4LFBL

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 10
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfbL00
2QGQA 4GOPC 1L1OC 1CKOA 2R6GA 3HOUG 3OTOQ 1NMGA 3A74A 3CAMA 4IFDG 5JEAG 4GOPB 1HNXQ 1L1OB 4PZ7A 3PIPA 1S72A 1HZBA 2MNAA 1VQJA 1XNQQ 2K5NA 1N32Q 1LYLA 3CW2C 3UDGA 3NBHB 3G48A 5J3BA 1C7YA 1VQ9A 4EQ5A 1XPUA 1QVCA 2VQEL 4LF6Q 1X3EA 2D62A 1NBWA 1XNRQ 1LTLA 1XJVA 3I4NG 4OXPA 3E9IA 2UU9L 4L5QA 1T9HA 3PF5A 1EQRA 2JJQA 5BR8Q 4OO1G 3JAMi 2A19A 1B7YB 4J15A 4YY3L 1KC8C 3U50C 3NELA 4TQUS 4JC0A 2Y0SG 1YEZA 4X62L 3T1HL 4B3SL 1QVFA 4PG3A 1TWHH 1UE5A 4A3IG 4WJ3M 2GVBA 3UDIA 2YTVA 1N36L 3PO2H 3J7A5 4P72A 2ID0A 3JAMc 1VQAA 1HNWQ 2PI2A 5M3FH 2K5HA 4QJFA 1VQEA 4R1JA 3HKZE 1E3PA 1SR3A 1VCIA 3M4QA 4GS3A 3RR5A 4HJ8A 4A3CH 2MQHA 2NVQH 2YYZA 1N33L 2R93H 2KHIA 1J5EQ 3PO3G 1IBLQ 5GROA 2RCNA 4GKKQ 3K0XA 1OXUA 4A3FG 3GD7A 4A3DH 1A63A 3PUZA 4NXNQ 4LFBQ 2ZTDA 2ZM6L 4DUZL 2KENA 3T1YL 2F3IA 4AQYL 4YWKA 1C9OA 4DV3Q 1X54A 4A3MH 4POGA 3K80C 4IPCA 4RG1A 3S14H 1XPOA 3TS0A 2JEBI 1X56A 3MEFA 4DAMA 2VQFL 1OXVA 3ERSX 1IBML 3GTGH 3ICEA 1QUQA 2E2HH 1AH9A 2UXCQ 3BZCA 1P16A 1Y1VG 2F52A 3B6YA 3HOVH 3S16H 2AMCB 4DR4Q 3M85A 1KRTA 4JBJA 1PA6A 3OW2A 3S17H 1IL2A 4KHPQ 4X66L 2KHJA 4KLKA 4BY1G 3S2HH 4C3JH 5C0XI 3U4VA 3HOXH 2AWNA 5HY6A 4UP8A 1L2FA 1PYBA 4FDBA 1EQQA 4L5RC 4BBSH 1Q81C 2BH8A 3S1RH 3I4MG 3E9HA 2VUMH 3PUXA 4JYAL 4LFCL 5GQOA 4A3LH 4H02A 2B63H 1WOCA 2LXKA 4B3TQ 4JI0L 2RHSB 3RZOH 4DR7Q 1YJ9A 5LMUQ 1EWIA 2AHOB 5IYBH 4DV4Q 4JOIC 2E5LQ 1PH4A 5EAYA 5C4JH 2KBNA 3D0FA 1I50H 3HOYH 2JE6I 1TWFH 4MTNA 2B29A 1Y1WH 1VQCA 2HIVA 1NMFA 5IP7H 4DR2Q 4O2DA 3GTPH 2YTXA 1EOVA 1IXRA 3GDEA 3H0GG 2IHFA 4NPSA 4DUYL 4DR3Q 2Z6KC 1X6OA 2QA4A 4A76A 3S1QH 1PH6A 2NVTH 4WJ4A 1HZCA 1EIYB 2HHHQ 1X55A 1Q8KA 5ELNA 4X64Q 4NXML 1IYJB 3FKIG 4QL5A 4A3GH 4OX9Q 4DV5Q 2AWOA 2MO0A 1KAWA 2CFMA 5FJ8G 3U58A 2EIFA 4UP9A 2IY5B 2K52A 4JBWA 1Y14B 4JI4L 4JG2A 3CCVA 3A0JA 3MXNB 1Q12A 1L0WA 2N78A 2JA8H 4GKJQ 1SROA 4LWCA 1V43A 2R92H 2QEXA 4JI8Q 5FLMG 3CCEA 1XMOL 4BA2I 4B3RQ 4GKJL 2Y0SE 3AQQA 2DGYA 4IJHA 1AE3A 4QY7A 4DR1L 4JI1Q 1MIUA 4UP7A 4A3JH 1SFOH 5C0XJ 3UE0A 5M3MG 3I56A 2UUAQ 1BBWA 3PCOB 2VW9A 3STBD 1K83H 2JA7H 4DV1Q 4TVAB 2HIXA 4XIGS 1KRSA 1W2BA 4LF9Q 2LSSA 1K3RA 2OQKA 1C0AA 1O7IA 1SRUA 2XTIA 4A3EG 2NVXH 3CC4A 3PGZA 1WCMH 3M4OH 2N49A 3PSIA 2VNUD 3RLNA 1VQGA 4A4IA 1TWAH 1UE1A 1LUZA 4L5TA 2IT1A 4BXXG 5IYCH 1M1KC 4GLAC 4R4TA 4A75A 2F4VL 4JBMA 4P75A 4BA1I 4JI2L 2Q2UA 4LF5L 5H1SE 4IPHA 2VY3A 2MO1A 5C0XG 1W3SA 4BBRH 1YIJA 3A5UA 4YWMA 4JI5L 5M5YH 2BA1A 2H5XA 2VQEQ 3RNUA 3CCRA 4QQBX 1RIPA 1BKBA 3J81i 1I5FA 3S24A 1JB7A 2EXDA 2UU9Q 1EIFA 3KDFA 3UDFA 1N34L 1MKHA 3E0EA 3K7AH 4DV0L 2YU9H 4YY3Q 4DV7L 1SLJA 2I5MX 2WAQG 4A93G 3AYHB 4P74A 3GTMH 4X62Q 2Q2HA 3T1HQ 4B3SQ 3GTOH 4IO9A 1FJGL 1VQOA 4A3CG 3SGIA 4DR6L 2OTLA 2Z0SA 2R93G 2NZOA 1OXTA 2NZHA 1UEBA 4A3KH 4AYBG 1N36Q 3HOWH 4A3DG 4APVA 2C35B 2CQOA 2RF4A 4X65L 1VQKA 4R4QA 1VS0A 1VQMA 1VQ6A 4YCVA 3U4ZA 3H3VH 3HOZG 1NE3A 1QUQB 1N33Q 4YHHL 1YNXA 1B70B 5IY0A 5DLQE 1VQ4A 2ZJRA 1MJCA 5C3EH 1R9TH 2K5VA 3CP0A 1MJEA 2E2JH 4BY7G 2ZM6Q 2PQAA 2Q2TA 4DUZQ 4GOPA 1E7ZA 3T1YQ 4YCWA 4GNXA 1EYGA 4AQYQ 1AE2A 1PFSA 4PZ6A 3CMAA 1IBKL 1OXXK 3ULLA 4JI7L 3I4NH 1QZHA 1EFWA 1J6QA 3HOXG 2VQFQ 3UE1A 3TRZA 5GAHC 1CUKA 3DM3A 1IBMQ 2JA6H 1K8AC 3HFZB 3J7ZC 4BBSG 1FL0A 2VUMG 3STBC 3K8AA 3TREA 3RN2A 4MNOA 4R4IA 4B3ML 4X66Q 3G71A 3BJUA 4Y7NH 1XMQL 1DGSA 4KHZA 2HT1A 1YITA 1I6HH 4DV6L 1HR0L 2ZJQA 3GTLH 1X65A 1ASYA 5IYBG 5JJKA 1UWVA 4LUZA 1Z47A 4OONA 1M90C 2JA5H 3HKSA 1FGUA 4DPGA 1OTCA 4JYAQ 4LFCQ 2ASBA 2I5LX 3HOYG 3OYYA 2UXBL 1JMCA 4JI0Q 1Y1WG 1SE8A 5AJ3L 2ZTEA 4LF8L 4JV5L 1NY4A 2WP8J 5IP7G 5HGQA 1PV4A 2UUCL 1GD7A 4PMWA 1JJGA 3VDYA 3CCSA 1KXLA 3FP9A 2RHQB 1UE7A 1HZ9A 1CKNB 4A3FH 4JI6L 4DNIA 4A3BH 4R4CA 2N3SA 1WJJA 3H3VI 1G291 2IX0A 4AH6A 4POFA 1HH2P 2ES2A 1E1OA 4JI3L 5IP9H 1XPRA 4DUYQ 2JQOA 3RLOA 3AEVA 2HQLA 1QVGA 4NXMQ 1JJCB 3RZDH 3RLFA 1U0LA 1A8VA 2JA8G 4X6AH 1Y1VH 3W1GA 5K36G 2R92G 3W5OA 1H95A 1I3QH 5C4XH 2R7DA 4P73A 4YWLA 2JA9A 3GTJH 3CCMA 4OWTB 1G51A 4A3JG 3F1ZA 1Q1BA 3I55A 4JI4Q 4GN5A 1HR0W 1S3OA 1YHQA 4K0KL 2I0QA 3J80i 2OCEA 1HNZQ 2JA7G 4DV2L 2B3GA 1VQPA 2WAQE 1Z9FA 3I4MH 2WFWA 1XMOQ 2AKWB 3CF5A 1HNZL 2OWOA 1PH1A 4LUVA 5IWAL 4HJ9A 1JT8A 4KI0A 1Q7YC 4LFAL 1PH7A 4IJLA 1WCMG 4DR1Q 1QZGA 3PF4A 1ASZA 2KCTA 4O0AA 4AYBE 4NB3A 4DR5L 3J80c 4C3HH 3K81C 2VZAA 1CSQA 1D8LA 3KF6A 5GAEC 3UDXA 4LF4L 5IT9c 1VQ5A 5JJIA 2CWAA 2MFIA 4JOIA 3RN5A 4OWWB 2UXDL 1B8AA 3W1BA 1LM0A 2GN5A 3IRBA 2F4VQ 1XTDA 3H15A 3PV0A 4JI2Q 4LF5Q 2A1AA 3FKIH 5LMNL 3A5ZB 4LF7L 3AFQA 2ZTCA 2KCMA 3PUYA 3ZJYC 1A0IA 1YVCA 4JI5Q 5IYDH 2R7FA 1SMXA 1Q46A 1VQIA 1TXYA 1E22A 4EX5A 1N34Q 1FVIA 1KHIA 4DV0Q 2K14A 4DKAC 2WB1G 1TWGH 2K75A 4DV7Q 1K8GA 3HOWG 3S1MH 2Q2IA 2K50A 5C44H 3ULJA 4LW1A 3PO2G 1YI2A 3J81j 2R7ZH 1RL2A 1I94Q 3KJOA 2UUBL 1FJGQ 5M3FG 2VS1A 2LXJA 3S1NH 4DR6Q 4GNXC 1JJ2A 2PNHA 3F2CA 2PQAB 2CCZA 3J81c 1GM5A 4GNXB 3OTOL 4A3EH 1NJIC 1HNXL 1WI5A 2PI2E 5C3EG 1VQLA 3CCJA 3GTQH 2BH2A 4X65Q 1N9WA 1K9MC 1XNQL 1S40A 2DUDA 1N32L 4BXXH 1X3FA 3GO5A 3NENA 3I7FA 2VL6A 4YHHQ 3Q8DA 4LF6L 3M9BA 4IPDA 4A3MG 1XNRL 3HOUH 2L15A 5LMNW 4Y52H 1YHAA 3CD6A 3F8TA 2JA6G 3WWVA 3KOJA 3CXCA 3S15H 5BR8L 2E2IH 1IBKQ 3KJPA 4JI7Q 1L1OA 1WYDA 3AFPA 5FLXc 3L0OA 5GAGC 1PH2A 3M3YH 3CQZH 1VQBA 3ULPA 3EN2A 3F2BA 2JA5G 1P8LA 2NN6I 4A93H 3LGJA 4RMFA 4B3MQ 1KIXA 1HNWL 1XMQQ 3EBEA 1HJPA 4A3LG 1U5KA 2NVYH 4GLXA 4DV6Q 1HR0Q 2B63G 2A8VA 1K0RA 1PH8A 1YBYA 2EQSA 1YHBA 3KFUA 4LUOA 4A3IH 1EUJA 2JEAI 1J5EL 3KLWA 1IBLL 4A3BG 4GKKL 1UE6A 2N8NA 4QGUA 4GN4B 3K7UC 4HIDA 2UXBQ 4NXNL 5AJ3Q 4LF8Q 1N8RC 4JV5Q 4LFBL 1Q82C 2UUCQ 3HOVG 3HOZH 2ALYB 1PVOA 4DAYB 3G6EA 3L7ZC 5IP9G 4DV3L 4HJAA 4JI6Q 3PUWA 1YJWA 1OXSC 3PO3H 1D7QA 1PH3A 4JBKA 3CPWA 4BY7H 3S2DH 2ZJPA 1X9NA 3CC2A 5C4XG 1JE5A 2UXCL 4A3GG 4IOAA 3CCUA 4IFDI 4JI3Q 4DR4L 5E7NA 2K4KA 1KL9A 2PMZE 4AIMA 4KHPL 5ELOA 4LNQA 4IOCA 2JK8A 2OTJA 2FXQA 3BZKA 2CKZB 2GVAA 2D0PA 1G6PA 2IHEA 3PIOA 1PHJA 2BA0A 1PH5A 2D0OA 4HIMA 4BY1H 1TWCH 4B3TL 4OO1I 3CPFA 3KF6B 4OWXB 3TQYA 5GADC 4L5SA 4K0KQ 4DR7L 2WB1E 3FHWA 4DV2Q 3HKZG 5LMUL 4ALPA 3M4PA 4DV4L 4C2MH 5JJLA 3I4OA 2E5LL 2ATWA 5IWAQ 4LFAQ 3NEMA 1PH9A 4MZ9A 1GKHA 1V1QA 4YCUA 1CKMA 3KYHC 3PUVA 5IE8A 3G4SA 2V1CC 2OQ0A 4P71A 4DR2L 5M5XH 1IZ6A 2I5HA 1E24A 4DR5Q 3CC7A 1K73C 1I94L 5IYCG 4DR3L 4LF4Q 1WFQA 4PZ8A 1PYSB 3KF8B 4HJ5A 4QIWE 2HHHL 4DK3C 2YTYA 4X64L 4HIKA 1VQ8A 1CKNA 2YV5A 4HIOA 1VQNA 1YZ6A 3DLLA 4OX9L 1Q1EA 4DV5L 3CMEA 1HZAA 1NTGA 1CSPA 3CCLA 1A62A 4BBRG 4UPAA 5IYDG 2UXDQ 3BU2A 3KDFB 3H0GH 3CCQA 2NN6G 3ER0A 3L2PA 5LMNQ 1VQDA 3I2ZA 4LF7Q 4GLVB 1VQ7A 4C3IH 3M7NA 1V9PA 3GTKH 2E8GA 2XGTA 4B3RL 4JI8L 4IFDJ 5JEAJ 5C44G 1BBUA 1E1TA 2Z6KA 4R4OA 3TEHB 5FJ8H 4GN3B 1X3GA 4JI1L 4HJ7A 2R7ZG 1KQSA 1Q86C 2UUAL 4IPGA 3D31A 1VQHA 5M5WH 1KD1C 4DV1L 4LF9L 1GVPA 4ME3A 5FLMH 2IX1A 4UY8C 1SN8A 3F2DA 3EIVA 4A3KG 1VQFA 2CWPA 4DK6C 1BVSA 4XTCS 1YJNA 2UUBQ 3JC66 3TS2A 5M3MH 4JCVE 1GO3E
chains in the Genus database with same CATH superfamily
2QGQA 3HOUG 1XWEA 5JEAG 1HNXQ 5JJZA 3PIPA 5IIFA 4BY1B 3UDGA 1C7YA 4EQ5A 4O1NA 2BOSA 4X3UA 1C8CA 1HQRD 1XNRQ 2LFNA 4L5QA 1SSOA 1SYGA 1TS3A 2JJQA 4OO1G 2QDLA 3JAMi 4J15A 4YY3L 5FLXL 4TQUS 1EY6A 4RGOS 2RA4A 1YEZA 1SJHD 5EBDA 3BDLA 1QVFA 5DNFA 1DJRD 1B9NA 2DNCA 1JWSD 4ABNA 2H1EA 4KHVA 5JOBA 5EPKA 3J7A5 5I6WA 2SEBD 3IFTA 1ONLA 4JVZA 5AFWA 3NPPA 3HKZE 4C3IB 1SR3A 3BVZA 3RR5A 1A63A 1SYDA 1NAPA 4NXNQ 2ZTDA 2FFKB 4DUZL 1DOLA 2KENA 1C9OA 2OXPA 1GHJA 3LX0A 4POGA 3K80C 4CJ2C 1I4RA 3ERSX 3GTGH 3BDOA 5M3MB 1P16A 1Q90A 2RVLA 1KRTA 1IL2A 4X66L 2KHJA 3QR8A 3HOXH 2AWNA 4UP8A 3WOFA 5CV9A 4L5RC 5M5YB 4CDFC 4C1NK 4LFCL 3VR5A 1RTNA 3KLSX 3J7AV 4B3TQ 3Q23A 1B2TA 1YJ9A 3MAQA 1KNAA 2F0LA 3KBXA 2AHOB 3C2PA 1F9QA 1G2TA 3FRPB 1SNPA 3HOYH 2F0JA 2SDFA 3HRZC 2B29A 4DNRB 2K5WA 2CW0D 4DR2Q 3GTPH 2QILA 3GDEA 1IYUA 4DUYL 4FNFA 1EIYB 2KQ3A 2EYOA 4X3KA 2K52A 4JI4L 1B3AA 2K28A 4JG2A 3CCVA 4N9TA 1F9RA 1SROA 2QEXA 3GQBA 1WTOA 2JN4A 3DEPA 1AE3A 4UP7A 2D9UA 3D8GA 3STBD 1K83H 1LTBD 3AB9A 3SR1A 4K2KA 4A3EG 2NVXH 3CC4A 3M4OH 1EOTA 1AP0A 5L37A 3HOXB 5M9OA 4A4IA 4R4TA 4ZQ3A 3EVQA 4A75A 1V1PA 3SXHA 5IODA 4LF5L 2B2YA 3OOCA 2HCIA 5H1SE 4OIKA 1Q3LA 3KF8A 5KRUA 1DOMA 5C0XG 1W3SA 3OIQA 5G3LF 4YWMA 2BA1A 2VQEQ 1EY4A 2AUJD 3S24A 2F4IA 2F0TA 3I8ZA 1N34L 1MKHA 3E0EA 3K7AH 2YU9H 1LO5D 3NSWA 1B1ZA 1SNQA 3GTPB 4A93G 1CM9A 3GTMH 1G2SA 4X62Q 2Q2HA 3T1HQ 2KECA 4DR6L 2I07B 4EVOA 1DOKA 2NZHA 1F2YA 1N36Q 2ZXRA 2RF4A 2B2WA 3MC0B 1VQKA 4KJNA 3JAME 4YCVA 2DY7A 3H3VH 3ERQA 3NP8A 4ZAIA 5J39A 3I72A 1B70B 5IY0A 1R9TH 2K5VA 1MJEA 1WTHA 4NKLA 1SMYC 1M8AA 1EYGA 1K83B 4PZ6A 3DMUA 3HZXA 1EFWA 1SYBA 2NVXB 1SE4A 5GAHC 3M4OB 2VB3X 3HFZB 1FL0A 3RN2A 3TREA 3G71A 4Y7NH 1MSHA 2HT1A 4DV6L 1HR0L 2ZJQA 2GA4B 1X65A 4KKUA 4CDEC 2BCOA 2PW5A 1M90C 1FGUA 1OTCA 1U4LA 5TSSA 4ZCKA 4JI0Q 2ZTEA 4JV5L 1LTGD 4H44C 3K7AB 2YU9B 1KXLA 1STAA 1UE7A 2Z6BA 5CORA 2EXZA 1QNKA 4RCNA 3GTMB 1WJJA 2XSCA 3H3VI 4AH6A 3OHXC 2ES2A 1A3UA 1JOOA 2EJMA 1WTQA 4FF3A 1A6XA 1E1OA 5IP9H 3UI2A 3GTQB 1A8VA 3GV6A 1D1IA 3H3VC 4QCLA 5C4XH 3M4YA 5KNCA 3GTJH 4OWTB 2A68D 1G51A 1Q1BA 1UNSA 3I55A 1YHQA 1R9TB 3J80i 2OCEA 4EQPA 2JA7G 1VQPA 1KABA 2RBMA 1XMOQ 1PH1A 4KI0A 1WCMG 2KCTA 3QOJA 4ODGA 4K5XA 1Y8OB 4DR5L 4KY7A 4XXEA 2VZAA 1D8LA 5GAEC 