A 1P90A 4IG0A 3C95A 2QXFA 2Q0UA 4BVOA 5BN8A 3V9ZA 4LFBK 4IEIA 4CJFA 4JI1K 4Z94A 4FWOA 1NMDA 1TAUA 4BRMA 2O4GA 3DXMA 3N4QA 3CCQN 3CD6N 4WCEL 4O5FA 2A6AA 4A5AA 2F9TA 1TKZA 2DFHA 2BH1A 4MLHA 3MCAB 3E01A 3H1QA 4BRPA 2PYLA 4JI3K 5GAEP 3J7AP 1QVFM 2P9NA 4CZHA 3DLLL 2YV0X 2HBJA 4M3XA 4B8CA 2WFBA 3E9LA 3DLHA 4CJRA 1S72N 4CHZA 4F2RA 5DK5A 4IDHA 1CZAN 1ZBUA 4EHUA 1J5OA 4MFBA 1RT1A 1BDGA 1S1UA 3QEWA 3RR8A 1IG8A 4X62K 4DV7K 1TGOA 1JLAA 4FLXA 5AJ3K 4FLUA 1A5XA 2ATQA 3E9OA 4C8KA 3GL1A 3OYEA 1QSLA 3CJ1A 4XH4A 3O3GA 4MLEA 4Z4IA 4DLEA 3SUPA 3H3NO 2YJFA 4KPYA 4BRIA 2DFFA 4CEAA 5GIPA 1Z05A 4KH5A 1U48A 1WB9A 2DPNA 4CF0A 4MDAA 4FLZA 1LW0A 4B9LA 3NF6A 1W7AA 5JS1A 2BANA 2GX9A 2XY6A 4FJJA 3TSUA 5GINA 1IBKK 4M3TA 2P9IB 4OO1J 2HNDA 4FWKA 4DR6K 2B6AA 2PFUA 3CC2N 3T19A 3CG7A 2IGIA 4LF6K 5AQPA 3SJJA 4BDPA 3HT3A 1GLCG 5J2NA 2ITGA 3LDLA 1NGHA 1RBSA 1X1PA 3QBWA 4OGEA 1BO5O 4DTUA 4JI2K 4BGAA 3G71N 1KAYA 5HROA 1U47A 3VA0A 1QQMA 3UKUA 3GG4A 4Y0WA 1HNIA 3MWPA 4XH5A 3LDSA 4LF4K 3BF3A 3AA4A 3OHRA 1NGEA 5IWAK 1TKXA 2B4JA 3OBYA 3QERA 2G8HA 1ASUA 5TKWA 3TU5A 3J7ZO 4AILC 4HTUA 1YXQA 3VERA 4DU1A 5FROA 3KLEA 2E1ZA 3TSQA 1X9SA 1TKDA 3O5BA 4J2BA 2XRIA 4PKGA 5J2MA 3DWLA 4HCCA 5AR0A 5LL6Z 2P9KA 1T44A 3VOVA 3R8EA 4CZLA 4AHVA 1RT3A 4M45A 3A0IX 3BEXA 3MN5A 4JI8K 3AVNA 3AVJA 3FR0A 5MLCQ 5KRTA 4WFBL 4LH5A 3S3MA 4CBWA 5E41A 2JLEA 5AZJA 4O5BA 1SAZA 1RNHA 2NRHA 1Q82O 4DV5K 1NGAA 1NK7A 2PBDA 4YY3K 3H46O 5M1QA 2E2NA 1S6QA 3BGRA 2OCEA 3AVIA 1ASVA 3MN7A 1DEJA 1QSSA 4JD2A 4FXDA 2W41A 3ID8A 1KFDA 1BGXT 2HHWA 2HMPA 1ESVA 3VQEA 3OW2M 1ILYA 3L3UA 1Q8IA 3HRGA 3GE1A 1C1BA 1LWEA 4X64K 3OYIA 3V6DA 4IDKA 3CJAA 2RF2A 3QB0A 1HX1A 3B8AX 1YIJN 3CCLN 3RRHA 2E5LK 4DR2K 4WQ4A 2IVOA 5AQTA 1QQOA 3O1BA 4RG8A 1BI4B 1JCGA 3U9ZA 3T7ZA 5BREA 1VQMN 5AZIA 2OZMA 2FF6A 3CCSN 1EQYA 4OKEA 4DV3K 1VQKN 5C2FA 5CYQA 1SKSA 4JI7K 4JKDA 1HNVA 2BGGA 2V7YA 4EZ6A 2DY4A 2GUPA 4Z0UA 3C7NB 4HTLA 1VSIA 3NF8A 4CD1A 4CFCA 3ZCMA 5T7BA 3K5MA 4J2DA 3DLGA 1GLJO 4KBOA 4IWVA 5HRRA 2J4RA 1WSFA 5C15A 3KK7A 1RBUA 4BDZA 1JJ2M 3V9SA 4FO0A 3TABA 1NG9A 1EXQA 4ELUA 4J2AA 1X9WA 4LC9B 4BR5A 3ATVA 4BG8A 1T3VA 4KHNA 4CZJA 3RVCA 3SMPA 4FJMA 2O8CB 2JWKA 3CJ9A 4BRHA 2OTJN 5AQZA 1BQNA 2RKIA 3O8MA 2A40A 4HUFA 3QFUA 3IG1A 4DKWA 1Y64A 4FJ8A 1WUAA 3O9UA 5HRSA 4Z4FA 3L8BA 1IJJA 1W0HA 4AHSA 4ELVA 4CEEA 3K5NA 3FZFA 3SQ1A 1D9FA 3AO5A 4FSVA 3EL2A 2NRXA 1S1XA 4Z4CA 2PY5A 2VG5A 2ZGZA 2QWLA 3L2VA 3P38A 1QS4A 4BR4A 5CR4A 3K57A 3F5TA 3C7NA 5HL7L 4X66K 1HYSA 3R6MA 4I6MB 2E2QA 2YI1A 4BC5A 2KZMA 4B3OA 2ZJPL 2JGUA 1J54A 1KVBA 2I5JA 2NRZA 4CEQA 3FZMA 4FPBA 4JRPA 3SUQA 3D2EB 5I3UA 1NGBA 4JI4K 3L2WA 4CBXA 4CK1A 4O8UA 2KQ2A 1VSJA 4RCHA 1S1VA 5KPTA 1RT7A 2RPIA 5KQ8A 2QM1A 4OPJA 4N56A 1IBLK 1Q81O 3OYFA 4A2BA 4NCGA 3LP2A 2G8WA 3K9KA 4FWRA 4YFUA 1VSLA 4KH4A 1KRPA 1MWKA 5AQYA 4BC2A 4M7YA 3QESA 2O8CA 2HVHA 2W42A 2O8DB 3BZKA 4DUZK 1D8YA 2V7ZA 4CHPA 5HBMA 4LF5K 1EX4A 2F96A 3PSIA 4Q5VA 4EZ9A 1SUQA 1VSMA 4O0JA 3CC4N 3C6TA 3ULEB 1D4XA 2KHOA 2P9SB 4BRLA 4W5RA 3TI0A 4ZTJA 3AVBA 1X3NA 2Q36A 1DT9A 3NGZA 3A5OC 4A5BA 4KB1A 4DTRA 4ISFA 4KB0A 5ELZA 4K43A 4PY5A 3AGRA 4BQZA 3P4IA 2YKNA 4H0XB 3OYBA 4AM6A 5AQOA 1M1KO 2YHWA 3VENA 2O4IA 3TTFA 4I6MA 4Z4GA 1J9AA 2QWRA 4B3TK 3S41A 4B3MK 3ENBA 2LSNA 3I8BA 4DSEA 3O80A 4M63C 3ENOA 4KRFA 1Y97A 4C8NA 3DRPA 5I9EB 4B9UA 2NRTA 4BRFA 4QS9A 4KH6A 4BDYA 5FRNA 3VESA 2YHAA 3VQ4A 1RT6A 3AVHA 3QINA 3CIPA 1L3TA 5JVHL 4B1XB 4J2EA 4HUGA 4GVMA 3BP8A 3V1RA 3SMSA 1HMVA 1OKJA 1L5UA 3PX0A 4R5PA 2P1JA 1SL0A 5A2QO 3NCIA 4JV5K 4F3OA 2CGJA 3CERA 4YHHK 3EE8A 2UYTA 4FJLA 1O1WA 4W5NA 1XC3A 3I55N 2HNZA 4FM2A 4CZGA 4A62A 2P9SA 3L2QA 4GVEA 1V4TA 3VEXA 1GOCA 2WUSA 3DMJA 2G8UA 1VQ8N 1RBTA 2Z1IA 3AVCA 3EKSA 1ITGA 3CJCA 3N4PA 4H8KA 2FC0A 5AQLA 1MWMA 2P9LA 4BWMA 5C10A 4CJ7A 2YNIA 2WC9A 5FLXO 1KFSA 3SAFA 3NE6A 4H0TB 4FLYA 3SV4A 