4LFBK

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lfbK00
4LFAK 4JI1K 4NXNK 3OTOK 4JI4K 3JAMO 4DV7K 1I94K 4DUYK 4DV0K 4DR5K 3J7AP 5IT9O 5LMUK 4CW7B 4YY3K 4LFBK 2VQEK 4OX9K 5FLXO 4JI0K 2HHHK 4JI8K 4X62K 2ZM6K 1N36K 2VQFK 4JYAK 4DV6K 4X64K 1HNXK 1IBLK 4LF7K 1N33K 4DR3K 2F4VK 4DV1K 1XMQK 4JI5K 4JV5K 1XNQK 4LF8K 2UUCK 4GKJK 4LF6K 4JI6K 5AJ3K 3J7YP 1N34K 2UXDK 1XNRK 4YHHK 4LF9K 5IWAK 2UXBK 4B3MK 4LF4K 4DV3K 2UXCK 2UUBK 3T1HK 4JI2K 2UUAK 1IBMK 4DR6K 5LMNK 1IBKK 1HR0K 4X65K 4JI7K 4DR4K 1FJGK 4X66K 4AQYK 5LL6Z 4DR2K 4GKKK 3T1YK 5A2QO 1XMOK 1HNWK 4K0KK 4B3TK 4DV5K 2UU9K 4V19S 4B3RK 4DV4K 3J80O 4DUZK 4CVNE 3J81O 1J5EK 4DR7K 4JI3K 5BR8K 4DR1K 4LFCK 4NXMK 2E5LK 1N32K 4DV2K 1HNZK 4B3SK 4KHPK 4LF5K
chains in the Genus database with same CATH superfamily
4KO0A 5AQMA 1E4FT 1ZBHA 1TV6A 1NU0A 4FPBA 1GLFO 2JWLA 5J2PA 2IS3A 2G8UA 4PQUA 5AFUH 3JXUA 1XUPO 2D0CA 2EWSA 4DR5K 4Q0BA 4BRHA 4DQSA 1BCMA 3VEOA 3SQ4A 1VQ6N 3AVCA 3CM5A 5E26A 1YVUA 3HOTA 3P1GA 5ELZA 5F2RA 3AAQA 2RKIA 4JYAK 1OVQA 3NAEA 3TI0A 3C7NB 4AH9A 4BRDA 1HYVA 3WNFA 3ZSRA 3TSPA 3N4QA 1BOTO 2I7NA 3ZX0A 1OH6A 3JYTA 4CZJA 1NOYA 3H1QA 1TUYA 1JLQA 1Q9XA 3NH2A 4O5BA 4ILHA 4EZ9A 3AVNA 4KHNA 1C1CA 1DEJA 2Z1IA 4FWKA 1C0UA 4BDZA 5IWAK 2P9NB 1TVRA 5C10A 1HJOA 3L3VA 1XI1A 2UXCK 3NVKA 2Q97A 4YOYA 5MLCQ 4R5PA 4DSIA 3QEWA 1BQMA 2FBXA 3KVGA 1DT9A 1IBKK 3AARA 4CJSA 3HVTA 4M3XA 5AQUA 2OPQA 3O6WA 3ZX3A 3VQ9A 3S3OA 3CMAN 4B3TK 2HHTA 1BHLA 4JI3K 2RN2A 2X78A 3M8SA 3RSEA 3DLGA 3CQ8A 3DAWA 3D2EA 3R1XA 4CZLA 4EZ6A 4KH6A 3WXLA 4FZYA 3OYEA 4PUOA 4IFEA 4YDUA 3EY1A 4CJ5A 5HP1A 1M1KO 5ADXA 1EETA 1TAUA 5AZIB 4DWIA 3A2FA 3CJAA 4B08A 4JI1K 5EU7A 1HKCA 5I3UA 3GL1A 3O9TA 3SCXA 2CGKA 1QQMA 4BWJA 5HRRA 4PKGA 4FJNA 4DQRA 4EIAA 1EQYA 4G1QA 3RR8A 1LWFA 4FVUA 4MLHA 1Z6RA 3ZSWA 1L3VA 1VRUA 4OJRA 1YHQN 1NMNA 1EXQA 2QWPA 3K57A 1IG8A 3HL8A 2VQFK 3WUHA 3OYIA 4MDAA 3WXJA 4I9LA 3FZMA 2HBKA 3I8BA 3G71N 2NRRA 3CHWA 3CERA 1TGOA 3JS6A 4J2DA 4YDUC 4W5OA 2OPSA 3LDNA 1KC8O 4FLWA 4FJJA 4CZMA 4WFAL 2VWBA 4NLCA 1Y64A 4PKIA 1MA9B 2QWLA 3D45A 3D7EO 3VTIA 2E2OA 2A5XA 3SLCA 1EX4A 4N56A 1BQNA 3H46O 3NFAA 4EP4A 3RR7A 3U3GA 3CXCM 4X65K 5M1FA 2IVNA 3R3LA 3A8YA 1I3AA 2VYPA 2E1YA 4Y1DA 3TAQA 3AGKA 3CI5A 2HVIA 3DXKB 4KI4A 5C2DA 3SQ1A 4YOUA 1ZBIA 4I6MB 2CGJA 3DYAA 3TANA 1LCUA 1VQ9N 3KLHA 2GUPA 3CFOA 2IVOA 4QOZB 4E1NA 5C42A 3DXMB 3OYCA 1T8EA 1JCGA 3NF6A 1QZ6A 2WC9A 1YITN 4KHQA 3PX6A 3W0LA 1BUPA 3G4SN 4BRLA 3ALYA 3HVRA 1GLEG 3ID6A 3AV9A 2E5LK 1WSFA 3ULEB 1YIJN 3U9ZA 3QO9A 5CHIA 3O9RA 4JK8A 2E1ZA 1JLEA 4FWSA 3HP6A 4UY8O 3ZT2A 3ZSYA 5JLFA 1ZBUA 4FL9A 3P39A 1QQOA 5FRNA 3DLHA 4L3QA 3THXB 3O3GA 1YVNA 3DI6A 4H4MA 5JVGL 4BRKA 1Z05A 4JI0K 3VQ8A 5CE3A 1X9JA 4O55A 1KVBA 2BTFA 4A61A 2O8FA 4CF9A 2E6LA 4JLHA 3MX2A 1GOAA 1FK9A 4IG0A 1YTUA 1U6ZA 3THVA 1GLJO 3QFUA 1C0MA 3WEEB 1W0HA 3QNNA 1YI2N 2DFHA 1VSJA 4U7BA 3VGKA 2QTDA 4U67L 4FWPA 1U04A 4CD1A 4GV9A 3HPOA 5GIOA 5AJ3K 3QESA 2HHSA 4LSNA 2WOMA 3A0IX 5HL7L 3V4IA 4A59A 3KK2A 3OYHA 2XO7A 4DFPA 4O8KA 3TARA 2KW4A 2VG5A 1NGAA 4M63C 2ZGZA 4YOTA 3EE9A 3HSCA 2RHKA 1DLOA 1BA0A 2FXUA 1S3XA 2P9PA 2O8EB 2F9WA 2WONA 4IFVA 3SK3A 4I2PA 1RDAA 1K8KA 1T44A 4WFNL 3QFPA 3MK6A 3P83D 4CGGA 3RMBA 2QEXN 1NK0A 3T1YK 3D2FB 1Z25A 5EOYA 4JD2A 5KQ8A 4Q5VA 1TK5A 4DQQA 3CPWM 3CIPA 5B8HA 5M1OA 3CCEN 1KAXA 5EY4A 3AAPA 4DR7K 1GOCA 3KLIA 5JVHL 2HHUA 1RTHA 1REVA 2QKBA 4DB3A 4CJ4A 3WT0A 3R8EA 4KBOA 3SQ2A 4BRPA 2G8FA 1YF5L 2A41A 1NK4A 3NF7A 3RRGA 1GOBA 4KRFA 2AJQA 3HRGA 3LL3A 3NGIA 4ISEA 4PA1A 1XQSC 3G6EN 2F9TA 1QSLA 2NUBA 4FJ9A 1X1PA 2V7ZA 4RW8A 4FK0A 2JGUA 2QA4N 5KTQA 4G9ZA 2Z1JA 1NGIA 4EHTA 4A2AA 2IVPA 3DOKA 4B1WB 2FSNA 1YJ9N 3L4IA 1SQKA 1FKPA 4GV3A 4BDPA 4F9OA 4A57A 5I42A 4JI8K 1NBWA 3CCJN 1G15A 1QZ5A 4DLGA 4BACA 4B8CA 1TKDA 2NLXA 1K6YA 4XEIA 4C8NA 4JKGA 1YT3A 3F2KA 3VOVA 4PL7A 2R7YA 4JI6K 2W6KA 1SL1A 3H45C 4BE0A 1HJRA 3L2UA 4W5RA 2XY5A 4DHYA 1C6VA 4FWLA 3Q7CA 4H5RA 3ULDA 4HTLA 4FZZA 4KAZA 2D4WA 1HQEA 1VHXA 3ZT4A 4ELVA 5BRHA 4E7IA 4E3SA 3A5LC 3NVMA 1ATRA 4NB4A 1E4GT 1ZYQA 1S6QA 4YFUA 4JI7K 1VQPN 1U48A 5HLFA 4AQYK 3NMUA 4JHDA 5FDLA 3K0SA 4Z4CA 1KCFA 3RTVA 3ZLJA 4M3ZA 4HVJA 4DF8A 4DV5K 5DM7L 1QVFM 3KLGA 3HSTB 3IRXA 3V9SA 3THWA 3AA2A 1WSIA 5KPZA 4XH5A 5BR8K 2CH6A 1G99A 4ISFA 4CJVA 3KHYA 2HBJA 2P1JA 4CZGA 2O8DA 2I7PA 4BVOA 4LFCK 1H1VA 3VEWA 4AHTA 2FC0A 3RSEB 3OS1A 2NRHA 3TSUA 1LWCA 2WBNA 3MN5A 3D2EB 4CFAA 3PIOL 2QWMA 3QERA 3LP3A 2Z1GA 2XY8A 3CJ7A 3LZIA 2AA4A 3AGRA 4IBNA 3K5MA 1B9DA 3AVLA 1KXPA 3HOSA 3PSIA 3NE6A 3SUPA 1JXBA 1SV5A 4AM7A 3IFRA 4JKDA 4DTXA 2HF4A 4DCHA 1XC3A 5BPMA 3EKSA 3AO5A 4FWMA 3ZSXA 2A42A 3KKSA 4XIUA 1A5WA 2A1RA 1NMDA 3FFKB 4PHTX 4OPAA 4DKWA 4LC9B 4CJEA 3I0SA 4FLYA 4E7LA 1J6ZA 3O9SA 3DLEA 3RMDA 2KZMA 4LSLA 4H0VB 3J8AA 3MCAB 1TK0A 4JS4A 3OYBA 1D9DA 3CCQN 4LY7A 5JS1A 3C6TA 4J2EA 4OLAA 4JN4A 3RVCA 1EP4A 2FBVA 5LJWA 4OGEA 4Z0UA 2OA8A 3BP8A 3VGMA 