3KF6A 4LF4L 3UDXA 2FHTA 5IT9c 4Y7NB 5JJIA 5E4WC 1RDPD 2MFIA 4V190 2C9OA 4K5WA 3HG9A 2EJFC 2OT2A 1F9SA 3TP7A 2AQ2B 1B8AA 2AQ1B 1LM0A 3IRBA 1IYVA 3A56A 1XTDA 4JI2Q 4LF7L 1E2VA 2ZTCA 3MHBA 2F0WA 3ZJYC 1YVCA 2QEJC 3KLRA 2K6AA 1VQIA 1Q46A 1TXYA 2R3ZA 3R2IA 1HUNA 1SAPA 3OMGA 2WB1G 1TWGH 2O5JC 1K8GA 3HOWG 2Q2IA 2K50A 5JVH3 3PO2G 2IWHA 3OSOA 1FJGQ 1LTAD 5M3FG 3C46A 3J7YW 2CCZA 4NP5A 4A3EH 1NJIC 3GTJB 2CW0C 2PI2E 1LT4D 3G7LA 1I4PA 5T1IA 1K9MC 2BH2A 1XNQL 2DUDA 1N32L 4F87A 2P5ZX 2G9DA 3I7FA 1ILQA 1GUNA 2EYJA 2VL6A 4YHHQ 3IKJA 4B9XA 4A3MG 2L15A 4IFDH 4Y52H 2B8GA 1O7YA 2PPBC 3F8TA 3KOJA 5C0XH 4NW2A 3VR6A 1EIGA 3H94A 4HSVA 4JI7Q 1WYDA 2EPBA 1TY2A 3H09A 2CQAA 3CQZH 3EN2A 3BS1A 2A5HA 1EY0A 4A93H 1LTRD 1FYCA 4RMFA 1IW7D 3WOEA 4CJ0B 1XMQQ 2XRSD 1O7LA 3EBEA 2NVYH 4GLXA 2B63G 3P1HA 2A8VA 1BCPD 3KFUA 1YHBA 5IGCA 1IBLL 2N8NA 4GN4B 1H9SB 4LFBL 1Q82C 2ALYB 1PVOA 2PYKA 1TWGB 4HJAA 2EYLA 4JI6Q 3PUWA 1YNND 2Z8LA 5ELDA 4ULLA 2F0UA 1JE5A 4A3GG 4R8IA 4IFDI 3OMCA 1DZ1A 4A3EB 5ELOA 4IOCA 1K3BC 2BE5D 4JK1C 2HD3A 4CJ1B 1G6PA 5EQ0A 1JB3A 4HIMA 1I4HA 4OWXB 2H4OA 2BDOA 4DR7L 1BDOA 2EYFA 3ND9A 4DA2A 4DV4L 5JJLA 4Z9CB 4C3HG 1G8ZD 4MZ9A 4E6IA 4YCUA 2B2VA 1DD2A 3PUVA 3G4SA 3CQZB 4P71A 4CHTB 1AN8A 4A93B 1E24A 1I94L 4EQNA 4PZ8A 3DWAA 2Y0SB 4HIKA 2JYOA 2NVYB 3A7LA 2YV5A 3J80E 3PIP3 1YZ6A 4OX9L 1A62A 4BBRG 5IYDG 3BU2A 3KDFB 1PRTF 1Z6HA 3ER0A 4HEDA 4KK7A 3L2PA 1PMRA 5LMNQ 4G57A 4GLVB 2E8GA 5JEAJ 2Z6KA 2KCNA 4GN3B 2R7ZG 3DXJC 4XQQA 4HMJA 3MFYA 4DU9A 1SBBB 3EROA 1STHA 4L8JA 3F2DA 4A3KG 5C5MA 3MXNA 2CWPA 1SNCA 2F0GA 1BVSA 4XTCS 3S1RB 4J8QA 3A8IE 4GOPC 3NQIA 1ZEQX 3OTOQ 3A74A 3DHQA 4R9WA 4GOPB 4PZ7A 1S72A 5I9PA 1HZBA 2KHSA 2K5NA 3MXGA 1LYLA 1PZKD 3G48A 5EKIA 3TMEA 5EBCA 1Y8NB 3I4NG 1Q8IA 4OXPA 3DUZA 4G7OC 4FO2A 4TKOB 2A68C 5BR8Q 1B7YB 1KC8C 2F0OA 4B3SL 4PG3A 1TWHH 3L9AX 1UE5A 4A3IG 4WJ3M 4X3TA 2MJ8A 3PO2H 1B44D 3FEWX 1S5ED 1HNWQ 2CVRA 2WKCA 5M3FH 5ISRA 1EY8A 1AW7A 1VCIA 4GS3A 2MQHA 2NVQH 4BS9A 2R93H 5HURA 2NBFA 1J5EQ 3PO3G 4CGYB 1G91A 3N52A 3K0XA 1OXUA 3F2UA 5A35A 1BR9A 3T1YL 3TP5A 2PZWA 4AQYL 4DV3Q 4A3MH 2F0DA 1WCMB 5CV6A 1LV9A 3I70A 2TSSA 1QUQA 2UXCQ 2L4NA 2F52A 3B6YA 2AMCB 4KHPQ 4KLKA 2OEOA 2PQEA 1L2FA 1PYBA 3FDTA 4FDBA 1M4VA 1X3PA 2BH8A 3E9HA 1WTVA 2VUMH 1WD0A 1DCZA 3MXUA 4JYAL 5GQOA 3V2TA 1ESRA 2B63H 1WOCA 1JOKA 5EGTA 1BO0A 3U9SA 3VYUA 4JOIC 2E5LQ 1S5FD 3NTHA 5EAYA 2KBNA 1I50H 1TWFH 4PV1C 4MTNA 1O80A 2HIVA 2XIWA 1TWHB 2YTXA 3A8JE 3EA6A 1IXRA 2IHFA 3S1QH 4DR3Q 2QA4A 2WAQB 3PO2B 2NVTH 1HZCA 4NXML 2HHHQ 4X64Q 5M3FB 1IYJB 2A69D 3FKIG 4DNTB 4QL5A 4A3GH 4DV5Q 4NMZA 1JCKB 1KAWA 2CFMA 2NVQB 2R93B 1T5XD 4OHJA 4JBWA 1Y14B 4QIWB 1IW7C 4MIUA 1LTID 2N78A 2JA8H 3W2DA 1S5BD 4OELB 2R92H 4BA2I 3CCEA 4JI8Q 2Y0SE 3AQQA 1BCPC 2DGYA 2KCCA 4IJHA 1ZYRC 1PZID 4A3MB 1GOZA 3K5OA 4QY7A 4DR1L 1DYQA 1MIUA 5C0XJ 3VA7A 1BBWA 3PCOB 2VW9A 4DV1Q 1JWUD 4XIGS 3Q24A 1BUVT 4QUFA 3RLNA 1YNNC 3E5SA 2O4XA 1PFBA 1TWAH 4KD4A 1LUZA 2IT1A 4GLAC 1V1OA 2VUMB 2F4VL 1SNMA 4IALA 2Q2UA 2B63B 4OGQC 4IPHA 2VY3A 3P20A 2MGSA 4BBRH 2BE5C 5M5YH 1EWCA 3RNUA 2ZT9C 4DAPA 1MGSA 3J81i 1I50B 1JB7A 2UU9Q 1TWFB 2Z4IA 1BNZA 3UDFA 2EVBA 4DV0L 4DV7L 1SLJA 3S1QB 2NVTB 3VYTA 4IO9A 2VXWA 1VQOA 4A3CG 3SGIA 4A3GB 1UEBA 4A3KH 4AYBG 4DXGA 4A3DG 4APVA 2NTTA 2C35B 3R8BA 2CQOA 4X65L 3A54A 1T5EA 2JA8B 2R92B 3IL8A 3E6ZX 1N33Q 5CV7A 1VQ4A 1MJCA 5C3EH 3CP0A 2EY5A 2M00A 3RD4A 2PQAA 2ZM6Q 2Q2TA 5BN5A 1E7ZA 3HOVG 2F0QA 3CMAA 4ZUIA 3I4NH 2E2DC 1OO9B 2L5TA 2VQFQ 3ITPA 1CUKA 1GUWA 1IBMQ 4CDDC 4KY5A 1K8AC 3AMUA 4FXDA 3J7ZC 4BBSG 1F9PA 1TWAB 3QIAA 2K5DA 1II3A 4R4IA 3D6WA 4B3ML 3DWPA 1QJOA 2DJFC 3W3AA 1MHWC 3GTLH 1ASYA 1HA5A 5IYBG 1UWVA 2DJGC 2JA5H 4RWSC 4BBRB 1RTOA 3HKSA 4DPGA 2B39A 3OYYA 4HN7A 2UXBL 1Y1WG 1SE8A 2PZTA 1NY4A 2MUYA 3QB3A 5IP7G 2QDBA 3EJIA 1GD7A 3CCSA 1CKNB 1SYEA 4DNIA 4A3BH 2R7ZB 4R4CA 2N3SA 5IOCA 1CQFA 1G291 2IX0A 1EZ6A 1HH2P 4G7ZC 4A3KB 3AEVA 2HQLA 3OWEB 3ZYYX 1U0LA 1HRJA 1CHPD 4DF7A 1NCVA 2R7DA 3I4LA 4P73A 4GZYC 1A2UA 1FNVA 2EOTA 4A3JG 3F1ZA 1HR0W 1S3OA 5C3EB 2B2TC 3DM1A 4K0KL 4DV2L 1WVLA 2WAQE 1Z9FA 2WFWA 5CV5A 1HNZL 4LUVA 5D14A 4HJ9A 3I4NB 1JT8A 1PH7A 1JR0D 5E4XA 1V1PB 2B2YC 1QZGA 1ASZA 4HMIA 3VR4A 4O0AA 4EQOA 5C3WA 2A74C 1WD1A 4EGVA 1PRTB 1VDZA 1MD2D 2CWAA 5EPLA 3X3MA 3GTLB 2EDGA 4M1UB 3RN5A 4KD3A 2JA5B 2UXDL 1NNXA 2GN5A 2F3VA 3PV0A 2A1AA 2TMPA 3FKIH 3A5ZB 1BXTA 3TP6A 3AFQA 1A0IA 4JI5Q 1PYWD 2L55A 1SMXA 2NN6H 1E22A 1EEID 4A3BB 2B2WC 2FINB 2EJGC 4RAUC 2K14A 4FF1A 2K01A 2K75A 4OL7A 2IX3A 1KLUD 3S1MH 1IKLA 3RMHA 2A6EC 4LW1A 3ULJA 1YI2A 4KKTA 1GXDC 2WV6D 4J1MA 1CTMA 2NWGA 3KJOA 2UUBL 2VS1A 3K59A 2PNHA 3J81c 3EFXD 1GM5A 1HNXL 1WI5A 3J81E 1VQLA 3GTQH 1LT5D 1N9WA 2HUGA 1KDBA 1X3FA 3GO5A 2PZUA 2A69C 3M9BA 4IPDA 3HOUH 1XNRL 5JEAH 3G6JB 1TS4A 3CD6A 2JA6G 3WWVA 1G6ZA 1IBKQ 3KJPA 1L1OA 1PTOF 3AFPA 1FGBD 3NTKA 3K0YA 3L0OA 4H0LC 3NBHA 4C3JG 1AFPA 1PFMA 4OO1H 1P8LA 2NN6I 3LGJA 4PMBA 4MN3A 2JP1A 1S5CD 2E75C 3FKIB 2NB0A 1K0RA 2QF7A 3I90A 1HXYD 1PH8A 1YBYA 4LUOA 1JOQA 1SEBD 2JEAI 1Y69U 1TVXA 4NXNL 5AJ3Q 4LF8Q 1N8RC 2UUCQ 3L7ZC 3S1MB 1J8IA 1D7QA 1PH3A 4JBKA 5G3LD 2ZJPA 1TU2B 4IOAA 4JI3Q 1A3TA 5D3DA 1KL9A 4AIMA 1EL0A 1ZKOA 2FXQA 3BZKA 2CKZB 2GVAA 4HTHA 3SK5A 3NTIA 1WTPA 1SDFA 2IHEA 4K14A 2F0SA 2WACA 2BA0A 1K0SA 3HOUB 4OO1I 4B3TL 3NHHA 3KF6B 3C3LA 4WFN3 3HKZG 3M4PA 3A7AB 4J6HA 2KEEA 5IWAQ 4LFAQ 1XYIA 4RGMA 1L0YB 3KYHC 5IE8A 3HS0C 2PW7A 1KAAA 3OWFA 4DR2L 1CZGA 3CC7A 1PYSB 4HJ5A 2VB2X 5ELFA 4DK3C 1LABA 3HP3A 3T51B 1VQNA 3FMCA 1Q1EA 3NWSA 5J1ZA 3CMEA 5IT9E 5IGDA 3CCLA 4IQZA 1QWYA 4A3DB 1HHVA 2NYZD 3MEHA 3M7GA 4K8JA 3M7NA 3D4RA 3GTKH 1FR3A 1BF4A 3S14B 5C44G 3IAYA 3TEHB 4R4OA 2N55A 4KY6A 3D31A 3HOVB 4ZKBB 2SNMA 2B8FA 3S17B 4UY8C 2F0NA 1WTRA 2G5DA 5K5PA 3RZOH 3J81L 2R6GA 1K8OA 1NMGA 3CAMA 4DK1A 1VQJA 1QG7A 3CW2C 5KGUA 1JICA 5DM63 1XPUA 1QVCA 4RA8A 2VQEL 4RKBA 1X3EA 4LF6Q 3NXWA 2SNSA 2ZXOA 4L63B 2RDHA 3E9IA 4DXFA 1Y1WB 2OF1A 1WTWA 2PNRC 4XQJA 1F2ZA 1D5ZC 4X62L 2I46A 3T1HL 1VMCA 3S9WA 2DNEA 2RKSA 1N36L 4P72A 1VQAA 3ONAB 5C6AA 4MTKA 1S4ZA 1DONA 2K5HA 4QJFA 1VQEA 3NWTA 1F2LA 1E3PA 3M4QA 2WKDA 3GTKB 1ZYRD 2KHIA 4LK1C 4GKKQ 2RCNA 4A3JB 5KYIA 3PUZA 4HSPA 4P2CB 4CDCC 4RGTA 3Q0AA 5LL6X 1X54A 5BN4A 4IPCA 1XPOA 2JEBI 2JSOA 2XVSA 1OXVA 4CKEA 5FO9B 2F0IA 4K6DA 3RZOB 4DR4Q 3OW2A 4BY1G 4C3JH 5C0XI 3FVQA 1EQQA 3K5NA 1SYCA 3S1RH 1FNWA 1CZWA 3C1FA 2PMZB 2LXKA 4JI0L 1STBA 4UDUC 5JPMC 5LMUQ 5C4JH 2RQXA 3D0FA 2JE6I 3LWUA 4QMGA 2EYMA 1GHKA 1TS5A 3D3RA 3H0GG 4NPSA 3BVGA 3P75A 5I2YA 2Z6KC 1X6OA 2F3WA 2B2UC 4XQNA 1PH6A 4ZUJA 1RF2D 2DY8A 1ET6A 1CA5A 5IT9L 4C3IG 5A2QL 1SE2A 2EZVA 2AWOA 1EYAA 5FJ8G 2EIFA 4UP9A 5JPNC 1CI3M 3OIPA 4RFBA 1RHPA 1C48A 4K5VA 3A0JA 3MXNB 1Q12A 3CU7A 4ILWA 4LWCA 4B3RQ 5FLMG 1XMOL 1YNJD 3URYA 2ICEC 4GKJL 4TSSA 4Q5VA 4KKSA 5DM73 4JI1Q 2JA6B 5M3MG 2UUAQ 4JW0A 2JA7H 1FNUA 1BOSA 1W2BA 1KRSA 4LF9Q 2OQKA 1DXMA 2LS01 1SRUA 2XTIA 3K58A 4I7AA 4IURA 3PGZA 1WCMH 4C3JB 1L0XB 2VNUD 1PZJD 1UE1A 3C1EA 2XRQD 4H7BA 4BXXG 1M1KC 4JI2L 5JVG3 4FF4A 2MO1A 1LT6D 4G4KA 3A5UA 4X3SA 4OEMB 3CCRA 5C4JB 1RIPA 1BKBA 5F2DA 1CT1D 1EIFA 3KDFA 1KNEA 4YY3Q 5KEEA 4PNYA 2QCPX 4LMQD 3AYHB 5FO7B 3MTSA 2F03A 4YIJA 1R4PB 1I3QB 1FJGL 2Z0SA 2K1BA 2NZOA 4WORA 3VR3A 1PDQA 3HOWH 3NBIA 1D2BA 1K8MA 4R4QA 4ZYSA 3U4ZA 4RCOA 1NE3A 1QUQB 4YHHL 1J9OA 1TR5A 1YNXA 1PTOB 2Q8RE 2O5IC 2KEDA 4HCEA 2F0HA 5IGEA 4DUZQ 4GOPA 1PRTD 4GNXA 2JA7B 1AE2A 1PFSA 4JI7L 1OXXK 3ULLA 1QZHA 1RCVD 4XYQA 5FKAC 3HOXG 4I7ZC 3UE1A 3TRZA 3R2TA 4KN4C 3K8AA 4X66Q 5IGBA 3BJUA 1XMQL 4ID6A 4KHZA 1R4QB 4ZKCB 4FP5D 1Z47A 1KTKA 2KVMA 4RHSA 4LAAA 4LFCQ 2ASBA 3HOYG 4QB4A 4FVMA 2MPMA 1JMCA 1Z7TA 1H9MA 2ENBA 2WP8J 1AZPA 1JJGA 5HGQA 3KBGA 5IGGA 1PV4A 3BVMA 2A6ED 3FP9A 2RHQB 4JI6L 3OW7A 1ZXTA 1ENFA 1TKWB 2QKIC 4POFA 2CHBD 2A6HC 1BQQT 2WB1B 4DUYQ 1CA6A 2FMMA 3HOWB 4O42A 4OIJA 5KNBA 1QVGA 3RLFA 3E3XA 4DAYA 4X6AH 5K36G 3W1GA 3W5OA 1VMPA 3QG1A 2JA9A 4QUCA 3CRKC 4JI4Q 1MI2A 2I0QA 1HNZQ 4ZLTF 1JQYD 2B3GA 2X6GA 5DAUA 1IHZA 3P7JA 4B9WA 2OWOA 2AKWB 1IKMA 3U9OA 4IJLA 3VYRA 3SEBA 2R61A 4G7HC 1QOHA 4NB3A 4F7XA 4C3HH 3K81C 3SDZA 1CSQA 4LJZC 4QF4A 5ELEA 1A3VA 4JOIA 3WDNA 4ME5A 2D5DA 2EY1A 4I65A 4DAVA 1EIHA 3H15A 4LF5Q 3KK7A 5LMNL 3KLSA 2L1BA 4ZK9B 3TZUA 2KCMA 1GUTA 5IYDH 2R7FA 3MVVA 3S2DB 1N34Q 1FVIA 1KHIA 5EKKA 4HR7B 2KA7A 3J81j 2R7ZH 1RL2A 3QJYA 4IUUA 2LXJA 3S1NH 4DR6Q 1JJ2A 3IFDA 3F2CA 2IL8A 2PQAB 1H9KA 2EYHA 4K6LA 3OTOL 3T53B 2E74C 3V96A 4BXXH 3K6OA 3NENA 4RH6A 2AUKA 2Z4HA 3SK4A 1YHAA 1ENCA 3QO2A 1U4RA 2Q8TA 4XYOA 2CH4W 5BR8L 5M5XB 3K57A 3H91A 4C3HB 5GAGC 1YNJC 1VQBA 3TZDA 3AU7A 3H0GB 4IZ8A 4DGZA 1F2MA 4KN7C 1HNWL 5NUCA 1ICFB 1HJPA 3KUPA 1U5KA 4A3LG 1GJXA 4DV6Q 1HR0Q 3HEJA 2EQSA 3D4DA 4A3IH 1EUJA 2RSOA 1J5EL 3KLWA 3VA5A 1UE6A 4HIDA 1D1KA 4JV5Q 3EQLC 1SE3A 4DFAA 5J22A 2EY6A 5IP9G 4CKBA 4DV3L 3T56B 1E2WA 3I3CA 1YJWA 3PO3H 1HA6A 1HUMA 1X9NA 3T4AC 5C4XG 2UXCL 3S1NB 2FMCA 1U4MA 1ENAA 1B3QA 4KHPL 2OTJA 2JK8A 1GUGA 2L0CA 3FPUB 1O7ZA 3PIOA 4N9PA 1PLFA 2BDNA 1PH5A 1NR4A 1TWCH 3BZDB 1I4XA 3CPFA 3TQYA 5C3XA 5GADC 2WB1E 1GUOA 4C2MH 3I4OA 2E5LL 2ATWA 3PQIA 1PH9A 1LTTD 2HDLA 1GKHA 4IN3A 1CKMA 4HAEA 2V1CC 2RCFA 1IZ6A 2XWBB 5I9OA 4DR5Q 5IYCG 4DR3L 1EY5A 1WFQA 1PRTC 4LF4Q 3KF8B 3J7AF 3LNNA 4QIWE 5COYA 4F88A 2HHHL 1VQ8A 2YTYA 4X64L 3MXPA 1CKNA 4DV5L 1NTGA 2NUCA 1CSPA 4UPAA 1ET9A 