2UXDK 4IBNA 4CHQA 2E88A 3ALYA 4DR7K 3VF6A 4DR4K 4F3TA 4U7BA 2IVPA 4HVJA 4MO5A 4BY9C 3F9MA 2AP1A 5J1EA 1C0UA 1MDUB 3GOIA 1JL1A 1DLOA 4FJHA 1CZBA 5LMUK 1VQ6N 4Q0BA 1JLCA 2YHXA 3B6OA 4IZ9A 3M8RA 4H5TA 3ZX2A 3JS6A 5KRSA 1JLGA 4KHSA 4QCLA 4UY8O 2E4LA 3HBTA 5M1KA 3WT0A 1CXQA 1QHTA 3LALA 4EP5A 3H45C 4XIUA 3VEOA 1BA0A 3WUHA 4WFAL 3DXMB 4JKGA 4DTXA 3LM2A 3IRXA 3U3GA 4BGBA 5C24A 4CZKA 3I0SA 4I2PA 3I56N 3TAQA 3ULDA 4JHDB 4OX9K 3M6GA 1NGIA 3ID6A 1ASWA 4HCBA 4KHUA 2ITMA 4YOVA 5KPZA 5TKYA 3FZLA 2HBKA 2VG6A 4N41A 3LDPA 3VQ7A 5BR8K 3CPWM 4B9SA 4CGIA 4EIAA 4YNQA 1BIUA 5AQIA 3NVMA 4PUOA 5FDLA 3HM8A 1KSPA 4XH1A 4IOXA 1T7PA 1RBRA 2Q0RA 1Q9YA 3AVKA 4FYDA 1DTTA 4F2SA 3ZEUA 2HHUA 3ZSXA 3KLHA 1KAZA 1QVGM 2O8BA 4DQIA 3G6EN 1B9FA 2UXBK 4YOWA 1XHXA 1LOTB 4Y1CA 2QTDA 1L3SA 2GV9A 2KFNA 4K8XA 3J7YP 4IFYA 2GUIA 1IBMK 3M8PA 4JYAK 3G0ZA 4NO7A 3OYHA 4A59A 4DQPA 1GLEG 1S9GA 3HOSA 1ZBHA 2A3ZA 1NBWA 1YTUA 3ZT1A 3BY5A 4B08A 3KLGA 4H4MA 5DM7L 3CXCM 5M1FA 2D0PA 2HOEA 4JHDA 2YKMA 3V4IA 4KO0A 4YOYA 2FBVA 4FM0A 4A57A 1BHLA 3KLIA 4YDUA 2RE2A 2QWOA 3K5LA 3LZIA 2ZM6K 4FZXC 5BRFA 4NLBA 5C2DA 1RCHA 4B9TA 5HRNA 3VGKA 3OVNA 1V4SA 3UKUB 2OZSA 3D6RA 2YNGA 4N47A 1R0AA 3MEEA 3R9PA 4YOXA 4I9QA 3AY9A 4DMNA 2UU9K 4Y1DA 4BR7A 3K0SA 1NNEA 3VPZA 1NK0A 1HPZA 3DRRA 4OLAA 4DSJA 3G25A 2CGLA 4KTWA 4DU4A 3U8XA 3FZHA 1R59O 4ILJA 1TL3A 3NHGA 2UUAK 2ZGYA 4FOIA 2WBNA 4B9QA 3PX4A 1TVRA 4PA1A 2G8KA 3MXJA 4IOCL 1X3MA 4JRQA 4PQUA 3AGKA 4MQ3A 2P9KB 3HPHA 4FZZA 4M3UA 1XNQK 2XY5A 1FKPA 2P5GA 5LJWA 1RBVA 1A5VA 4AM7A 3DLBA 2NZTA 2IVNA 4OPKA 2ASMA 4DLGA 3T1AA 4Z4EA 1NJXA 3CQ8A 5AZJB 1XHZA 4CEBA 3KK1A 4DQ8A 4ILHA 2B5JA 4CJPA 1HPMA 4MO4A 3EE9A 1SZ2A 1IV0A 3QETA 1VSHA 2I7PA 1IKXA 3UKRA 3VQAA 4JD2B 4BR2A 1O13A 3CMEN 4LF7K 3ZSOA 3HYFA 2D0CA 5DM6L 2HHVA 4KHQA 3SBTA 5EOYA 3QICA 4AH9A 1C0GA 1UOCA 1VHXA 3THYB 3SJHA 5GIOA 2Y1JA 4E7LA 1OH8A 4OPAA 1RDUA 5BPMA 4DFJA 2GWKA 4RW4A 4CEZA 3K59A 3AA3A 4BRDA 3SZ2A 3T69A 4R79A 1S5JA 3AA2A 3HSTB 3RTVA 1S6PA 4BREA 1KAXA 4CGHA 4M42A 3CPEA 5FPMA 5AZIB 2FSJA 4E3SA 2HHSA 2BTFA 5C25A 2UXCK 4IFVA 3TAMA 4KFBA 5AQGA 3WEEA 2QWPA 3V1QA 1U04A 5F2RA 3O4NA 3HOTA 1VAZA 3P1GA 3HM9A 1HRHA 3MECA 3EY1A 4DV2K 4C8MA 3VN5A 2KW4A 1GLAG 4X65K 3EYZA 4BC3A 2VCPA 3C65A 4RTFD 3DXKA 4OKKA 3KKSA 4BC4A 5FPEA 1NKEA 1VQNN 1KQSM 4CZFA 3OYKA 2DFEA 3KJVA 1QSYA 2X78A 4WQ4C 3FGUA 3NGIA 3U9DA 4WE1A 4H0OA 4H03B 4KHPK 3SAHA 4CHOA 4JNEA 4DSIA 3RSEA 2QW9A 3SUNA 3S9HA 2P9UA 3THYA 1JKHA 3AAPA 3AV9A 1ZBIA 2PAVA 1RTJA 3MAQA 5FPDA 5M1OA 3ZSRA 4IG3A 1CLQA 4B1ZA 3D7EO 4K41A 1D9DA 1QHAA 3DOKA 3PUFA 5JLFA 3TTDA 1WLJA 4B9NA 4RW8A 3QEXA 1KLNA 4LFCK 3ZYYX 3TANA 4XEIA 3KZBA 3VQQA 1NK4A 2Z1HA 2EWSA 1MU2A 1EWQA 1U2VA 2HBLA 4JLHA 2GELA 3CCMN 1VSEA 2D0BA 4GNIA
chains in the Genus database with same CATH topology
4JI5K 5AJ3K 1XMOK 1I94K 5LMUK 1HR0K 1XMQK 4JI6K 2ZM6K 3JAMO 4DV5K 3J80O 4DV6K 4DUYK 4YY3K 4B3TK 4B3MK 1XNRK 2UU9K 4DR3K 4K0KK 4DV4K 4DV0K 2UXCK 3T1HK 1J5EK 2HHHK 1IBKK 4OX9K 1FJGK 1N32K 4DV2K 4B3SK 4LF9K 1N36K 4DR6K 4X65K 5LMNK 4DR5K 2VQEK 1HNZK 4B3RK 4LF6K 4CVNE 4X64K 2UUBK 3T1YK 2UUAK 4LF8K 4X66K 4V19S 5A2QO 4JV5K 2UUCK 5BR8K 1XNQK 4JI2K 4YHHK 2E5LK 4DR2K 4KHPK 2VQFK 4LFBK 4JI1K 2F4VK 4LF4K 4DV3K 4JI0K 3J81O 4DR1K 4JI4K 1HNWK 1N34K 2UXBK 1N33K 5IWAK 4NXMK 4JI7K 4NXNK 1IBLK 1HNXK 3J7YP 1IBMK 4AQYK 4JYAK 4CW7B 5FLXO 3OTOK 4DUZK 4JI3K 4LF5K 2UXDK 5IT9O 4LFCK 3J7AP 4LF7K 4DR7K 4DV1K 4GKKK 4DR4K 5LL6Z 4LFAK 4DV7K 4X62K 4GKJK 4JI8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 K;  5AJ3 K;  1XMO K;  1I94 K;  5LMU K;  1HR0 K;  1XMQ K;  4JI6 K;  2ZM6 K;  3JAM O;  4DV5 K;  3J80 O;  4DV6 K;  4DUY K;  4YY3 K;  4B3T K;  4B3M K;  1XNR K;  2UU9 K;  4DR3 K;  4K0K K;  4DV4 K;  4DV0 K;  2UXC K;  3T1H K;  1J5E K;  2HHH K;  1IBK K;  4OX9 K;  1FJG K;  1N32 K;  4DV2 K;  4B3S K;  