4LFBL

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 10
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfbL00
1HNZL 3I4NH 1GO3E 4LF4Q 1OXTA 3K0XA 1S3OA 2JA8H 3UDXA 4POFA 1NY4A 3RLOA 4B3RL 1YJ9A 4KHPL 1VQDA 1A0IA 3H0GG 3CP0A 1X55A 5C0XG 2VQFL 4AQYL 1KXLA 4A3IG 1A62A 1PV4A 2R7ZH 1VQPA 1XPRA 3HOUH 4LFAL 1LTLA 1WI5A 5LMNQ 3U50C 1W2BA 3S2DH 1UE1A 1VQJA 1CUKA 1CKMA 1U5KA 1Q1BA 2EQSA 1JJGA 4A3CG 1B70B 4JC0A 1HZBA 2AKWB 1VQBA 3RLFA 5M3MH 4FDBA 3CC7A 4DR1L 4A3FG 2JA7G 4IFDG 5K36G 2JEBI 2UXDQ 2IX1A 4YWMA 1ASZA 4DR6L 2K4KA 2KENA 3E9HA 2CWAA 5EAYA 4WJ3M 1E1OA 2WAQE 4EQ5A 4LF9Q 4IOCA 4LUZA 1V1QA 4L5TA 1HNXL 1E24A 2XTIA 4B3TL 1IBML 4OX9Q 1OXSC 4GOPC 2HIXA 2B29A 2WP8J 4A3MG 4IO9A 1K3RA 4IJHA 4JCVE 4DV0Q 4DUZL 1L1OB 1RIPA 2UUCQ 4A3JH 3STBC 2D62A 1Q12A 3KF6A 1VS0A 4LFCL 5JJIA 4KLKA 3M7NA 2RHSB 1YITA 2B63G 4HIOA 2OCEA 4P71A 4A3IH 3I2ZA 4UP9A 1EYGA 4GNXB 4DR2L 5LMUQ 1X3EA 4YCVA 2UUAQ 4IPDA 4JI5Q 2B63H 3GTGH 3I4MH 2RCNA 1EOVA 2JE6I 3PF5A 2E2JH 1X56A 1XPOA 5IWAL 1J6QA 1SFOH 4LF8Q 3CPFA 3CD6A 2A1AA 5LMNW 3GTQH 3TS0A 3HOWH 3I7FA 5IT9c 3K7AH 3T1YL 4A3MH 4DR7L 1E22A 4BBRH 1W3SA 4APVA 4P75A 3CPWA 5DLQE 4OWXB 4JI3Q 1VCIA 5IP9G 2BH8A 2ZTEA 3HOVH 1QVCA 4DR4Q 5JJLA 1PH6A 2HQLA 4DV0L 2UUCL 1QVGA 3W1BA 1YJWA 2VZAA 3CQZH 4LF4L 4LUVA 5IYDG 2IHEA 1UE6A 2WFWA 1Z9FA 3ER0A 5E7NA 5IE8A 2NVQH 4DV2Q 4KI0A 4BY7H 5FLMG 3GTJH 4DV6L 3L7ZC 4ALPA 2R7ZG 1G6PA 4IPGA 2H5XA 2VY3A 4P73A 4KHZA 1K0RA 2Y0SG 2Z6KA 1Y1WG 2NVXH 4DV1Q 4OO1I 1TWHH 4GNXC 5C4XH 1QUQB 1VQGA 3AFPA 2Q2HA 3KJPA 4X64Q 3KJOA 4BY1H 5GROA 3EIVA 1Q46A 1N36L 3TEHB 1VQ8A 3T1YQ 2CFMA 1VQOA 4LF6L 1EIYB 2JA6H 4DAMA 5FLMH 3BZKA 1YI2A 4DR3L 3I4NG 1L1OA 1FVIA 2VW9A 1D8LA 4YCWA 2QEXA 2A8VA 2N3SA 1NTGA 3S15H 5GQOA 2F4VL 2K14A 3EBEA 4JOIA 4NPSA 2HHHL 2JEAI 2K5VA 4PZ6A 4LF9L 3F2CA 1XJVA 3NEMA 4JI6Q 4P72A 1MJEA 4A93H 2PQAB 4B3MQ 3K81C 3PUYA 3KDFA 1AH9A 2YYZA 5M5YH 4DV6Q 1QUQA 2BA0A 4DR4L 1S72A 3TREA 4NB3A 5C0XJ 4DUZQ 1HJPA 1C7YA 1Z47A 3ULJA 3J7A5 3S16H 2ASBA 1X54A 4O2DA 4X66Q 4GLXA 3TS2A 1GVPA 2KCMA 2I5LX 1J5EL 4GN4B 1TWCH 2V1CC 2A19A 4A3KG 1EQRA 2QA4A 2LXJA 2JA6G 1PYSB 2K5NA 4B3SQ 4HJ7A 2KHJA 3NBHB 4GN3B 3W5OA 4BY1G 2VS1A 3F2BA 2UXBL 3HOXG 4LF5Q 3GD7A 5C3EG 3J81c 3CCVA 5IY0A 1I50H 1Y1VH 5GAGC 2IHFA 4DUYL 3FHWA 1VQAA 1Q8KA 4LW1A 1YEZA 5IYCH 1BBUA 1WYDA 2ZM6Q 2I5MX 4A3KH 2HHHQ 4QQBX 4YHHL 5IYBG 3M4PA 1X6OA 5M5WH 4HJ9A 4GOPB 4B3ML 4JI8Q 4QIWE 1PH1A 3DM3A 3H3VH 4QL5A 4IOAA 2N78A 4C3IH 3KYHC 1N33L 2PNHA 1TWAH 3CCJA 3KF8B 3M4QA 1JMCA 1I3QH 4GNXA 3J81i 2R93G 4BA1I 5C4JH 1CSPA 1NMGA 2KCTA 1VQCA 1CKOA 3M9BA 1C9OA 1I94Q 1UWVA 4YY3Q 4JI2L 3PSIA 2GVBA 4X62Q 1VQKA 2UXBQ 1Y1VG 2AWNA 4QGUA 4OWTB 3ULPA 4X64L 1M90C 2Q2IA 1WJJA 2VNUD 3PO3G 3F2DA 2NN6I 1XNQQ 4BA2I 2OTLA 4BBSH 3UDFA 4JOIC 4DNIA 2JJQA 1GKHA 1QZHA 4X6AH 2UU9L 4C3HH 1YHQA 4DR3Q 3H15A 4DK3C 4A3GH 1IBLQ 3ERSX 1IL2A 3SGIA 1HH2P 3OTOL 1K8GA 4R4IA 3PO3H 1B8AA 3PUWA 3TQYA 2VQEL 1VQFA 4JI1L 1FGUA 4C2MH 1KQSA 4AIMA 4X65Q 5IYDH 3A5UA 1OXUA 4GKKL 4R4CA 3CC2A 4ME3A 3CXCA 1E7ZA 4HIMA 1JT8A 1PH9A 1PYBA 1L2FA 1JJCB 3F1ZA 1MJCA 3AEVA 3NELA 1WCMG 2KHIA 1EUJA 2N8NA 4NXNQ 1WFQA 3IRBA 4AYBG 5H1SE 4DV3Q 2E5LL 4JI0L 1VQNA 1LM0A 3KOJA 1N34L 3ICEA 1N32Q 3M85A 4BBRG 4DV5Q 1I5FA 2ZTDA 4JI4L 1NMFA 