1RD9D 4A3IB 4IUVA 3LWEA 3CCQA 5C5LA 1EYCA 4LF7Q 5K36H 4H13C 1V9PA 1Y8PB 2XGTA 4JI8L 1EU3A 1E1TA 3TN2A 1U4PA 3BDCA 4B08A 1X3GA 3PO3B 3GTGB 1KQSA 5T1GA 1AEXA 5EKLA 5E3FA 1ILPA 1IL8A 5M5WH 3NQTA 4DV1L 1PXUA 4ME3A 1MSGA 5ELBA 2IX1A 1SN8A 3EIVA 1VQFA 2B2TA 2F1MA 4DK6C 3GP7A 3JC66 1W6JA 2MHVA 2NZ1D 1LTSD 1STEA 2E76C 1L1OC 1CKOA 2RSNA 4UHVA 4U673 4FYDA 4IFDG 1L1OB 2MNAA 1TWCB 1XNQQ 2WIIB 3H6MA 1N32Q 3NBHB 5J3BA 1VQ9A 1I6VC 3CHBD 4C2MB 2D62A 3HOYB 1NBWA 1LTLA 1XJVA 1ML0D 4IUNA 2UU9L 4HCSA 1A15A 1T9HA 3PF5A 1EQRA 2A19A 3U50C 4WJWA 1UUPA 5E1FA 3NELA 4R8NA 4JC0A 2J7ZA 2Y0SG 2EY2A 4XT3B 3TDQA 3GV3A 1EWHA 2GVBA 3UDIA 1RODA 2YTVA 5CV8A 2ID0A 3JAMc 3R3OA 2PI2A 4R1JA 3VR2A 1WTXA 4PMCA 4HJ8A 4A3CH 4TRDA 2ICIA 2YYZA 3NE5B 1N33L 1QE6A 1EEFD 1IBLQ 5GROA 5KNDA 5BN3A 4A3FG 4U68A 1KLGD 3GD7A 5CV4A 4A3DH 4LFBQ 2KUMA 2HCCA 1TQOA 2ZM6L 4CBVA 4IUTA 2F3IA 2K05A 1QNUA 5M5WB 4YWKA 2ZXPA 1B50A 4RG1A 3S14H 3TS0A 1EY9A 1X56A 3MEFA 4DAMA 1V8QA 5CMDA 2VQFL 1AZQA 1IBML 2JXMB 3ICEA 1H9RA 1VF5C 2E2HH 1HFNA 1AH9A 3BZCA 1Y1VG 3S16H 4ZRZA 2K5QA 3HOVH 3M85A 4JBJA 1PA6A 3S17H 3I91A 3S2HH 1SNOA 3U4VA 5CYUA 5HY6A 2V4DA 1HCZA 5I2XA 4BBSH 1Q81C 3I4MG 1LACA 3PUXA 4A3LH 4H02A 1B4OA 2RHSB 1B9MA 4DR7Q 1EWIA 5IYBH 1U9RA 4DV4Q 3N6RA 1PH4A 5FOBB 5IGFA 3ND8A 2K33A 1Y1WH 1VQCA 4FF2A 1NMFA 3PMFA 5IP7H 4FXGC 2F0FA 4O2DA 5CC4A 1EOVA 1I94Q 4Q0FA 2X69A 4A76A 3TBIB 4WJ4A 1QCBD 1JORA 1X55A 1Q8KA 5ELNA 1PTOD 4OX9Q 1VF7A 2MO0A 1GUSA 3U58A 5A2QE 4AYBB 2IY5B 1H9JA 2K03A 1L0WA 4GKJQ 1V43A 1HQMC 3D6CA 1SJED 2AQ3B 1C4QA 4A3JH 1SFOH 3UE0A 3I56A 2PCFB 2E2HB 5LL6S 4CKCA 4TVAB 2HIXA 4L6TB 3S16B 2LSSA 1K3RA 1C0AA 1BCPF 1O7IA 3MWYW 5DEHA 3S2HB 2N49A 3PSIA 1VQGA 4L5TA 4BBSB 5IYCH 3V05A 4JBMA 4P75A 4BA1I 3NK9A 2M9VA 5D3IB 1E0BA 1YIJA 2WINB 4JI5L 4QQBX 4F8MA 2H5XA 2IPKD 1I5FA 3L3OC 2EXDA 2A6HD 2F0MA 1XTCD 2LY7A 3TSSA 2I5MX 1CHQD 1SXTA 2WAQG 1HFGA 4P74A 4BWGB 3DWQA 1BBXC 2RDFA 4B3SQ 1W6KA 2Z9HA 1ICWA 3GTOH 3SK8A 5C4XB 3DEOA 2Z1CA 2OTLA 2R93G 1OXTA 3CRLC 3JAML 4KTAA 1TT2A 4WRDA 1KDAA 1VQMA 1VS0A 1VQ6A 1EYDA 3HOZG 1EY7A 5EPJA 3SVMA 5DLQE 1EQVA 2ZJRA 1SNDA 2E2JH 4BY7G 1SFOB 1ESFA 3T1YQ 4YCWA 3R93A 4AQYQ 1IBKL 4XT1B 3SK6A 1J6QA 1NUCA 3DM3A 2LKVA 3O13A 2JA6H 2VUMG 3D4WA 3HGBA 3STBC 4MNOA 1TY0A 1DGSA 1LT3D 1YITA 1I6HH 5LHY1 2B2VC 5JJKA 4LUZA 4OONA 3CKIB 4JYAQ 2I5LX 2L11A 1SYFA 5AJ3L 4LF8L 1EZ8A 4K2LA 3X3NA 2UUCL 2HQEA 4NDXA 4PMWA 1HTPA 3Q6SA 4V0BA 5KYLA 3VDYA 2PO4A 1HZ9A 4A3FH 2SOBA 1I4QA 2MP1A 2K32A 3GTOB 1EQTA 4JI3L 1XPRA 2JQOA 3RLOA 1H9SA 5C4HA 4NXMQ 1JJCB 3RZDH 1LLRD 2JA8G 1STGA 1Y1VH 2XN9C 2C5CA 2M2LA 2R92G 1CK1A 1I3QH 1H95A 4XDXA 4YWLA 3CCMA 2L12A 4GN5A 2E2JB 1B53A 3I4MH 2J0TD 2NTSA 3CF5A 1RJTA 5IWAL 1Q7YC 4LFAL 2XNAC 1PTOH 4DR1Q 4FXKC 3OPOA 3PF4A 1K28A 2Q8IB 2XWJB 3BYTB 4AYBE 3J80c 1STNA 1VQ5A 1QB5D 1I6HB 4OWWB 5KIXA 4S3SA 3W1BA 4RGNA 2F4VQ 2K04A 2IJ0A 4KV6A 1X3QA 4RHRA 3PUYA 1JC7A 2B2UA 5I6YA 1A2TA 4A3FB 4C56C 4PQXA 5CBAE 4EX5A 3E0JA 3T13A 4DV0Q 4N8FA 4DKAC 3MFGA 4DV7Q 2DN8A 2F0EA 1KDCA 5C44H 5ELCA 3RZDB 3BYYB 2F0VA 1Y1VB 3SHLA 4GNXC 2FJ2A 2KOLA 4GNXB 4RKLA 2EE1A 4JPBW 5C3EG 4IUQA 3CCJA 4X65Q 5HGTA 5JAVA 2IW3A 1S40A 1D5MC 3I4MB 1STYA 3Q8DA 3Q22A 1PTOC 1UAPA 4LF6L 2CH4A 3NUCA 5LMNW 1JWMD 5CR3A 2A73B 5FO8B 3CXCA 3S15H 2E2IH 4DK0A 4MHEA 3TP8A 5FK9C 3HKZB 5FLXc 1UEAB 5FLXE 1RKNA 3QWNA 3A8KE 1PH2A 3M3YH 3ULPA 3F2BA 2JA5G 3K5LA 2RDGA 3QOLA 1PFNA 4B3MQ 3PIO3 1KIXA 1D6EC 3T16A 5CGKA 2QW7A 4DN4M 2L9HA 2F0PA 3I73A 4GKKL 4A3BG 3VYSA 4QGUA 2UXBQ 3K7UC 3HOZH 4DAYB 3G6EA 1EU4A 4M8AA 5D65A 4KJOA 2X6LA 2HDMA 1XXGA 1OXSC 3MZ5A 1EFID 5C44B 2D2CC 4BY7H 3CPWA 4N8X1 3S2DH 2J4XA 1CQVA 3RUZA 1HPCA 3CC2A 1FD7D 3SE0A 4C1NI 3CCUA 4DR4L 1NR2A 5E7NA 2K4KA 2PMZE 4LNQA 3BG3A 2LMCB 2D0PA 1PHJA 1F77A 1TIID 2F0KA 2D0OA 4BY1H 1TS2A 1HTLD 5I4DA 4L5SA 4K0KQ 3FHWA 4DV2Q 3S15B 2E2IB 5LMUL 4ALPA 1O78A 3NEMA 1XX8A 1V1QA 1X32A 4KMUC 3M3YB 2O2LD 2OQ0A 3MA2B 5M5XH 2G9HD 2I5HA 3FPPA 1K73C 3J80L 1DM0B 5EJWA 4HIOA 3DLLA 4IUPA 5C4ZA 1HZAA 1QILA 2N88A 2UXDQ 5CBEE 1E2ZA 3H0GH 2NN6G 1NSNS 1SMYD 2K7VA 1VQDA 1CFMA 3A55A 3I2ZA 1VQ7A 4C3IH 4K8IA 3K5MA 1S5DD 3HOZB 4B3RL 4IFDJ 1MBYA 1BBUA 5FJ8H 1BCPB 1I4GA 4HJ7A 4JI1L 4UAIA 4BY7B 2EYPA 1Q86C 2UUAL 4IPGA 1VQHA 1KD1C 4LF9L 1GVPA 5FLMH 2KJXA 1D5XC 1YJNA 2UUBQ 3TS2A 5M3MH 1JE4A 4JCVE 1GO3E
chains in the Genus database with same CATH topology
2QGQA 4GOPC 1L1OC 1CKOA 2R6GA 3HOUG 3OTOQ 1NMGA 3A74A 3CAMA 4IFDG 5JEAG 4GOPB 1HNXQ 1L1OB 4PZ7A 3PIPA 1S72A 1HZBA 2MNAA 1VQJA 1XNQQ 2K5NA 1N32Q 1LYLA 3CW2C 3UDGA 3NBHB 3G48A 5J3BA 1C7YA 1VQ9A 4EQ5A 1XPUA 1QVCA 2VQEL 4LF6Q 1X3EA 2D62A 1NBWA 1XNRQ 1LTLA 1XJVA 3I4NG 4OXPA 3E9IA 2UU9L 4L5QA 1T9HA 3PF5A 1EQRA 2JJQA 5BR8Q 4OO1G 3JAMi 2A19A 1B7YB 4J15A 4YY3L 1KC8C 3U50C 3NELA 4TQUS 4JC0A 2Y0SG 1YEZA 4X62L 3T1HL 4B3SL 1QVFA 4PG3A 1TWHH 1UE5A 4A3IG 4WJ3M 2GVBA 3UDIA 2YTVA 1N36L 3PO2H 3J7A5 4P72A 2ID0A 3JAMc 1VQAA 1HNWQ 2PI2A 5M3FH 2K5HA 4QJFA 1VQEA 4R1JA 3HKZE 1E3PA 1SR3A 1VCIA 3M4QA 4GS3A 3RR5A 4HJ8A 4A3CH 2MQHA 2NVQH 2YYZA 1N33L 2R93H 2KHIA 1J5EQ 3PO3G 1IBLQ 5GROA 2RCNA 4GKKQ 3K0XA 1OXUA 4A3FG 3GD7A 4A3DH 1A63A 3PUZA 4NXNQ 4LFBQ 2ZTDA 2ZM6L 4DUZL 2KENA 3T1YL 2F3IA 4AQYL 4YWKA 1C9OA 4DV3Q 1X54A 4A3MH 4POGA 3K80C 4IPCA 4RG1A 3S14H 1XPOA 3TS0A 2JEBI 1X56A 3MEFA 4DAMA 2VQFL 1OXVA 3ERSX 1IBML 3GTGH 3ICEA 1QUQA 2E2HH 1AH9A 2UXCQ 3BZCA 1P16A 1Y1VG 2F52A 3B6YA 3HOVH 3S16H 2AMCB 4DR4Q 3M85A 1KRTA 4JBJA 1PA6A 3OW2A 3S17H 1IL2A 4KHPQ 4X66L 2KHJA 4KLKA 4BY1G 3S2HH 4C3JH 5C0XI 3U4VA 3HOXH 2AWNA 5HY6A 4UP8A 1L2FA 1PYBA 4FDBA 1EQQA 4L5RC 4BBSH 1Q81C 2BH8A 3S1RH 3I4MG 3E9HA 2VUMH 3PUXA 4JYAL 4LFCL 5GQOA 4A3LH 4H02A 2B63H 1WOCA 2LXKA 4B3TQ 4JI0L 2RHSB 3RZOH 4DR7Q 1YJ9A 5LMUQ 1EWIA 2AHOB 5IYBH 4DV4Q 4JOIC 2E5LQ 1PH4A 5EAYA 5C4JH 2KBNA 3D0FA 1I50H 3HOYH 2JE6I 1TWFH 4MTNA 2B29A 1Y1WH 1VQCA 2HIVA 1NMFA 5IP7H 4DR2Q 4O2DA 3GTPH 2YTXA 1EOVA 1IXRA 3GDEA 3H0GG 2IHFA 4NPSA 4DUYL 4DR3Q 2Z6KC 1X6OA 2QA4A 4A76A 3S1QH 1PH6A 2NVTH 4WJ4A 1HZCA 1EIYB 2HHHQ 1X55A 1Q8KA 5ELNA 4X64Q 4NXML 1IYJB 3FKIG 4QL5A 4A3GH 4OX9Q 4DV5Q 2AWOA 2MO0A 1KAWA 2CFMA 5FJ8G 3U58A 2EIFA 4UP9A 2IY5B 2K52A 4JBWA 1Y14B 4JI4L 4JG2A 3CCVA 3A0JA 3MXNB 1Q12A 1L0WA 2N78A 2JA8H 4GKJQ 1SROA 4LWCA 1V43A 2R92H 2QEXA 4JI8Q 5FLMG 3CCEA 1XMOL 4BA2I 4B3RQ 4GKJL 2Y0SE 3AQQA 2DGYA 4IJHA 1AE3A 4QY7A 4DR1L 4JI1Q 1MIUA 4UP7A 4A3JH 1SFOH 5C0XJ 3UE0A 5M3MG 3I56A 2UUAQ 1BBWA 3PCOB 2VW9A 3STBD 1K83H 2JA7H 4DV1Q 4TVAB 2HIXA 4XIGS 1KRSA 1W2BA 4LF9Q 2LSSA 1K3RA 2OQKA 1C0AA 1O7IA 1SRUA 2XTIA 4A3EG 2NVXH 3CC4A 3PGZA 1WCMH 3M4OH 2N49A 3PSIA 2VNUD 3RLNA 1VQGA 4A4IA 1TWAH 1UE1A 1LUZA 4L5TA 2IT1A 4BXXG 5IYCH 1M1KC 4GLAC 4R4TA 4A75A 2F4VL 4JBMA 4P75A 4BA1I 4JI2L 2Q2UA 4LF5L 5H1SE 4IPHA 2VY3A 2MO1A 5C0XG 1W3SA 4BBRH 1YIJA 3A5UA 4YWMA 4JI5L 5M5YH 2BA1A 2H5XA 2VQEQ 3RNUA 3CCRA 4QQBX 1RIPA 1BKBA 3J81i 1I5FA 3S24A 1JB7A 2EXDA 2UU9Q 1EIFA 3KDFA 3UDFA 1N34L 1MKHA 3E0EA 3K7AH 4DV0L 2YU9H 4YY3Q 4DV7L 1SLJA 2I5MX 2WAQG 4A93G 3AYHB 4P74A 3GTMH 4X62Q 2Q2HA 3T1HQ 4B3SQ 3GTOH 4IO9A 1FJGL 1VQOA 4A3CG 3SGIA 4DR6L 2OTLA 2Z0SA 2R93G 2NZOA 1OXTA 2NZHA 1UEBA 4A3KH 4AYBG 1N36Q 3HOWH 4A3DG 4APVA 2C35B 2CQOA 2RF4A 4X65L 1VQKA 4R4QA 1VS0A 1VQMA 1VQ6A 4YCVA 3U4ZA 3H3VH 3HOZG 1NE3A 1QUQB 1N33Q 4YHHL 1YNXA 1B70B 5IY0A 5DLQE 1VQ4A 2ZJRA 1MJCA 5C3EH 1R9TH 2K5VA 3CP0A 1MJEA 2E2JH 4BY7G 2ZM6Q 2PQAA 2Q2TA 4DUZQ 4GOPA 1E7ZA 3T1YQ 4YCWA 4GNXA 1EYGA 4AQYQ 1AE2A 1PFSA 4PZ6A 3CMAA 1IBKL 1OXXK 3ULLA 4JI7L 3I4NH 1QZHA 1EFWA 1J6QA 3HOXG 2VQFQ 3UE1A 3TRZA 5GAHC 1CUKA 3DM3A 1IBMQ 2JA6H 1K8AC 3HFZB 3J7ZC 4BBSG 1FL0A 2VUMG 3STBC 3K8AA 3TREA 3RN2A 4MNOA 4R4IA 4B3ML 4X66Q 3G71A 3BJUA 4Y7NH 1XMQL 1DGSA 4KHZA 2HT1A 1YITA 1I6HH 4DV6L 1HR0L 2ZJQA 3GTLH 1X65A 1ASYA 5IYBG 5JJKA 1UWVA 4LUZA 1Z47A 4OONA 1M90C 2JA5H 3HKSA 1FGUA 4DPGA 1OTCA 4JYAQ 4LFCQ 2ASBA 2I5LX 3HOYG 3OYYA 2UXBL 1JMCA 4JI0Q 1Y1WG 1SE8A 5AJ3L 2ZTEA 4LF8L 4JV5L 1NY4A 2WP8J 5IP7G 5HGQA 1PV4A 2UUCL 1GD7A 4PMWA 1JJGA 3VDYA 3CCSA 1KXLA 3FP9A 2RHQB 1UE7A 1HZ9A 1CKNB 4A3FH 4JI6L 4DNIA 4A3BH 4R4CA 2N3SA 1WJJA 3H3VI 1G291 2IX0A 4AH6A 4POFA 1HH2P 2ES2A 1E1OA 4JI3L 5IP9H 1XPRA 4DUYQ 2JQOA 3RLOA 3AEVA 2HQLA 1QVGA 4NXMQ 1JJCB 3RZDH 3RLFA 1U0LA 1A8VA 2JA8G 4X6AH 1Y1VH 3W1GA 5K36G 2R92G 3W5OA 1H95A 1I3QH 5C4XH 2R7DA 4P73A 4YWLA 2JA9A 3GTJH 3CCMA 4OWTB 1G51A 4A3JG 3F1ZA 1Q1BA 3I55A 4JI4Q 4GN5A 1HR0W 1S3OA 1YHQA 4K0KL 2I0QA 3J80i 2OCEA 1HNZQ 2JA7G 4DV2L 2B3GA 1VQPA 2WAQE 1Z9FA 3I4MH 2WFWA 1XMOQ 2AKWB 3CF5A 1HNZL 2OWOA 1PH1A 4LUVA 5IWAL 4HJ9A 1JT8A 4KI0A 1Q7YC 4LFAL 1PH7A 4IJLA 1WCMG 4DR1Q 1QZGA 3PF4A 1ASZA 2KCTA 4O0AA 4AYBE 4NB3A 4DR5L 3J80c 4C3HH 3K81C 2VZAA 1CSQA 1D8LA 3KF6A 5GAEC 3UDXA 4LF4L 5IT9c 1VQ5A 5JJIA 2CWAA 2MFIA 4JOIA 3RN5A 4OWWB 2UXDL 1B8AA 3W1BA 1LM0A 2GN5A 3IRBA 2F4VQ 1XTDA 3H15A 3PV0A 4JI2Q 4LF5Q 2A1AA 3FKIH 5LMNL 3A5ZB 4LF7L 3AFQA 2ZTCA 2KCMA 3PUYA 3ZJYC 1A0IA 1YVCA 4JI5Q 5IYDH 2R7FA 1SMXA 1Q46A 1VQIA 1TXYA 1E22A 4EX5A 1N34Q 1FVIA 1KHIA 4DV0Q 2K14A 4DKAC 2WB1G 1TWGH 2K75A 4DV7Q 1K8GA 3HOWG 3S1MH 2Q2IA 2K50A 5C44H 3ULJA 4LW1A 3PO2G 1YI2A 3J81j 2R7ZH 1RL2A 1I94Q 3KJOA 2UUBL 1FJGQ 5M3FG 2VS1A 2LXJA 3S1NH 4DR6Q 4GNXC 1JJ2A 2PNHA 3F2CA 2PQAB 2CCZA 3J81c 1GM5A 4GNXB 3OTOL 4A3EH 1NJIC 1HNXL 1WI5A 2PI2E 5C3EG 1VQLA 3CCJA 3GTQH 2BH2A 4X65Q 1N9WA 1K9MC 1XNQL 1S40A 