4LF9 K;  1N36 K;  4DR6 K;  4X65 K;  5LMN K;  4DR5 K;  2VQE K;  1HNZ K;  4B3R K;  4LF6 K;  4CVN E;  4X64 K;  2UUB K;  3T1Y K;  2UUA K;  4LF8 K;  4X66 K;  4V19 S;  5A2Q O;  4JV5 K;  2UUC K;  5BR8 K;  1XNQ K;  4JI2 K;  4YHH K;  2E5L K;  4DR2 K;  4KHP K;  2VQF K;  4LFB K;  4JI1 K;  2F4V K;  4LF4 K;  4DV3 K;  4JI0 K;  3J81 O;  4DR1 K;  4JI4 K;  1HNW K;  1N34 K;  2UXB K;  1N33 K;  5IWA K;  4NXM K;  4JI7 K;  4NXN K;  1IBL K;  1HNX K;  3J7Y P;  1IBM K;  4AQY K;  4JYA K;  4CW7 B;  5FLX O;  3OTO K;  4DUZ K;  4JI3 K;  4LF5 K;  2UXD K;  5IT9 O;  4LFC K;  3J7A P;  4LF7 K;  4DR7 K;  4DV1 K;  4GKK K;  4DR4 K;  5LL6 Z;  4LFA K;  4DV7 K;  4X62 K;  4GKJ K;  4JI8 K; 
#chains in the Genus database with same CATH topology
 2GEM A;  1EP4 A;  3FZK A;  2G8F A;  3TAF A;  1RIL A;  3KWI A;  4BWJ A;  1S1T A;  1XMO K;  2ETJ A;  3QNN A;  2KKZ A;  4FVM A;  1JCF A;  3MED A;  2G8V A;  4OKJ A;  4QS7 A;  3AO3 A;  2FBY A;  4B9V A;  5JMV A;  3HL8 A;  1YTA A;  3H1V X;  3LP3 A;  3WQT A;  3IKM A;  4W5Q A;  4CJQ A;  2FSN A;  1N32 K;  4B3S K;  3RRG A;  2Q31 A;  2O8E A;  3DOL A;  4CHY A;  3CCE N;  1HNZ K;  3VGL A;  4BRG A;  5HP1 A;  3PIO L;  1LV5 A;  3PX6 A;  2HF4 A;  1NGC A;  3WXJ A;  1HKC A;  1L3U A;  5CYM A;  1I3A A;  2O8F A;  3AVL A;  3E9P A;  4LD0 A;  3M5R A;  1NWK A;  2A1S A;  3TPQ A;  2YNH A;  4WFN L;  3VQD A;  4KTQ A;  5KGW A;  2R7Y A;  4BRO A;  4BRA A;  1W2B M;  3MMV A;  2F8S A;  5AQQ A;  4OJR A;  2HBM A;  3ZT2 A;  3IMX A;  1CZ9 A;  3AAQ A;  4CJ4 A;  3BUZ B;  3HXM A;  3CFP A;  4ZHR A;  4ICL A;  2ZJR L;  5D3G A;  1BWF O;  3T3F A;  4EP4 A;  4DCH A;  4O8K A;  1NGF A;  1N6Q A;  1NGG A;  4DQQ A;  1GLD G;  3NH0 A;  4FLW A;  1VSF A;  1SS6 A;  3IDH A;  4LSL A;  4B1V A;  3VEZ A;  1HYV A;  4CE9 A;  3THV A;  3VQ8 A;  4IJA A;  3OYL A;  3AO1 A;  3PO4 A;  2CGK A;  1HUX A;  1ATR A;  3P39 A;  3LPT A;  5IT9 O;  4CCH A;  4CJU A;  1C0M A;  3NGY A;  1ATS A;  3A5M C;  5AQK A;  2X6S A;  3VQ9 A;  5BPL A;  4CJE A;  1HJR A;  4JAX A;  2E6M A;  3TAP A;  3C6A A;  4IXC A;  4RWT A;  4C8L A;  3MWT A;  3L0Q A;  3NBP A;  3A5L C;  4NCB A;  3OYN A;  4DF4 A;  2IAJ A;  1I94 K;  2NUB A;  4LY7 A;  2CH6 A;  2H3G X;  4DF8 A;  4NLC A;  4E1M A;  3JAM O;  4FK0 A;  1XUP O;  4AHC A;  2ZJQ L;  5BR9 A;  4K42 A;  2WTU A;  1LWC A;  4BG9 A;  4EFH A;  5FPN A;  1YI2 N;  5CY4 A;  3SPY A;  2BUP A;  2AJQ A;  1X9J A;  3JXU A;  4DV0 K;  2E1Y A;  1JXE A;  4Z4H A;  4QOZ B;  3ZET B;  3F9K A;  2ZWH A;  3HP6 A;  1NJW A;  1JCE A;  2HST A;  1MA9 B;  2NRW A;  2P9L B;  4FCY A;  4O55 A;  3KD1 E;  3HP9 A;  4DWI A;  2YHY A;  1C6V A;  4M3W A;  2KFZ A;  1WBD A;  4C1N I;  2HNY A;  3A2F A;  1TYQ A;  3ZSY A;  1VQ9 N;  1S3X A;  3H08 A;  4FWQ A;  4CF1 A;  3HI0 A;  4PKI A;  4HHT A;  2Z1J A;  1YVN A;  4JKE A;  3VF2 A;  3NF7 A;  4H0V B;  3CQY A;  2QA4 N;  1LCU A;  3EEQ A;  3IFR A;  1OH6 A;  1VQ7 N;  5C42 A;  1M90 O;  4DR1 K;  1LWF A;  1N34 K;  3LM9 A;  4I2Q A;  1T03 A;  1RT4 A;  3QEV A;  3MN6 A;  4NXN K;  2YJE A;  1RTI A;  1F21 A;  2F7T A;  3E1Y A;  2YX6 A;  3UB5 A;  3HPG A;  2OA8 A;  5AQF A;  4KAZ A;  3C94 A;  1VRU A;  4HWI A;  2ASO A;  4TSX A;  3V1O A;  3VTI A;  1VQ4 N;  3D2F B;  3PO5 A;  4EAH D;  1EET A;  2P51 A;  1QZ6 A;  4JKG B;  4WYB A;  1EKE A;  4ISG A;  4CI6 A;  3CET A;  2FXU A;  3THW A;  4H5V A;  2Q97 A;  3DLK A;  2OYQ A;  1T6D A;  3RR7 A;  1CXU A;  2VG7 A;  3HZ6 A;  3KIO A;  3ZET A;  4CFD A;  3CM6 A;  4CF8 A;  1IKW A;  3WXK A;  5KQD A;  4BR0 A;  4W5T A;  1KC8 O;  2NRV A;  4FJ7 A;  5ADX A;  1G99 A;  1BCO A;  4GV6 A;  5AQH A;  1C1C A;  4F4K A;  3A5N C;  1B92 A;  3V81 A;  4JN4 A;  3ITH A;  2WOM A;  1SQK A;  4CGJ A;  2DTU A;  4E89 A;  1WSH A;  4NYF A;  1REV A;  3GDQ A;  1IKV A;  1NLV A;  5EY4 A;  3ZEU B;  4IKF A;  4FJK A;  5GAD P;  4PWD A;  2O8B B;  3OBW A;  5AQN A;  1Z26 A;  4E1N A;  2HW3 A;  4BAC A;  4PL8 A;  2IIR A;  3CHW A;  5EX5 A;  4CJW A;  4CJK A;  5LY3 A;  1Q18 A;  4FPA A;  1N36 K;  4M3R A;  1YJW N;  4WQ5 A;  4DR5 K;  4AHR A;  5F0X A;  4EHT A;  4E0D A;  3LAK A;  1WOQ A;  4CEO A;  3ZT4 A;  3T1Y K;  3L6Q A;  1W97 L;  4DTP A;  4CIE A;  4KI6 A;  2P5O A;  4IO9 L;  3NDK A;  2QXL A;  1J6Z A;  2UUC K;  4FWP A;  4KI4 A;  2WON A;  3CFR A;  3D2F A;  1IKY A;  5LJV A;  3IS9 A;  4CGG A;  2A42 A;  3K9J A;  4CED A;  4CJ5 A;  3F73 A;  3RMC A;  1TK0 A;  4CBU A;  3J81 O;  3K2P A;  2A1R A;  4IOA L;  1HNW K;  4PHT X;  1JXB A;  2RHK A;  1RDW X;  4CD3 A;  4A2A A;  1X9M A;  2KZZ A;  1UAX A;  4IJN A;  3KLF A;  5CE3 A;  1NGJ A;  4AQY K;  3O9R A;  4CW7 B;  1XQS C;  5F1X A;  1QE1 A;  3WNF A;  4KKO A;  5ADX H;  5KGX A;  3CQX A;  3OYA A;  2FF3 B;  5AQR A;  3EO3 A;  3I33 A;  3OJS A;  1TKT A;  4C8O A;  3FLC O;  4DSF A;  2G8I A;  1RDA A;  2HHQ A;  2D0O A;  4CFB A;  5DMR A;  3QIO A;  3TTC A;  4JEP A;  1IH7 A;  4GKJ K;  4ISE A;  2XY8 A;  3LDO A;  4GV9 A;  1OVQ A;  4YDU C;  2GWJ A;  3MX5 A;  1DKG D;  3DJC A;  1YT3 A;  3I0R A;  3SUO A;  1XMQ K;  5C0Y A;  2E6L A;  3OS2 A;  3LAM A;  1EO1 A;  1YHQ N;  2QWQ A;  3LPU A;  4KTZ A;  4CES A;  4FM1 A;  1K73 O;  3VF4 A;  4E7J A;  2VYP A;  2HB5 A;  2Q3S A;  1XNR K;  1DGK N;  3OYG A;  1RDD A;  3NH1 A;  4DQS A;  4ZTF A;  1NOZ A;  3WXI A;  1QQN A;  2OTL N;  3H3O B;  1WBB A;  3OJU A;  1BIZ A;  4B1U B;  3LDN A;  4FJX A;  3HVT A;  4FWN A;  3ZSZ A;  1C1A A;  3UKR B;  3S3O A;  4FLV A;  3AVM A;  4BVP A;  1SKW A;  3VTH A;  4FJ5 A;  1BQM A;  4LF8 K;  4H0Y B;  4DTJ A;  5GAH P;  3U4L A;  1KXP A;  5KI6 A;  3GBT A;  2RN2 A;  3M1F A;  2VWB A;  2W6K A;  4NB4 A;  2D0A A;  5HOO A;  1W9H A;  3CC7 N;  3WNG A;  3QML A;  3ZX0 A;  3EZ5 A;  3SLC A;  2PZS A;  3F2K A;  2QI2 A;  3NFA A;  3U6F A;  1Z6R A;  3QO9 A;  3SBG A;  2GBZ A;  3UE5 A;  2D4W A;  1K8A O;  3TAG A;  1HNX K;  4M41 A;  3K58 A;  5AQJ A;  1D5A A;  4NCA A;  4DFM A;  1WSJ A;  3SV3 A;  3LP1 A;  3TWH A;  5CZ2 A;  2VGM A;  1VQL N;  3VEW A;  3LP0 A;  4DS4 A;  1OH5 A;  3WEE B;  1Z25 A;  4LSN A;  3CMA N;  4HUE A;  3L2U A;  1SV5 A;  4CGD A;  2VWK A;  2KLA A;  4O0I A;  1BU6 O;  4DHY A;  3O4Q A;  3OY9 A;  1WN7 A;  3DXK B;  3V9X A;  1BCM A;  1E3M A;  2E2O A;  3KK2 A;  1P8Z A;  1VQ5 N;  2NNW A;  1NOY A;  2Y1I A;  4E1J A;  4CIF A;  3SPZ A;  4N5S A;  3UIQ A;  3VQB A;  2NRR A;  3LWM A;  1JLQ A;  4PKH A;  4JKC A;  3ZLJ A;  1I39 A;  4AF1 A;  1RDB A;  3AVA A;  3ENH A;  4BQL A;  1BOT O;  2VGN A;  3RSE B;  4DUY K;  2XO7 A;  2ASP A;  1S1W A;  2HHT A;  3O9T A;  3VQ6 A;  2P9U B;  4U67 L;  4DR3 K;  1RGI A;  1FXX A;  4DV4 K;  4E7I A;  4AHU A;  4FWM A;  3Q7C A;  2QK9 A;  2CH5 A;  5KTQ A;  3VA3 A;  3ASM A;  3QIP A;  3HVR A;  2D5R A;  4AHT A;  5M1P A;  3OYC A;  3SQ4 A;  3TSP A;  1NJY A;  1GLL O;  3PSF A;  3AO2 A;  3RMB A;  4H4O A;  4OLB A;  5E84 A;  1U4B A;  2FSK A;  3O6W A;  2ZD1 A;  3FFK B;  3ZT0 A;  1N8R O;  3LDQ A;  5BN9 A;  4YOT A;  1U2V B;  1GOB A;  2W6L A;  3OYJ A;  3VET A;  3THX B;  4ELT A;  2F4V K;  4JKH A;  4CEC A;  4BE0 A;  4K25 A;  2GTD A;  2QKB A;  1RTH A;  3DLR A;  5AQX A;  4NXM K;  4BR9 A;  5BRH A;  3OYM A;  1UA1 A;  3EN9 A;  1HKB A;  4CER A;  1KVC A;  3TAR A;  2NLX A;  5HLF A;  1L3V A;  2P9I A;  2Q1N A;  1OH7 A;  3OTO K;  2ZF5 O;  3ZT3 A;  2I7N A;  4FK2 A;  1NMN A;  3L2R A;  2E20 A;  3MXM A;  3A8Y A;  3V9W A;  4DV1 K;  3TR8 A;  2XY7 A;  3CJ7 A;  3VMF B;  2O8E B;  4BRK A;  1G15 A;  3NF9 A;  1ZC6 A;  1DTQ A;  1S22 A;  1VRT A;  3DYA A;  5JIC A;  4CJL A;  4CJV A;  3D0P A;  3QEP A;  5JVG L;  2V51 B;  3RMA A;  2O8F B;  4QAG A;  1HJO A;  4FWL A;  2A41 A;  4B9M A;  5BPN A;  3HPO A;  1QTM A;  1HR0 K;  2V52 B;  4DSK A;  3J80 O;  1SL2 A;  1QZ5 A;  1TAQ A;  4FLT A;  4CZI A;  1N5Y A;  1TL1 A;  4CF2 A;  3SCX A;  