1C1BA 1HYZA 2BDPA 3QDKA 4FYDA 1T6DA 3H08A 4FM0A 1P90A 1LV5A 2VG7A 1KLMA 4BE2A 3U9DA 3O4WA 2ASOA 4CHQA 3I0RA 1HLUA 2O8BA 3WQUA 4CJLA 2E2NA 2IGIA 5HBMA 3J80O 3SUOA 4OO1J 4N5SA 2D0AA 2P51A 2HMPA 4NO7A 3VESA 1L3UA 5AQGA 4ILGB 1M90O 2QXFA 2Q0RA 5LJVA 3CCUN 1ITGA 4JKBA 3AVBA 5HOOA 4KH4A 4RW6A 1NM1A 1W7AA 3TU5A 4CFBA 4DV2K 4A62A 1HYSA 2PY5A 4JK9A 3LDQA 5SWMA 3CC7N 4FJHA 1GLLO 4LF5K 3L2RA 3L2VA 3H3NO 1T05A 4CJTA 3TPQA 4Y0WA 5AQZA 3OS0A 3ZT3A 3GOIA 4CF0A 4ID5A 2D0BA 4LD0A 3IAYA 1FXXA 2OANA 3VEVA 4WQ5A 4YY3K 4FJGA 1W97L 4OX9K 1GLAG 4WQ4C 4BRGA 3L4QA 1GLBG 1VQON 4J8FA 3W3DA 4B9TA 4PY5A 3S41A 1IH7A 4X64K 4FCYA 3FR0A 2O8FB 3R6MA 4DR3K 1P8ZA 4DV1K 3PO5A 3SBGA 5KGXA 3H1VX 1WSGA 1X9WA 1W9HA 2QK9A 2V52B 4FJIA 3BEXA 4M7YA 4F2RA 3U8XA 4GNIA 1Q86O 1HNVA 2FSKA 3OYKA 1XNRK 2ZF5O 2D0PA 4A2BA 1QS4A 3G0ZA 3B8AX 1BU6O 3AO1A 4CERA 4DS4A 1TKXA 4JI2K 4JKEA 4WQ5C 4IWVA 2EX3A 2Y1JA 3NGYA 4KTZA 2IAJA 4M7XA 3J7ZO 2G8IA 1TKTA 3ATUA 2P9LA 4X66K 4OPJA 4E89A 3ZSZA 3KIOA 1UA0A 3PY8A 1VSMA 3BZCA 4QS7A 1HX1A 5A2QO 2XHBA 3MXMA 3L2WA 2KFZA 4JKHA 3WXMB 1UAXA 4CVNE 3J81O 2GUIA 3M3ZA 3FGUA 1BO5O 3ZEUB 1RBVA 4B9MA 4B8AB 4WCEL 1SL2A 2V51B 3OBYA 4DR1K 2PZSA 1HUXA 3F5TA 1GLCG 4M3YA 4M3TA 1X3NA 4CEEA 1WN7A 3OA9A 2IC3A 3P38A 3CCMN 3KWIA 1LAWA 3AA5X 1HRHA 4B3SK 4JKCA 4NYFA 4BR4A 4YORA 2QI2A 3TAMA 2YNIA 1XWLA 5AQIA 4H0YB 2QWNA 3KD5E 1U47A 4FJKA 1VQNN 4HCCA 3SAFA 2WUSA 2DPNA 3EEQA 2HNYA 1D8YA 1X9MA 1KFDA 3OVNA 3UKUB 4KI6A 1T6CA 3VQAA 4IKFA 1N36K 4K42A 1ZC6A 4CJQA 4DSKA 1WBDA 4LF7K 4IO9L 2HBLA 4BR2A 4RW9A 1N33K 1IKXA 2F4VK 3SV3A 1U4BA 3MAQA 4A5AA 2WTUA 4JV5K 4R79A 4LF8K 4YNQA 4FK4A 1RTJA 4FXDA 1S1VA 3UKRB 4FM1A 2QKKA 2Q0UA 1RGIA 1BA1A 4FSVA 3GDQA 1YXQA 4YHHK 5CY4A 1EKEA 3K2PA 4GMJB 3MMVA 3T3FA 4N47A 3SJJA 4CEOA 4H8KA 4IZ9A 1V4SA 3VF6A 5ADXH 1NGEA 3T69A 1VQ8N 5LMNK 3LP2A 1VQKN 4CBWA 2GBZA 4CD3A 4CESA 3CCRN 1HMVA 4I7FA 3VEZA 4BDYA 5F0XA 1X3MA 3CM6A 4DU4A 3PX4A 3SPYA 3SV4A 2PAVA 5HRPA 3OS2A 2G8VA 2D0OA 4JHDB 3BUZB 4IDKA 3QLHA 2FBYA 4CBXA 4PL8A 3LP0A 3OYLA 5SZTA 1ASVA 3D6RA 3THWB 4CECA 4E1JA 2BUPA 3IDHA 3NDKA 4HCBA 1VSDA 1I39A 3MCPA 4DTSA 2O8DB 3L2QA 3CQYA 3Q7BA 4WE1A 2FSJA 1K73O 4FJLA 3P31A 2YJFA 1BG3A 4BRQA 2OTLN 1YJWN 4CJFA 4CZHA 4DU3A 1ATNA 2UYTA 4ILJA 4OKKA 1C1AA 2HB5A 4C8MA 2A1SA 4BC5A 4DUYK 4JKAA 4PKHA 5M1PA 4CW7B 4K25A 1T3VA 3KK1A 3BF3A 3KZBA 1RT2A 2YX6A 5I9EB 5GAEP 4X62K 4CHOA 3RWUA 4JRPA 5CZ1A 1U49A 3EKUA 1BL3A 1FW6A 1S1UA 2E6MA 3ZSQA 2GV9A 4CEQA 3LDOA 1KVCA 5JMVA 4TSXA 4RW7A 4CJRA 3DLKA 3AVHA 1NK5A 1J5OA 3JSMA 2O8CA 4H5WA 4UQGA 3VQEA 4HTUA 3J7YP 2GTDA 4RTFD 5AZJB 4AHCA 3QICA 4W5NA 2UXDK 3P4IA 2P9SA 4DTMA 1VSFA 2OZSA 3M8RA 5FPDA 4QCLA 1R0AA 3RMAA 1ILYA 3P5JA 1YTAA 5JLHA 2F96A 1HPZA 4Z4HA 4F3OA 3CYMA 4KTWA 2Y1IA 4FLUA 3ZSVA 4O5FA 3HZ6A 3O1BA 2HNDA 4CEBA 2PBDA 4FWRA 3S9HA 3PUFA 3BF1A 3H6EA 2P5OA 4L8RB 4DR2K 1IKWA 4DSJA 2OTJN 4B1XB 4FJ8A 4C8OA 1RT1A 2UU9K 2O8BB 2OPRA 3HPHA 1BIUA 2RF2A 4BGAA 4KV8A 4CEFA 5C12A 5E41A 2P9KB 5AQOA 4CHZA 1ATSA 2PYJA 3V1OA 3OYDA 1J9AA 3SMSA 3LPTA 3LPUA 3I56N 3HK2A 3MEGA 1LAVA 3SAHA 5FPNA 3SJHA 4DU1A 3CF5L 1TAQA 3AVFA 2KLAA 3SUQA 4LFAK 2YI1A 3LDSA 2NRWA 3O4QA 5TKWA 4JI4K 4WF9L 3MWTA 1I94K 4DV0K 4FM2A 1NLVA 3LALA 2GWKA 2W40A 3BY5A 1KFSA 3VF2A 5FLXO 3CMEN 1UWBA 2ZM6K 5KGWA 4ISGA 1K8AO 2OCEA 3TAEA 3CPEA 1SKRA 2E2PA 1DTTA 3VQCA 1Q18A 4GVMA 4ELUA 1RT4A 4CJPA 2F7TA 4FLZA 1LOTB 3PX0A 1QHAA 4GKJK 3CJBA 2XY6A 4H0TB 4BG9A 2W41A 3G10A 4CK3A 5AQXA 1NJIO 3V81A 3SNNA 1VQ4N 3DLBA 3HTVA 3I8DA 4FJ5A 5M1NA 2VWKA 4FLVA 3B6PA 4H4OA 4DG1A 3VQ6A 1CXUA 4CJWA 2ZQBA 2E8AA 2G8WA 4ZTJA 4IO8A 4DR4K 1FJGK 4B1ZA 1QQCA 1WUAA 5JICA 4DF4A 3IS9A 5FROA 3CC2N 1J54A 2P9LB 3K5NA 4YOWA 3UIQA 5DM6L 1CLQA 5AQNA 5GADP 4KHUA 5KPTA 4DV4K 5E84A 3WNGA 3DWLA 2HF3A 1NKEA 4GW6A 4H5TA 3VA3A 5CZ2A 3LWLA 1QTMA 1ASUA 3TTFA 1SKSA 3TWHA 3ZX2A 2NRTA 1WAJA 3L0QA 4AHSA 4ZTFA 1RDBA 1CXQA 3MN9A 1L3SA 4CGJA 1VRTA 4DSEA 3SQ0A 1GLDG 4BRMA 4B9NA 1C0TA 4C8KA 1JLBA 1JLAA 3LDLA 1KLNA 2HHXA 4CHNA 2A40A 4MO4A 3F9MA 3JAMO 4W5QA 3VERA 3K58A 2JWKA 4IEIA 2IDOA 3E66A 4RW4A 4FWOA 3VQPA 2YHBA 2RE2A 3OYMA 3S3NA 3OYJA 3B6OA 1T7PA 1ZBLA 4Z4IA 4M3UA 4AHVA 2HOEA 3HM9A 4DMNA 3V9WA 1TL3A 4OPHA 3AVJA 5M1KA 3VEXA 4O4GA 3VPZA 2HBMA 1KTQA 2A3ZA 4M45A 4HUFA 1TUUA 3TSQA 1N34K 3OBWA 1YUWA 5AQTA 3ZT1A 3AO3A 3BGRA 2ZJQL 2KZZA 2G8KA 1VSHA 4LF9K 4O44A 3O3HA 4CK1A 4LF4K 3V1QA 4Z4EA 4B9VA 1S6PA 1VSKA 2O4IA 3T1HK 3LANA 1S1XA 4H0OA 3WNEA 3ZCMA 4BQZA 1NJYA 1SAZA 3GE1A 1ZXOA 3I55N 4DQ8A 2KHOA 3U4LA 3OYNA 5GAGP 1OH7A 3CG7A 3QETA 4IOAL 4H5VA 4IXCA 4KH5A 4Y1CA 3LAMA 2D1KA 3S3MA 3LAKA 1FKOA 2W42A 3ISNC 1JCEA 3OW2M 5J2QA 3QBXA 1TKZA 2Q36A 3AVAA 1RDUA 1HQUA 2P9UA 4BC2A 1V4TA 1B9FA 2VG6A 1XHZA 5FPEA 4DQIA 3U3YA 4FOIA 1N6QA 1TL1A 3VQQA 3AO4A 4DFMA 3RRHA 2HNZA 4LH4A 2PFUA 2RPIA 3EL2A 3AVMA 4DTPA 1VAZA 3L3UA 4BR0A 1S9EA 3IUCA 5H1SQ 4BG8A 4AHRA 1LWEA 4BC4A 5J2MA 