2DUDA 1N32L 4BXXH 1X3FA 3GO5A 3NENA 3I7FA 2VL6A 4YHHQ 3Q8DA 4LF6L 3M9BA 4IPDA 4A3MG 1XNRL 3HOUH 2L15A 5LMNW 4Y52H 1YHAA 3CD6A 3F8TA 2JA6G 3WWVA 3KOJA 3CXCA 3S15H 5BR8L 2E2IH 1IBKQ 3KJPA 4JI7Q 1L1OA 1WYDA 3AFPA 5FLXc 3L0OA 5GAGC 1PH2A 3M3YH 3CQZH 1VQBA 3ULPA 3EN2A 3F2BA 2JA5G 1P8LA 2NN6I 4A93H 3LGJA 4RMFA 4B3MQ 1KIXA 1HNWL 1XMQQ 3EBEA 1HJPA 4A3LG 1U5KA 2NVYH 4GLXA 4DV6Q 1HR0Q 2B63G 2A8VA 1K0RA 1PH8A 1YBYA 2EQSA 1YHBA 3KFUA 4LUOA 4A3IH 1EUJA 2JEAI 1J5EL 3KLWA 1IBLL 4A3BG 4GKKL 1UE6A 2N8NA 4QGUA 4GN4B 3K7UC 4HIDA 2UXBQ 4NXNL 5AJ3Q 4LF8Q 1N8RC 4JV5Q 4LFBL 1Q82C 2UUCQ 3HOVG 3HOZH 2ALYB 1PVOA 4DAYB 3G6EA 3L7ZC 5IP9G 4DV3L 4HJAA 4JI6Q 3PUWA 1YJWA 1OXSC 3PO3H 1D7QA 1PH3A 4JBKA 3CPWA 4BY7H 3S2DH 2ZJPA 1X9NA 3CC2A 5C4XG 1JE5A 2UXCL 4A3GG 4IOAA 3CCUA 4IFDI 4JI3Q 4DR4L 5E7NA 2K4KA 1KL9A 2PMZE 4AIMA 4KHPL 5ELOA 4LNQA 4IOCA 2JK8A 2OTJA 2FXQA 3BZKA 2CKZB 2GVAA 2D0PA 1G6PA 2IHEA 3PIOA 1PHJA 2BA0A 1PH5A 2D0OA 4HIMA 4BY1H 1TWCH 4B3TL 4OO1I 3CPFA 3KF6B 4OWXB 3TQYA 5GADC 4L5SA 4K0KQ 4DR7L 2WB1E 3FHWA 4DV2Q 3HKZG 5LMUL 4ALPA 3M4PA 4DV4L 4C2MH 5JJLA 3I4OA 2E5LL 2ATWA 5IWAQ 4LFAQ 3NEMA 1PH9A 4MZ9A 1GKHA 1V1QA 4YCUA 1CKMA 3KYHC 3PUVA 5IE8A 3G4SA 2V1CC 2OQ0A 4P71A 4DR2L 5M5XH 1IZ6A 2I5HA 1E24A 4DR5Q 3CC7A 1K73C 1I94L 5IYCG 4DR3L 4LF4Q 1WFQA 4PZ8A 1PYSB 3KF8B 4HJ5A 4QIWE 2HHHL 4DK3C 2YTYA 4X64L 4HIKA 1VQ8A 1CKNA 2YV5A 4HIOA 1VQNA 1YZ6A 3DLLA 4OX9L 1Q1EA 4DV5L 3CMEA 1HZAA 1NTGA 1CSPA 3CCLA 1A62A 4BBRG 4UPAA 5IYDG 2UXDQ 3BU2A 3KDFB 3H0GH 3CCQA 2NN6G 3ER0A 3L2PA 5LMNQ 1VQDA 3I2ZA 4LF7Q 4GLVB 1VQ7A 4C3IH 3M7NA 1V9PA 3GTKH 2E8GA 2XGTA 4B3RL 4JI8L 4IFDJ 5JEAJ 5C44G 1BBUA 1E1TA 2Z6KA 4R4OA 3TEHB 5FJ8H 4GN3B 1X3GA 4JI1L 4HJ7A 2R7ZG 1KQSA 1Q86C 2UUAL 4IPGA 3D31A 1VQHA 5M5WH 1KD1C 4DV1L 4LF9L 1GVPA 4ME3A 5FLMH 2IX1A 4UY8C 1SN8A 3F2DA 3EIVA 4A3KG 1VQFA 2CWPA 4DK6C 1BVSA 4XTCS 1YJNA 2UUBQ 3JC66 3TS2A 5M3MH 4JCVE 1GO3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGQ A;  4GOP C;  1L1O C;  1CKO A;  2R6G A;  3HOU G;  3OTO Q;  1NMG A;  3A74 A;  3CAM A;  4IFD G;  5JEA G;  4GOP B;  1HNX Q;  1L1O B;  4PZ7 A;  3PIP A;  1S72 A;  1HZB A;  2MNA A;  1VQJ A;  1XNQ Q;  2K5N A;  1N32 Q;  1LYL A;  3CW2 C;  3UDG A;  3NBH B;  3G48 A;  5J3B A;  1C7Y A;  1VQ9 A;  4EQ5 A;  1XPU A;  1QVC A;  2VQE L;  4LF6 Q;  1X3E A;  2D62 A;  1NBW A;  1XNR Q;  1LTL A;  1XJV A;  3I4N G;  4OXP A;  3E9I A;  2UU9 L;  4L5Q A;  1T9H A;  3PF5 A;  1EQR A;  2JJQ A;  5BR8 Q;  4OO1 G;  3JAM i;  2A19 A;  1B7Y B;  4J15 A;  4YY3 L;  1KC8 C;  3U50 C;  3NEL A;  4TQU S;  4JC0 A;  2Y0S G;  1YEZ A;  4X62 L;  3T1H L;  4B3S L;  1QVF A;  4PG3 A;  1TWH H;  1UE5 A;  4A3I G;  4WJ3 M;  2GVB A;  3UDI A;  2YTV A;  1N36 L;  3PO2 H;  3J7A 5;  4P72 A;  2ID0 A;  3JAM c;  1VQA A;  1HNW Q;  2PI2 A;  5M3F H;  2K5H A;  4QJF A;  1VQE A;  4R1J A;  3HKZ E;  1E3P A;  1SR3 A;  1VCI A;  3M4Q A;  4GS3 A;  3RR5 A;  4HJ8 A;  4A3C H;  2MQH A;  2NVQ H;  2YYZ A;  1N33 L;  2R93 H;  2KHI A;  1J5E Q;  3PO3 G;  1IBL Q;  5GRO A;  2RCN A;  4GKK Q;  3K0X A;  1OXU A;  4A3F G;  3GD7 A;  4A3D H;  1A63 A;  3PUZ A;  4NXN Q;  4LFB Q;  2ZTD A;  2ZM6 L;  4DUZ L;  2KEN A;  3T1Y L;  2F3I A;  4AQY L;  4YWK A;  1C9O A;  4DV3 Q;  1X54 A;  4A3M H;  4POG A;  3K80 C;  4IPC A;  4RG1 A;  3S14 H;  1XPO A;  3TS0 A;  2JEB I;  1X56 A;  3MEF A;  4DAM A;  2VQF L;  1OXV A;  3ERS X;  1IBM L;  3GTG H;  3ICE A;  1QUQ A;  2E2H H;  1AH9 A;  2UXC Q;  3BZC A;  1P16 A;  1Y1V G;  2F52 A;  3B6Y A;  3HOV H;  3S16 H;  2AMC B;  4DR4 Q;  3M85 A;  1KRT A;  4JBJ A;  1PA6 A;  3OW2 A;  3S17 H;  1IL2 A;  4KHP Q;  4X66 L;  2KHJ A;  4KLK A;  4BY1 G;  3S2H H;  4C3J H;  5C0X I;  3U4V A;  3HOX H;  2AWN A;  5HY6 A;  4UP8 A;  1L2F A;  1PYB A;  4FDB A;  1EQQ A;  4L5R C;  4BBS H;  1Q81 C;  2BH8 A;  3S1R H;  3I4M G;  3E9H A;  2VUM H;  3PUX A;  4JYA L;  4LFC L;  5GQO A;  4A3L H;  4H02 A;  2B63 H;  1WOC A;  2LXK A;  4B3T Q;  4JI0 L;  2RHS B;  3RZO H;  4DR7 Q;  1YJ9 A;  5LMU Q;  1EWI A;  2AHO B;  5IYB H;  4DV4 Q;  4JOI C;  2E5L Q;  1PH4 A;  5EAY A;  5C4J H;  2KBN A;  3D0F A;  1I50 H;  3HOY H;  2JE6 I;  1TWF H;  4MTN A;  2B29 A;  1Y1W H;  1VQC A;  2HIV A;  1NMF A;  5IP7 H;  4DR2 Q;  4O2D A;  3GTP H;  2YTX A;  1EOV A;  1IXR A;  3GDE A;  3H0G G;  2IHF A;  4NPS A;  4DUY L;  4DR3 Q;  2Z6K C;  1X6O A;  2QA4 A;  4A76 A;  3S1Q H;  1PH6 A;  2NVT H;  4WJ4 A;  1HZC A;  1EIY B;  2HHH Q;  1X55 A;  1Q8K A;  5ELN A;  4X64 Q;  4NXM L;  1IYJ B;  3FKI G;  4QL5 A;  4A3G H;  4OX9 Q;  4DV5 Q;  2AWO A;  2MO0 A;  1KAW A;  2CFM A;  5FJ8 G;  3U58 A;  2EIF A;  4UP9 A;  2IY5 B;  2K52 A;  4JBW A;  1Y14 B;  4JI4 L;  4JG2 A;  3CCV A;  3A0J A;  3MXN B;  1Q12 A;  1L0W A;  2N78 A;  2JA8 H;  4GKJ Q;  1SRO A;  4LWC A;  1V43 A;  2R92 H;  2QEX A;  4JI8 Q;  5FLM G;  3CCE A;  1XMO L;  4BA2 I;  4B3R Q;  4GKJ L;  2Y0S E;  3AQQ A;  2DGY A;  4IJH A;  1AE3 A;  4QY7 A;  4DR1 L;  4JI1 Q;  1MIU A;  4UP7 A;  4A3J H;  1SFO H;  5C0X J;  3UE0 A;  5M3M G;  3I56 A;  2UUA Q;  1BBW A;  3PCO B;  2VW9 A;  3STB D;  1K83 H;  2JA7 H;  4DV1 Q;  4TVA B;  2HIX A;  4XIG S;  1KRS A;  1W2B A;  4LF9 Q;  2LSS A;  1K3R A;  2OQK A;  1C0A A;  1O7I A;  1SRU A;  2XTI A;  4A3E G;  2NVX H;  3CC4 A;  3PGZ A;  1WCM H;  3M4O H;  2N49 A;  3PSI A;  2VNU D;  3RLN A;  1VQG A;  4A4I A;  1TWA H;  1UE1 A;  1LUZ A;  4L5T A;  2IT1 A;  4BXX G;  5IYC H;  1M1K C;  4GLA C;  4R4T A;  4A75 A;  2F4V L;  4JBM A;  4P75 A;  4BA1 I;  4JI2 L;  2Q2U A;  4LF5 L;  5H1S E;  4IPH A;  2VY3 A;  2MO1 A;  5C0X G;  1W3S A;  4BBR H;  1YIJ A;  3A5U A;  4YWM A;  4JI5 L;  5M5Y H;  2BA1 A;  2H5X A;  2VQE Q;  3RNU A;  3CCR A;  4QQB X;  1RIP A;  1BKB A;  3J81 i;  1I5F A;  3S24 A;  1JB7 A;  2EXD A;  2UU9 Q;  1EIF A;  3KDF A;  3UDF A;  1N34 L;  1MKH A;  3E0E A;  3K7A H;  4DV0 L;  2YU9 H;  4YY3 Q;  4DV7 L;  1SLJ A;  2I5M X;  2WAQ G;  4A93 G;  3AYH B;  4P74 A;  3GTM H;  4X62 Q;  2Q2H A;  3T1H Q;  4B3S Q;  3GTO H;  4IO9 A;  1FJG L;  1VQO A;  4A3C G;  3SGI A;  4DR6 L;  2OTL A;  2Z0S A;  2R93 G;  2NZO A;  1OXT A;  2NZH A;  1UEB A;  4A3K H;  4AYB G;  1N36 Q;  3HOW H;  4A3D G;  4APV A;  2C35 B;  2CQO A;  2RF4 A;  4X65 L;  1VQK A;  4R4Q A;  1VS0 A;  1VQM A;  1VQ6 A;  4YCV A;  3U4Z A;  3H3V H;  3HOZ G;  1NE3 A;  1QUQ B;  1N33 Q;  4YHH L;  1YNX A;  1B70 B;  5IY0 A;  5DLQ E;  1VQ4 A;  2ZJR A;  1MJC A;  5C3E H;  1R9T H;  2K5V A;  3CP0 A;  1MJE A;  2E2J H;  4BY7 G;  2ZM6 Q;  2PQA A;  2Q2T A;  4DUZ Q;  4GOP A;  1E7Z A;  3T1Y Q;  4YCW A;  4GNX A;  1EYG A;  4AQY Q;  1AE2 A;  1PFS A;  4PZ6 A;  3CMA A;  1IBK L;  1OXX K;  3ULL A;  4JI7 L;  3I4N H;  1QZH A;  1EFW A;  1J6Q A;  3HOX G;  2VQF Q;  3UE1 A;  3TRZ A;  5GAH C;  1CUK A;  3DM3 A;  1IBM Q;  2JA6 H;  1K8A C;  3HFZ B;  3J7Z C;  4BBS G;  1FL0 A;  2VUM G;  3STB C;  3K8A A;  3TRE A;  3RN2 A;  4MNO A;  4R4I A;  4B3M L;  4X66 Q;  3G71 A;  3BJU A;  4Y7N H;  1XMQ L;  1DGS A;  4KHZ A;  2HT1 A;  1YIT A;  1I6H H;  4DV6 L;  1HR0 L;  2ZJQ A;  3GTL H;  1X65 A;  1ASY A;  5IYB G;  5JJK A;  1UWV A;  4LUZ A;  1Z47 A;  4OON A;  1M90 C;  2JA5 H;  3HKS A;  1FGU A;  4DPG A;  1OTC A;  4JYA Q;  4LFC Q;  2ASB A;  2I5L X;  3HOY G;  3OYY A;  2UXB L;  1JMC A;  4JI0 Q;  1Y1W G;  1SE8 A;  5AJ3 L;  2ZTE A;  4LF8 L;  4JV5 L;  1NY4 A;  2WP8 J;  5IP7 G;  5HGQ A;  1PV4 A;  2UUC L;  1GD7 A;  4PMW A;  1JJG A;  3VDY A;  3CCS A;  1KXL A;  3FP9 A;  2RHQ B;  1UE7 A;  1HZ9 A;  1CKN B;  4A3F H;  4JI6 L;  4DNI A;  4A3B H;  4R4C A;  2N3S A;  1WJJ A;  3H3V I;  1G29 1;  2IX0 A;  4AH6 A;  4POF A;  1HH2 P;  2ES2 A;  1E1O A;  4JI3 L;  5IP9 H;  1XPR A;  4DUY Q;  2JQO A;  3RLO A;  3AEV A;  2HQL A;  1QVG A;  4NXM Q;  1JJC B;  3RZD H;  3RLF A;  1U0L A;  1A8V A;  2JA8 G;  4X6A H;  1Y1V H;  3W1G A;  5K36 G;  2R92 G;  3W5O A;  1H95 A;  1I3Q H;  5C4X H;  2R7D A;  4P73 A;  4YWL A;  2JA9 A;  3GTJ H;  3CCM A;  4OWT B;  1G51 A;  4A3J G;  3F1Z A;  1Q1B A;  3I55 A;  4JI4 Q;  4GN5 A;  1HR0 W;  1S3O A;  1YHQ A;  4K0K L;  2I0Q A;  3J80 i;  2OCE A;  1HNZ Q;  2JA7 G;  4DV2 L;  2B3G A;  1VQP A;  2WAQ E;  1Z9F A;  3I4M H;  2WFW A;  1XMO Q;  2AKW B;  3CF5 A;  1HNZ L;  2OWO A;  1PH1 A;  4LUV A;  5IWA L;  4HJ9 A;  1JT8 A;  4KI0 A;  1Q7Y C;  4LFA L;  1PH7 A;  4IJL A;  1WCM G;  4DR1 Q;  1QZG A;  3PF4 A;  1ASZ A;  2KCT A;  4O0A A;  4AYB E;  4NB3 A;  4DR5 L;  3J80 c;  4C3H H;  3K81 C;  2VZA A;  1CSQ A;  1D8L A;  3KF6 A;  5GAE C;  3UDX A;  4LF4 L;  5IT9 c;  1VQ5 A;  5JJI A;  2CWA A;  2MFI A;  4JOI A;  3RN5 A;  4OWW B;  2UXD L;  1B8A A;  3W1B A;  1LM0 A;  2GN5 A;  3IRB A;  2F4V Q;  1XTD A;  3H15 A;  3PV0 A;  4JI2 Q;  4LF5 Q;  2A1A A;  3FKI H;  5LMN L;  3A5Z B;  4LF7 L;  3AFQ A;  2ZTC A;  2KCM A;  3PUY A;  3ZJY C;  1A0I A;  1YVC A;  4JI5 Q;  5IYD H;  2R7F A;  1SMX A;  1Q46 A;  1VQI A;  1TXY A;  1E22 A;  4EX5 A;  1N34 Q;  1FVI A;  1KHI A;  4DV0 Q;  2K14 A;  4DKA C;  2WB1 G;  1TWG H;  2K75 A;  4DV7 Q;  1K8G A;  3HOW G;  3S1M H;  2Q2I A;  2K50 A;  5C44 H;  3ULJ A;  4LW1 A;  3PO2 G;  1YI2 A;  3J81 j;  2R7Z H;  1RL2 A;  1I94 Q;  3KJO A;  2UUB L;  1FJG Q;  5M3F G;  2VS1 A;  2LXJ A;  3S1N H;  4DR6 Q;  4GNX C;  1JJ2 A;  2PNH A;  3F2C A;  2PQA B;  2CCZ A;  3J81 c;  1GM5 A;  4GNX B;  3OTO L;  4A3E H;  1NJI C;  1HNX L;  1WI5 A;  2PI2 E;  5C3E G;  1VQL A;  3CCJ A;  3GTQ H;  2BH2 A;  4X65 Q;  1N9W A;  1K9M C;  1XNQ L;  1S40 A;  2DUD A;  1N32 L;  4BXX H;  1X3F A;  3GO5 A;  3NEN A;  3I7F A;  2VL6 A;  4YHH Q;  3Q8D A;  4LF6 L;  3M9B A;  4IPD A;  4A3M G;  1XNR L;  3HOU H;  2L15 A;  5LMN W;  4Y52 H;  1YHA A;  3CD6 A;  3F8T A;  2JA6 G;  3WWV A;  3KOJ A;  3CXC A;  3S15 H;  5BR8 L;  2E2I H;  1IBK Q;  3KJP A;  4JI7 Q;  1L1O A;  1WYD A;  3AFP A;  5FLX c;  3L0O A;  5GAG C;  1PH2 A;  3M3Y H;  3CQZ H;  1VQB A;  3ULP A;  3EN2 A;  3F2B A;  2JA5 G;  1P8L A;  2NN6 I;  4A93 H;  3LGJ A;  4RMF A;  4B3M Q;  1KIX A;  1HNW L;  1XMQ Q;  3EBE A;  1HJP A;  4A3L G;  1U5K A;  2NVY H;  4GLX A;  4DV6 Q;  1HR0 Q;  2B63 G;  2A8V A;  1K0R A;  1PH8 A;  1YBY A;  2EQS A;  1YHB A;  3KFU A;  4LUO A;  4A3I H;  1EUJ A;  2JEA I;  1J5E L;  3KLW A;  1IBL L;  4A3B G;  4GKK L;  1UE6 A;  2N8N A;  4QGU A;  4GN4 B;  3K7U C;  4HID A;  2UXB Q;  4NXN L;  5AJ3 Q;  4LF8 Q;  1N8R C;  4JV5 Q;  4LFB L;  1Q82 C;  2UUC Q;  3HOV G;  3HOZ H;  2ALY B;  1PVO A;  4DAY B;  3G6E A;  3L7Z C;  5IP9 G;  4DV3 L;  4HJA A;  4JI6 Q;  3PUW A;  1YJW A;  1OXS C;  3PO3 H;  1D7Q A;  1PH3 A;  4JBK A;  3CPW A;  4BY7 H;  3S2D H;  2ZJP A;  1X9N A;  3CC2 A;  5C4X G;  1JE5 A;  2UXC L;  4A3G G;  4IOA A;  3CCU A;  4IFD I;  4JI3 Q;  4DR4 L;  5E7N A;  2K4K A;  1KL9 A;  2PMZ E;  4AIM A;  4KHP L;  5ELO A;  4LNQ A;  4IOC A;  2JK8 A;  2OTJ A;  2FXQ A;  3BZK A;  2CKZ B;  2GVA A;  2D0P A;  1G6P A;  2IHE A;  3PIO A;  1PHJ A;  2BA0 A;  1PH5 A;  2D0O A;  4HIM A;  4BY1 H;  1TWC H;  4B3T L;  4OO1 I;  3CPF A;  3KF6 B;  4OWX B;  3TQY A;  5GAD C;  4L5S A;  4K0K Q;  4DR7 L;  2WB1 E;  3FHW A;  4DV2 Q;  3HKZ G;  5LMU L;  4ALP A;  3M4P A;  4DV4 L;  4C2M H;  5JJL A;  3I4O A;  2E5L L;  2ATW A;  5IWA Q;  4LFA Q;  3NEM A;  1PH9 A;  4MZ9 A;  1GKH A;  1V1Q A;  4YCU A;  1CKM A;  3KYH C;  3PUV A;  5IE8 A;  3G4S A;  2V1C C;  2OQ0 A;  4P71 A;  4DR2 L;  5M5X H;  1IZ6 A;  2I5H A;  1E24 A;  4DR5 Q;  3CC7 A;  1K73 C;  1I94 L;  5IYC G;  4DR3 L;  4LF4 Q;  1WFQ A;  4PZ8 A;  1PYS B;  3KF8 B;  4HJ5 A;  4QIW E;  2HHH L;  4DK3 C;  2YTY A;  4X64 L;  4HIK A;  1VQ8 A;  1CKN A;  2YV5 A;  4HIO A;  1VQN A;  1YZ6 A;  3DLL A;  4OX9 L;  1Q1E A;  4DV5 L;  3CME A;  1HZA A;  1NTG A;  1CSP A;  3CCL A;  1A62 A;  4BBR G;  4UPA A;  5IYD G;  2UXD Q;  3BU2 A;  3KDF B;  3H0G H;  3CCQ A;  2NN6 G;  3ER0 A;  3L2P A;  5LMN Q;  1VQD A;  3I2Z A;  4LF7 Q;  4GLV B;  1VQ7 A;  4C3I H;  3M7N A;  1V9P A;  3GTK H;  2E8G A;  2XGT A;  4B3R L;  4JI8 L;  4IFD J;  5JEA J;  5C44 G;  1BBU A;  1E1T A;  2Z6K A;  4R4O A;  3TEH B;  5FJ8 H;  4GN3 B;  1X3G A;  4JI1 L;  4HJ7 A;  2R7Z G;  1KQS A;  1Q86 C;  2UUA L;  4IPG A;  3D31 A;  1VQH A;  5M5W H;  1KD1 C;  4DV1 L;  4LF9 L;  1GVP A;  4ME3 A;  5FLM H;  2IX1 A;  4UY8 C;  1SN8 A;  3F2D A;  3EIV A;  4A3K G;  1VQF A;  2CWP A;  4DK6 C;  1BVS A;  4XTC S;  1YJN A;  2UUB Q;  3JC6 6;  3TS2 A;  5M3M H;  4JCV E;  1GO3 E; 
#chains in the Genus database with same CATH topology
 2QGQ A;  3HOU G;  1XWE A;  5JEA G;  1HNX Q;  5JJZ A;  3PIP A;  5IIF A;  4BY1 B;  3UDG A;  1C7Y A;  4EQ5 A;  4O1N A;  2BOS A;  4X3U A;  1C8C A;  1HQR D;  1XNR Q;  2LFN A;  4L5Q A;  1SSO A;  1SYG A;  1TS3 A;  2JJQ A;  4OO1 G;  2QDL A;  3JAM i;  4J15 A;  4YY3 L;  5FLX L;  4TQU S;  1EY6 A;  4RGO S;  2RA4 A;  1YEZ A;  1SJH D;  5EBD A;  3BDL A;  1QVF A;  5DNF A;  1DJR D;  1B9N A;  2DNC A;  1JWS D;  4ABN A;  2H1E A;  4KHV A;  5JOB A;  5EPK A;  3J7A 5;  5I6W A;  2SEB D;  3IFT A;  1ONL A;  4JVZ A;  5AFW A;  3NPP A;  3HKZ E;  4C3I B;  1SR3 A;  3BVZ A;  3RR5 A;  1A63 A;  1SYD A;  1NAP A;  4NXN Q;  2ZTD A;  2FFK B;  4DUZ L;  1DOL A;  2KEN A;  1C9O A;  2OXP A;  1GHJ A;  3LX0 A;  4POG A;  3K80 C;  4CJ2 C;  1I4R A;  3ERS X;  3GTG H;  3BDO A;  5M3M B;  1P16 A;  1Q90 A;  2RVL A;  1KRT A;  1IL2 A;  4X66 L;  2KHJ A;  3QR8 A;  3HOX H;  2AWN A;  4UP8 A;  3WOF A;  5CV9 A;  4L5R C;  5M5Y B;  4CDF C;  4C1N K;  4LFC L;  3VR5 A;  1RTN A;  3KLS X;  3J7A V;  4B3T Q;  3Q23 A;  1B2T A;  1YJ9 A;  3MAQ A;  1KNA A;  2F0L A;  3KBX A;  2AHO B;  3C2P A;  1F9Q A;  1G2T A;  3FRP B;  1SNP A;  3HOY H;  2F0J A;  2SDF A;  3HRZ C;  2B29 A;  4DNR B;  2K5W A;  2CW0 D;  4DR2 Q;  3GTP H;  2QIL A;  3GDE A;  1IYU A;  4DUY L;  4FNF A;  1EIY B;  2KQ3 A;  2EYO A;  4X3K A;  2K52 A;  4JI4 L;  1B3A A;  2K28 A;  4JG2 A;  3CCV A;  4N9T A;  1F9R A;  1SRO A;  2QEX A;  3GQB A;  1WTO A;  2JN4 A;  3DEP A;  1AE3 A;  4UP7 A;  2D9U A;  3D8G A;  3STB D;  1K83 H;  1LTB D;  3AB9 A;  3SR1 A;  4K2K A;  4A3E G;  2NVX H;  3CC4 A;  3M4O H;  1EOT A;  1AP0 A;  5L37 A;  3HOX B;  5M9O A;  4A4I A;  4R4T A;  4ZQ3 A;  3EVQ A;  4A75 A;  1V1P A;  3SXH A;  5IOD A;  4LF5 L;  2B2Y A;  3OOC A;  2HCI A;  5H1S E;  4OIK A;  1Q3L A;  3KF8 A;  5KRU A;  1DOM A;  5C0X G;  1W3S A;  3OIQ A;  5G3L F;  4YWM A;  2BA1 A;  2VQE Q;  1EY4 A;  2AUJ D;  3S24 A;  2F4I A;  2F0T A;  3I8Z A;  1N34 L;  1MKH A;  3E0E A;  3K7A H;  2YU9 H;  1LO5 D;  3NSW A;  1B1Z A;  1SNQ A;  3GTP B;  4A93 G;  1CM9 A;  3GTM H;  1G2S A;  4X62 Q;  2Q2H A;  3T1H Q;  2KEC A;  4DR6 L;  2I07 B;  4EVO A;  1DOK A;  2NZH A;  1F2Y A;  1N36 Q;  2ZXR A;  2RF4 A;  2B2W A;  3MC0 B;  1VQK A;  4KJN A;  3JAM E;  4YCV A;  2DY7 A;  3H3V H;  3ERQ A;  3NP8 A;  4ZAI A;  5J39 A;  3I72 A;  1B70 B;  5IY0 A;  1R9T H;  2K5V A;  1MJE A;  1WTH A;  4NKL A;  1SMY C;  1M8A A;  1EYG A;  1K83 B;  4PZ6 A;  3DMU A;  3HZX A;  1EFW A;  1SYB A;  2NVX B;  1SE4 A;  5GAH C;  3M4O B;  2VB3 X;  3HFZ B;  1FL0 A;  3RN2 A;  3TRE A;  3G71 A;  4Y7N H;  1MSH A;  2HT1 A;  4DV6 L;  1HR0 L;  2ZJQ A;  2GA4 B;  1X65 A;  4KKU A;  4CDE C;  2BCO A;  2PW5 A;  1M90 C;  1FGU A;  1OTC A;  1U4L A;  5TSS A;  4ZCK A;  4JI0 Q;  2ZTE A;  4JV5 L;  1LTG D;  4H44 C;  3K7A B;  2YU9 B;  1KXL A;  1STA A;  1UE7 A;  2Z6B A;  5COR A;  2EXZ A;  1QNK A;  4RCN A;  3GTM B;  1WJJ A;  2XSC A;  3H3V I;  4AH6 A;  3OHX C;  2ES2 A;  1A3U A;  1JOO A;  2EJM A;  1WTQ A;  4FF3 A;  1A6X A;  1E1O A;  5IP9 H;  3UI2 A;  3GTQ B;  1A8V A;  3GV6 A;  1D1I A;  3H3V C;  4QCL A;  5C4X H;  3M4Y A;  5KNC A;  3GTJ H;  4OWT B;  2A68 D;  1G51 A;  1Q1B A;  1UNS A;  3I55 A;  1YHQ A;  1R9T B;  3J80 i;  2OCE A;  4EQP A;  2JA7 G;  1VQP A;  1KAB A;  2RBM A;  1XMO Q;  1PH1 A;  4KI0 A;  1WCM G;  2KCT A;  3QOJ A;  4ODG A;  4K5X A;  1Y8O B;  4DR5 L;  4KY7 A;  4XXE A;  2VZA A;  1D8L A;  5GAE C;  3KF6 A;  4LF4 L;  3UDX A;  2FHT A;  5IT9 c;  4Y7N B;  5JJI A;  5E4W C;  1RDP D;  2MFI A;  4V19 0;  2C9O A;  4K5W A;  3HG9 A;  2EJF C;  2OT2 A;  1F9S A;  3TP7 A;  2AQ2 B;  1B8A A;  2AQ1 B;  1LM0 A;  3IRB A;  1IYV A;  3A56 A;  1XTD A;  4JI2 Q;  4LF7 L;  1E2V A;  2ZTC A;  3MHB A;  2F0W A;  3ZJY C;  1YVC A;  2QEJ C;  3KLR A;  2K6A A;  1VQI A;  1Q46 A;  1TXY A;  2R3Z A;  3R2I A;  1HUN A;  1SAP A;  3OMG A;  2WB1 G;  1TWG H;  2O5J C;  1K8G A;  3HOW G;  2Q2I A;  2K50 A;  5JVH 3;  3PO2 G;  2IWH A;  3OSO A;  1FJG Q;  1LTA D;  5M3F G;  3C46 A;  3J7Y W;  2CCZ A;  4NP5 A;  4A3E H;  1NJI C;  3GTJ B;  2CW0 C;  2PI2 E;  1LT4 D;  3G7L A;  1I4P A;  5T1I A;  1K9M C;  2BH2 A;  1XNQ L;  2DUD A;  1N32 L;  4F87 A;  2P5Z X;  2G9D A;  3I7F A;  1ILQ A;  1GUN A;  2EYJ A;  2VL6 A;  4YHH Q;  3IKJ A;  4B9X A;  4A3M G;  2L15 A;  4IFD H;  4Y52 H;  2B8G A;  1O7Y A;  2PPB C;  3F8T A;  3KOJ A;  5C0X H;  4NW2 A;  3VR6 A;  1EIG A;  3H94 A;  4HSV A;  4JI7 Q;  1WYD A;  2EPB A;  1TY2 A;  3H09 A;  2CQA A;  3CQZ H;  3EN2 A;  3BS1 A;  2A5H A;  1EY0 A;  4A93 H;  1LTR D;  1FYC A;  4RMF A;  1IW7 D;  3WOE A;  4CJ0 B;  1XMQ Q;  2XRS D;  1O7L A;  3EBE A;  2NVY H;  4GLX A;  2B63 G;  3P1H A;  2A8V A;  1BCP D;  3KFU A;  1YHB A;  5IGC A;  1IBL L;  2N8N A;  4GN4 B;  1H9S B;  4LFB L;  1Q82 C;  2ALY B;  1PVO A;  2PYK A;  1TWG B;  4HJA A;  2EYL A;  4JI6 Q;  3PUW A;  1YNN D;  2Z8L A;  5ELD A;  4ULL A;  2F0U A;  1JE5 A;  4A3G G;  4R8I A;  4IFD I;  3OMC A;  1DZ1 A;  4A3E B;  5ELO A;  4IOC A;  1K3B C;  2BE5 D;  4JK1 C;  2HD3 A;  4CJ1 B;  1G6P A;  5EQ0 A;  1JB3 A;  4HIM A;  1I4H A;  4OWX B;  2H4O A;  2BDO A;  4DR7 L;  1BDO A;  2EYF A;  3ND9 A;  4DA2 A;  4DV4 L;  5JJL A;  4Z9C B;  4C3H G;  1G8Z D;  4MZ9 A;  4E6I A;  4YCU A;  2B2V A;  1DD2 A;  3PUV A;  3G4S A;  3CQZ B;  4P71 A;  4CHT B;  1AN8 A;  4A93 B;  1E24 A;  1I94 L;  4EQN A;  4PZ8 A;  3DWA A;  2Y0S B;  4HIK A;  2JYO A;  2NVY B;  3A7L A;  2YV5 A;  3J80 E;  3PIP 3;  1YZ6 A;  4OX9 L;  1A62 A;  4BBR G;  5IYD G;  3BU2 A;  3KDF B;  1PRT F;  1Z6H A;  3ER0 A;  4HED A;  4KK7 A;  3L2P A;  1PMR A;  5LMN Q;  4G57 A;  4GLV B;  2E8G A;  5JEA J;  2Z6K A;  2KCN A;  4GN3 B;  2R7Z G;  3DXJ C;  4XQQ A;  4HMJ A;  3MFY A;  4DU9 A;  1SBB B;  3ERO A;  1STH A;  4L8J A;  3F2D A;  4A3K G;  5C5M A;  3MXN A;  2CWP A;  1SNC A;  2F0G A;  1BVS A;  4XTC S;  3S1R B;  4J8Q A;  3A8I E;  4GOP C;  3NQI A;  1ZEQ X;  3OTO Q;  3A74 A;  3DHQ A;  4R9W A;  4GOP B;  4PZ7 A;  1S72 A;  5I9P A;  1HZB A;  2KHS A;  2K5N A;  3MXG A;  1LYL A;  1PZK D;  3G48 A;  5EKI A;  3TME A;  5EBC A;  1Y8N B;  3I4N G;  1Q8I A;  4OXP A;  3DUZ A;  4G7O C;  4FO2 A;  4TKO B;  2A68 C;  5BR8 Q;  1B7Y B;  1KC8 C;  2F0O A;  4B3S L;  4PG3 A;  1TWH H;  3L9A X;  1UE5 A;  4A3I G;  4WJ3 M;  4X3T A;  2MJ8 A;  3PO2 H;  1B44 D;  3FEW X;  1S5E D;  1HNW Q;  2CVR A;  2WKC A;  5M3F