3O9S A;  4JKA A;  3QLH A;  3L4I A;  4B1Y B;  4QS8 A;  2VWJ A;  3THX A;  3CJB A;  1T05 A;  3WQU A;  3S3N A;  2QEX N;  4JK9 A;  1TUU A;  2E2P A;  1FJG K;  3ATU A;  4IO8 A;  3ZSW A;  4KV8 A;  3L3V A;  3VQ5 A;  4A61 A;  3CYM A;  2VQE K;  1Q7Y O;  5EU7 A;  4B3R K;  3KKR A;  1KCF A;  3O3F A;  3IUC A;  3C0B A;  5EXW A;  3M8Q A;  4FJG A;  1FK9 A;  3TAE A;  4CZM A;  1JLE A;  1KTQ A;  2Z1G A;  3QDK A;  1RFQ A;  1VQP N;  1NK8 A;  1XI1 A;  2VQF K;  2AA4 A;  3CFO A;  1Q86 O;  5KPR A;  5E26 A;  4BRC A;  4CK3 A;  3LL3 A;  1QQC A;  4JI0 K;  2HF3 A;  1Q9X A;  4MDB A;  3EZW A;  5CZ1 A;  3VQC A;  2F9W A;  1KLM A;  4G9Z A;  4H5R A;  4JS4 A;  2FBT A;  1HQU A;  3DM2 A;  4WF9 L;  4FWS A;  4CF9 A;  4JKF A;  5AQM A;  5JS2 A;  3RMD A;  3I8D A;  4KRE A;  1NJZ A;  1LAV A;  4FJ9 A;  4DFK A;  3OA9 A;  3ISN C;  3WXL A;  2OAN A;  1WSI A;  3KWG A;  2IS3 A;  1NU0 A;  4BRQ A;  3NH2 A;  1HQE A;  3CCV N;  2IC3 A;  1BI4 A;  1NJI O;  1TYQ B;  3MDQ A;  1RT5 A;  4I7F A;  1NM1 A;  1B9D A;  3C6H A;  4OPH A;  3OS1 A;  3RWU A;  1RT2 A;  3P31 A;  3WXM B;  3CCR N;  3DAW A;  3BZC A;  4DSL A;  1IO2 A;  3O9Q A;  4IFE A;  4L8R B;  4M7X A;  3MEG A;  3D45 A;  3QBX A;  1ZBL A;  1VSK A;  3M3Z A;  4GMJ B;  4B1W B;  1GOA A;  1T6C A;  4CJ3 A;  4K0K K;  4DG1 A;  1FW6 A;  3KK3 A;  4IEE A;  4F9O A;  3QEI A;  1J5E K;  2YCH A;  3Q7B A;  4GV3 A;  2OPQ A;  1TK5 A;  3LAN A;  1ZBF A;  3SQ0 A;  5I42 A;  3FE1 A;  2IDO A;  3KHY A;  1HYZ A;  3KD5 E;  1VSD A;  4CGF A;  3IAY A;  4CVN E;  3HSC A;  4H0P A;  4E19 A;  3SQ2 A;  1RTD A;  3K5O A;  2X74 A;  3CF5 L;  5AQW A;  1HKG A;  3THW B;  3HO1 A;  3VQP A;  1KD1 O;  4DTN A;  1KVA A;  3ZX3 A;  4BRN A;  1S9E A;  3PIP L;  3O3H A;  4DS5 A;  1WAJ A;  2YNF A;  4JKB A;  4KHW A;  1BIS A;  2P9P B;  1VQO N;  4FK4 A;  3C6U A;  5AQU A;  4LH4 A;  3R1X A;  3SK3 A;  1BA1 A;  1N33 K;  4JK7 A;  5AQV A;  1UA0 A;  3O4W A;  3HJF A;  1NKB A;  4JS5 A;  2ZE2 A;  3HK2 A;  3BDP A;  1GLB G;  2FLO A;  1FKO A;  4CFA A;  5AQS A;  1JLB A;  4NYN A;  4CK2 A;  4DQR A;  1HLU A;  3AVF A;  2HVI A;  1JLF A;  1OVY A;  3W0L A;  1C0F A;  2F8T A;  1YF5 L;  2IOC A;  4GKK K;  4ILG B;  4LFA K;  4O4G A;  1K8K B;  1YJN N;  1SKR A;  4CJT A;  2ZQB A;  5H1S Q;  2EX3 A;  1A5W A;  1YUW A;  1BG3 A;  1ZXO A;  1YJ9 N;  1T8E A;  3PLA A;  2QWN A;  4K8Z A;  4W5O A;  2OPR A;  3CCU N;  3FFI A;  4JI5 K;  3BF1 A;  3CM5 A;  4CIG A;  4M3Z A;  3D2E A;  1E4G T;  4BE2 A;  4CZE A;  3NMU A;  5JLH A;  2W40 A;  3AO4 A;  1YIT N;  4L3Q A;  1IG9 A;  3O1W A;  4BE1 A;  4DV6 K;  1YAG A;  5EVZ A;  1LAW A;  1XC9 A;  4G1Q A;  3VEV A;  3NAE A;  3AA5 X;  1NKC A;  4FW1 A;  3CCJ N;  5J2P A;  2O8D A;  2P9P A;  4GW6 A;  3T1H K;  1XWL A;  4DTO A;  2X6N A;  2KTQ A;  4I9L A;  4WQ5 C;  2D1K A;  2HHH K;  3MX2 A;  1H1V A;  3ULE A;  1K6Y A;  3W3D A;  4CJS A;  1WAF A;  3ZSV A;  3ZSQ A;  4JK8 A;  2EHG A;  3MK6 A;  3E66 A;  3KTQ A;  3OYD A;  2UUB K;  4CHN A;  3P83 D;  1WNS A;  4C23 A;  3KVG A;  4OVL A;  4KHY A;  2HMI A;  4F8R A;  4V19 S;  4N76 A;  3WNE A;  2Q2R A;  3DLE A;  4H5N A;  5C12 A;  4PL7 A;  3QFP A;  3DRS A;  4FL9 A;  4RW7 A;  1NK5 A;  3M8S A;  4C1N K;  5AFU A;  1EWR A;  4RW6 A;  1ATN A;  3SAG A;  1NGD A;  1K8K A;  2JWL A;  4FW2 A;  1J53 A;  2PYJ A;  5SWM A;  1TV6 A;  4FOE A;  3G10 A;  3OS0 A;  3SYZ A;  4OGC A;  3LWL A;  2A5X A;  3NVK A;  1WSG A;  5FRM A;  1SL1 A;  3WNH A;  5K14 A;  4UQG A;  4H5W A;  4E7H A;  3L4Q A;  1TK8 A;  1ZBS A;  4DB3 A;  3H6E A;  3HTV A;  3LZJ A;  2QWM A;  1C0T A;  2E8A A;  1GLF O;  3U3Y A;  1YVU A;  4FJI A;  3SNN A;  5CHI A;  4YOU A;  5J2Q A;  4CEF A;  4DFP A;  3JYT A;  2OPS A;  3PY8 A;  5GAG P;  3SI6 A;  5B8H A;  1K9M O;  3MCP A;  4B8A B;  4DTS A;  1LW2 A;  4JI6 K;  1NK6 A;  4DU3 A;  3EKU A;  4ID1 A;  3R3L A;  1VK0 A;  3MXI A;  1U49 A;  4M3Y A;  1BUP