1N5YA 5AQJA 3GG4A 4H5NA 5K14A 3WNHA 3SMPA 1OH5A 4O8UA 4JRQA 4IOXA 4F8RA 2WFBA 1JL2A 3O3FA 4KHSA 4DV7K 1RILA 4KB1A 3I33A 4OVLA 3J7AP 1BGXT 1VSLA 2ZE2A 2XRIA 5BRDA 4DTRA 1RT3A 2NRXA 4ICLA 1D5AA 4DFKA 1JKHA 4GVEA 1O13A 3UE5A 4HHTA 3R9PA 1B92A 1XHXA 3DRSA 2O8EA 3WXKA 4O0IA 3AA3A 4DV6K 4E7HA 4KPYA 4FWNA 1RT6A 4FW1A 4M41A 1RT5A 4YOXA 2B6AA 3TABA 4KB0A 3M6GA 4JI5K 4OKJA 1RBRA 1NK9A 3OHRA 3SBTA 4KHYA 2VGMA 1L3TA 3CCVN 4QS9A 2FBTA 5GAHP 2O8CB 4C1NK 3KD1E 4E7JA 2ZJPL 4F4KA 1X9SA 1RFQA 1JL1A 4DV3K 1S9GA 4EHUA 3O1WA 4MDBA 2P9SB 4CGFA 5AFUA 4AILC 1JXEA 2HW3A 2A6AA 3IKMA 2ITGA 1WBBA 2DY4A 4WYBA 5AQKA 3K9JA 2HSTA 4CGIA 5T7BA 3NHGA 4CF2A 3LDPA 3VF4A 4DLEA 4QS8A 4GKKK 2DTUA 4BY9C 3MX5A 4OPKA 1VSIA 1HNWK 4DQPA 1D4XA 4B9SA 4C8LA 3TAPA 1O1WA 4BQLA 4B3RK 2ZGYA 3OYFA 5BPNA 3EE8A 4CIEA 2I5JA 1WOQA 4CJUA 1KVAA 3SYZA 5F1XA 5BPLA 2YHYA 1N8RO 3LP1A 5C15A 1JJ2M 1J53A 3MWPA 4F3TA 2P9PB 5C2FA 3CCSN 4KHPK 1K8KB 3VQ5A 2DFEA 4CFCA 2YKNA 3T7ZA 1S22A 3EN9A 4AHUA 3DM2A 2YNGA 4H0XB 3OTOK 4JD2B 4ID1A 2P9IA 2ITMA 1JLGA 5GINA 1EO1A 2VWJA 4CEDA 3E1YA 1TYQA 3C94A 3MXJA 3HJFA 4F2SA 3KWGA 2NZTA 4BR9A 4M3RA 4WFBL 1XC9A 5GIPA 3QEXA 2JLEA 2YNFA 1OKJA 1Q7YO 2GELA 5CYQA 2HMIA 3M8PA 1XMQK 4HUGA 4BR5A 3THYA 4B9QA 2FF3B 4FLXA 4AF1A 3HP9A 2W6LA 4IDHA 2YCHA 4JNEA 3SUNA 3CCLN 4H03B 4ZHRA 4J2BA 4B3MK 1NGBA 3QB0A 1WLJA 3KK7A 3H3OB 3NF8A 4FLTA 3QINA 1S1TA 4O0JA 1EWRA 2LSNA 1C0GA 3L6QA 2B4JA 3QIOA 5CYMA 2UUAK 3O4NA 4DTOA 3E9LA 3TTDA 1C0FA 1RBUA 3CETA 4DTJA 4CIGA 1IKVA 1NKCA 1ESVA 4JKGB 1NK8A 3CJ9A 1QQNA 3M5RA 2KKZA 2YHAA 1BISA 5AR0A 1JLFA 1WSHA 4K0KK 3LM2A 4V19S 1U2VA 2BANA 4E19A 3DRPA 3NF9A 3NH0A 1RDWX 3OJUA 2O4GA 5AQQA 1NNEA 3FZFA 4DSFA 3A5OC 5AQWA 3A5NC 4NXMK 3WXIA 5DMRA 1W2BM 1YJNN 4BVPA 1KQSM 1OVYA 1QHTA 4Z94A 4E1MA 4GV6A 3M8QA 5EVZA 2DFFA 4JEPA 3DRRA 2VGNA 1HNZK 4CFDA 5BREA 3LWMA 4BC3A 3F9KA 2BH1A 3VEYA 1KAYA 1NWKA 4FO0A 5IT9O 4CJ3A 3ITHA 4LFBK 5J2NA 1SS6A 4XH4A 2HHHK 1A5XA 5HRNA 2ZD1A 1OH8A 1KSPA 5BR9A 2BGGA 2J4RA 3DMJA 1ZBFA 3M1FA 3FE1A 3ZYYX 1MU2A 2D5RA 5AQVA 2OYQA 2Q31A 2YV0X 3C6HA 4CGDA 2UUCK 1IV0A 3AVIA 4EFHA 3PV8A 4Z4GA 3PLAA 3MN7A 1RCHA 2Q3SA 3MN6A 1NOZA 4FJ7A 3HBTA 1Q81O 1MDUB 3SAGA 3C6UA 5FRMA 3PO4A 2HHQA 1WB9A 3KTQA 4EAHD 3EZ5A 4CGHA 4RG8A 4DFJA 3NGZA 3IMXA 2QWRA 3PSFA 4CJ7A 1T03A 4B9UA 1JLCA 3QIPA 3VQ4A 2E4LA 2HHVA 3ASMA 1BCOA 2GEMA 4B1YB 3V1RA 1XMOK 2OZMA 2ZWHA 1VQMN 3ZETA 3O8MA 1RT7A 3G25A 3O9UA 2QWQA 1MWMA 4BRFA 3LZJA 3VA0A 1J5EK 1WSJA 1BI4A 3CFPA 2GWJA 3QBWA 4KTQA 2P9UB 1CZ9A 2E88A 2V7YA 4FZXC 3CQXA 4RCHA 2ATQA 1ASWA 2YHXA 3AO2A 3VGLA 4KREA 5C25A 1EWQA 5JS2A 3HXMA 1R59O 4XH1A 3KLEA 4K8ZA 3MDQA 1N32K 4CF8A 4BREA 2QM1A 2G8HA 3U6FA 3TAGA 3HPGA 4B9LA 4GY2B 2X74A 4E0DA 4BR7A 2Q2RA 1JCFA 3ZT0A 3HM8A 3UB5A 5D3GA 3PIPL 1DKGD 4CZEA 3QNOA 2YKMA 3C95A 2VQEK 1ZBSA 3VETA 4CCHA 3FLCO 2QW9A 4DTUA 4BE1A 1NKBA 3C7NA 1S1WA 3IG1A 1VQ5N 3BDPA 3MEDA 1HKBA 1UOCA 2FLOA 3HT3A 1NG9A 1HNIA 5KRTA 4K41A 1RNHA 4OKEA 3K5LA 4B1VA 4H0PA 1QVGM 1CZBA 3K9KA 4CEAA 3RMCA 1CZAN 3N4PA 1RTDA 3NBPA 3AY9A 4ELTA 2ZJRL 1Y97A 4LF6K 2KQ2A 3ID8A 4C23A 3CC4N 2P9NA 1BWFO 3HYFA 1IO2A 2YNHA 1YAGA 3MECA 3QEPA 4C1NI 2Q1NA 2QWOA 2H3GX 3ZEUA 3ZSOA 3F73A 1NGHA 4BROA 2HHWA 2UUBK 4MLEA 1SUQA 5HRSA 3CFRA 4FOEA 5BN9A 3VMFB 4DR6K 3VTHA 1HR0K 1VSEA 3C6AA 4CJKA 3VN5A 4CF1A 3MEEA 4MQ3A 1VQ7N 5KI6A 3OYAA 3O5BA 2X6SA 5KPRA 4DTNA 4A5BA 4JAXA 4DSLA 4OGCA 2IOCA 4DUZK 4NCGA 4K43A 3E9PA 3C0BA 2ASMA 4FJMA 2FF6A 5M1QA 3UKUA 3QMLA 4HWIA 2X6NA 1NGFA 3KKRA 4HUEA 3ENOA 3AA4A 1RDCA 1WSEA 1VK0A 5BN8A 2BE2A 4E7KA 4FK2A 2KTQA 5AZIA 1LW0A 2YJEA 4JK7A 3VENA 3LM9A 4CHPA 1NK7A 4I2QA 4JS5A 3V6DA 4NXNK 3UKRA 1HKGA 3EYZA 3O80A 1S5JA 3DLLL 4K8XA 5DK5A 2P9IB 5LMUK 1U45A 1D9FA 5AQLA 4OLBA 2KFNA 4I9QA 1TYQB 1KD1O 1QSSA 4CI6A 1NJXA 1IBLK 4KHWA 1MWKA 2P5GA 3MXIA 4FPAA 1HPMA 1QSYA 4FWQA 2VCPA 3KLFA 1XNQK 1K9MO 4IG3A 5C24A 5CR4A 4CIFA 5TKYA 3EO3A 1NGGA 4BGBA 3V9XA 4BWMA 4CEZA 1QE1A 3FZKA 3THYB 1NJWA 4N41A 3TTCA 3FZLA 4M3WA 3OYGA 1RBSA 1LW2A 2CGLA 4B3OA 1NJZA 1DTQA 3BZKA 4IEEA 3ATVA 3ENHA 3KJVA 5AQSA 4RWTA 4FVMA 3O08A 4CZIA 4IJAA 3DXKA 3EZWA 4I6MA 5FPMA 3SZ2A 1RTIA 4IFYA 3DXMA 4CK2A 1NK6A 1SL0A 2B5JA 5AQFA 4CHYA 4NCAA 1KAZA 2Z1HA 1U2VB 4PWDA 4LH5A 3ULEA 4BRAA 1KRPA 5BRFA 5AQHA 4EP5A 3QEVA 2NRVA 4N76A 1L5UA 5KQDA 2ETJA 2NNWA 1Q8IA 3DJCA 3L8BA 2EHGA 1A5VA 1SZ2A 3QEIA 4NLBA 3THXA 4BRNA 4DS5A 3OJSA 4KKOA 5AZJA 5HROA 3V9UA 1NGDA 3CJCA 2GX9A 3DOLA 5EX5A 3T19A 2F8SA 2CH5A 2XY7A 3HI0A 4CZKA 3GBTA 5AQYA 3AVKA 4YOVA 4BRCA 1Z26A 3E01A 4M42A 3FZHA 3WEEA 3T1AA 1IG9A 1Q9YA 3OY9A 1RBTA 3AVGA 1HNXK 3VQDA 2F8TA 2NRZA 5J1EA 2E20A 4IOCL 4MO5A 4NCBA 1DGKN 2QXLA 3K59A 4AM6A 5C0YA 4J2AA 3DLRA 2P9KA 2UXBK 1NGJA 4WQ4A 1BDGA 1UA1A 3KK3A 3TAFA 1NGCA 4MFBA 2IIRA 5EXWA 1IBMK 3SPZA 1IKYA 4NYNA 3HO1A 4FJXA 4CZFA 4B1UB 3V9ZA 3D2FA 3WQTA 3SI6A 2YHWA 5AQPA 3NH1A 1TK8A 2E2QA 3TR8A 5LL6Z 5LY3A 3NCIA 1F21A 3VQBA 4BRIA 4QAGA 4CE9A 4JKFA 3E9OA 4W5TA 4KFBA 2HVHA 3ENBA 1WAFA 5AQRA 3CJ1A 3D0PA 4FW2A 2OPPA 4IJNA 3ZETB 1BIZA 3C65A 1IJJA 1RDDA 3VQ7A 1SKWA 3O9QA 2ASPA 3FFIA 1WNSA 5KRSA 1BI4B 1Q82O 2AP1A 2PYLA 3CD6N 4CBUA 3K5OA 1E3MA 3A5MC 1S72N 1VQLN 4Z4FA