H;  5ISR A;  1EY8 A;  1AW7 A;  1VCI A;  4GS3 A;  2MQH A;  2NVQ H;  4BS9 A;  2R93 H;  5HUR A;  2NBF A;  1J5E Q;  3PO3 G;  4CGY B;  1G91 A;  3N52 A;  3K0X A;  1OXU A;  3F2U A;  5A35 A;  1BR9 A;  3T1Y L;  3TP5 A;  2PZW A;  4AQY L;  4DV3 Q;  4A3M H;  2F0D A;  1WCM B;  5CV6 A;  1LV9 A;  3I70 A;  2TSS A;  1QUQ A;  2UXC Q;  2L4N A;  2F52 A;  3B6Y A;  2AMC B;  4KHP Q;  4KLK A;  2OEO A;  2PQE A;  1L2F A;  1PYB A;  3FDT A;  4FDB A;  1M4V A;  1X3P A;  2BH8 A;  3E9H A;  1WTV A;  2VUM H;  1WD0 A;  1DCZ A;  3MXU A;  4JYA L;  5GQO A;  3V2T A;  1ESR A;  2B63 H;  1WOC A;  1JOK A;  5EGT A;  1BO0 A;  3U9S A;  3VYU A;  4JOI C;  2E5L Q;  1S5F D;  3NTH A;  5EAY A;  2KBN A;  1I50 H;  1TWF H;  4PV1 C;  4MTN A;  1O80 A;  2HIV A;  2XIW A;  1TWH B;  2YTX A;  3A8J E;  3EA6 A;  1IXR A;  2IHF A;  3S1Q H;  4DR3 Q;  2QA4 A;  2WAQ B;  3PO2 B;  2NVT H;  1HZC A;  4NXM L;  2HHH Q;  4X64 Q;  5M3F B;  1IYJ B;  2A69 D;  3FKI G;  4DNT B;  4QL5 A;  4A3G H;  4DV5 Q;  4NMZ A;  1JCK B;  1KAW A;  2CFM A;  2NVQ B;  2R93 B;  1T5X D;  4OHJ A;  4JBW A;  1Y14 B;  4QIW B;  1IW7 C;  4MIU A;  1LTI D;  2N78 A;  2JA8 H;  3W2D A;  1S5B D;  4OEL B;  2R92 H;  4BA2 I;  3CCE A;  4JI8 Q;  2Y0S E;  3AQQ A;  1BCP C;  2DGY A;  2KCC A;  4IJH A;  1ZYR C;  1PZI D;  4A3M B;  1GOZ A;  3K5O A;  4QY7 A;  4DR1 L;  1DYQ A;  1MIU A;  5C0X J;  3VA7 A;  1BBW A;  3PCO B;  2VW9 A;  4DV1 Q;  1JWU D;  4XIG S;  3Q24 A;  1BUV T;  4QUF A;  3RLN A;  1YNN C;  3E5S A;  2O4X A;  1PFB A;  1TWA H;  4KD4 A;  1LUZ A;  2IT1 A;  4GLA C;  1V1O A;  2VUM B;  2F4V L;  1SNM A;  4IAL A;  2Q2U A;  2B63 B;  4OGQ C;  4IPH A;  2VY3 A;  3P20 A;  2MGS A;  4BBR H;  2BE5 C;  5M5Y H;  1EWC A;  3RNU A;  2ZT9 C;  4DAP A;  1MGS A;  3J81 i;  1I50 B;  1JB7 A;  2UU9 Q;  1TWF B;  2Z4I A;  1BNZ A;  3UDF A;  2EVB A;  4DV0 L;  4DV7 L;  1SLJ A;  3S1Q B;  2NVT B;  3VYT A;  4IO9 A;  2VXW A;  1VQO A;  4A3C G;  3SGI A;  4A3G B;  1UEB A;  4A3K H;  4AYB G;  4DXG A;  4A3D G;  4APV A;  2NTT A;  2C35 B;  3R8B A;  2CQO A;  4X65 L;  3A54 A;  1T5E A;  2JA8 B;  2R92 B;  3IL8 A;  3E6Z X;  1N33 Q;  5CV7 A;  1VQ4 A;  1MJC A;  5C3E H;  3CP0 A;  2EY5 A;  2M00 A;  3RD4 A;  2PQA A;  2ZM6 Q;  2Q2T A;  5BN5 A;  1E7Z A;  3HOV G;  2F0Q A;  3CMA A;  4ZUI A;  3I4N H;  2E2D C;  1OO9 B;  2L5T A;  2VQF Q;  3ITP A;  1CUK A;  1GUW A;  1IBM Q;  4CDD C;  4KY5 A;  1K8A C;  3AMU A;  4FXD A;  3J7Z C;  4BBS G;  1F9P A;  1TWA B;  3QIA A;  2K5D A;  1II3 A;  4R4I A;  3D6W A;  4B3M L;  3DWP A;  1QJO A;  2DJF C;  3W3A A;  1MHW C;  3GTL H;  1ASY A;  1HA5 A;  5IYB G;  1UWV A;  2DJG C;  2JA5 H;  4RWS C;  4BBR B;  1RTO A;  3HKS A;  4DPG A;  2B39 A;  3OYY A;  4HN7 A;  2UXB L;  1Y1W G;  1SE8 A;  2PZT A;  1NY4 A;  2MUY A;  3QB3 A;  5IP7 G;  2QDB A;  3EJI A;  1GD7 A;  3CCS A;  1CKN B;  1SYE A;  4DNI A;  4A3B H;  2R7Z B;  4R4C A;  2N3S A;  5IOC A;  1CQF A;  1G29 1;  2IX0 A;  1EZ6 A;  1HH2 P;  4G7Z C;  4A3K B;  3AEV A;  2HQL A;  3OWE B;  3ZYY X;  1U0L A;  1HRJ A;  1CHP D;  4DF7 A;  1NCV A;  2R7D A;  3I4L A;  4P73 A;  4GZY C;  1A2U A;  1FNV A;  2EOT A;  4A3J G;  3F1Z A;  1HR0 W;  1S3O A;  5C3E B;  2B2T C;  3DM1 A;  4K0K L;  4DV2 L;  1WVL A;  2WAQ E;  1Z9F A;  2WFW A;  5CV5 A;  1HNZ L;  4LUV A;  5D14 A;  4HJ9 A;  3I4N B;  1JT8 A;  1PH7 A;  1JR0 D;  5E4X A;  1V1P B;  2B2Y C;  1QZG A;  1ASZ A;  4HMI A;  3VR4 A;  4O0A A;  4EQO A;  5C3W A;  2A74 C;  1WD1 A;  4EGV A;  1PRT B;  1VDZ A;  1MD2 D;  2CWA A;  5EPL A;  3X3M A;  3GTL B;  2EDG A;  4M1U B;  3RN5 A;  4KD3 A;  2JA5 B;  2UXD L;  1NNX A;  2GN5 A;  2F3V A;  3PV0 A;  2A1A A;  2TMP A;  3FKI H;  3A5Z B;  1BXT A;  3TP6 A;  3AFQ A;  1A0I A;  4JI5 Q;  1PYW D;  2L55 A;  1SMX A;  2NN6 H;  1E22 A;  1EEI D;  4A3B B;  2B2W C;  2FIN B;  2EJG C;  4RAU C;  2K14 A;  4FF1 A;  2K01 A;  2K75 A;  4OL7 A;  2IX3 A;  1KLU D;  3S1M H;  1IKL A;  3RMH A;  2A6E C;  4LW1 A;  3ULJ A;  1YI2 A;  4KKT A;  1GXD C;  2WV6 D;  4J1M A;  1CTM A;  2NWG A;  3KJO A;  2UUB L;  2VS1 A;  3K59 A;  2PNH A;  3J81 c;  3EFX D;  1GM5 A;  1HNX L;  1WI5 A;  3J81 E;  1VQL A;  3GTQ H;  1LT5 D;  1N9W A;  2HUG A;  1KDB A;  1X3F A;  3GO5 A;  2PZU A;  2A69 C;  3M9B A;  4IPD A;  3HOU H;  1XNR L;  5JEA H;  3G6J B;  1TS4 A;  3CD6 A;  2JA6 G;  3WWV A;  1G6Z A;  1IBK Q;  3KJP A;  1L1O A;  1PTO F;  3AFP A;  1FGB D;  3NTK A;  3K0Y A;  3L0O A;  4H0L C;  3NBH A;  4C3J G;  1AFP A;  1PFM A;  4OO1 H;  1P8L A;  2NN6 I;  3LGJ A;  4PMB A;  4MN3 A;  2JP1 A;  1S5C D;  2E75 C;  3FKI B;  2NB0 A;  1K0R A;  2QF7 A;  3I90 A;  1HXY D;  1PH8 A;  1YBY A;  4LUO A;  1JOQ A;  1SEB D;  2JEA I;  1Y69 U;  1TVX A;  4NXN L;  5AJ3 Q;  4LF8 Q;  1N8R C;  2UUC Q;  3L7Z C;  3S1M B;  1J8I A;  1D7Q A;  1PH3 A;  4JBK A;  5G3L D;  2ZJP A;  1TU2 B;  4IOA A;  4JI3 Q;  1A3T A;  5D3D A;  1KL9 A;  4AIM A;  1EL0 A;  1ZKO A;  2FXQ A;  3BZK A;  2CKZ B;  2GVA A;  4HTH A;  3SK5 A;  3NTI A;  1WTP A;  1SDF A;  2IHE A;  4K14 A;  2F0S A;  2WAC A;  2BA0 A;  1K0S A;  3HOU B;  4OO1 I;  4B3T L;  3NHH A;  3KF6 B;  3C3L A;  4WFN 3;  3HKZ G;  3M4P A;  3A7A B;  4J6H A;  2KEE A;  5IWA Q;  4LFA Q;  1XYI A;  4RGM A;  1L0Y B;  3KYH C;  5IE8 A;  3HS0 C;  2PW7 A;  1KAA A;  3OWF A;  4DR2 L;  1CZG A;  3CC7 A;  1PYS B;  4HJ5 A;  2VB2 X;  5ELF A;  4DK3 C;  1LAB A;  3HP3 A;  3T51 B;  1VQN A;  3FMC A;  1Q1E A;  3NWS A;  5J1Z A;  3CME A;  5IT9 E;  5IGD A;  3CCL A;  4IQZ A;  1QWY A;  4A3D B;  1HHV A;  2NYZ D;  3MEH A;  3M7G A;  4K8J A;  3M7N A;  3D4R A;  3GTK H;  1FR3 A;  1BF4 A;  3S14 B;  5C44 G;  3IAY A;  3TEH B;  4R4O A;  2N55 A;  4KY6 A;  3D31 A;  3HOV B;  4ZKB B;  2SNM A;  2B8F A;  3S17 B;  4UY8 C;  2F0N A;  1WTR A;  2G5D A;  5K5P A;  3RZO H;  3J81 L;  2R6G A;  1K8O A;  1NMG A;  3CAM A;  4DK1 A;  1VQJ A;  1QG7 A;  3CW2 C;  5KGU A;  1JIC A;  5DM6 3;  1XPU A;  1QVC A;  4RA8 A;  2VQE L;  4RKB A;  1X3E A;  4LF6 Q;  3NXW A;  2SNS A;  2ZXO A;  4L63 B;  2RDH A;  3E9I A;  4DXF A;  1Y1W B;  2OF1 A;  1WTW A;  2PNR C;  4XQJ A;  1F2Z A;  1D5Z C;  4X62 L;  2I46 A;  3T1H L;  1VMC A;  3S9W A;  2DNE A;  2RKS A;  1N36 L;  4P72 A;  1VQA A;  3ONA B;  5C6A A;  4MTK A;  1S4Z A;  1DON A;  2K5H A;  4QJF A;  1VQE A;  3NWT A;  1F2L A;  1E3P A;  3M4Q A;  2WKD A;  3GTK B;  1ZYR D;  2KHI A;  4LK1 C;  4GKK Q;  2RCN A;  4A3J B;  5KYI A;  3PUZ A;  4HSP A;  4P2C B;  4CDC C;  4RGT A;  3Q0A A;  5LL6 X;  1X54 A;  5BN4 A;  4IPC A;  1XPO A;  2JEB I;  2JSO A;  2XVS A;  1OXV A;  4CKE A;  5FO9 B;  2F0I A;  4K6D A;  3RZO B;  4DR4 Q;  3OW2 A;  4BY1 G;  4C3J H;  5C0X I;  3FVQ A;  1EQQ A;  3K5N A;  1SYC A;  3S1R H;  1FNW A;  1CZW A;  3C1F A;  2PMZ B;  2LXK A;  4JI0 L;  1STB A;  4UDU C;  5JPM C;  5LMU Q;  5C4J H;  2RQX A;  3D0F A;  2JE6 I;  3LWU A;  4QMG A;  2EYM A;  1GHK A;  1TS5 A;  3D3R A;  3H0G G;  4NPS A;  3BVG A;  3P75 A;  5I2Y A;  2Z6K C;  1X6O A;  2F3W A;  2B2U C;  4XQN A;  1PH6 A;  4ZUJ A;  1RF2 D;  2DY8 A;  1ET6 A;  1CA5 A;  5IT9 L;  4C3I G;  5A2Q L;  1SE2 A;  2EZV A;  2AWO A;  1EYA A;  5FJ8 G;  2EIF A;  4UP9 A;  5JPN C;  1CI3 M;  3OIP A;  4RFB A;  1RHP A;  1C48 A;  4K5V A;  3A0J A;  3MXN B;  1Q12 A;  3CU7 A;  4ILW A;  4LWC A;  4B3R Q;  5FLM G;  1XMO L;  1YNJ D;  3URY A;  2ICE C;  4GKJ L;  4TSS A;  4Q5V A;  4KKS A;  5DM7 3;  4JI1 Q;  2JA6 B;  5M3M G;  2UUA Q;  4JW0 A;  2JA7 H;  1FNU A;  1BOS A;  1W2B A;  1KRS A;  4LF9 Q;  2OQK A;  1DXM A;  2LS0 1;  1SRU A;  2XTI A;  3K58 A;  4I7A A;  4IUR A;  3PGZ A;  1WCM H;  4C3J B;  1L0X B;  2VNU D;  1PZJ D;  1UE1 A;  3C1E A;  2XRQ D;  4H7B A;  4BXX G;  1M1K C;  4JI2 L;  5JVG 3;  4FF4 A;  2MO1 A;  1LT6 D;  4G4K A;  3A5U A;  4X3S A;  4OEM B;  3CCR A;  5C4J B;  1RIP A;  1BKB A;  5F2D A;  1CT1 D;  1EIF A;  3KDF A;  1KNE A;  4YY3 Q;  5KEE A;  4PNY A;  2QCP X;  4LMQ D;  3AYH B;  5FO7 B;  3MTS A;  2F03 A;  4YIJ A;  1R4P B;  1I3Q B;  1FJG L;  2Z0S A;  2K1B A;  2NZO A;  4WOR A;  3VR3 A;  1PDQ A;  3HOW H;  3NBI A;  1D2B A;  1K8M A;  4R4Q A;  4ZYS A;  3U4Z A;  4RCO A;  1NE3 A;  1QUQ B;  4YHH L;  1J9O A;  1TR5 A;  1YNX A;  1PTO B;  2Q8R E;  2O5I C;  2KED A;  4HCE A;  2F0H A;  5IGE A;  4DUZ Q;  4GOP A;  1PRT D;  4GNX A;  2JA7 B;  1AE2 A;  1PFS A;  4JI7 L;  1OXX K;  3ULL A;  1QZH A;  1RCV D;  4XYQ A;  5FKA C;  3HOX G;  4I7Z C;  3UE1 A;  3TRZ A;  3R2T A;  4KN4 C;  3K8A A;  4X66 Q;  5IGB A;  3BJU A;  1XMQ L;  4ID6 A;  4KHZ A;  1R4Q B;  4ZKC B;  4FP5 D;  1Z47 A;  1KTK A;  2KVM A;  4RHS A;  4LAA A;  4LFC Q;  2ASB A;  3HOY G;  4QB4 A;  4FVM A;  2MPM A;  1JMC A;  1Z7T A;  1H9M A;  2ENB A;  2WP8 J;  1AZP A;  1JJG A;  5HGQ A;  3KBG A;  5IGG A;  1PV4 A;  3BVM A;  2A6E D;  3FP9 A;  2RHQ B;  4JI6 L;  3OW7 A;  1ZXT A;  1ENF A;  1TKW B;  2QKI C;  4POF A;  2CHB D;  2A6H C;  1BQQ T;  2WB1 B;  4DUY Q;  1CA6 A;  2FMM A;  3HOW B;  4O42 A;  4OIJ A;  5KNB A;  1QVG A;  3RLF A;  3E3X A;  4DAY A;  4X6A H;  5K36 G;  3W1G A;  3W5O A;  1VMP A;  3QG1 A;  2JA9 A;  4QUC A;  3CRK C;  4JI4 Q;  1MI2 A;  2I0Q A;  1HNZ Q;  4ZLT F;  1JQY D;  2B3G A;  2X6G A;  5DAU A;  1IHZ A;  3P7J A;  4B9W A;  2OWO A;  2AKW B;  1IKM A;  3U9O A;  4IJL A;  3VYR A;  3SEB A;  2R61 A;  4G7H C;  1QOH A;  4NB3 A;  4F7X A;  4C3H H;  3K81 C;  3SDZ A;  1CSQ A;  4LJZ C;  4QF4 A;  5ELE A;  1A3V A;  4JOI A;  3WDN A;  4ME5 A;  2D5D A;  2EY1 A;  