A;  3VEY A;  2P9N B;  3O08 A;  4ID5 A;  3QNO A;  2XHB A;  4FZY A;  3AVG A;  2BE2 A;  1BL3 A;  1JL2 A;  5BRD A;  3JSM A;  2FBX A;  1U45 A;  1UWB A;  1E4F T;  3MN9 A;  3J8A A;  5M1N A;  3VGM A;  1ZYQ A;  2QKK A;  5SZT A;  2HHX A;  1NK9 A;  4LF9 K;  4YOR A;  1TUY A;  3AAR A;  5LMN K;  4DTM A;  5AFU H;  4FVU A;  4O44 A;  4GY2 B;  1RDC A;  5HRP A;  4J8F A;  3DI6 A;  4E7K A;  3P5J A;  3G4S N;  2BDP A;  3B6P A;  2OPP A;  1U6Z A;  2YHB A;  4RW9 A;  4FJN A;  1WSE A;  3CI5 A;  3V9U A;  3PV8 A;  1P90 A;  4IG0 A;  3C95 A;  2QXF A;  2Q0U A;  4BVO A;  5BN8 A;  3V9Z A;  4LFB K;  4IEI A;  4CJF A;  4JI1 K;  4Z94 A;  4FWO A;  1NMD A;  1TAU A;  4BRM A;  2O4G A;  3DXM A;  3N4Q A;  3CCQ N;  3CD6 N;  4WCE L;  4O5F A;  2A6A A;  4A5A A;  2F9T A;  1TKZ A;  2DFH A;  2BH1 A;  4MLH A;  3MCA B;  3E01 A;  3H1Q A;  4BRP A;  2PYL A;  4JI3 K;  5GAE P;  3J7A P;  1QVF M;  2P9N A;  4CZH A;  3DLL L;  2YV0 X;  2HBJ A;  4M3X A;  4B8C A;  2WFB A;  3E9L A;  3DLH A;  4CJR A;  1S72 N;  4CHZ A;  4F2R A;  5DK5 A;  4IDH A;  1CZA N;  1ZBU A;  4EHU A;  1J5O A;  4MFB A;  1RT1 A;  1BDG A;  1S1U A;  3QEW A;  3RR8 A;  1IG8 A;  4X62 K;  4DV7 K;  1TGO A;  1JLA A;  4FLX A;  5AJ3 K;  4FLU A;  1A5X A;  2ATQ A;  3E9O A;  4C8K A;  3GL1 A;  3OYE A;  1QSL A;  3CJ1 A;  4XH4 A;  3O3G A;  4MLE A;  4Z4I A;  4DLE A;  3SUP A;  3H3N O;  2YJF A;  4KPY A;  4BRI A;  2DFF A;  4CEA A;  5GIP A;  1Z05 A;  4KH5 A;  1U48 A;  1WB9 A;  2DPN A;  4CF0 A;  4MDA A;  4FLZ A;  1LW0 A;  4B9L A;  3NF6 A;  1W7A A;  5JS1 A;  2BAN A;  2GX9 A;  2XY6 A;  4FJJ A;  3TSU A;  5GIN A;  1IBK K;  4M3T A;  2P9I B;  4OO1 J;  2HND A;  4FWK A;  4DR6 K;  2B6A A;  2PFU A;  3CC2 N;  3T19 A;  3CG7 A;  2IGI A;  4LF6 K;  5AQP A;  3SJJ A;  4BDP A;  3HT3 A;  1GLC G;  5J2N A;  2ITG A;  3LDL A;  1NGH A;  1RBS A;  1X1P A;  3QBW A;  4OGE A;  1BO5 O;  4DTU A;  4JI2 K;  4BGA A;  3G71 N;  1KAY A;  5HRO A;  1U47 A;  3VA0 A;  1QQM A;  3UKU A;  3GG4 A;  4Y0W A;  1HNI A;  3MWP A;  4XH5 A;  3LDS A;  4LF4 K;  3BF3 A;  3AA4 A;  3OHR A;  1NGE A;  5IWA K;  1TKX A;  2B4J A;  3OBY A;  3QER A;  2G8H A;  1ASU A;  5TKW A;  3TU5 A;  3J7Z O;  4AIL C;  4HTU A;  1YXQ A;  3VER A;  4DU1 A;  5FRO A;  3KLE A;  2E1Z A;  3TSQ A;  1X9S A;  1TKD A;  3O5B A;  4J2B A;  2XRI A;  4PKG A;  5J2M A;  3DWL A;  4HCC A;  5AR0 A;  5LL6 Z;  2P9K A;  1T44 A;  3VOV A;  3R8E A;  4CZL A;  4AHV A;  1RT3 A;  4M45 A;  3A0I X;  3BEX A;  3MN5 A;  4JI8 K;  3AVN A;  3AVJ A;  3FR0 A;  5MLC Q;  5KRT A;  4WFB L;  4LH5 A;  3S3M A;  4CBW A;  5E41 A;  2JLE A;  5AZJ A;  4O5B A;  1SAZ A;  1RNH A;  2NRH A;  1Q82 O;  4DV5 K;  1NGA A;  1NK7 A;  2PBD A;  4YY3 K;  3H46 O;  5M1Q A;  2E2N A;  1S6Q A;  3BGR A;  2OCE A;  3AVI A;  1ASV A;  3MN7 A;  1DEJ A;  1QSS A;  4JD2 A;  4FXD A;  2W41 A;  3ID8 A;  1KFD A;  1BGX T;  2HHW A;  2HMP A;  1ESV A;  3VQE A;  3OW2 M;  1ILY A;  3L3U A;  1Q8I A;  3HRG A;  3GE1 A;  1C1B A;  1LWE A;  4X64 K;  3OYI A;  3V6D A;  4IDK A;  3CJA A;  2RF2 A;  3QB0 A;  1HX1 A;  3B8A X;  1YIJ N;  3CCL N;  3RRH A;  2E5L K;  4DR2 K;  4WQ4 A;  2IVO A;  5AQT A;  1QQO A;  3O1B A;  4RG8 A;  1BI4 B;  1JCG A;  3U9Z A;  3T7Z A;  5BRE A;  1VQM N;  5AZI A;  2OZM A;  2FF6 A;  3CCS N;  1EQY A;  4OKE A;  4DV3 K;  1VQK N;  5C2F A;  5CYQ A;  1SKS A;  4JI7 K;  4JKD A;  1HNV A;  2BGG A;  2V7Y A;  4EZ6 A;  2DY4 A;  2GUP A;  4Z0U A;  3C7N B;  4HTL A;  1VSI A;  3NF8 A;  4CD1 A;  4CFC A;  3ZCM A;  5T7B A;  3K5M A;  4J2D A;  3DLG A;  1GLJ O;  4KBO A;  4IWV A;  5HRR A;  2J4R A;  1WSF A;  5C15 A;  3KK7 A;  1RBU A;  4BDZ A;  1JJ2 M;  3V9S A;  4FO0 A;  3TAB A;  1NG9 A;  1EXQ A;  4ELU A;  4J2A A;  1X9W A;  4LC9 B;  4BR5 A;  3ATV A;  4BG8 A;  1T3V A;  4KHN A;  4CZJ A;  3RVC A;  3SMP A;  4FJM A;  2O8C B;  2JWK A;  3CJ9 A;  4BRH A;  2OTJ N;  5AQZ A;  1BQN A;  