chains in the Genus database with same CATH topology
4LFAK 4JI1K 4NXNK 3OTOK 4JI4K 3JAMO 4DV7K 1I94K 4DUYK 4DV0K 4DR5K 3J7AP 5IT9O 5LMUK 4CW7B 4YY3K 4LFBK 2VQEK 4OX9K 5FLXO 4JI0K 2HHHK 4JI8K 4X62K 2ZM6K 1N36K 2VQFK 4JYAK 4DV6K 4X64K 1HNXK 1IBLK 4LF7K 1N33K 4DR3K 2F4VK 4DV1K 1XMQK 4JI5K 4JV5K 1XNQK 4LF8K 2UUCK 4GKJK 4LF6K 4JI6K 5AJ3K 3J7YP 1N34K 2UXDK 1XNRK 4YHHK 4LF9K 5IWAK 2UXBK 4B3MK 4LF4K 4DV3K 2UXCK 2UUBK 3T1HK 4JI2K 2UUAK 1IBMK 4DR6K 5LMNK 1IBKK 1HR0K 4X65K 4JI7K 4DR4K 1FJGK 4X66K 4AQYK 5LL6Z 4DR2K 4GKKK 3T1YK 5A2QO 1XMOK 1HNWK 4K0KK 4B3TK 4DV5K 2UU9K 4V19S 4B3RK 4DV4K 3J80O 4DUZK 4CVNE 3J81O 1J5EK 4DR7K 4JI3K 5BR8K 4DR1K 4LFCK 4NXMK 2E5LK 1N32K 4DV2K 1HNZK 4B3SK 4KHPK 4LF5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA K;  4JI1 K;  4NXN K;  3OTO K;  4JI4 K;  3JAM O;  4DV7 K;  1I94 K;  4DUY K;  4DV0 K;  4DR5 K;  3J7A P;  5IT9 O;  5LMU K;  4CW7 B;  4YY3 K;  4LFB K;  2VQE K;  4OX9 K;  5FLX O;  4JI0 K;  2HHH K;  4JI8 K;  4X62 K;  2ZM6 K;  1N36 K;  2VQF K;  4JYA K;  4DV6 K;  4X64 K;  1HNX K;  1IBL K;  4LF7 K;  1N33 K;  4DR3 K;  2F4V K;  4DV1 K;  1XMQ K;  4JI5 K;  4JV5 K;  1XNQ K;  4LF8 K;  2UUC K;  4GKJ K;  4LF6 K;  4JI6 K;  5AJ3 K;  3J7Y P;  1N34 K;  2UXD K;  1XNR K;  4YHH K;  4LF9 K;  5IWA K;  2UXB K;  4B3M K;  4LF4 K;  4DV3 K;  2UXC K;  2UUB K;  3T1H K;  4JI2 K;  2UUA K;  1IBM K;  4DR6 K;  5LMN K;  1IBK K;  1HR0 K;  4X65 K;  4JI7 K;  4DR4 K;  1FJG K;  4X66 K;  4AQY K;  5LL6 Z;  4DR2 K;  4GKK K;  3T1Y K;  5A2Q O;  1XMO K;  1HNW K;  4K0K K;  4B3T K;  4DV5 K;  2UU9 K;  4V19 S;  4B3R K;  4DV4 K;  3J80 O;  4DUZ K;  4CVN E;  3J81 O;  1J5E K;  4DR7 K;  4JI3 K;  5BR8 K;  4DR1 K;  4LFC K;  4NXM K;  2E5L K;  1N32 K;  4DV2 K;  1HNZ K;  4B3S K;  4KHP K;  4LF5 K; 
#chains in the Genus database with same CATH topology
 4KO0 A;  5AQM A;  1E4F T;  1ZBH A;  1TV6 A;  1NU0 A;  4FPB A;  1GLF O;  2JWL A;  5J2P A;  2IS3 A;  2G8U A;  4PQU A;  5AFU H;  3JXU A;  1XUP O;  2D0C A;  2EWS A;  4DR5 K;  4Q0B A;  4BRH A;  4DQS A;  1BCM A;  3VEO A;  3SQ4 A;  1VQ6 N;  3AVC A;  3CM5 A;  5E26 A;  1YVU A;  3HOT A;  3P1G A;  5ELZ A;  5F2R A;  3AAQ A;  2RKI A;  4JYA K;  1OVQ A;  3NAE A;  3TI0 A;  3C7N B;  4AH9 A;  4BRD A;  1HYV A;  3WNF A;  3ZSR A;  3TSP A;  3N4Q A;  1BOT O;  2I7N A;  3ZX0 A;  1OH6 A;  3JYT A;  4CZJ A;  1NOY A;  3H1Q A;  1TUY A;  1JLQ A;  1Q9X A;  3NH2 A;  4O5B A;  4ILH A;  4EZ9 A;  3AVN A;  4KHN A;  1C1C A;  1DEJ A;  2Z1I A;  4FWK A;  1C0U A;  4BDZ A;  5IWA K;  2P9N B;  1TVR A;  5C10 A;  1HJO A;  3L3V A;  1XI1 A;  2UXC K;  3NVK A;  2Q97 A;  4YOY A;  5MLC Q;  4R5P A;  4DSI A;  3QEW A;  1BQM A;  2FBX A;  3KVG A;  1DT9 A;  1IBK K;  3AAR A;  4CJS A;  3HVT A;  4M3X A;  5AQU A;  2OPQ A;  3O6W A;  3ZX3 A;  3VQ9 A;  3S3O A;  3CMA N;  4B3T K;  2HHT A;  1BHL A;  4JI3 K;  2RN2 A;  2X78 A;  3M8S A;  3RSE A;  3DLG A;  3CQ8 A;  3DAW A;  3D2E A;  3R1X A;  4CZL A;  4EZ6 A;  4KH6 A;  3WXL A;  4FZY A;  3OYE A;  4PUO A;  4IFE A;  4YDU A;  3EY1 A;  4CJ5 A;  5HP1 A;  1M1K O;  5ADX A;  1EET A;  1TAU A;  5AZI B;  4DWI A;  3A2F A;  3CJA A;  4B08 A;  4JI1 K;  5EU7 A;  1HKC A;  5I3U A;  3GL1 A;  3O9T A;  3SCX A;  2CGK A;  1QQM A;  4BWJ A;  5HRR A;  4PKG A;  4FJN A;  4DQR A;  4EIA A;  1EQY A;  4G1Q A;  3RR8 A;  1LWF A;  4FVU A;  4MLH A;  1Z6R A;  3ZSW A;  1L3V A;  1VRU A;  4OJR A;  1YHQ N;  1NMN A;  1EXQ A;  2QWP A;  3K57 A;  1IG8 A;  3HL8 A;  2VQF K;  3WUH A;  3OYI A;  4MDA A;  3WXJ A;  4I9L A;  3FZM A;  2HBK A;  3I8B A;  3G71 N;  2NRR A;  3CHW A;  3CER A;  1TGO A;  3JS6 A;  4J2D A;  4YDU C;  4W5O A;  2OPS A;  3LDN A;  1KC8 O;  4FLW A;  4FJJ A;  4CZM A;  4WFA L;  2VWB A;  4NLC A;  1Y64 A;  4PKI A;  1MA9 B;  2QWL A;  3D45 A;  3D7E O;  3VTI A;  2E2O A;  2A5X A;  3SLC A;  1EX4 A;  4N56 A;  1BQN A;  3H46 O;  3NFA A;  4EP4 A;  3RR7 A;  3U3G A;  3CXC M;  4X65 K;  5M1F A;  2IVN A;  3R3L A;  3A8Y A;  1I3A A;  2VYP A;  2E1Y A;  4Y1D A;  3TAQ A;  3AGK A;  3CI5 A;  2HVI A;  3DXK B;  4KI4 A;  5C2D A;  3SQ1 A;  4YOU A;  1ZBI A;  4I6M B;  2CGJ A;  3DYA A;  3TAN A;  1LCU A;  1VQ9 N;  3KLH A;  2GUP A;  3CFO A;  2IVO A;  4QOZ B;  4E1N A;  5C42 A;  3DXM B;  3OYC A;  1T8E A;  1JCG A;  3NF6 A;  1QZ6 A;  2WC9 A;  1YIT N;  4KHQ A;  3PX6 A;  3W0L A;  1BUP A;  3G4S N;  4BRL A;  3ALY A;  3HVR A;  1GLE G;  3ID6 A;  3AV9 A;  2E5L K;  1WSF A;  3ULE B;  1YIJ N;  3U9Z A;  3QO9 A;  5CHI A;  3O9R A;  4JK8 A;  2E1Z A;  1JLE A;  4FWS A;  3HP6 A;  4UY8 O;  3ZT2 A;  3ZSY A;  5JLF A;  1ZBU A;  4FL9 A;  3P39 A;  1QQO A;  5FRN A;  3DLH A;  4L3Q A;  3THX