4I65 A;  4DAV A;  1EIH A;  3H15 A;  4LF5 Q;  3KK7 A;  5LMN L;  3KLS A;  2L1B A;  4ZK9 B;  3TZU A;  2KCM A;  1GUT A;  5IYD H;  2R7F A;  3MVV A;  3S2D B;  1N34 Q;  1FVI A;  1KHI A;  5EKK A;  4HR7 B;  2KA7 A;  3J81 j;  2R7Z H;  1RL2 A;  3QJY A;  4IUU A;  2LXJ A;  3S1N H;  4DR6 Q;  1JJ2 A;  3IFD A;  3F2C A;  2IL8 A;  2PQA B;  1H9K A;  2EYH A;  4K6L A;  3OTO L;  3T53 B;  2E74 C;  3V96 A;  4BXX H;  3K6O A;  3NEN A;  4RH6 A;  2AUK A;  2Z4H A;  3SK4 A;  1YHA A;  1ENC A;  3QO2 A;  1U4R A;  2Q8T A;  4XYO A;  2CH4 W;  5BR8 L;  5M5X B;  3K57 A;  3H91 A;  4C3H B;  5GAG C;  1YNJ C;  1VQB A;  3TZD A;  3AU7 A;  3H0G B;  4IZ8 A;  4DGZ A;  1F2M A;  4KN7 C;  1HNW L;  5NUC A;  1ICF B;  1HJP A;  3KUP A;  1U5K A;  4A3L G;  1GJX A;  4DV6 Q;  1HR0 Q;  3HEJ A;  2EQS A;  3D4D A;  4A3I H;  1EUJ A;  2RSO A;  1J5E L;  3KLW A;  3VA5 A;  1UE6 A;  4HID A;  1D1K A;  4JV5 Q;  3EQL C;  1SE3 A;  4DFA A;  5J22 A;  2EY6 A;  5IP9 G;  4CKB A;  4DV3 L;  3T56 B;  1E2W A;  3I3C A;  1YJW A;  3PO3 H;  1HA6 A;  1HUM A;  1X9N A;  3T4A C;  5C4X G;  2UXC L;  3S1N B;  2FMC A;  1U4M A;  1ENA A;  1B3Q A;  4KHP L;  2OTJ A;  2JK8 A;  1GUG A;  2L0C A;  3FPU B;  1O7Z A;  3PIO A;  4N9P A;  1PLF A;  2BDN A;  1PH5 A;  1NR4 A;  1TWC H;  3BZD B;  1I4X A;  3CPF A;  3TQY A;  5C3X A;  5GAD C;  2WB1 E;  1GUO A;  4C2M H;  3I4O A;  2E5L L;  2ATW A;  3PQI A;  1PH9 A;  1LTT D;  2HDL A;  1GKH A;  4IN3 A;  1CKM A;  4HAE A;  2V1C C;  2RCF A;  1IZ6 A;  2XWB B;  5I9O A;  4DR5 Q;  5IYC G;  4DR3 L;  1EY5 A;  1WFQ A;  1PRT C;  4LF4 Q;  3KF8 B;  3J7A F;  3LNN A;  4QIW E;  5COY A;  4F88 A;  2HHH L;  1VQ8 A;  2YTY A;  4X64 L;  3MXP A;  1CKN A;  4DV5 L;  1NTG A;  2NUC A;  1CSP A;  4UPA A;  1ET9 A;  1RD9 D;  4A3I B;  4IUV A;  3LWE A;  3CCQ A;  5C5L A;  1EYC A;  4LF7 Q;  5K36 H;  4H13 C;  1V9P A;  1Y8P B;  2XGT A;  4JI8 L;  1EU3 A;  1E1T A;  3TN2 A;  1U4P A;  3BDC A;  4B08 A;  1X3G A;  3PO3 B;  3GTG B;  1KQS A;  5T1G A;  1AEX A;  5EKL A;  5E3F A;  1ILP A;  1IL8 A;  5M5W H;  3NQT A;  4DV1 L;  1PXU A;  4ME3 A;  1MSG A;  5ELB A;  2IX1 A;  1SN8 A;  3EIV A;  1VQF A;  2B2T A;  2F1M A;  4DK6 C;  3GP7 A;  3JC6 6;  1W6J A;  2MHV A;  2NZ1 D;  1LTS D;  1STE A;  2E76 C;  1L1O C;  1CKO A;  2RSN A;  4UHV A;  4U67 3;  4FYD A;  4IFD G;  1L1O B;  2MNA A;  1TWC B;  1XNQ Q;  2WII B;  3H6M A;  1N32 Q;  3NBH B;  5J3B A;  1VQ9 A;  1I6V C;  3CHB D;  4C2M B;  2D62 A;  3HOY B;  1NBW A;  1LTL A;  1XJV A;  1ML0 D;  4IUN A;  2UU9 L;  4HCS A;  1A15 A;  1T9H A;  3PF5 A;  1EQR A;  2A19 A;  3U50 C;  4WJW A;  1UUP A;  5E1F A;  3NEL A;  4R8N A;  4JC0 A;  2J7Z A;  2Y0S G;  2EY2 A;  4XT3 B;  3TDQ A;  3GV3 A;  1EWH A;  2GVB A;  3UDI A;  1ROD A;  2YTV A;  5CV8 A;  2ID0 A;  3JAM c;  3R3O A;  2PI2 A;  4R1J A;  3VR2 A;  1WTX A;  4PMC A;  4HJ8 A;  4A3C H;  4TRD A;  2ICI A;  2YYZ A;  3NE5 B;  1N33 L;  1QE6 A;  1EEF D;  1IBL Q;  5GRO A;  5KND A;  5BN3 A;  4A3F G;  4U68 A;  1KLG D;  3GD7 A;  5CV4 A;  4A3D H;  4LFB Q;  2KUM A;  2HCC A;  1TQO A;  2ZM6 L;  4CBV A;  4IUT A;  2F3I A;  2K05 A;  1QNU A;  5M5W B;  4YWK A;  2ZXP A;  1B50 A;  4RG1 A;  3S14 H;  3TS0 A;  1EY9 A;  1X56 A;  3MEF A;  4DAM A;  1V8Q A;  5CMD A;  2VQF L;  1AZQ A;  1IBM L;  2JXM B;  3ICE A;  1H9R A;  1VF5 C;  2E2H H;  1HFN A;  1AH9 A;  3BZC A;  1Y1V G;  3S16 H;  4ZRZ A;  2K5Q A;  3HOV H;  3M85 A;  4JBJ A;  1PA6 A;  3S17 H;  3I91 A;  3S2H H;  1SNO A;  3U4V A;  5CYU A;  5HY6 A;  2V4D A;  1HCZ A;  5I2X A;  4BBS H;  1Q81 C;  3I4M G;  1LAC A;  3PUX A;  4A3L H;  4H02 A;  1B4O A;  2RHS B;  1B9M A;  4DR7 Q;  1EWI A;  5IYB H;  1U9R A;  4DV4 Q;  3N6R A;  1PH4 A;  5FOB B;  5IGF A;  3ND8 A;  2K33 A;  1Y1W H;  1VQC A;  4FF2 A;  1NMF A;  3PMF A;  5IP7 H;  4FXG C;  2F0F A;  4O2D A;  5CC4 A;  1EOV A;  1I94 Q;  4Q0F A;  2X69 A;  4A76 A;  3TBI B;  4WJ4 A;  1QCB D;  1JOR A;  1X55 A;  1Q8K A;  5ELN A;  1PTO D;  4OX9 Q;  1VF7 A;  2MO0 A;  1GUS A;  3U58 A;  5A2Q E;  4AYB B;  2IY5 B;  1H9J A;  2K03 A;  1L0W A;  4GKJ Q;  1V43 A;  1HQM C;  3D6C A;  1SJE D;  2AQ3 B;  1C4Q A;  4A3J H;  1SFO H;  3UE0 A;  3I56 A;  2PCF B;  2E2H B;  5LL6 S;  4CKC A;  4TVA B;  2HIX A;  4L6T B;  3S16 B;  2LSS A;  1K3R A;  1C0A A;  1BCP F;  1O7I A;  3MWY W;  5DEH A;  3S2H B;  2N49 A;  3PSI A;  1VQG A;  4L5T A;  4BBS B;  5IYC H;  3V05 A;  4JBM A;  4P75 A;  4BA1 I;  3NK9 A;  2M9V A;  5D3I B;  1E0B A;  1YIJ A;  2WIN B;  4JI5 L;  4QQB X;  4F8M A;  2H5X A;  2IPK D;  1I5F A;  3L3O C;  2EXD A;  2A6H D;  2F0M A;  1XTC D;  2LY7 A;  3TSS A;  2I5M X;  1CHQ D;  1SXT A;  2WAQ G;  1HFG A;  4P74 A;  4BWG B;  3DWQ A;  1BBX C;  2RDF A;  4B3S Q;  1W6K A;  2Z9H A;  1ICW A;  3GTO H;  3SK8 A;  5C4X B;  3DEO A;  2Z1C A;  2OTL A;  2R93 G;  1OXT A;  3CRL C;  3JAM L;  4KTA A;  1TT2 A;  4WRD A;  1KDA A;  1VQM A;  1VS0 A;  1VQ6 A;  1EYD A;  3HOZ G;  1EY7 A;  5EPJ A;  3SVM A;  5DLQ E;  1EQV A;  2ZJR A;  1SND A;  2E2J H;  4BY7 G;  1SFO B;  1ESF A;  3T1Y Q;  4YCW A;  3R93 A;  4AQY Q;  1IBK L;  4XT1 B;  3SK6 A;  1J6Q A;  1NUC A;  3DM3 A;  2LKV A;  3O13 A;  2JA6 H;  2VUM G;  3D4W A;  3HGB A;  3STB C;  4MNO A;  1TY0 A;  1DGS A;  1LT3 D;  1YIT A;  1I6H H;  5LHY 1;  2B2V C;  5JJK A;  4LUZ A;  4OON A;  3CKI B;  4JYA Q;  2I5L X;  2L11 A;  1SYF A;  5AJ3 L;  4LF8 L;  1EZ8 A;  4K2L A;  3X3N A;  2UUC L;  2HQE A;  4NDX A;  4PMW A;  1HTP A;  3Q6S A;  4V0B A;  5KYL A;  3VDY A;  2PO4 A;  1HZ9 A;  4A3F H;  2SOB A;  1I4Q A;  2MP1 A;  2K32 A;  3GTO B;  1EQT A;  4JI3 L;  1XPR A;  2JQO A;  3RLO A;  1H9S A;  5C4H A;  4NXM Q;  1JJC B;  3RZD H;  1LLR D;  2JA8 G;  1STG A;  1Y1V H;  2XN9 C;  2C5C A;  2M2L A;  2R92 G;  1CK1 A;  1I3Q H;  1H95 A;  4XDX A;  4YWL A;  3CCM A;  2L12 A;  4GN5 A;  2E2J B;  1B53 A;  3I4M H;  2J0T D;  2NTS A;  3CF5 A;  1RJT A;  5IWA L;  1Q7Y C;  4LFA L;  2XNA C;  1PTO H;  4DR1 Q;  4FXK C;  3OPO A;  3PF4 A;  1K28 A;  2Q8I B;  2XWJ B;  3BYT B;  4AYB E;  3J80 c;  1STN A;  1VQ5 A;  1QB5 D;  1I6H B;  4OWW B;  5KIX A;  4S3S A;  3W1B A;  4RGN A;  2F4V Q;  2K04 A;  2IJ0 A;  4KV6 A;  1X3Q A;  4RHR A;  3PUY A;  1JC7 A;  2B2U A;  5I6Y A;  1A2T A;  4A3F B;  4C56 C;  4PQX A;  5CBA E;  4EX5 A;  3E0J A;  3T13 A;  4DV0 Q;  4N8F A;  4DKA C;  3MFG A;  4DV7 Q;  2DN8 A;  2F0E A;  1KDC A;  5C44 H;  5ELC A;  3RZD B;  3BYY B;  2F0V A;  1Y1V B;  3SHL A;  4GNX C;  2FJ2 A;  2KOL A;  4GNX B;  4RKL A;  2EE1 A;  4JPB W;  5C3E G;  4IUQ A;  3CCJ A;  4X65 Q;  5HGT A;  5JAV A;  2IW3 A;  1S40 A;  1D5M C;  3I4M B;  1STY A;  3Q8D A;  3Q22 A;  1PTO C;  1UAP A;  4LF6 L;  2CH4 A;  3NUC A;  5LMN W;  1JWM D;  5CR3 A;  2A73 B;  5FO8 B;  3CXC A;  3S15 H;  2E2I H;  4DK0 A;  4MHE A;  3TP8 A;  5FK9 C;  3HKZ B;  5FLX c;  1UEA B;  5FLX E;  1RKN A;  3QWN A;  3A8K E;  1PH2 A;  3M3Y H;  3ULP A;  3F2B A;  2JA5 G;  3K5L A;  2RDG A;  3QOL A;  1PFN A;  4B3M Q;  3PIO 3;  1KIX A;  1D6E C;  3T16 A;  5CGK A;  2QW7 A;  4DN4 M;  2L9H A;  2F0P A;  3I73 A;  4GKK L;  4A3B G;  3VYS A;  4QGU A;  2UXB Q;  3K7U C;  3HOZ H;  4DAY B;  3G6E A;  1EU4 A;  4M8A A;  5D65 A;  4KJO A;  2X6L A;  2HDM A;  1XXG A;  1OXS C;  3MZ5 A;  1EFI D;  5C44 B;  2D2C C;  4BY7 H;  3CPW A;  4N8X 1;  3S2D H;  2J4X A;  1CQV A;  3RUZ A;  1HPC A;  3CC2 A;  1FD7 D;  3SE0 A;  4C1N I;  3CCU A;  4DR4 L;  1NR2 A;  5E7N A;  2K4K A;  2PMZ E;  4LNQ A;  3BG3 A;  2LMC B;  2D0P A;  1PHJ A;  1F77 A;  1TII D;  2F0K A;  2D0O A;  4BY1 H;  1TS2 A;  1HTL D;  5I4D A;  4L5S A;  4K0K Q;  3FHW A;  4DV2 Q;  3S15 B;  2E2I B;  5LMU L;  4ALP A;  1O78 A;  3NEM A;  1XX8 A;  1V1Q A;  1X32 A;  4KMU C;  3M3Y B;  2O2L D;  2OQ0 A;  3MA2 B;  5M5X H;  2G9H D;  2I5H A;  3FPP A;  1K73 C;  3J80 L;  1DM0 B;  5EJW A;  4HIO A;  3DLL A;  4IUP A;  5C4Z A;  1HZA A;  1QIL A;  2N88 A;  2UXD Q;  5CBE E;  1E2Z A;  3H0G H;  2NN6 G;  1NSN S;  1SMY D;  2K7V A;  1VQD A;  1CFM A;  3A55 A;  3I2Z A;  1VQ7 A;  4C3I H;  4K8I A;  3K5M A;  1S5D D;  3HOZ B;  4B3R L;  4IFD J;  1MBY A;  1BBU A;  5FJ8 H;  1BCP B;  1I4G A;  4HJ7 A;  4JI1 L;  4UAI A;  4BY7 B;  2EYP A;  1Q86 C;  2UUA L;  4IPG A;  1VQH A;  1KD1 C;  4LF9 L;  1GVP A;  5FLM H;  2KJX A;  1D5X C;  1YJN A;  2UUB Q;  3TS2 A;  5M3M H;  1JE4 A;  4JCV E;  1GO3 E; 
#chains in the Genus database with same CATH homology