1LUZA 1HNZQ 3GTMH 1RL2A 4UP8A 1XMOL 4OXPA 1IBLL 3K80C 1TWGH 1UEBA 3AQQA 5J3BA 4DAYB 2HT1A 1Y14B 3S17H 2ZM6L 4KHPQ 1X3GA 1NBWA 1Q7YC 1XPUA 2MO0A 1PH8A 4RG1A 1CKNB 2VQFQ 2DGYA 1KL9A 1OXXK 4AQYQ 4AH6A 1EFWA 2JA8G 3S1NH 1VQLA 1HR0W 4BY7G 2YU9H 2VUMH 2PI2A 3CCSA 3PUXA 1PA6A 4A3DH 1N8RC 4A75A 1VQEA 2OWOA 3J80i 3UE1A 1HR0Q 3CMAA 4LF7Q 4K0KL 3CMEA 2MQHA 2BA1A 5AJ3L 2UXDL 5GAEC 4LFBQ 2ALYB 4DR6Q 4JI0Q 2QGQA 1IBKQ 3CAMA 2I5HA 5M5XH 1N34Q 4A3EG 1HNWL 1OTCA 2ATWA 4DV5L 1EIFA 4JI2Q 4EX5A 4YY3L 4A76A 4JI4Q 2JA5H 3PUVA 1XNRQ 3GDEA 3VDYA 1XMQL 1PHJA 3FKIG 2F4VQ 4WJ4A 4A93G 5C44G 2AMCB 3LGJA 4PG3A 4BXXH 2IT1A 2DUDA 1JE5A 1ASYA 5M3MG 1X3FA 4A3FH 1YHAA 4XIGS 1D7QA 2CQOA 2LXKA 1IBMQ 4OX9L 3J7ZC 5IYCG 1NJIC 3H3VI 1DGSA 1KRSA 4R4OA 4R1JA 2VUMG 1V9PA 3HOUG 3AYHB 4Y7NH 4L5SA 1BVSA 1FJGQ 1L1OC 5GADC 1M1KC 2Y0SE 1KHIA 5JJKA 3A5ZB 2D0OA 3G4SA 4K0KQ 4LF8L 2UUAL 4JYAQ 4TVAB 3RZOH 4LFBL 2ZTCA 3DLLA 3HKSA 2R7DA 3RZDH 4LFAQ 2NZOA 5IWAQ 2R92H 5LMNL 2MO1A 3FKIH 5JEAJ 1UE5A 2VL6A 3KF6B 3G6EA 3S1QH 2MFIA 3KFUA 3FP9A 4IPCA 1Q1EA 2NZHA 4MTNA 4GS3A 3M3YH 5M3FG 3HOYH 2NVTH 3D0FA 1GM5A 4GLAC 3KLWA 1Q86C 1VQ9A 2YTYA 4AYBE 1HNXQ 2WB1E 4DK6C 3HOYG 3TRZA 3A0JA 4JBKA 2ID0A 1PVOA 3PIPA 3D31A 5IP7G 4OONA 2AWOA 2MNAA 3RLNA 2R92G 1KAWA 4DV2L 2I0QA 3HOWG 4DV1L 1CSQA 1SRUA 2UXCQ 3S1RH 1QZGA 3H0GH 3S2HH 1PFSA 1HZ9A 3I4MG 2OTJA 4R4QA 4LFCQ 4YCUA 4DR2Q 1Y1WH 4A3JG 1N36Q 1FL0A 2RHQB 4A3BG 1YIJA 1CKNA 5LMUL 4LF6Q 1HZAA 3W1GA 2ZJPA 4TQUS 3EN2A 4MNOA 2CWPA 2OQKA 3CCMA 4O0AA 2K75A 4DV7L 1PH2A 2LSSA 3A74A 4J15A 1XNRL 3BZCA 1XMQQ 4A3LG 4DR7Q 1HZCA 4BXXG 3MXNB 3GTKH 2PQAA 3RR5A 4HJAA 4YWLA 3PO2H 3KDFB 1WCMH 5HY6A 1VQIA 3U4ZA 4JBJA 4JI3L 1KRTA 5FLXc 5M3FH 2JA5G 1C0AA 4LNQA 1MKHA 1E3PA 1I6HH 2E8GA 2HIVA 1PH5A 2UXCL 1VQHA 3CCLA 4A3DG 3OW2A 1QVFA 1OXVA 1FJGL 1A8VA 1MIUA 3I4OA 1VQ4A 5ELOA 1V43A 5FJ8G 4B3SL 4A3BH 1IZ6A 2EXDA 2R6GA 1X9NA 4OWWB 4HJ8A 2GVAA 2PI2E 4NXML 1BBWA 2OQ0A 4L5QA 1PH7A 2EIFA 4A3GG 2CKZB 5C4XG 2F3IA 3PV0A 4PZ8A 1X65A 4Y52H 1BKBA 4XTCS 5BR8L 4JV5Q 3ZJYC 4YHHQ 2K5HA 4P74A 4DUYQ 4DR5Q 5FJ8H 4L5RC 1O7IA 1B7YB 2K50A 3F8TA 3K7UC 1SROA 4GLVB 4PMWA 3M4OH 2RF4A 4PZ7A 3JAMc 1VQ5A 4JI8L 4C3JH 4JI6L 1U0LA 3S24A 1KIXA 4GKJQ 3ULLA 3RN2A 4DKAC 3HOVG 3S14H 3PO2G 2B3GA 4DV4Q 2YTXA 1VQ7A 4JG2A 4GN5A 4JI7Q 2JK8A 2D0PA 2ZJRA 2NN6G 2Z0SA 1IXRA 1YHBA 5IYBH 2NVYH 3G71A 1N9WA 1VQMA 3CC4A 4YWKA 1SE8A 1WOCA 2FXQA 3HKZE 1SMXA 1J5EQ 1K83H 3CCEA 3HOZH 1JJ2A 2KBNA 3BJUA 3BU2A 1XNQL 4X66L 5C3EH 3AFQA 5C0XI 3E0EA 4UPAA 2UUBL 4JBMA 4JV5L 1G291 4QJFA 4DR5L 4LF5L 2BH2A 5JEAG 2ES2A 1JB7A 3Q8DA 2ZJQA 2WB1G 4IJLA 3E9IA 3HOXH 3RNUA 3NENA 4B3RQ 4DV7Q 4R4TA 4IPHA 4BBSG 2AHOB 2JA9A 1EQQA 3UE0A 4IFDJ 4GKJL 5IP7H 1EWIA 3J81j 3T1HL 1P16A 3PF4A 1IYJB 1TWFH 4JI1Q 3PIOA 5C44H 2N49A 2E2IH 4X65L 3CCQA 1H95A 3UDIA 3CW2C 3GTLH 1Q82C 1R9TH 1N33Q 5HGQA 4GKKQ 3STBD 1T9HA 2E2HH 2Q2TA 4NXNL 5ELNA 5IP9H 2E5LQ 1SLJA 2YV5A 4HJ5A 4A3EH 3CF5A 1YZ6A 4LUOA 3U4VA 1YJNA 1PH4A 2XGTA 3K8AA 4DPGA 2PMZE 4X62L 1L0WA 3B6YA 4DV3L 1N32L 4A3CH 3HKZG 1I94L 2C35B 3J80c 4NXMQ 1SR3A 3UDGA 1NE3A 3GTOH 3WWVA 1K8AC 4LWCA 4B3TQ 1YNXA 1XMOQ 5BR8Q 1KC8C 2Q2UA 2R7FA 1P8LA 3PUZA 3JAMi 1A63A 1S40A 2L15A 4HIDA 3T1HQ 1SN8A 2Z6KC 2UU9Q 4H02A 1AE2A 3HFZB 2F52A 4UY8C 2CCZA 1XTDA 3OTOQ 4GOPA 1KD1C 3PCOB 1Q81C 2YTVA 1HR0L 2WAQG 2VQEQ 3GO5A 5AJ3Q 1AE3A 4MZ9A 3MEFA 3CCUA 1GD7A 3U58A 4JI5L 1PH3A 2GN5A 4OO1G 4LF7L 4POGA 4DV4L 5GAHC 3HOZG 3GTPH 1HNWQ 4JI7L 1VQ6A 1YVCA 4RMFA 2R93H 1TXYA 1IBKL 4JYAL 3I55A 3L2PA 1K9MC 1YBYA 3OYYA 4A4IA 3PGZA 4DR1Q 2IY5B 3RN5A 2JQOA 1K73C 4IFDI 4QY7A 1UE7A 1G51A 2JA7H 4JBWA 4A3LH 3JC66 4UP7A 4HIKA 2IX0A 3G48A 2UUBQ 3L0OA 1E1TA 2K52A 1LYLA 3CCRA 3S1MH 3I56A