B;  3O3G A;  1YVN A;  3DI6 A;  4H4M A;  5JVG L;  4BRK A;  1Z05 A;  4JI0 K;  3VQ8 A;  5CE3 A;  1X9J A;  4O55 A;  1KVB A;  2BTF A;  4A61 A;  2O8F A;  4CF9 A;  2E6L A;  4JLH A;  3MX2 A;  1GOA A;  1FK9 A;  4IG0 A;  1YTU A;  1U6Z A;  3THV A;  1GLJ O;  3QFU A;  1C0M A;  3WEE B;  1W0H A;  3QNN A;  1YI2 N;  2DFH A;  1VSJ A;  4U7B A;  3VGK A;  2QTD A;  4U67 L;  4FWP A;  1U04 A;  4CD1 A;  4GV9 A;  3HPO A;  5GIO A;  5AJ3 K;  3QES A;  2HHS A;  4LSN A;  2WOM A;  3A0I X;  5HL7 L;  3V4I A;  4A59 A;  3KK2 A;  3OYH A;  2XO7 A;  4DFP A;  4O8K A;  3TAR A;  2KW4 A;  2VG5 A;  1NGA A;  4M63 C;  2ZGZ A;  4YOT A;  3EE9 A;  3HSC A;  2RHK A;  1DLO A;  1BA0 A;  2FXU A;  1S3X A;  2P9P A;  2O8E B;  2F9W A;  2WON A;  4IFV A;  3SK3 A;  4I2P A;  1RDA A;  1K8K A;  1T44 A;  4WFN L;  3QFP A;  3MK6 A;  3P83 D;  4CGG A;  3RMB A;  2QEX N;  1NK0 A;  3T1Y K;  3D2F B;  1Z25 A;  5EOY A;  4JD2 A;  5KQ8 A;  4Q5V A;  1TK5 A;  4DQQ A;  3CPW M;  3CIP A;  5B8H A;  5M1O A;  3CCE N;  1KAX A;  5EY4 A;  3AAP A;  4DR7 K;  1GOC A;  3KLI A;  5JVH L;  2HHU A;  1RTH A;  1REV A;  2QKB A;  4DB3 A;  4CJ4 A;  3WT0 A;  3R8E A;  4KBO A;  3SQ2 A;  4BRP A;  2G8F A;  1YF5 L;  2A41 A;  1NK4 A;  3NF7 A;  3RRG A;  1GOB A;  4KRF A;  2AJQ A;  3HRG A;  3LL3 A;  3NGI A;  4ISE A;  4PA1 A;  1XQS C;  3G6E N;  2F9T A;  1QSL A;  2NUB A;  4FJ9 A;  1X1P A;  2V7Z A;  4RW8 A;  4FK0 A;  2JGU A;  2QA4 N;  5KTQ A;  4G9Z A;  2Z1J A;  1NGI A;  4EHT A;  4A2A A;  2IVP A;  3DOK A;  4B1W B;  2FSN A;  1YJ9 N;  3L4I A;  1SQK A;  1FKP A;  4GV3 A;  4BDP A;  4F9O A;  4A57 A;  5I42 A;  4JI8 K;  1NBW A;  3CCJ N;  1G15 A;  1QZ5 A;  4DLG A;  4BAC A;  4B8C A;  1TKD A;  2NLX A;  1K6Y A;  4XEI A;  4C8N A;  4JKG A;  1YT3 A;  3F2K A;  3VOV A;  4PL7 A;  2R7Y A;  4JI6 K;  2W6K A;  1SL1 A;  3H45 C;  4BE0 A;  1HJR A;  3L2U A;  4W5R A;  2XY5 A;  4DHY A;  1C6V A;  4FWL A;  3Q7C A;  4H5R A;  3ULD A;  4HTL A;  4FZZ A;  4KAZ A;  2D4W A;  1HQE A;  1VHX A;  3ZT4 A;  4ELV A;  5BRH A;  4E7I A;  4E3S A;  3A5L C;  3NVM A;  1ATR A;  4NB4 A;  1E4G T;  1ZYQ A;  1S6Q A;  4YFU A;  4JI7 K;  1VQP N;  1U48 A;  5HLF A;  4AQY K;  3NMU A;  4JHD A;  5FDL A;  3K0S A;  4Z4C A;  1KCF A;  3RTV A;  3ZLJ A;  4M3Z A;  4HVJ A;  4DF8 A;  4DV5 K;  5DM7 L;  1QVF M;  3KLG A;  3HST B;  3IRX A;  3V9S A;  3THW A;  3AA2 A;  1WSI A;  5KPZ A;  4XH5 A;  5BR8 K;  2CH6 A;  1G99 A;  4ISF A;  4CJV A;  3KHY A;  2HBJ A;  2P1J A;  4CZG A;  2O8D A;  2I7P A;  4BVO A;  4LFC K;  1H1V A;  3VEW A;  4AHT A;  2FC0 A;  3RSE B;  3OS1 A;  2NRH A;  3TSU A;  1LWC A;  2WBN A;  3MN5 A;  3D2E B;  4CFA A;  3PIO L;  2QWM A;  3QER A;  3LP3 A;  2Z1G A;  2XY8 A;  3CJ7 A;  3LZI A;  2AA4 A;  3AGR A;  4IBN A;  3K5M A;  1B9D A;  3AVL A;  1KXP A;  3HOS A;  3PSI A;  3NE6 A;  3SUP A;  1JXB A;  1SV5 A;  4AM7 A;  3IFR A;  4JKD A;  4DTX A;  2HF4 A;  4DCH A;  1XC3 A;  5BPM A;  3EKS A;  3AO5 A;  4FWM A;  3ZSX A;  2A42 A;  3KKS A;  4XIU A;  1A5W A;  2A1R A;  1NMD A;  3FFK B;  4PHT X;  4OPA A;  4DKW A;  4LC9 B;  4CJE A;  3I0S A;  4FLY A;  4E7L A;  1J6Z A;  3O9S A;  3DLE A;  3RMD A;  2KZM A;  4LSL A;  4H0V B;  3J8A A;  3MCA B;  1TK0 A;  4JS4 A;  3OYB A;  1D9D A;  3CCQ N;  4LY7 A;  5JS1 A;  3C6T A;  4J2E A;  4OLA A;  4JN4 A;  3RVC A;  1EP4 A;  2FBV A;  5LJW A;  4OGE A;  4Z0U A;  2OA8 A;  3BP8 A;  3VGM A;  1C1B A;  1HYZ A;  2BDP A;  3QDK A;  4FYD A;  1T6D A;  3H08 A;  4FM0 A;  1P90 A;  1LV5 A;  2VG7 A;  1KLM A;  4BE2 A;  3U9D A;  3O4W A;  2ASO A;  4CHQ A;  3I0R A;  1HLU A;  2O8B A;  3WQU A;  4CJL A;  2E2N A;  2IGI A;  5HBM A;  3J80 O;  3SUO A;  4OO1 J;  4N5S A;  2D0A A;  2P51 A;  2HMP A;  4NO7 A;  3VES A;  1L3U A;  5AQG A;  4ILG B;  1M90 O;  2QXF A;  2Q0R A;  5LJV A;  3CCU N;  1ITG A;  4JKB A;  3AVB A;  5HOO A;  4KH4 A;  4RW6 A;  1NM1 A;  1W7A A;  3TU5 A;  4CFB A;  4DV2 K;  4A62 A;  1HYS A;  2PY5 A;  4JK9 A;  3LDQ A;  5SWM A;  3CC7 N;  4FJH A;  1GLL O;  4LF5 K;  3L2R A;  3L2V A;  3H3N O;  1T05 A;  4CJT A;  3TPQ A;  4Y0W A;  5AQZ A;  3OS0 A;  3ZT3 A;  3GOI A;  4CF0 A;  4ID5 A;  2D0B A;  4LD0 A;  3IAY A;  1FXX A;  2OAN A;  3VEV A;  4WQ5 A;  4YY3 K;  4FJG A;  1W97 L;  4OX9 K;  1GLA G;  4WQ4 C;  4BRG A;  3L4Q A;  1GLB G;  1VQO N;  4J8F A;  3W3D A;  4B9T A;  4PY5 A;  3S41 A;  1IH7 A;  4X64 K;  4FCY A;  3FR0 A;  2O8F B;  3R6M A;  4DR3 K;  1P8Z A;  4DV1 K;  3PO5 A;  3SBG A;  5KGX A;  3H1V X;  1WSG A;  1X9W A;  1W9H A;  2QK9 A;  2V52 B;  4FJI A;  3BEX A;  4M7Y A;  4F2R A;  3U8X A;  4GNI A;  1Q86 O;  1HNV A;  2FSK A;  3OYK A;  1XNR K;  2ZF5 O;  2D0P A;  4A2B A;  1QS4 A;  3G0Z A;  3B8A X;  1BU6 O;  3AO1 A;  4CER A;  4DS4 A;  1TKX A;  4JI2 K;  4JKE A;  4WQ5 C;  4IWV A;  2EX3 A;  2Y1J A;  3NGY A;  4KTZ A;  2IAJ A;  4M7X A;  3J7Z O;  2G8I A;  1TKT A;  3ATU A;  2P9L A;  4X66 K;  4OPJ A;  4E89 A;  3ZSZ A;  3KIO A;  1UA0 A;  3PY8 A;  