 2QGQ A;  4GOP C;  1L1O C;  1CKO A;  2R6G A;  3HOU G;  3OTO Q;  1NMG A;  3A74 A;  3CAM A;  4IFD G;  5JEA G;  4GOP B;  1HNX Q;  1L1O B;  4PZ7 A;  3PIP A;  1S72 A;  1HZB A;  2MNA A;  1VQJ A;  1XNQ Q;  2K5N A;  1N32 Q;  1LYL A;  3CW2 C;  3UDG A;  3NBH B;  3G48 A;  5J3B A;  1C7Y A;  1VQ9 A;  4EQ5 A;  1XPU A;  1QVC A;  2VQE L;  4LF6 Q;  1X3E A;  2D62 A;  1NBW A;  1XNR Q;  1LTL A;  1XJV A;  3I4N G;  4OXP A;  3E9I A;  2UU9 L;  4L5Q A;  1T9H A;  3PF5 A;  1EQR A;  2JJQ A;  5BR8 Q;  4OO1 G;  3JAM i;  2A19 A;  1B7Y B;  4J15 A;  4YY3 L;  1KC8 C;  3U50 C;  3NEL A;  4TQU S;  4JC0 A;  2Y0S G;  1YEZ A;  4X62 L;  3T1H L;  4B3S L;  1QVF A;  4PG3 A;  1TWH H;  1UE5 A;  4A3I G;  4WJ3 M;  2GVB A;  3UDI A;  2YTV A;  1N36 L;  3PO2 H;  3J7A 5;  4P72 A;  2ID0 A;  3JAM c;  1VQA A;  1HNW Q;  2PI2 A;  5M3F H;  2K5H A;  4QJF A;  1VQE A;  4R1J A;  3HKZ E;  1E3P A;  1SR3 A;  1VCI A;  3M4Q A;  4GS3 A;  3RR5 A;  4HJ8 A;  4A3C H;  2MQH A;  2NVQ H;  2YYZ A;  1N33 L;  2R93 H;  2KHI A;  1J5E Q;  3PO3 G;  1IBL Q;  5GRO A;  2RCN A;  4GKK Q;  3K0X A;  1OXU A;  4A3F G;  3GD7 A;  4A3D H;  1A63 A;  3PUZ A;  4NXN Q;  4LFB Q;  2ZTD A;  2ZM6 L;  4DUZ L;  2KEN A;  3T1Y L;  2F3I A;  4AQY L;  4YWK A;  1C9O A;  4DV3 Q;  1X54 A;  4A3M H;  4POG A;  3K80 C;  4IPC A;  4RG1 A;  3S14 H;  1XPO A;  3TS0 A;  2JEB I;  1X56 A;  3MEF A;  4DAM A;  2VQF L;  1OXV A;  3ERS X;  1IBM L;  3GTG H;  3ICE A;  1QUQ A;  2E2H H;  1AH9 A;  2UXC Q;  3BZC A;  1P16 A;  1Y1V G;  2F52 A;  3B6Y A;  3HOV H;  3S16 H;  2AMC B;  4DR4 Q;  3M85 A;  1KRT A;  4JBJ A;  1PA6 A;  3OW2 A;  3S17 H;  1IL2 A;  4KHP Q;  4X66 L;  2KHJ A;  4KLK A;  4BY1 G;  3S2H H;  4C3J H;  5C0X I;  3U4V A;  3HOX H;  2AWN A;  5HY6 A;  4UP8 A;  1L2F A;  1PYB A;  4FDB A;  1EQQ A;  4L5R C;  4BBS H;  1Q81 C;  2BH8 A;  3S1R H;  3I4M G;  3E9H A;  2VUM H;  3PUX A;  4JYA L;  4LFC L;  5GQO A;  4A3L H;  4H02 A;  2B63 H;  1WOC A;  2LXK A;  4B3T Q;  4JI0 L;  2RHS B;  3RZO H;  4DR7 Q;  1YJ9 A;  5LMU Q;  1EWI A;  2AHO B;  5IYB H;  4DV4 Q;  4JOI C;  2E5L Q;  1PH4 A;  5EAY A;  5C4J H;  2KBN A;  3D0F A;  1I50 H;  3HOY H;  2JE6 I;  1TWF H;  4MTN A;  2B29 A;  1Y1W H;  1VQC A;  2HIV A;  1NMF A;  5IP7 H;  4DR2 Q;  4O2D A;  3GTP H;  2YTX A;  1EOV A;  1IXR A;  3GDE A;  3H0G G;  2IHF A;  4NPS A;  4DUY L;  4DR3 Q;  2Z6K C;  1X6O A;  2QA4 A;  4A76 A;  3S1Q H;  1PH6 A;  2NVT H;  4WJ4 A;  1HZC A;  1EIY B;  2HHH Q;  1X55 A;  1Q8K A;  5ELN A;  4X64 Q;  4NXM L;  1IYJ B;  3FKI G;  4QL5 A;  4A3G H;  4OX9 Q;  4DV5 Q;  2AWO A;  2MO0 A;  1KAW A;  2CFM A;  5FJ8 G;  3U58 A;  2EIF A;  4UP9 A;  2IY5 B;  2K52 A;  4JBW A;  1Y14 B;  4JI4 L;  4JG2 A;  3CCV A;  3A0J A;  3MXN B;  1Q12 A;  1L0W A;  2N78 A;  2JA8 H;  4GKJ Q;  1SRO A;  4LWC A;  1V43 A;  2R92 H;  2QEX A;  4JI8 Q;  5FLM G;  3CCE A;  1XMO L;  4BA2 I;  4B3R Q;  4GKJ L;  2Y0S E;  3AQQ A;  2DGY A;  4IJH A;  1AE3 A;  4QY7 A;  4DR1 L;  4JI1 Q;  1MIU A;  4UP7 A;  4A3J H;  1SFO H;  5C0X J;  3UE0 A;  5M3M G;  3I56 A;  2UUA Q;  1BBW A;  3PCO B;  2VW9 A;  3STB D;  1K83 H;  2JA7 H;  4DV1 Q;  4TVA B;  2HIX A;  4XIG S;  1KRS A;  1W2B A;  4LF9 Q;  2LSS A;  1K3R A;  2OQK A;  1C0A A;  1O7I A;  1SRU A;  2XTI A;  4A3E G;  2NVX H;  3CC4 A;  3PGZ A;  1WCM H;  3M4O H;  2N49 A;  3PSI A;  2VNU D;  3RLN A;  1VQG A;  4A4I A;  1TWA H;  1UE1 A;  1LUZ A;  4L5T A;  2IT1 A;  4BXX G;  5IYC H;  1M1K C;  4GLA C;  4R4T A;  4A75 A;  2F4V L;  4JBM A;  4P75 A;  4BA1 I;  4JI2 L;  2Q2U A;  4LF5 L;  5H1S E;  4IPH A;  2VY3 A;  2MO1 A;  5C0X G;  1W3S A;  4BBR H;  1YIJ A;  3A5U A;  4YWM A;  4JI5 L;  5M5Y H;  2BA1 A;  2H5X A;  2VQE Q;  3RNU A;  3CCR A;  4QQB X;  1RIP A;  1BKB A;  3J81 i;  1I5F A;  3S24 A;  1JB7 A;  2EXD A;  2UU9 Q;  1EIF A;  3KDF A;  3UDF A;  1N34 L;  1MKH A;  3E0E A;  3K7A H;  4DV0 L;  2YU9 H;  4YY3 Q;  4DV7 L;  1SLJ A;  2I5M X;  2WAQ G;  4A93 G;  3AYH B;  4P74 A;  3GTM H;  4X62 Q;  2Q2H A;  3T1H Q;  4B3S Q;  3GTO H;  4IO9 A;  1FJG L;  1VQO A;  4A3C G;  3SGI A;  4DR6 L;  2OTL A;  2Z0S A;  2R93 G;  2NZO A;  1OXT A;  2NZH A;  1UEB A;  4A3K H;  4AYB G;  1N36 Q;  3HOW H;  4A3D G;  4APV A;  2C35 B;  2CQO A;  2RF4 A;  4X65 L;  1VQK A;  4R4Q A;  1VS0 A;  1VQM A;  1VQ6 A;  4YCV A;  3U4Z A;  3H3V H;  3HOZ G;  1NE3 A;  1QUQ B;  1N33 Q;  4YHH L;  1YNX A;  1B70 B;  5IY0 A;  5DLQ E;  1VQ4 A;  2ZJR A;  1MJC A;  5C3E H;  1R9T H;  2K5V A;  3CP0 A;  1MJE A;  2E2J H;  4BY7 G;  2ZM6 Q;  2PQA A;  2Q2T A;  4DUZ Q;  4GOP A;  1E7Z A;  3T1Y Q;  4YCW A;  4GNX A;  1EYG A;  4AQY Q;  1AE2 A;  1PFS A;  4PZ6 A;  3CMA A;  1IBK L;  1OXX K;  3ULL A;  4JI7 L;  3I4N H;  1QZH A;  1EFW A;  1J6Q A;  3HOX G;  2VQF Q;  3UE1 A;  3TRZ A;  5GAH C;  1CUK A;  3DM3 A;  1IBM Q;  2JA6 H;  1K8A C;  3HFZ B;  3J7Z C;  4BBS G;  1FL0 A;  2VUM G;  3STB C;  3K8A A;  3TRE A;  3RN2 A;  4MNO A;  4R4I A;  4B3M L;  4X66 Q;  3G71 A;  3BJU A;  4Y7N H;  1XMQ L;  1DGS A;  4KHZ A;  2HT1 A;  1YIT A;  1I6H H;  4DV6 L;  1HR0 L;  2ZJQ A;  3GTL H;  1X65 A;  1ASY A;  5IYB G;  5JJK A;  1UWV A;  4LUZ A;  1Z47 A;  4OON A;  1M90 C;  2JA5 H;  3HKS A;  1FGU A;  4DPG A;  1OTC A;  4JYA Q;  4LFC Q;  2ASB A;  2I5L X;  3HOY G;  3OYY A;  2UXB L;  1JMC A;  4JI0 Q;  1Y1W G;  1SE8 A;  5AJ3 L;  2ZTE A;  4LF8 L;  4JV5 L;  1NY4 A;  2WP8 J;  5IP7 G;  5HGQ A;  1PV4 A;  2UUC L;  1GD7 A;  4PMW A;  1JJG A;  3VDY A;  3CCS A;  1KXL A;  3FP9 A;  2RHQ B;  1UE7 A;  1HZ9 A;  1CKN B;  4A3F H;  4JI6 L;  4DNI A;  4A3B H;  4R4C A;  2N3S A;  1WJJ A;  3H3V I;  1G29 1;  2IX0 A;  4AH6 A;  4POF A;  1HH2 P;  2ES2 A;  1E1O A;  4JI3 L;  5IP9 H;  1XPR A;  4DUY Q;  2JQO A;  3RLO A;  3AEV A;  2HQL A;  1QVG A;  4NXM Q;  1JJC B;  3RZD H;  3RLF A;  1U0L A;  1A8V A;  2JA8 G;  4X6A H;  1Y1V H;  3W1G A;  5K36 G;  2R92 G;  3W5O A;  1H95 A;  1I3Q H;  5C4X H;  2R7D A;  4P73 A;  4YWL A;  2JA9 A;  3GTJ H;  3CCM A;  4OWT B;  1G51 A;  4A3J G;  3F1Z A;  1Q1B A;  3I55 A;  4JI4 Q;  4GN5 A;  1HR0 W;  1S3O A;  1YHQ A;  4K0K L;  2I0Q A;  3J80 i;  2OCE A;  1HNZ Q;  2JA7 G;  4DV2 L;  2B3G A;  1VQP A;  2WAQ E;  1Z9F A;  3I4M H;  2WFW A;  1XMO Q;  2AKW B;  3CF5 A;  1HNZ L;  2OWO A;  1PH1 A;  4LUV A;  5IWA L;  4HJ9 A;  1JT8 A;  4KI0 A;  1Q7Y C;  4LFA L;  1PH7 A;  4IJL A;  1WCM G;  4DR1 Q;  1QZG A;  3PF4 A;  1ASZ A;  2KCT A;  4O0A A;  4AYB E;  4NB3 A;  4DR5 L;  3J80 c;  4C3H H;  3K81 C;  2VZA A;  1CSQ A;  1D8L A;  3KF6 A;  5GAE C;  3UDX A;  4LF4 L;  5IT9 c;  1VQ5 A;  5JJI A;  2CWA A;  2MFI A;  4JOI A;  3RN5 A;  4OWW B;  2UXD L;  1B8A A;  3W1B A;  1LM0 A;  2GN5 A;  3IRB A;  2F4V Q;  1XTD A;  3H15 A;  3PV0 A;  4JI2 Q;  4LF5 Q;  2A1A A;  3FKI H;  5LMN L;  3A5Z B;  4LF7 L;  3AFQ A;  2ZTC A;  2KCM A;  3PUY A;  3ZJY C;  1A0I A;  1YVC A;  4JI5 Q;  5IYD H;  2R7F A;  1SMX A;  1Q46 A;  1VQI A;  1TXY A;  1E22 A;  4EX5 A;  1N34 Q;  1FVI A;  1KHI A;  4DV0 Q;  2K14 A;  4DKA C;  2WB1 G;  1TWG H;  2K75 A;  4DV7 Q;  1K8G A;  3HOW G;  3S1M H;  2Q2I A;  2K50 A;  5C44 H;  3ULJ A;  4LW1 A;  3PO2 G;  1YI2 A;  3J81 j;  2R7Z H;  1RL2 A;  1I94 Q;  3KJO A;  2UUB L;  1FJG Q;  5M3F G;  2VS1 A;  2LXJ A;  3S1N H;  4DR6 Q;  4GNX C;  1JJ2 A;  2PNH A;  3F2C A;  2PQA B;  2CCZ A;  3J81 c;  1GM5 A;  4GNX B;  3OTO L;  4A3E H;  1NJI C;  1HNX L;  1WI5 A;  2PI2 E;  5C3E G;  1VQL A;  3CCJ A;  3GTQ H;  2BH2 A;  4X65 Q;  1N9W A;  1K9M C;  1XNQ L;  1S40 A;  2DUD A;  1N32 L;  4BXX H;  1X3F A;  3GO5 A;  3NEN A;  3I7F A;  2VL6 A;  4YHH Q;  3Q8D A;  4LF6 L;  3M9B A;  4IPD A;  4A3M G;  1XNR L;  3HOU H;  2L15 A;  5LMN W;  4Y52 H;  1YHA A;  3CD6 A;  3F8T A;  2JA6 G;  3WWV A;  3KOJ A;  3CXC A;  3S15 H;  5BR8 L;  2E2I H;  1IBK Q;  3KJP A;  4JI7 Q;  1L1O A;  1WYD A;  3AFP A;  5FLX c;  3L0O A;  5GAG C;  1PH2 A;  3M3Y H;  3CQZ H;  1VQB A;  3ULP A;  3EN2 A;  3F2B A;  2JA5 G;  1P8L A;  2NN6 I;  4A93 H;  3LGJ A;  4RMF A;  4B3M Q;  1KIX A;  1HNW L;  1XMQ Q;  3EBE A;  1HJP A;  4A3L G;  1U5K A;  2NVY H;  4GLX A;  4DV6 Q;  1HR0 Q;  2B63 G;  2A8V A;  1K0R A;  1PH8 A;  1YBY A;  2EQS A;  1YHB A;  3KFU A;  4LUO A;  4A3I H;  1EUJ A;  2JEA I;  1J5E L;  3KLW A;  1IBL L;  4A3B G;  4GKK L;  1UE6 A;  2N8N A;  4QGU A;  4GN4 B;  3K7U C;  4HID A;  2UXB Q;  4NXN L;  5AJ3 Q;  4LF8 Q;  1N8R C;  4JV5 Q;  4LFB L;  1Q82 C;  2UUC Q;  3HOV G;  3HOZ H;  2ALY B;  1PVO A;  4DAY B;  3G6E A;  3L7Z C;  5IP9 G;  4DV3 L;  4HJA A;  4JI6 Q;  3PUW A;  1YJW A;  1OXS C;  3PO3 H;  1D7Q A;  1PH3 A;  4JBK A;  3CPW A;  4BY7 H;  3S2D H;  2ZJP A;  1X9N A;  3CC2 A;  5C4X G;  1JE5 A;  2UXC L;  4A3G G;  4IOA A;  3CCU A;  4IFD I;  4JI3 Q;  4DR4 L;  5E7N A;  2K4K A;  1KL9 A;  2PMZ E;  4AIM A;  4KHP L;  5ELO A;  4LNQ A;  4IOC A;  2JK8 A;  2OTJ A;  2FXQ A;  3BZK A;  2CKZ B;  2GVA A;  2D0P A;  1G6P A;  2IHE A;  3PIO A;  1PHJ A;  2BA0 A;  1PH5 A;  2D0O A;  4HIM A;  4BY1 H;  1TWC H;  4B3T L;  4OO1 I;  3CPF A;  3KF6 B;  4OWX B;  3TQY A;  5GAD C;  4L5S A;  4K0K Q;  4DR7 L;  2WB1 E;  3FHW A;  4DV2 Q;  3HKZ G;  5LMU L;  4ALP A;  3M4P A;  4DV4 L;  4C2M H;  5JJL A;  3I4O A;  2E5L L;  2ATW A;  5IWA Q;  4LFA Q;  3NEM A;  1PH9 A;  4MZ9 A;  1GKH A;  1V1Q A;  4YCU A;  1CKM A;  3KYH C;  3PUV A;  5IE8 A;  3G4S A;  2V1C C;  2OQ0 A;  4P71 A;  4DR2 L;  5M5X H;  1IZ6 A;  2I5H A;  1E24 A;  4DR5 Q;  3CC7 A;  1K73 C;  1I94 L;  5IYC G;  4DR3 L;  4LF4 Q;  1WFQ A;  4PZ8 A;  1PYS B;  3KF8 B;  4HJ5 A;  4QIW E;  2HHH L;  4DK3 C;  2YTY A;  4X64 L;  4HIK A;  1VQ8 A;  1CKN A;  2YV5 A;  4HIO A;  1VQN A;  1YZ6 A;  3DLL A;  4OX9 L;  1Q1E A;  4DV5 L;  3CME A;  1HZA A;  1NTG A;  1CSP A;  3CCL A;  1A62 A;  4BBR G;  4UPA A;  5IYD G;  2UXD Q;  3BU2 A;  3KDF B;  3H0G H;  3CCQ A;  2NN6 G;  3ER0 A;  3L2P A;  5LMN Q;  1VQD A;  3I2Z A;  4LF7 Q;  4GLV B;  1VQ7 A;  4C3I H;  3M7N A;  1V9P A;  3GTK H;  2E8G A;  2XGT A;  4B3R L;  4JI8 L;  4IFD J;  5JEA J;  5C44 G;  1BBU A;  1E1T A;  2Z6K A;  4R4O A;  3TEH B;  5FJ8 H;  4GN3 B;  1X3G A;  4JI1 L;  4HJ7 A;  2R7Z G;  1KQS A;  1Q86 C;  2UUA L;  4IPG A;  3D31 A;  1VQH A;  5M5W H;  1KD1 C;  4DV1 L;  4LF9 L;  1GVP A;  4ME3 A;  5FLM H;  2IX1 A;  4UY8 C;  1SN8 A;  3F2D A;  3EIV A;  4A3K G;  1VQF A;  2CWP A;  4DK6 C;  1BVS A;  4XTC S;  1YJN A;  2UUB Q;  3JC6 6;  3TS2 A;  5M3M H;  4JCV E;  1GO3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...