2RKI A;  3O8M A;  2A40 A;  4HUF A;  3QFU A;  3IG1 A;  4DKW A;  1Y64 A;  4FJ8 A;  1WUA A;  3O9U A;  5HRS A;  4Z4F A;  3L8B A;  1IJJ A;  1W0H A;  4AHS A;  4ELV A;  4CEE A;  3K5N A;  3FZF A;  3SQ1 A;  1D9F A;  3AO5 A;  4FSV A;  3EL2 A;  2NRX A;  1S1X A;  4Z4C A;  2PY5 A;  2VG5 A;  2ZGZ A;  2QWL A;  3L2V A;  3P38 A;  1QS4 A;  4BR4 A;  5CR4 A;  3K57 A;  3F5T A;  3C7N A;  5HL7 L;  4X66 K;  1HYS A;  3R6M A;  4I6M B;  2E2Q A;  2YI1 A;  4BC5 A;  2KZM A;  4B3O A;  2ZJP L;  2JGU A;  1J54 A;  1KVB A;  2I5J A;  2NRZ A;  4CEQ A;  3FZM A;  4FPB A;  4JRP A;  3SUQ A;  3D2E B;  5I3U A;  1NGB A;  4JI4 K;  3L2W A;  4CBX A;  4CK1 A;  4O8U A;  2KQ2 A;  1VSJ A;  4RCH A;  1S1V A;  5KPT A;  1RT7 A;  2RPI A;  5KQ8 A;  2QM1 A;  4OPJ A;  4N56 A;  1IBL K;  1Q81 O;  3OYF A;  4A2B A;  4NCG A;  3LP2 A;  2G8W A;  3K9K A;  4FWR A;  4YFU A;  1VSL A;  4KH4 A;  1KRP A;  1MWK A;  5AQY A;  4BC2 A;  4M7Y A;  3QES A;  2O8C A;  2HVH A;  2W42 A;  2O8D B;  3BZK A;  4DUZ K;  1D8Y A;  2V7Z A;  4CHP A;  5HBM A;  4LF5 K;  1EX4 A;  2F96 A;  3PSI A;  4Q5V A;  4EZ9 A;  1SUQ A;  1VSM A;  4O0J A;  3CC4 N;  3C6T A;  3ULE B;  1D4X A;  2KHO A;  2P9S B;  4BRL A;  4W5R A;  3TI0 A;  4ZTJ A;  3AVB A;  1X3N A;  2Q36 A;  1DT9 A;  3NGZ A;  3A5O C;  4A5B A;  4KB1 A;  4DTR A;  4ISF A;  4KB0 A;  5ELZ A;  4K43 A;  4PY5 A;  3AGR A;  4BQZ A;  3P4I A;  2YKN A;  4H0X B;  3OYB A;  4AM6 A;  5AQO A;  1M1K O;  2YHW A;  3VEN A;  2O4I A;  3TTF A;  4I6M A;  4Z4G A;  1J9A A;  2QWR A;  4B3T K;  3S41 A;  4B3M K;  3ENB A;  2LSN A;  3I8B A;  4DSE A;  3O80 A;  4M63 C;  3ENO A;  4KRF A;  1Y97 A;  4C8N A;  3DRP A;  5I9E B;  4B9U A;  2NRT A;  4BRF A;  4QS9 A;  4KH6 A;  4BDY A;  5FRN A;  3VES A;  2YHA A;  3VQ4 A;  1RT6 A;  3AVH A;  3QIN A;  3CIP A;  1L3T A;  5JVH L;  4B1X B;  4J2E A;  4HUG A;  4GVM A;  3BP8 A;  3V1R A;  3SMS A;  1HMV A;  1OKJ A;  1L5U A;  3PX0 A;  4R5P A;  2P1J A;  1SL0 A;  5A2Q O;  3NCI A;  4JV5 K;  4F3O A;  2CGJ A;  3CER A;  4YHH K;  3EE8 A;  2UYT A;  4FJL A;  1O1W A;  4W5N A;  1XC3 A;  3I55 N;  2HNZ A;  4FM2 A;  4CZG A;  4A62 A;  2P9S A;  3L2Q A;  4GVE A;  1V4T A;  3VEX A;  1GOC A;  2WUS A;  3DMJ A;  2G8U A;  1VQ8 N;  1RBT A;  2Z1I A;  3AVC A;  3EKS A;  1ITG A;  3CJC A;  3N4P A;  4H8K A;  2FC0 A;  5AQL A;  1MWM A;  2P9L A;  4BWM A;  5C10 A;  4CJ7 A;  2YNI A;  2WC9 A;  5FLX O;  1KFS A;  3SAF A;  3NE6 A;  4H0T B;  4FLY A;  3SV4 A;  2UXD K;  4IBN A;  4CHQ A;  2E88 A;  3ALY A;  4DR7 K;  3VF6 A;  4DR4 K;  4F3T A;  4U7B A;  2IVP A;  4HVJ A;  4MO5 A;  4BY9 C;  3F9M A;  2AP1 A;  5J1E A;  1C0U A;  1MDU B;  3GOI A;  1JL1 A;  1DLO A;  4FJH A;  1CZB A;  5LMU K;  1VQ6 N;  4Q0B A;  1JLC A;  2YHX A;  3B6O A;  4IZ9 A;  3M8R A;  4H5T A;  3ZX2 A;  3JS6 A;  5KRS A;  1JLG A;  4KHS A;  4QCL A;  4UY8 O;  2E4L A;  3HBT A;  5M1K A;  3WT0 A;  1CXQ A;  1QHT A;  3LAL A;  4EP5 A;  3H45 C;  4XIU A;  3VEO A;  1BA0 A;  3WUH A;  4WFA L;  3DXM B;  4JKG A;  4DTX A;  3LM2 A;  3IRX A;  3U3G A;  4BGB A;  5C24 A;  4CZK A;  3I0S A;  4I2P A;  3I56 N;  3TAQ A;  3ULD A;  4JHD B;  4OX9 K;  3M6G A;  1NGI A;  3ID6 A;  1ASW A;  4HCB A;  4KHU A;  2ITM A;  4YOV A;  5KPZ A;  5TKY A;  3FZL A;  2HBK A;  2VG6 A;  4N41 A;  3LDP A;  3VQ7 A;  5BR8 K;  3CPW M;  4B9S A;  4CGI A;  4EIA A;  4YNQ A;  1BIU A;  5AQI A;  3NVM A;  4PUO A;  5FDL A;  3HM8 A;  1KSP A;  4XH1 A;  4IOX A;  1T7P A;  1RBR A;  2Q0R A;  1Q9Y A;  3AVK A;  4FYD A;  1DTT A;  4F2S A;  3ZEU A;  2HHU A;  3ZSX A;  3KLH A;  1KAZ A;  1QVG M;  2O8B A;  4DQI A;  3G6E N;  1B9F A;  2UXB K;  4YOW A;  1XHX A;  1LOT B;  4Y1C A;  2QTD A;  1L3S A;  2GV9 A;  2KFN A;  4K8X A;  3J7Y P;  4IFY A;  2GUI A;  1IBM K;  3M8P A;  4JYA K;  3G0Z A;  4NO7 A;  3OYH A;  4A59 A;  4DQP A;  1GLE G;  1S9G A;  3HOS A;  1ZBH A;  2A3Z A;  1NBW A;  1YTU A;  3ZT1 