1VSM A;  3BZC A;  4QS7 A;  1HX1 A;  5A2Q O;  2XHB A;  3MXM A;  3L2W A;  2KFZ A;  4JKH A;  3WXM B;  1UAX A;  4CVN E;  3J81 O;  2GUI A;  3M3Z A;  3FGU A;  1BO5 O;  3ZEU B;  1RBV A;  4B9M A;  4B8A B;  4WCE L;  1SL2 A;  2V51 B;  3OBY A;  4DR1 K;  2PZS A;  1HUX A;  3F5T A;  1GLC G;  4M3Y A;  4M3T A;  1X3N A;  4CEE A;  1WN7 A;  3OA9 A;  2IC3 A;  3P38 A;  3CCM N;  3KWI A;  1LAW A;  3AA5 X;  1HRH A;  4B3S K;  4JKC A;  4NYF A;  4BR4 A;  4YOR A;  2QI2 A;  3TAM A;  2YNI A;  1XWL A;  5AQI A;  4H0Y B;  2QWN A;  3KD5 E;  1U47 A;  4FJK A;  1VQN N;  4HCC A;  3SAF A;  2WUS A;  2DPN A;  3EEQ A;  2HNY A;  1D8Y A;  1X9M A;  1KFD A;  3OVN A;  3UKU B;  4KI6 A;  1T6C A;  3VQA A;  4IKF A;  1N36 K;  4K42 A;  1ZC6 A;  4CJQ A;  4DSK A;  1WBD A;  4LF7 K;  4IO9 L;  2HBL A;  4BR2 A;  4RW9 A;  1N33 K;  1IKX A;  2F4V K;  3SV3 A;  1U4B A;  3MAQ A;  4A5A A;  2WTU A;  4JV5 K;  4R79 A;  4LF8 K;  4YNQ A;  4FK4 A;  1RTJ A;  4FXD A;  1S1V A;  3UKR B;  4FM1 A;  2QKK A;  2Q0U A;  1RGI A;  1BA1 A;  4FSV A;  3GDQ A;  1YXQ A;  4YHH K;  5CY4 A;  1EKE A;  3K2P A;  4GMJ B;  3MMV A;  3T3F A;  4N47 A;  3SJJ A;  4CEO A;  4H8K A;  4IZ9 A;  1V4S A;  3VF6 A;  5ADX H;  1NGE A;  3T69 A;  1VQ8 N;  5LMN K;  3LP2 A;  1VQK N;  4CBW A;  2GBZ A;  4CD3 A;  4CES A;  3CCR N;  1HMV A;  4I7F A;  3VEZ A;  4BDY A;  5F0X A;  1X3M A;  3CM6 A;  4DU4 A;  3PX4 A;  3SPY A;  3SV4 A;  2PAV A;  5HRP A;  3OS2 A;  2G8V A;  2D0O A;  4JHD B;  3BUZ B;  4IDK A;  3QLH A;  2FBY A;  4CBX A;  4PL8 A;  3LP0 A;  3OYL A;  5SZT A;  1ASV A;  3D6R A;  3THW B;  4CEC A;  4E1J A;  2BUP A;  3IDH A;  3NDK A;  4HCB A;  1VSD A;  1I39 A;  3MCP A;  4DTS A;  2O8D B;  3L2Q A;  3CQY A;  3Q7B A;  4WE1 A;  2FSJ A;  1K73 O;  4FJL A;  3P31 A;  2YJF A;  1BG3 A;  4BRQ A;  2OTL N;  1YJW N;  4CJF A;  4CZH A;  4DU3 A;  1ATN A;  2UYT A;  4ILJ A;  4OKK A;  1C1A A;  2HB5 A;  4C8M A;  2A1S A;  4BC5 A;  4DUY K;  4JKA A;  4PKH A;  5M1P A;  4CW7 B;  4K25 A;  1T3V A;  3KK1 A;  3BF3 A;  3KZB A;  1RT2 A;  2YX6 A;  5I9E B;  5GAE P;  4X62 K;  4CHO A;  3RWU A;  4JRP A;  5CZ1 A;  1U49 A;  3EKU A;  1BL3 A;  1FW6 A;  1S1U A;  2E6M A;  3ZSQ A;  2GV9 A;  4CEQ A;  3LDO A;  1KVC A;  5JMV A;  4TSX A;  4RW7 A;  4CJR A;  3DLK A;  3AVH A;  1NK5 A;  1J5O A;  3JSM A;  2O8C A;  4H5W A;  4UQG A;  3VQE A;  4HTU A;  3J7Y P;  2GTD A;  4RTF D;  5AZJ B;  4AHC A;  3QIC A;  4W5N A;  2UXD K;  3P4I A;  2P9S A;  4DTM A;  1VSF A;  2OZS A;  3M8R A;  5FPD A;  4QCL A;  1R0A A;  3RMA A;  1ILY A;  3P5J A;  1YTA A;  5JLH A;  2F96 A;  1HPZ A;  4Z4H A;  4F3O A;  3CYM A;  4KTW A;  2Y1I A;  4FLU A;  3ZSV A;  4O5F A;  3HZ6 A;  3O1B A;  2HND A;  4CEB A;  2PBD A;  4FWR A;  3S9H A;  3PUF A;  3BF1 A;  3H6E A;  2P5O A;  4L8R B;  4DR2 K;  1IKW A;  4DSJ A;  2OTJ N;  4B1X B;  4FJ8 A;  4C8O A;  1RT1 A;  2UU9 K;  2O8B B;  2OPR A;  3HPH A;  1BIU A;  2RF2 A;  4BGA A;  4KV8 A;  4CEF A;  5C12 A;  5E41 A;  2P9K B;  5AQO A;  4CHZ A;  1ATS A;  2PYJ A;  3V1O A;  3OYD A;  1J9A A;  3SMS A;  3LPT A;  3LPU A;  3I56 N;  3HK2 A;  3MEG A;  1LAV A;  3SAH A;  5FPN A;  3SJH A;  4DU1 A;  3CF5 L;  1TAQ A;  3AVF A;  2KLA A;  3SUQ A;  4LFA K;  2YI1 A;  3LDS A;  2NRW A;  3O4Q A;  5TKW A;  4JI4 K;  4WF9 L;  3MWT A;  1I94 K;  4DV0 K;  4FM2 A;  1NLV A;  3LAL A;  2GWK A;  2W40 A;  3BY5 A;  1KFS A;  3VF2 A;  5FLX O;  3CME N;  1UWB A;  2ZM6 K;  5KGW A;  4ISG A;  1K8A O;  2OCE A;  3TAE A;  3CPE A;  1SKR A;  2E2P A;  1DTT A;  3VQC A;  1Q18 A;  4GVM A;  4ELU A;  1RT4 A;  4CJP A;  2F7T A;  4FLZ A;  1LOT B;  3PX0 A;  1QHA A;  4GKJ K;  3CJB A;  2XY6 A;  4H0T B;  4BG9 A;  2W41 A;  3G10 A;  4CK3 A;  5AQX A;  1NJI O;  3V81 A;  3SNN A;  1VQ4 N;  3DLB A;  3HTV A;  3I8D A;  4FJ5 A;  5M1N A;  2VWK A;  4FLV A;  3B6P A;  4H4O A;  4DG1 A;  3VQ6 A;  1CXU A;  4CJW A;  2ZQB A;  2E8A A;  2G8W A;  4ZTJ A;  4IO8 A;  4DR4 K;  1FJG K;  4B1Z A;  1QQC A;  1WUA A;  5JIC A;  4DF4 A;  3IS9 A;  5FRO A;  3CC2 N;  1J54 A;  2P9L B;  3K5N A;  4YOW A;  3UIQ A;  5DM6 L;  1CLQ A;  5AQN A;  5GAD P;  4KHU A;  5KPT A;  4DV4 K;  5E84 A;  3WNG A;  3DWL A;  2HF3 A;  1NKE A;  4GW6 A;  4H5T A;  3VA3 A;  5CZ2 A;  3LWL A;  1QTM A;  1ASU A;  3TTF A;  1SKS A;  3TWH A;  3ZX2 A;  2NRT A;  1WAJ A;  3L0Q A;  4AHS A;  4ZTF A;  1RDB A;  1CXQ A;  3MN9 A;  1L3S A;  4CGJ A;  1VRT A;  4DSE A;  3SQ0 A;  1GLD G;  4BRM A;  4B9N A;  1C0T A;  4C8K A;  1JLB A;  1JLA A;  3LDL A;  1KLN A;  2HHX A;  4CHN A;  2A40 A;  4MO4 A;  3F9M A;  3JAM O;  4W5Q A;  3VER A;  3K58 A;  2JWK A;  4IEI A;  2IDO A;  3E66 A;  4RW4 A;  4FWO A;  3VQP A;  2YHB A;  2RE2 A;  3OYM A;  3S3N A;  3OYJ A;  3B6O A;  1T7P A;  1ZBL A;  4Z4I A;  4M3U A;  4AHV A;  2HOE A;  3HM9 A;  4DMN A;  3V9W A;  1TL3 A;  4OPH A;  3AVJ A;  5M1K A;  3VEX A;  4O4G A;  3VPZ A;  2HBM A;  1KTQ A;  2A3Z A;  4M45 A;  4HUF A;  1TUU A;  3TSQ A;  1N34 K;  