chains in the Genus database with same CATH superfamily
3I4NH 1EZ6A 2EYPA 4B3RL 1QJOA 4C3HG 1VQDA 3BS1A 4FF2A 1HTPA 1X55A 1KXLA 1VQPA 1SAPA 1LTLA 5LMNQ 1Y8OB 3U50C 4UHVA 2EQSA 1CKMA 4YIJA 1Q1BA 1DYQA 2B2VA 5EBCA 1BNZA 1B70B 4A3CG 4JC0A 2AKWB 1LT5D 1VQBA 3H09A 3CC7A 2UXDQ 2IX1A 2K4KA 3I73A 2SNSA 4CDDC 2CWAA 2ZXRA 1F2MA 4ME5A 3SK6A 2SDFA 4L5TA 1HNXL 4B3TL 2F0JA 4KJNA 3T53B 4GOPC 2WP8J 4DV0Q 1L1OB 1XWEA 1SJHD 4O42A 1Q12A 2NTTA 5JJIA 4TSSA 4UDUC 1QB5D 3C46A 1YITA 1X3EA 2B63H 1ILQA 3GTGH 1U9RA 1EOVA 5CBAE 3GV6A 5JAVA 1DCZA 2J0TD 2LS01 2Z6BA 1X56A 1V1PB 1QWYA 3T1YL 3K7AH 3HZXA 2ZXOA 4A3MH 4DR7L 1E22A 4EQPA 4PMBA 1VMPA 4B08A 3CPWA 2MUYA 2F3WA 3I70A 3HOVH 1RTOA 3W1BA 4FF3A 4QCLA 4QIWB 1UE6A 4ZQ3A 3ER0A 1FR3A 2A73B 4BY7H 3W2DA 2F0PA 2H5XA 2FMCA 4KHZA 1K0RA 3T56B 1Y1WG 2NVXH 1TWHH 3R2IA 4A3IB 5C4XH 3K0YA 1VQGA 1SYFA 3KJOA 5KRUA 1Z7TA 1K3BC 3T1YQ 2CFMA 1LV9A 2NB0A 1EIYB 5FLMH 2Z9HA 1SE3A 3SXHA 1YI2A 1SSOA 1II3A 1RDPD 4DR3L 3IAYA 2RBMA 1L1OA 5TSSA 4YCWA 2A8VA 5CYUA 4N8FA 3GV3A 1JOKA 2M2LA 4JOIA 3J7AV 3VR6A 2JEAI 4PZ6A 4LF9L 5CV6A 4CJ0B 4FF1A 2D2CC 4B3MQ 3K81C 3PUYA 3KDFA 1AH9A 4RH6A 2BA0A 1SMYC 1C7YA 4NB3A 3SE0A 2EY5A 2NVQB 4O2DA 4GLXA 3TS2A 2I5LX 1YNJD 5M9OA 2B2VC 2EE1A 3NBHB 2J4XA 1WVLA 1SNQA 5I2YA 5JVH3 1SNDA 1Y8NB 1VQAA 1Q8KA 5IYCH 1YEZA 4WJWA 2F4VQ 1WYDA 2ZM6Q 4YHHL 5IYBG 3Q6SA 2F0EA 3MXUA 4HJ9A 4GOPB 3NTHA 2QDBA 4C3IH 3KYHC 1N33L 3QOJA 3CCJA 2X6LA 1ICWA 1TQOA 3QJYA 4DAVA 5C4JH 4ZUIA 3A8KE 3BYYB 1NMGA 5DAUA 1CKOA 3M9BA 1UWVA 2KECA 3BZDB 2AWNA 4OWTB 3KLSX 4X64L 2VNUD 1DZ1A 3F2DA 5EKIA 1IW7C 4JOIC 2JJQA 3P20A 1GKHA 4EQOA 1ZEQX 4X6AH 4K8JA 1YHQA 1I4XA 1K8MA 3E5SA 2QF7A 5KNBA 4G7OC 1IL2A 4IUVA 4R4IA 2RCFA 3QIAA 1B8AA 3PO3H 4A3DB 2E2IB 5BN4A 1JR0D 3NUCA 3GTLB 5IYDH 2BE5D 2DN8A 4HIMA 1PYBA 1F9PA 3S1RB 1JJCB 1Y1WB 4M8AA 3AEVA 1EUJA 1PRTB 2K03A 2NWGA 4JI0L 1VQNA 1N32Q 3DEOA 3M85A 2ZTDA 2JA6B 3H3VC 1LUZA 2A69C 1RL2A 1XMOL 3S1MB 1TWGH 2HT1A 4K5WA 4IUUA 2R7ZB 2ZM6L 1PH8A 1BDOA 4AQYQ 1EFWA 1KL9A 3J81E 1S4ZA 3S1NH 5KNCA 2J7ZA 4CJ1B 2MGSA 3PUXA 4HCEA 1N8RC 4A75A 1CI3M 4K0KL 3CMEA 2MQHA 3GTPB 5AJ3L 5GAEC 4LFBQ 1CHPD 3CAMA 2I5HA 2O2LD 4A3EG 1OTCA 1EIFA 5I6YA 3VDYA 1XMQL 4WJ4A 3FKIG 4ZKCB 4NMZA 1O78A 3LGJA 2IT1A 2CH4A 2N55A 4A3FH 1X3FA 1BUVT 4OX9L 1NJIC 1DGSA 5C0XH 1V8QA 5L37A 1MD2D 2WACA 5CMDA 3X3MA 1NNXA 1BVSA 4DF7A 4JVZA 2EZVA 3H91A 4L63B 2F0KA 4J1MA 4LF8L 2XRSD 4TVAB 4KMUC 1KDAA 1EIHA 4QMGA 4LFAQ 1HCZA 5CORA 1STYA 2R92H 2MO1A 3KF6B 2VXWA 4EQNA 2E74C 4IPCA 4MHEA 3GTOB 1LTID 1CT1D 2KOLA 5JPNC 1DONA 3KLWA 3OOCA 4OELB 3T13A 4C3IG 3J81L 1EY8A 3IKJA 2YTYA 4AYBE 3OSOA 4N9TA 3A0JA 5G3LF 4JBKA 2K1BA 4ZYSA 3PIPA 3D31A 2CQAA 3OIPA 2AWOA 3BVGA 3S1RH 3S2HH 5A35A 1DOLA 4LFCQ 5EPLA 1N36Q 1FL0A 2RHQB 3HG9A 4X3SA 3TDQA 1HZAA 4R8NA 1B1ZA 4MNOA 1E2WA 4MIUA 4O0AA 