A;  3BY5 A;  4B08 A;  3KLG A;  4H4M A;  5DM7 L;  3CXC M;  5M1F A;  2D0P A;  2HOE A;  4JHD A;  2YKM A;  3V4I A;  4KO0 A;  4YOY A;  2FBV A;  4FM0 A;  4A57 A;  1BHL A;  3KLI A;  4YDU A;  2RE2 A;  2QWO A;  3K5L A;  3LZI A;  2ZM6 K;  4FZX C;  5BRF A;  4NLB A;  5C2D A;  1RCH A;  4B9T A;  5HRN A;  3VGK A;  3OVN A;  1V4S A;  3UKU B;  2OZS A;  3D6R A;  2YNG A;  4N47 A;  1R0A A;  3MEE A;  3R9P A;  4YOX A;  4I9Q A;  3AY9 A;  4DMN A;  2UU9 K;  4Y1D A;  4BR7 A;  3K0S A;  1NNE A;  3VPZ A;  1NK0 A;  1HPZ A;  3DRR A;  4OLA A;  4DSJ A;  3G25 A;  2CGL A;  4KTW A;  4DU4 A;  3U8X A;  3FZH A;  1R59 O;  4ILJ A;  1TL3 A;  3NHG A;  2UUA K;  2ZGY A;  4FOI A;  2WBN A;  4B9Q A;  3PX4 A;  1TVR A;  4PA1 A;  2G8K A;  3MXJ A;  4IOC L;  1X3M A;  4JRQ A;  4PQU A;  3AGK A;  4MQ3 A;  2P9K B;  3HPH A;  4FZZ A;  4M3U A;  1XNQ K;  2XY5 A;  1FKP A;  2P5G A;  5LJW A;  1RBV A;  1A5V A;  4AM7 A;  3DLB A;  2NZT A;  2IVN A;  4OPK A;  2ASM A;  4DLG A;  3T1A A;  4Z4E A;  1NJX A;  3CQ8 A;  5AZJ B;  1XHZ A;  4CEB A;  3KK1 A;  4DQ8 A;  4ILH A;  2B5J A;  4CJP A;  1HPM A;  4MO4 A;  3EE9 A;  1SZ2 A;  1IV0 A;  3QET A;  1VSH A;  2I7P A;  1IKX A;  3UKR A;  3VQA A;  4JD2 B;  4BR2 A;  1O13 A;  3CME N;  4LF7 K;  3ZSO A;  3HYF A;  2D0C A;  5DM6 L;  2HHV A;  4KHQ A;  3SBT A;  5EOY A;  3QIC A;  4AH9 A;  1C0G A;  1UOC A;  1VHX A;  3THY B;  3SJH A;  5GIO A;  2Y1J A;  4E7L A;  1OH8 A;  4OPA A;  1RDU A;  5BPM A;  4DFJ A;  2GWK A;  4RW4 A;  4CEZ A;  3K59 A;  3AA3 A;  4BRD A;  3SZ2 A;  3T69 A;  4R79 A;  1S5J A;  3AA2 A;  3HST B;  3RTV A;  1S6P A;  4BRE A;  1KAX A;  4CGH A;  4M42 A;  3CPE A;  5FPM A;  5AZI B;  2FSJ A;  4E3S A;  2HHS A;  2BTF A;  5C25 A;  2UXC K;  4IFV A;  3TAM A;  4KFB A;  5AQG A;  3WEE A;  2QWP A;  3V1Q A;  1U04 A;  5F2R A;  3O4N A;  3HOT A;  1VAZ A;  3P1G A;  3HM9 A;  1HRH A;  3MEC A;  3EY1 A;  4DV2 K;  4C8M A;  3VN5 A;  2KW4 A;  1GLA G;  4X65 K;  3EYZ A;  4BC3 A;  2VCP A;  3C65 A;  4RTF D;  3DXK A;  4OKK A;  3KKS A;  4BC4 A;  5FPE A;  1NKE A;  1VQN N;  1KQS M;  4CZF A;  3OYK A;  2DFE A;  3KJV A;  1QSY A;  2X78 A;  4WQ4 C;  3FGU A;  3NGI A;  3U9D A;  4WE1 A;  4H0O A;  4H03 B;  4KHP K;  3SAH A;  4CHO A;  4JNE A;  4DSI A;  3RSE A;  2QW9 A;  3SUN A;  3S9H A;  2P9U A;  3THY A;  1JKH A;  3AAP A;  3AV9 A;  1ZBI A;  2PAV A;  1RTJ A;  3MAQ A;  5FPD A;  5M1O A;  3ZSR A;  4IG3 A;  1CLQ A;  4B1Z A;  3D7E O;  4K41 A;  1D9D A;  1QHA A;  3DOK A;  3PUF A;  5JLF A;  3TTD A;  1WLJ A;  4B9N A;  4RW8 A;  3QEX A;  1KLN A;  4LFC K;  3ZYY X;  3TAN A;  4XEI A;  3KZB A;  3VQQ A;  1NK4 A;  2Z1H A;  2EWS A;  1MU2 A;  1EWQ A;  1U2V A;  2HBL A;  4JLH A;  2GEL A;  3CCM N;  1VSE A;  2D0B A;  4GNI A; 
#chains in the Genus database with same CATH homology
 4JI5 K;  5AJ3 K;  1XMO K;  1I94 K;  5LMU K;  1HR0 K;  1XMQ K;  4JI6 K;  2ZM6 K;  3JAM O;  4DV5 K;  3J80 O;  4DV6 K;  4DUY K;  4YY3 K;  4B3T K;  4B3M K;  1XNR K;  2UU9 K;  4DR3 K;  4K0K K;  4DV4 K;  4DV0 K;  2UXC K;  3T1H K;  1J5E K;  2HHH K;  1IBK K;  4OX9 K;  1FJG K;  1N32 K;  4DV2 K;  4B3S K;  4LF9 K;  1N36 K;  4DR6 K;  4X65 K;  5LMN K;  4DR5 K;  2VQE K;  1HNZ K;  4B3R K;  4LF6 K;  4CVN E;  4X64 K;  2UUB K;  3T1Y K;  2UUA K;  4LF8 K;  4X66 K;  4V19 S;  5A2Q O;  4JV5 K;  2UUC K;  5BR8 K;  1XNQ K;  4JI2 K;  4YHH K;  2E5L K;  4DR2 K;  4KHP K;  2VQF K;  4LFB K;  4JI1 K;  2F4V K;  4LF4 K;  4DV3 K;  4JI0 K;  3J81 O;  4DR1 K;  4JI4 K;  1HNW K;  1N34 K;  2UXB K;  1N33 K;  5IWA K;  4NXM K;  4JI7 K;  4NXN K;  1IBL K;  1HNX K;  3J7Y P;  1IBM K;  4AQY K;  4JYA K;  4CW7 B;  5FLX O;  3OTO K;  4DUZ K;  4JI3 K;  4LF5 K;  2UXD K;  5IT9 O;  4LFC K;  3J7A P;  4LF7 K;  4DR7 K;  4DV1 K;  4GKK K;  4DR4 K;  5LL6 Z;  4LFA K;  4DV7 K;  4X62 K;  4GKJ K;  4JI8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...