3OBW A;  1YUW A;  5AQT A;  3ZT1 A;  3AO3 A;  3BGR A;  2ZJQ L;  2KZZ A;  2G8K A;  1VSH A;  4LF9 K;  4O44 A;  3O3H A;  4CK1 A;  4LF4 K;  3V1Q A;  4Z4E A;  4B9V A;  1S6P A;  1VSK A;  2O4I A;  3T1H K;  3LAN A;  1S1X A;  4H0O A;  3WNE A;  3ZCM A;  4BQZ A;  1NJY A;  1SAZ A;  3GE1 A;  1ZXO A;  3I55 N;  4DQ8 A;  2KHO A;  3U4L A;  3OYN A;  5GAG P;  1OH7 A;  3CG7 A;  3QET A;  4IOA L;  4H5V A;  4IXC A;  4KH5 A;  4Y1C A;  3LAM A;  2D1K A;  3S3M A;  3LAK A;  1FKO A;  2W42 A;  3ISN C;  1JCE A;  3OW2 M;  5J2Q A;  3QBX A;  1TKZ A;  2Q36 A;  3AVA A;  1RDU A;  1HQU A;  2P9U A;  4BC2 A;  1V4T A;  1B9F A;  2VG6 A;  1XHZ A;  5FPE A;  4DQI A;  3U3Y A;  4FOI A;  1N6Q A;  1TL1 A;  3VQQ A;  3AO4 A;  4DFM A;  3RRH A;  2HNZ A;  4LH4 A;  2PFU A;  2RPI A;  3EL2 A;  3AVM A;  4DTP A;  1VAZ A;  3L3U A;  4BR0 A;  1S9E A;  3IUC A;  5H1S Q;  4BG8 A;  4AHR A;  1LWE A;  4BC4 A;  5J2M A;  1N5Y A;  5AQJ A;  3GG4 A;  4H5N A;  5K14 A;  3WNH A;  3SMP A;  1OH5 A;  4O8U A;  4JRQ A;  4IOX A;  4F8R A;  2WFB A;  1JL2 A;  3O3F A;  4KHS A;  4DV7 K;  1RIL A;  4KB1 A;  3I33 A;  4OVL A;  3J7A P;  1BGX T;  1VSL A;  2ZE2 A;  2XRI A;  5BRD A;  4DTR A;  1RT3 A;  2NRX A;  4ICL A;  1D5A A;  4DFK A;  1JKH A;  4GVE A;  1O13 A;  3UE5 A;  4HHT A;  3R9P A;  1B92 A;  1XHX A;  3DRS A;  2O8E A;  3WXK A;  4O0I A;  3AA3 A;  4DV6 K;  4E7H A;  4KPY A;  4FWN A;  1RT6 A;  4FW1 A;  4M41 A;  1RT5 A;  4YOX A;  2B6A A;  3TAB A;  4KB0 A;  3M6G A;  4JI5 K;  4OKJ A;  1RBR A;  1NK9 A;  3OHR A;  3SBT A;  4KHY A;  2VGM A;  1L3T A;  3CCV N;  4QS9 A;  2FBT A;  5GAH P;  2O8C B;  4C1N K;  3KD1 E;  4E7J A;  2ZJP L;  4F4K A;  1X9S A;  1RFQ A;  1JL1 A;  4DV3 K;  1S9G A;  4EHU A;  3O1W A;  4MDB A;  2P9S B;  4CGF A;  5AFU A;  4AIL C;  1JXE A;  2HW3 A;  2A6A A;  3IKM A;  2ITG A;  1WBB A;  2DY4 A;  4WYB A;  5AQK A;  3K9J A;  2HST A;  4CGI A;  5T7B A;  3NHG A;  4CF2 A;  3LDP A;  3VF4 A;  4DLE A;  4QS8 A;  4GKK K;  2DTU A;  4BY9 C;  3MX5 A;  4OPK A;  1VSI A;  1HNW K;  4DQP A;  1D4X A;  4B9S A;  4C8L A;  3TAP A;  1O1W A;  4BQL A;  4B3R K;  2ZGY A;  3OYF A;  5BPN A;  3EE8 A;  4CIE A;  2I5J A;  1WOQ A;  4CJU A;  1KVA A;  3SYZ A;  5F1X A;  5BPL A;  2YHY A;  1N8R O;  3LP1 A;  5C15 A;  1JJ2 M;  1J53 A;  3MWP A;  4F3T A;  2P9P B;  5C2F A;  3CCS N;  4KHP K;  1K8K B;  3VQ5 A;  2DFE A;  4CFC A;  2YKN A;  3T7Z A;  1S22 A;  3EN9 A;  4AHU A;  3DM2 A;  2YNG A;  4H0X B;  3OTO K;  4JD2 B;  4ID1 A;  2P9I A;  2ITM A;  1JLG A;  5GIN A;  1EO1 A;  2VWJ A;  4CED A;  3E1Y A;  1TYQ A;  3C94 A;  3MXJ A;  3HJF A;  4F2S A;  3KWG A;  2NZT A;  4BR9 A;  4M3R A;  4WFB L;  1XC9 A;  5GIP A;  3QEX A;  2JLE A;  2YNF A;  1OKJ A;  1Q7Y O;  2GEL A;  5CYQ A;  2HMI A;  3M8P A;  1XMQ K;  4HUG A;  4BR5 A;  3THY A;  4B9Q A;  2FF3 B;  4FLX A;  4AF1 A;  3HP9 A;  2W6L A;  4IDH A;  2YCH A;  4JNE A;  3SUN A;  3CCL N;  4H03 B;  4ZHR A;  4J2B A;  4B3M K;  1NGB A;  3QB0 A;  1WLJ A;  3KK7 A;  3H3O B;  3NF8 A;  4FLT A;  3QIN A;  1S1T A;  4O0J A;  1EWR A;  2LSN A;  1C0G A;  3L6Q A;  2B4J A;  3QIO A;  5CYM A;  2UUA K;  3O4N A;  4DTO A;  3E9L A;  3TTD A;  1C0F A;  1RBU A;  3CET A;  4DTJ A;  4CIG A;  1IKV A;  1NKC A;  1ESV A;  4JKG B;  1NK8 A;  3CJ9 A;  1QQN A;  3M5R A;  2KKZ A;  2YHA A;  1BIS A;  5AR0 A;  1JLF A;  1WSH A;  4K0K K;  3LM2 A;  4V19 S;  1U2V A;  2BAN A;  4E19 A;  3DRP A;  3NF9 A;  3NH0 A;  1RDW X;  3OJU A;  2O4G A;  5AQQ A;  1NNE A;  3FZF A;  4DSF A;  3A5O C;  5AQW A;  3A5N C;  4NXM K;  3WXI A;  5DMR A;  1W2B M;  1YJN N;  4BVP A;  1KQS M;  1OVY A;  1QHT A;  4Z94 A;  4E1M A;  4GV6 A;  3M8Q A;  5EVZ A;  2DFF A;  4JEP A;  3DRR A;  2VGN A;  1HNZ K;  4CFD A;  5BRE A;  3LWM A;  4BC3 A;  3F9K A;  2BH1 A;  3VEY A;  1KAY A;  1NWK A;  4FO0 A;  5IT9 O;  4CJ3 A;  3ITH A;  4LFB K;  5J2N A;  1SS6 A;  4XH4 A;  2HHH K;  1A5X A;  5HRN A;  2ZD1 A;  1OH8 A;  1KSP A;  5BR9 A;  2BGG A;  2J4R A;  3DMJ A;  1ZBF A;  3M1F A;  3FE1 A;  3ZYY X;  1MU2 A;  2D5R A;  5AQV A;  2OYQ A;  2Q31 A;  2YV0 X;  3C6H A;  4CGD A;  2UUC K;  1IV0 A;  3AVI A;  4EFH A;  3PV8 A;  4Z4G A;  3PLA A;  3MN7 A;  1RCH A;  2Q3S A;  3MN6 A;  1NOZ A;  4FJ7 A;  3HBT A;  1Q81 O;  1MDU B;  3SAG A;  3C6U A;  5FRM A;  3PO4 A;  2HHQ A;  1WB9 A;  3KTQ A;  4EAH D;  3EZ5 A;  4CGH A;  4RG8 A;  4DFJ A;  3NGZ A;  3IMX A;  2QWR A;  3PSF A;  4CJ7 A;  1T03 A;  4B9U A;  1JLC A;  3QIP A;  3VQ4 A;  2E4L A;  2HHV A;  3ASM A;  1BCO A;  2GEM A;  4B1Y B;  3V1R A;  1XMO K;  2OZM A;  2ZWH A;  1VQM N;  3ZET A;  3O8M A;  1RT7 A;  3G25 A;  3O9U A;  2QWQ A;  1MWM A;  4BRF A;  3LZJ A;  3VA0 A;  1J5E K;  1WSJ A;  1BI4 A;  3CFP A;  2GWJ A;  3QBW A;  4KTQ A;  2P9U B;  1CZ9 A;  2E88 A;  2V7Y A;  4FZX C;  3CQX A;  4RCH A;  2ATQ A;  1ASW A;  2YHX A;  3AO2 A;  3VGL A;  4KRE A;  5C25 A;  1EWQ A;  5JS2 A;  3HXM A;  1R59 O;  4XH1 A;  3KLE A;  4K8Z A;  3MDQ A;  