1TWGB 2KCCA 4HCSA 1PH2A 2LSSA 3M3YB 3I4NB 1CHQD 1EWCA 3GTKH 4YWLA 1EEFD 5CV8A 3PO2H 1ENCA 1JJGA 1WCMH 4DR4Q 4N9PA 1KRTA 1I4HA 3NBIA 1MKHA 1E3PA 1I6HH 1PH5A 1VQHA 4S3SA 3VYUA 4OL7A 2HQEA 1QVFA 4C2MB 2B2TA 1OXVA 4DA2A 2VB2X 4B3SL 2R6GA 4OWWB 1TWHB 2GVAA 2QKIC 3VYSA 1BBWA 2JN4A 4A3GG 2CKZB 1R4PB 4B9WA 3D3RA 4Y52H 3I8ZA 4PZ8A 1BKBA 1JICA 1A3VA 1DM0B 3ZJYC 1SJED 4DR5Q 3MXGA 2HDLA 3GTMB 5G3LD 5IODA 1DOKA 1B7YB 1SROA 1X3PA 4GLVB 4PMWA 2XRQD 2WAQB 4JI8L 3FRPB 4JPBW 1KIXA 3ULLA 3HOVG 4DKAC 3DWPA 3G7LA 4WFN3 4H13C 4KJOA 2ZJRA 2Z0SA 1IXRA 1VQMA 2NVYH 2MJ8A 1GHKA 2SNMA 3HKZE 3U9OA 3H6MA 3BU2A 3DEPA 4PV1C 1WTVA 1XNQL 4A3MB 3E0EA 4UPAA 3Q24A 2O5IC 4CKBA 3I4LA 1HXYD 4LF5L 4BBSB 3DM1A 1JB7A 2WB1G 4IJLA 2XWBB 2A5HA 3SDZA 3A7LA 4BBSG 2JP1A 5IP7H 2LY7A 3MWYW 4XQQA 1TWFH 2SEBD 1RCVD 4B9XA 2N49A 4RWSC 4X65L 3CCQA 3CW2C 4WRDA 5M5WB 5FK9C 1F2YA 1D1IA 2NVXB 2E2HH 3OMCA 5ELNA 3CF5A 4OHJA 1YJNA 1PH4A 1SFOB 1HPCA 2F0SA 2C35B 3FKIB 1AFPA 1IL8A 1SR3A 3KLSA 1NE3A 3WWVA 3I90A 1K8AC 4LWCA 4B3TQ 1XMOQ 1H9RA 2F0TA 3G6JB 1GOZA 2Q2UA 3PUZA 4RGMA 1A63A 1FNVA 1EIGA 2UU9Q 1RD9D 2CCZA 1PFMA 2YTVA 5AJ3Q 4MZ9A 3MEFA 5LL6X 2KHSA 1D5MC 4JI5L 4F8MA 4POGA 1F2ZA 4OIJA 2B2TC 3F2UA 3L2PA 1LT3D 3OYYA 3M4YA 4RAUC 3ND8A 4IFDI 4UP7A 4HIKA 2UUBQ 1EY0A 3K7AB 1LYLA 3CCRA 3S1MH 1PLFA 2RDHA 4V190 1YJ9A 1HA6A 4X3UA 1XXGA 1STGA 5M3FB 3CP0A 5C0XG 1A62A 1EU3A 2B8GA 2FFKB 3HOUH 1SEBD 3NTKA 1J9OA 3MZ5A 1W2BA 4G7ZC 1UE1A 1CUKA 1EFID 5M3MH 4DR1L 5DM63 4IFDG 1H9JA 4HR7B 1Z6HA 4YWMA 1ASZA 1HUNA 5C4XB 2PCFB 2KENA 4HEDA 3E9HA 5EAYA 2WAQE 2B2YC 3FPPA 1R4QB 4LF9Q 5DNFA 4IOCA 1H9MA 1E2ZA 4ULLA 1E24A 3ITPA 2XTIA 2IL8A 4IQZA 1K3RA 4DUZL 3Q22A 1GUOA 3STBC 2D62A 3KF6A 4AYBB 4KLKA 3M7NA 2RHSB 2ZT9C 3I2ZA 1EYGA 2QCPX 4DR2L 2UUAQ 4IPDA 1CQVA 2RCNA 3TZDA 3S2DH 1XPOA 1J6QA 1QILA 5JJZA 5LMNW 3HRZC 1WD0A 3CD6A 3HOWH 5IT9c 4ZKBB 5JPMC 1WTPA 1GHJA 1W3SA 4FO2A 1CTMA 2KEDA 3RD4A 4OWXB 4JI3Q 2F03A 1KDCA 2BH8A 2ZTEA 1QVCA 5ELEA 5JJLA 1E2VA 4DV0L 1F2LA 1Q8IA 4LF4L 4RGTA 5IYDG 1SMYD 4L6TB 1MHWC 5E7NA 4OO1H 4DV2Q 4U68A 5CV5A 3SK5A 2TSSA 4ALPA 2PO4A 4IPGA 1NCVA 2VY3A 1IKLA 1JE4A 4C3IB 2Y0SG 2WV6D 1YNJC 1QUQB 3AFPA 1LTBD 1ET9A 4X64Q 4BY1H 5GROA 3DUZA 5IGEA 4KHVA 1D5XC 3BZKA 2OF1A 3SEBA 3M4OB 1FVIA 5GQOA 2K14A 3GTKB 4OEMB 2K5VA 3VR3A 1GUTA 4JI6Q 4G4KA 1MJEA 2QEJC 2EY6A 4NP5A 3R3OA 5M5YH 4C3JG 3J7A5 3ULJA 5KGUA 3E6ZX 3LX0A 4HSPA 1J5EL 4GN4B 1TWCH 2V1CC 2JA6G 3OWEB 3FEWX 3NK9A 5CGKA 5D3IB 3R93A 4GN3B 2JA5B 2F4IA 4O1NA 2VS1A 4BY1G 3W5OA 3HOXG 4N8X1 3GQBA 4LF5Q 5C3EG 3CCVA 4C3HB 3FPUB 5IY0A 1Y1VH 5GAGC 2IHFA 5I4DA 4IALA 1STNA 1SYDA 4QQBX 2HHHQ 2MP1A 1X6OA 4B3ML 1EYAA 4QL5A 2BE5C 1S5DD 3K5LA 1GUGA 2FINB 1TWAH 3KF8B 3M4QA 4C1NK 2H1EA 4Q0FA 1ZYRD 2R93G 1I94Q 3PMFA 4YY3Q 2GVBA 2Z4IA 4X62Q 2M9VA 1VQKA 2UXBQ 1PRTD 4QGUA 2M00A 1K83B 2Q2IA 4DFAA 1L0XB 3A7AB 4BBSH 4DNIA 2UU9L 2CW0C 3H15A 3ERSX 1QNUA 4QUCA 1HH2P 3SGIA 3S16B 2NUCA 1K8GA 1BCPD 3PUWA 2F0GA 1BQQT 1TWFB 4C2MH 3K57A 4Q5VA 4AIMA 3H94A 4NDXA 1JCKB 4XT1B 4ME3A 1YNND 1E7ZA 4IUQA 1U4RA 2KA7A 1L2FA 1MJCA 2KHIA 2N8NA 5FOBB 3VA5A 2A68C 3OIQA 3IRBA 4AYBG 3NPPA 1MSHA 1W6KA 3BDLA 3VR2A 1I5FA 4DK1A 4JI4L 1NMFA 4A3KB 3GTMH 4ABNA 4OXPA 1IBLL 1VDZA 1O7LA 1UEBA 1Y14B 4CKCA 2A6EC 1Q7YC 4K6DA 2MO0A 2HCCA 4RG1A 1I3QB 2VQFQ 2EYLA 2JA8G 1VQLA 2RVLA 3CCSA 1XTCD 4LF7Q 4EVOA 2PZTA 5CV4A 3MA2B 2ALYB 2A6HD 2NYZD 3IFTA 2BCOA 2ATWA 1LTRD 4MTKA 4YY3L 2MPMA 3PUVA 5IT9E 2K33A 1F77A 1HQRD 2AMCB 4BXXH 3URYA 2BDNA 1ASYA 5M3MG 3VYRA 1YHAA 2CQOA 2LXKA 1IBMQ 5IYCG 4R4OA 2VUMG 3BVMA 1V9PA 3HOUG 4RCNA 3AYHB 1B2TA 1FGBD 1FJGQ 5JJKA 3A5ZB 2E2HB 1D6EC 1I6HB 4LFBL 2ZTCA 3DLLA 3HKSA 3OPOA 2R7DA 3RZDH 4LMQD 5ELFA 2NZOA 1JORA 3NP8A 3FKIH 3G6EA 1UE5A 1CZGA 5KIXA 2NZHA 2PMZB 2Z1CA 2NVTH 3LNNA 3D0FA 3QG1A 1JOOA 1G91A 2F0QA 2KCNA 3TRZA 5LL6S 1NUCA 5FO7B 1A3TA 2F0VA 5IP7G 1JQYD 1RF2D 1KAWA 3H0GB 3P7JA 4EGVA 4DV1L 1CSQA 2UXCQ 1QZGA 1DJRD 1PMRA 3I4MG 1AZQA 4YCUA 1FD7D 5IOCA 4DXFA 1QOHA 1HTLD 4A3BG 5FLXL 4LF6Q 3TMEA 3GP7A 4IN3A 2OQKA 2K01A 3CCMA 2IPKD 3EJIA 1BF4A 1FNUA 4J15A 3A74A 2CHBD 4BXXG 4KN7C 4HJAA 4I65A 3A8JE 5FLXc 5HY6A 5M3FH 3U4ZA 4JBJA 4JI3L 4E6IA 1CQFA 3PO2B 5EKKA 1C0AA 2E8GA 1JWSD 3D4WA 2EYJA 1NR4A 3OW2A 1MIUA 1ZXTA 1VQ4A 1V43A 2EPBA 1X9NA 5ISRA 1G8ZD 4NXML 1DOMA 2OQ0A 2EIFA 5M5XB 5C4XG 5JEAH 1ENAA 1D2BA 1HFNA 4XTCS 4JV5Q 3MVVA 1SNOA 4L5RC 4G7HC 2K50A 3F8TA 2RF4A 4JI6L 3RN2A 1ZYRC 4GN5A 4JI7Q 4A3EB 2JK8A 2D0PA 1GUSA 2NN6G 2PNRC 2R61A 3BDCA 1YHBA 4KD4A 3BG3A 3TP6A 3CC4A 1SE8A 1WOCA 1EY4A 2FXQA 2KVMA 1SMXA 3HOZH 3CCEA 4X66L 1LABA 4K5XA 5C3EH 4PMCA 3AFQA 3DWQA 2DJFC 2NTSA 1IKMA 4OIKA 4JBMA 4QJFA 4DR5L 2BH2A 1G6ZA 1TIID 3CRLC 3NENA 1LTTD 3WDNA 5ELBA 1M4VA 3UE0A 1SNCA 1MI2A 1MBYA 5C44H 1SE4A 1PZJD 4KV6A 3P1HA 1Q82C 1PTOB 1R9TH 1N33Q 4GKKQ 3STBD 1T9HA 2Q2TA 5EPJA 1E0BA 4NXNL 5IP9H 1GUWA 1A3UA 3ND9A 4HJ5A 3FVQA 4HN7A 3ONAB 3TP7A 1L0WA 1I4GA 1UUPA 4A3CH 1HRJA 1FYCA 2KUMA 3KBGA 1EYDA 5FKAC 1L0YB 2A6ED 1Y8PB 3QR8A 1P8LA 5DEHA 3JAMi 1VF7A 3EA6A 2C9OA 3T1HQ 2Z6KC 3R8BA 4UY8C 1AE2A 3HFZB 2F52A 1EY5A 1XTDA 3OTOQ 1HR0L 1Q81C 2K05A 4CDCC 2YU9B 3U58A 2LKVA 4BY7B 1GD7A 3X3NA 2GN5A 4OO1G 2EOTA 3O13A 3HOZG 1CA6A 4JI7L 1VQ6A 1YVCA 1I4RA 1TXYA 4QF4A 4BWGB 2JQOA 2PPBC 2EXZA 2KQ3A 5KYIA 1K73C 3PIP3 2F3VA 1UE7A 1G51A 4A3FB 1Y1VB 1IYVA 2JA7H 5CR3A 1BCPF 4A3LH 3G48A 2K52A 1HNZL 1GO3E 1OXTA 1S5CD 3K0XA 2JA8H 2PQEA 4K14A 1NY4A 2WKCA 3RLOA 2K6AA 3PIO3 4KHPL 1A0IA 3H0GG 4FVMA 2VQFL 1JWUD 2F0FA 4A3IG 1PV4A 1XPRA 4DK0A 3HOZB 1LT6D 1PXUA 3SVMA 1PRTF 1VQJA 4FYDA 4A3FG 3VA7A 3RLFA 3FMCA 2IWHA 5K36G 2JEBI 4DR6L 1O7YA 4H44C 4WJ3M 1E1OA 3JAME 1QE6A 2XSCA 1TS3A 4LUZA 1VMCA 1IBML 1OXSC 4PNYA 3VYTA 2B29A 4A3MG 4JCVE 4IJHA 2UUCQ 1RIPA 1KABA 3K6OA 1WTXA 3V05A 3W3AA 4HIOA 1TS4A 2C5CA 2OCEA 4P71A 4A3IH 4UP9A 2XWJB 3EVQA 4YCVA 2WIIB 4JI5Q 1SYGA 2XVSA 3I4MH 2OEOA 4K6LA 3PF5A 1SYBA 5IWAL 3QOLA 5EJWA 4G57A 4APVA 5D3DA 2ENBA 3K5OA 4L8JA 1VCIA 3SR1A 3J7YW 3NBHA 2F0DA 3DMUA 1QVGA 1YJWA 4A3GB 4LUVA 1GJXA 2WFWA 1Z9FA 5IE8A 2X69A 2NVQH 1BCPC 4KI0A 3GTJH 1M8AA 1OO9B 2NBFA 3L7ZC 1AEXA 4RKLA 2L12A 2KJXA 4GNXC 2Q2HA 1EOTA 3EIVA 1Q46A 2Q8TA 1N36L 3TEHB 1TS5A 4BY1B 1H9KA 1HHVA 2EY2A 2JA6H 4I7AA 4DAMA 3K5NA 3VR4A 1C4QA 3I4NG 5IT9L 2OXPA 1D8LA 2N3SA 4WORA 3S15H 4NPSA 3C3LA 2HHHL 4RKBA 3F2CA 3NEMA 4A93H 2ZXPA 3HS0C 2YYZA 5C4JB 4DV6Q 4DR4L 2AUKA 4DUZQ 3S16H 1JC7A 1HJPA 1Z47A 2B2WA 4X66Q 4XYQA 1GVPA 2F0IA 2KCMA 2L11A 1EQRA 2LXJA 1A2TA 2K5NA 1TWCB 1ENFA 1PZID 2KHJA 1EY7A 4HJ7A 3OMGA 2NZ1D 2F0HA 1LT4D 2EY1A 