1N32 K;  4CF8 A;  4BRE A;  2QM1 A;  2G8H A;  3U6F A;  3TAG A;  3HPG A;  4B9L A;  4GY2 B;  2X74 A;  4E0D A;  4BR7 A;  2Q2R A;  1JCF A;  3ZT0 A;  3HM8 A;  3UB5 A;  5D3G A;  3PIP L;  1DKG D;  4CZE A;  3QNO A;  2YKM A;  3C95 A;  2VQE K;  1ZBS A;  3VET A;  4CCH A;  3FLC O;  2QW9 A;  4DTU A;  4BE1 A;  1NKB A;  3C7N A;  1S1W A;  3IG1 A;  1VQ5 N;  3BDP A;  3MED A;  1HKB A;  1UOC A;  2FLO A;  3HT3 A;  1NG9 A;  1HNI A;  5KRT A;  4K41 A;  1RNH A;  4OKE A;  3K5L A;  4B1V A;  4H0P A;  1QVG M;  1CZB A;  3K9K A;  4CEA A;  3RMC A;  1CZA N;  3N4P A;  1RTD A;  3NBP A;  3AY9 A;  4ELT A;  2ZJR L;  1Y97 A;  4LF6 K;  2KQ2 A;  3ID8 A;  4C23 A;  3CC4 N;  2P9N A;  1BWF O;  3HYF A;  1IO2 A;  2YNH A;  1YAG A;  3MEC A;  3QEP A;  4C1N I;  2Q1N A;  2QWO A;  2H3G X;  3ZEU A;  3ZSO A;  3F73 A;  1NGH A;  4BRO A;  2HHW A;  2UUB K;  4MLE A;  1SUQ A;  5HRS A;  3CFR A;  4FOE A;  5BN9 A;  3VMF B;  4DR6 K;  3VTH A;  1HR0 K;  1VSE A;  3C6A A;  4CJK A;  3VN5 A;  4CF1 A;  3MEE A;  4MQ3 A;  1VQ7 N;  5KI6 A;  3OYA A;  3O5B A;  2X6S A;  5KPR A;  4DTN A;  4A5B A;  4JAX A;  4DSL A;  4OGC A;  2IOC A;  4DUZ K;  4NCG A;  4K43 A;  3E9P A;  3C0B A;  2ASM A;  4FJM A;  2FF6 A;  5M1Q A;  3UKU A;  3QML A;  4HWI A;  2X6N A;  1NGF A;  3KKR A;  4HUE A;  3ENO A;  3AA4 A;  1RDC A;  1WSE A;  1VK0 A;  5BN8 A;  2BE2 A;  4E7K A;  4FK2 A;  2KTQ A;  5AZI A;  1LW0 A;  2YJE A;  4JK7 A;  3VEN A;  3LM9 A;  4CHP A;  1NK7 A;  4I2Q A;  4JS5 A;  3V6D A;  4NXN K;  3UKR A;  1HKG A;  3EYZ A;  3O80 A;  1S5J A;  3DLL L;  4K8X A;  5DK5 A;  2P9I B;  5LMU K;  1U45 A;  1D9F A;  5AQL A;  4OLB A;  2KFN A;  4I9Q A;  1TYQ B;  1KD1 O;  1QSS A;  4CI6 A;  1NJX A;  1IBL K;  4KHW A;  1MWK A;  2P5G A;  3MXI A;  4FPA A;  1HPM A;  1QSY A;  4FWQ A;  2VCP A;  3KLF A;  1XNQ K;  1K9M O;  4IG3 A;  5C24 A;  5CR4 A;  4CIF A;  5TKY A;  3EO3 A;  1NGG A;  4BGB A;  3V9X A;  4BWM A;  4CEZ A;  1QE1 A;  3FZK A;  3THY B;  1NJW A;  4N41 A;  3TTC A;  3FZL A;  4M3W A;  3OYG A;  1RBS A;  1LW2 A;  2CGL A;  4B3O A;  1NJZ A;  1DTQ A;  3BZK A;  4IEE A;  3ATV A;  3ENH A;  3KJV A;  5AQS A;  4RWT A;  4FVM A;  3O08 A;  4CZI A;  4IJA A;  3DXK A;  3EZW A;  4I6M A;  5FPM A;  3SZ2 A;  1RTI A;  4IFY A;  3DXM A;  4CK2 A;  1NK6 A;  1SL0 A;  2B5J A;  5AQF A;  4CHY A;  4NCA A;  1KAZ A;  2Z1H A;  1U2V B;  4PWD A;  4LH5 A;  3ULE A;  4BRA A;  1KRP A;  5BRF A;  5AQH A;  4EP5 A;  3QEV A;  2NRV A;  4N76 A;  1L5U A;  5KQD A;  2ETJ A;  2NNW A;  1Q8I A;  3DJC A;  3L8B A;  2EHG A;  1A5V A;  1SZ2 A;  3QEI A;  4NLB A;  3THX A;  4BRN A;  4DS5 A;  3OJS A;  4KKO A;  5AZJ A;  5HRO A;  3V9U A;  1NGD A;  3CJC A;  2GX9 A;  3DOL A;  5EX5 A;  3T19 A;  2F8S A;  2CH5 A;  2XY7 A;  3HI0 A;  4CZK A;  3GBT A;  5AQY A;  3AVK A;  4YOV A;  4BRC A;  1Z26 A;  3E01 A;  4M42 A;  3FZH A;  3WEE A;  3T1A A;  1IG9 A;  1Q9Y A;  3OY9 A;  1RBT A;  3AVG A;  1HNX K;  3VQD A;  2F8T A;  2NRZ A;  5J1E A;  2E20 A;  4IOC L;  4MO5 A;  4NCB A;  1DGK N;  2QXL A;  3K59 A;  4AM6 A;  5C0Y A;  4J2A A;  3DLR A;  2P9K A;  2UXB K;  1NGJ A;  4WQ4 A;  1BDG A;  1UA1 A;  3KK3 A;  3TAF A;  1NGC A;  4MFB A;  2IIR A;  5EXW A;  1IBM K;  3SPZ A;  1IKY A;  4NYN A;  3HO1 A;  4FJX A;  4CZF A;  4B1U B;  3V9Z A;  3D2F A;  3WQT A;  3SI6 A;  2YHW A;  5AQP A;  3NH1 A;  1TK8 A;  2E2Q A;  3TR8 A;  5LL6 Z;  5LY3 A;  3NCI A;  1F21 A;  3VQB A;  4BRI A;  4QAG A;  4CE9 A;  4JKF A;  3E9O A;  4W5T A;  4KFB A;  2HVH A;  3ENB A;  1WAF A;  5AQR A;  3CJ1 A;  3D0P A;  4FW2 A;  2OPP A;  4IJN A;  3ZET B;  1BIZ A;  3C65 A;  1IJJ A;  1RDD A;  3VQ7 A;  1SKW A;  3O9Q A;  2ASP A;  3FFI A;  1WNS A;  5KRS A;  1BI4 B;  1Q82 O;  2AP1 A;  2PYL A;  3CD6 N;  4CBU A;  3K5O A;  1E3M A;  3A5M C;  1S72 N;  1VQL N;  4Z4F A; 
#chains in the Genus database with same CATH homology
 4LFA K;  4JI1 K;  4NXN K;  3OTO K;  4JI4 K;  3JAM O;  4DV7 K;  1I94 K;  4DUY K;  4DV0 K;  4DR5 K;  3J7A P;  5IT9 O;  5LMU K;  4CW7 B;  4YY3 K;  4LFB K;  2VQE K;  4OX9 K;  5FLX O;  4JI0 K;  2HHH K;  4JI8 K;  4X62 K;  2ZM6 K;  1N36 K;  2VQF K;  4JYA K;  4DV6 K;  4X64 K;  1HNX K;  1IBL K;  4LF7 K;  1N33 K;  4DR3 K;  2F4V K;  4DV1 K;  1XMQ K;  4JI5 K;  4JV5 K;  1XNQ K;  4LF8 K;  2UUC K;  4GKJ K;  4LF6 K;  4JI6 K;  5AJ3 K;  3J7Y P;  1N34 K;  2UXD K;  1XNR K;  4YHH K;  4LF9 K;  5IWA K;  2UXB K;  4B3M K;  4LF4 K;  4DV3 K;  2UXC K;  2UUB K;  3T1H K;  4JI2 K;  2UUA K;  1IBM K;  4DR6 K;  5LMN K;  1IBK K;  1HR0 K;  4X65 K;  4JI7 K;  4DR4 K;  1FJG K;  4X66 K;  4AQY K;  5LL6 Z;  4DR2 K;  4GKK K;  3T1Y K;  5A2Q O;  1XMO K;  1HNW K;  4K0K K;  4B3T K;  4DV5 K;  2UU9 K;  4V19 S;  4B3R K;  4DV4 K;  3J80 O;  4DUZ K;  4CVN E;  3J81 O;  1J5E K;  4DR7 K;  4JI3 K;  5BR8 K;  4DR1 K;  4LFC K;  4NXM K;  2E5L K;  1N32 K;  4DV2 K;  1HNZ K;  4B3S K;  4KHP K;  4LF5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...