1BBUA 4KKTA 2I5MX 4A3KH 2B39A 2HDMA 3M4PA 3NQIA 1T5XD 5M5WH 4H0LC 4QIWE 3DM3A 4IOAA 2N78A 2O4XA 3LWUA 2PNHA 1YNNC 3EROA 1I3QH 4GNXA 3I4MB 1ILPA 3DXJC 2EYHA 3V2TA 1C8CA 1K8OA 3GTGB 2R92B 3RZOB 3D6WA 4RA8A 3R2TA 1FNWA 1Y1VG 3JAML 3ULPA 1K28A 1ONLA 1WJJA 1XNQQ 2EYOA 4BA2I 1ESRA 2OTLA 4DXGA 1BCPB 1B53A 2AQ2B 4UAIA 4A3GH 4XQNA 3J80L 2EJMA 5EGTA 2E2DC 3OTOL 3GTJB 3LWEA 4JI1L 2DY8A 1FGUA 4HTHA 4TKOB 4X65Q 1KQSA 5FO9B 1EY6A 3A5UA 1OXUA 4GKKL 2WKDA 3CC2A 2A6HC 1PH9A 1SNMA 4JYAQ 3F1ZA 4DN4M 3KUPA 3SK8A 1WFQA 1TY2A 2PZWA 5HGTA 4DV3Q 1LM0A 3KOJA 3ICEA 4BBRG 1S5ED 5C4HA 3VR5A 1STEA 3S15B 1V1PA 4UP8A 3K80C 1I6VC 4A93B 4DAYB 3AQQA 3K58A 3QO2A 1RJTA 4KHPQ 3U9SA 3HOUB 5EBDA 1HR0W 2YU9H 2VUMH 3C1EA 2PI2A 1PA6A 4K2LA 4A3DH 3J80i 3UE1A 3CMAA 4XDXA 2UXDL 2NN6H 4DR6Q 2QGQA 3CKIB 1CA5A 1HNWL 2VB3X 4A76A 4JI4Q 3MFYA 3NSWA 4A93G 1K0SA 5C44G 5F2DA 1D7QA 4J8QA 5ELDA 1KLUD 5I9OA 3H3VI 2Q8RE 1KRSA 3NWSA 1U4LA 3BDOA 4RGNA 4Y7NH 4L5SA 5GADC 2Y0SE 1KHIA 1KNEA 2D0OA 3MXNA 3G4SA 4CGYB 1NR2A 4OGQC 4K0KQ 2AQ3B 4H7BA 2RA4A 3RZOH 2RDGA 3HOWB 3J7AF 4F88A 3MFGA 5JEAJ 3GTQB 3S1QH 2VL6A 3HOYB 2MFIA 3KFUA 3FP9A 2BOSA 1TKWB 4GS3A 3M3YH 5M3FG 1GM5A 2NVTB 4GLAC 1DD2A 1VQ9A 3NXWA 3A8IE 3N52A 3HOXB 4XYOA 1B4OA 2WB1E 2CH4W 4ODGA 5IGGA 2ID0A 4I7ZC 1PVOA 3A56A 1EYCA 2ICIA 4OONA 5KEEA 5AFWA 2R92G 1B9MA 4RGOS 2FHTA 2KEEA 4DV2L 3HOWG 3MEHA 4RCOA 3H0GH 4ZAIA 3TBIB 3CU7A 4KD3A 2OTJA 4DNRB 1IHZA 3TN2A 1Y1WH 1D1KA 2QDLA 1YIJA 2JA7B 3EN2A 2CWPA 2L5TA 4IURA 4DV7L 1XNRL 3TZUA 3BZCA 1XMQQ 4A3LG 5BN3A 1HZCA 2G9HD 3MXNB 4CHTB 2E76C 5E3FA 1KNAA 3KDFB 1UEAB 1VQIA 4FF4A 3QB3A 3HOVB 1EU4A 2HIVA 2UXCL 3T4AC 2NVYB 3CCLA 1SXTA 1FJGL 1A8VA 4A3BH 1EL0A 2EXDA 1LTAD 5C3XA 4HJ8A 2PI2E 2D9UA 3NQTA 5IGBA 4L5QA 1PH7A 2IJ0A 1JWMD 5NUCA 1X65A 4YHHQ 1U4PA 2K5HA 4P74A 4DUYQ 5FJ8H 2RSOA 1O7IA 3RMHA 2F1MA 1TR5A 1PZKD 5EKLA 3MAQA 4PZ7A 3JAMc 2WB1B 4Y7NB 3S14B 1TWAB 4ZUJA 4GKJQ 1W6JA 3PO2G 2B3GA 4M1UB 1WTQA 3OHXC 4IUPA 4K5VA 2HUGA 5IYBH 1X3QA 3G71A 4Z9CB 4YWKA 2D5DA 5I2XA 1J5EQ 1K83H 3ERQA 1JJ2A 1EEID 3EFXD 2UUBL 5C3EB 1UNSA 4CKEA 3T16A 3C2PA 1EZ8A 2ES2A 2ZJQA 3Q8DA 3HOXH 1ML0D 3E9IA 3RNUA 2RQXA 2A74C 2DNCA 3KBXA 4HAEA 4B3RQ 4IFDJ 1EQQA 3UI2A 4X3KA 4GKJL 2PW7A 3J81j 1KDBA 3AB9A 1P16A 1IYJB 4PQXA 1F9SA 5HGQA 4A3JB 1WTOA 4ID6A 1PTOH 1R9TB 3T51B 2E5LQ 1YZ6A 4J6HA 4LUOA 5C5MA 1BO0A 3K8AA 4DPGA 4X62L 4DV3L 1PTOD 1N32L 3HKZG 5FO8B 1I94L 1H9SA 1SYEA 3MHBA 5IGCA 3N6RA 5K5PA 3UDGA 5I9PA 3AU7A 3FDTA 1STAA 1STBA 5BR8Q 4DU9A 1SNPA 1S40A 2F0MA 1SN8A 1KD1C 4HSVA 2EYFA 3CHBD 1AE3A 3E3XA 3CCUA 4A3BB 1PH3A 2PYKA 4DV4L 5GAHC 5M3MB 2R93H 1IBKL 1SDFA 3I55A 1NAPA 1BOSA 1YBYA 3L3OC 4DR1Q 4DAYA 3RN5A 1A2UA 1KTKA 2GA4B 2HD3A 2DY7A 5IGFA 1EQTA 3JC66 2K32A 2I46A 3I56A 1HA5A 3D4RA 4CDFC 4LF4Q 2LFNA 1S3OA 3UDXA 4POFA 1LTGD 1QG7A 5D65A 2JA8B 1KAAA 3IL8A 1RHPA 1AZPA 4AQYL 1AW7A 2OT2A 2R7ZH 3NHHA 2K04A 2B2UA 4LFAL 1WI5A 1U5KA 1TY0A 2DNEA 1HZBA 1RTNA 1RODA 4FDBA 4JW0A 1JOQA 2JA7G 4XQJA 2A69D 2L0CA 1PTOC 5LHY1 5JVG3 3OWFA 4EQ5A 1CFMA 2EJGC 2K5DA 1V1QA 3OW7A 1KLGD 4OX9Q 2HIXA 4IO9A 4A3JH 1CM9A 4LFCL 1VS0A 1MGSA 2B63G 4KY6A 3SHLA 4GNXB 5LMUQ 1CK1A 2JE6I 2HCIA 2E2JH 4LF8Q 1SFOH 3CPFA 3E0JA 2A1AA 3GTQH 2BDOA 3TS0A 1NSNS 3I7FA 4IUNA 2L1BA 4R9WA 4XXEA 4KN4C 4BBRH 4P75A 2PW5A 3Q23A 5DLQE 3CRKC 5T1IA 5IP9G 2Y0SB 5K36H 2PZUA 1PH6A 2ICEC 2HQLA 2UUCL 2XN9C 1QCBD 2N88A 2VZAA 3HGBA 3CQZH 4ZLTF 2VUMB 2IHEA 4KKUA 2TMPA 1G2SA 5FLMG 4DV6L 4K2KA 2R7ZG 1G6PA 4P73A 2Z6KA 4DV1Q 1Q90A 4OO1I 3KJPA 5IGDA 1U4MA 1WTWA 4KTAA 1VQ8A 2Q8IB 1VQOA 5DM73 4LF6L 4KY7A 4LAAA 5BN5A 2VW9A 2QEXA 1NTGA 2F4VL 3EBEA 1XJVA 4C3JB 4P72A 2PQAB 4R8IA 2EDGA 5J39A 3S17B 2R3ZA 4QB4A 1QUQA 1WCMB 1S72A 3TREA 5C0XJ 2ASBA 2K28A 1X54A 3NE5B 3HP3A 5JOBA 1MSGA 1BBXC 2A19A 4A3KG 2QA4A 3S1QB 1PYSB 4B3SQ 2UXBL 3F2BA 3GD7A 1GXDC 3J81c 1I50H 1ESFA 4DUYL 4DGZA 3FHWA 4LW1A 5E4XA 1O7ZA 2EJFC 1B50A 3L9AX 5C44B 5E4WC 1EQVA 1PDQA 5A2QE 4JI8Q 1PH1A 4ZRZA 3H3VH 1BXTA 3KK7A 1WTHA 2B2YA 1JMCA 3J81i 3TP5A 4BA1I 5M5YB 1CSPA 2E2JB 2KCTA 3EQLC 1VQCA 2K5QA 1C9OA 1EWHA 1SBBB 3D4DA 3RZDB 4JI2L 3PSIA 5I6WA 1STHA 1TS2A 1B3QA 5J1ZA 4BBRB 1M90C 2CVRA 3PO3G 2NN6I 3UDFA 1QZHA 4C3HH 4DR3Q 1ICFB 4DK3C 1IBLQ 2Z8LA 2SOBA 3BYTB 3TQYA 2VQEL 1VQFA 3WOEA 4CJ2C 1I4PA 4R4CA 1JT8A 3CXCA 1WTRA 2AQ1B 2V4DA 2L9HA 4FXGC 3PQIA 1X32A 5CV9A 3NELA 1WCMG 4CBVA 4NXNQ 5H1SE 3WOFA 4P2CB 2E5LL 2P5ZX 3A55A 1N34L 4DV5Q 4KKSA 1HNZQ 4ZCKA 4LJZC 5CBEE 5J3BA 5KNDA 5KYLA 3S17H 1X3GA 1NBWA 1XPUA 3S1NB 1CKNB 2K7VA 2DGYA 4RHRA 1OXXK 2QILA 4AH6A 4BY7G 3KLRA 3NWTA 1VQEA 2OWOA 1HR0Q 2BA1A 4MN3A 5IIFA 4JI0Q 1IBKQ 1QNKA 1N34Q 5M5XH 4DV5L 4JI2Q 4EX5A 2JA5H 1V1OA 1XNRQ 3GDEA 2EYMA 1PHJA 2CW0D 1A6XA 2F0LA 3P75A 3HKZB 3SK4A 4PG3A 1AP0A 2DUDA 4RFBA 3ZYYX 1JE5A 2JYOA 4CDEC 1XX8A 4XIGS 3J80E 3PO3B 3J7ZC 1Y69U 1J8IA 4R1JA 1I4QA 4XT3B 2MHVA 1L1OC 2EVBA 4FP5D 1M1KC 4RHSA 3Q0AA 2A68D 2UUAL 1S5BD 2B63B 2O5JC 5IWAQ 5LMNL 2F0UA 1Q1EA 1D5ZC 4MTNA 2IX3A 1LTSD 3HOYH 2FMMA 4HMJA 5EPKA 4K8IA 1Q86C 1T5EA 1H9SB 1HNXQ 4C1NI 4DK6C 3HOYG 2MNAA 3RLNA 1IYUA 3S2HB 1CZWA 5CV7A 2I0QA 4KY5A 1SRUA 1JB3A 2WINB 4BS9A 1PFSA 1HZ9A 1TT2A 4IUTA 4R4QA 1XYIA 4DR2Q 4A3JG 3MXPA 5COYA 5C4ZA 1CKNA 5LMUL 1PFNA 4IZ8A 3W1GA 1PYWD 4TQUS 2ZJPA 2AUJD 2L4NA 3S2DB 2K75A 2G5DA 3DWAA 3TSSA 4X3TA 1ET6A 4DR7Q 3TP8A 2B2UC 2PQAA 3RR5A 1LACA 3DHQA 3I3CA 2JA5G 1HUMA 1RKNA 4U673 1DXMA 1TU2B 4LNQA 1GUNA 2B2WC 2G9DA 3K59A 2FJ2A 4A3DG 1PTOF 2L55A 5D14A 2I07B 2RDFA 3I4OA 3M7GA 4ILWA 5E1FA 5ELOA 5FJ8G 2IW3A 2RSNA 1IZ6A 1EY9A 4QUFA 1B44D 4LK1C 1AN8A 5T1GA 2X6GA 2F3IA 3PV0A 5CC4A 5EQ0A 5BR8L 1B3AA 2XIWA 5FLXE 3K7UC 3M4OH 5J22A 4ZK9B 2JXMB 1VQ5A 2E75C 3I91A 4C3JH 1U0LA 3S24A 3V96A 3S14H 4DV4Q 2YTXA 4DNTB 1VF5C 4JG2A 1VQ7A 2XNAC 5C5LA 1Q3LA 1N9WA 4FXKC 3K5MA 3HEJA 2KBNA 3BJUA 1ZKOA 4NKLA 5C0XI 4HMIA 1A15A 3C1FA 4JV5L 1G291 1C48A 3AMUA 1IW7D 5JEAG 4TRDA 1HQMC 3D8GA 4DV7Q 4GZYC 4R4TA 4IPHA 2LMCB 2AHOB 2JA9A 5C6AA 3MTSA 3CQZB 1EWIA 3T1HL 1LO5D 1HFGA 2H4OA 4JI1Q 3PIOA 2E2IH 3PF4A 1H95A 5C3WA 3UDIA 1WD1A 3GTLH 1B9NA 1SLJA 2YV5A 4A3EH 1G2TA 5HURA 4C56C 3U4VA 2K5WA 2XGTA 1LLRD 2PMZE 3B6YA 1BR9A 3J80c 4NXMQ 2F0WA 1F9QA 3GTOH 4FXDA 5ELCA 1SYCA 1YNXA 1SE2A 1KC8C 3I72A 2R7FA 2QW7A 4JK1C 4F87A 5A2QL 2L15A 4FNFA 4HIDA 4H02A 3BVZA 2B8FA 3S9WA 1F9RA 4GOPA 3PCOB 3QWNA 3NTIA 1S5FD 2DJGC 2WAQG 2VQEQ 3GO5A 4KK7A 2F0NA 1UAPA 4LF7L 3GTPH 1HNWQ 2F0OA 4RMFA 4JYAL 2JSOA 3MC0B 1PFBA 1K9MC 2R93B 1PRTC 3RUZA 4DAPA 4A4IA 1O80A 2RKSA 2Z4HA 3A54A 3PGZA 2IY5B 4V0BA 3KF8A 4QY7A 3IFDA 1I50B 1TVXA 4IFDH 4JBWA 3D6CA 2IX0A 3L0OA 1E1TA 4F7XA 4NW2A
chains in the Genus database with same CATH topology
1HNZL 3I4NH 1GO3E 4LF4Q 1OXTA 3K0XA 1S3OA 2JA8H 3UDXA 4POFA 1NY4A 3RLOA 4B3RL 1YJ9A 4KHPL 1VQDA 1A0IA 3H0GG 3CP0A 1X55A 5C0XG 2VQFL 4AQYL 1KXLA 4A3IG 1A62A 1PV4A 2R7ZH 1VQPA 1XPRA 3HOUH 4LFAL 1LTLA 1WI5A 5LMNQ 3U50C 1W2BA 3S2DH 1UE1A 1VQJA 1CUKA 1CKMA 1U5KA 1Q1BA 2EQSA 1JJGA 4A3CG 1B70B 4JC0A 1HZBA 2AKWB 1VQBA 3RLFA 5M3MH 4FDBA 3CC7A 4DR1L 4A3FG 2JA7G 4IFDG 5K36G 2JEBI 2UXDQ 2IX1A 4YWMA 1ASZA 4DR6L 2K4KA 2KENA 3E9HA 2CWAA 5EAYA 4WJ3M 1E1OA 2WAQE 4EQ5A 4LF9Q 4IOCA 4LUZA 1V1QA 4L5TA 1HNXL 1E24A 2XTIA 4B3TL 1IBML 4OX9Q 1OXSC 4GOPC 2HIXA 2B29A 2WP8J 4A3MG 4IO9A 1K3RA 4IJHA 4JCVE 4DV0Q 4DUZL 1L1OB 1RIPA 2UUCQ 4A3JH 3STBC 2D62A 1Q12A 3KF6A 1VS0A 4LFCL 5JJIA 4KLKA 3M7NA 2RHSB 1YITA 2B63G 4HIOA 2OCEA 4P71A 4A3IH 3I2ZA 4UP9A 1EYGA 4GNXB 4DR2L 5LMUQ 1X3EA 4YCVA 2UUAQ 4IPDA 4JI5Q 2B63H 3GTGH 3I4MH 2RCNA 1EOVA 2JE6I 3PF5A 2E2JH 1X56A 1XPOA 5IWAL 1J6QA 1SFOH 4LF8Q 3CPFA 3CD6A 2A1AA 5LMNW 3GTQH 3TS0A 3HOWH 3I7FA 5IT9c 3K7AH 3T1YL 4A3MH 4DR7L 1E22A 4BBRH 1W3SA 4APVA 4P75A 3CPWA 5DLQE 4OWXB 4JI3Q 1VCIA 5IP9G 2BH8A 2ZTEA 3HOVH 1QVCA 4DR4Q 5JJLA 1PH6A 2HQLA 4DV0L 2UUCL 1QVGA 3W1BA 1YJWA 2VZAA 3CQZH 4LF4L 4LUVA 5IYDG 2IHEA 1UE6A 2WFWA 1Z9FA 3ER0A 5E7NA 5IE8A 2NVQH 4DV2Q 4KI0A 4BY7H 5FLMG 3GTJH 4DV6L 3L7ZC 4ALPA 2R7ZG 1G6PA 4IPGA 2H5XA 2VY3A 4P73A 4KHZA 1K0RA 2Y0SG 2Z6KA 1Y1WG 2NVXH 4DV1Q 4OO1I 1TWHH 4GNXC 5C4XH 1QUQB 1VQGA 3AFPA 2Q2HA 3KJPA 4X64Q 3KJOA 4BY1H 5GROA 3EIVA 1Q46A 1N36L 3TEHB 1VQ8A 3T1YQ 2CFMA 1VQOA 4LF6L 1EIYB 2JA6H 4DAMA 5FLMH 3BZKA 1YI2A 4DR3L 3I4NG 1L1OA 1FVIA 2VW9A 1D8LA 4YCWA 2QEXA 2A8VA 2N3SA 1NTGA 3S15H 5GQOA 2F4VL 2K14A 3EBEA 4JOIA 4NPSA 2HHHL 2JEAI 2K5VA 4PZ6A 4LF9L 3F2CA 1XJVA 3NEMA 4JI6Q 4P72A 1MJEA 4A93H 2PQAB 4B3MQ 3K81C 3PUYA 3KDFA 1AH9A 2YYZA 5M5YH 4DV6Q 1QUQA 2BA0A 4DR4L 1S72A 3TREA 4NB3A 5C0XJ 4DUZQ 1HJPA 1C7YA 1Z47A 3ULJA 3J7A5 3S16H 2ASBA 1X54A 4O2DA 4X66Q 4GLXA 3TS2A 1GVPA 2KCMA 2I5LX 1J5EL 4GN4B 1TWCH 2V1CC 2A19A 4A3KG 1EQRA 2QA4A 2LXJA 2JA6G 1PYSB 2K5NA 4B3SQ 4HJ7A 2KHJA 3NBHB 4GN3B 3W5OA 4BY1G 2VS1A 3F2BA 2UXBL 3HOXG 4LF5Q 3GD7A 5C3EG 3J81c 3CCVA 5IY0A 1I50H 1Y1VH 5GAGC 2IHFA 4DUYL 3FHWA 1VQAA 1Q8KA 4LW1A 1YEZA 5IYCH 1BBUA 1WYDA 2ZM6Q 2I5MX 4A3KH 2HHHQ 4QQBX 4YHHL 5IYBG 3M4PA 1X6OA 5M5WH 4HJ9A 4GOPB 4B3ML 4JI8Q 4QIWE 1PH1A 3DM3A 3H3VH 4QL5A 4IOAA 2N78A 4C3IH 3KYHC 1N33L 2PNHA 1TWAH 3CCJA 3KF8B 3M4QA 1JMCA 1I3QH 4GNXA 3J81i 2R93G 4BA1I 5C4JH 1CSPA 1NMGA 2KCTA 1VQCA 1CKOA 3M9BA 1C9OA 1I94Q 1UWVA 4YY3Q 4JI2L 3PSIA 2GVBA 4X62Q 1VQKA 2UXBQ 1Y1VG 2AWNA 4QGUA 4OWTB 3ULPA 4X64L 1M90C 2Q2IA 1WJJA 2VNUD 3PO3G 3F2DA 2NN6I 1XNQQ 4BA2I 2OTLA 4BBSH 3UDFA 4JOIC 4DNIA 2JJQA 1GKHA 1QZHA 4X6AH 2UU9L 4C3HH 1YHQA 4DR3Q 3H15A 4DK3C 4A3GH 1IBLQ 3ERSX 1IL2A 3SGIA 1HH2P 3OTOL 1K8GA 4R4IA 3PO3H 1B8AA 3PUWA 3TQYA 2VQEL 1VQFA 4JI1L 1FGUA 4C2MH 1KQSA 4AIMA 4X65Q 5IYDH 3A5UA 1OXUA 4GKKL 4R4CA 3CC2A 4ME3A 3CXCA 1E7ZA 4HIMA 1JT8A 1PH9A 1PYBA 1L2FA 1JJCB 3F1ZA 1MJCA 3AEVA 3NELA 1WCMG 2KHIA 1EUJA 2N8NA 4NXNQ 1WFQA 3IRBA 4AYBG 5H1SE 4DV3Q 2E5LL 4JI0L 1VQNA 1LM0A 3KOJA 1N34L 3ICEA 1N32Q 3M85A 4BBRG 4DV5Q 1I5FA 2ZTDA 4JI4L 1NMFA 1LUZA 1HNZQ 3GTMH 1RL2A 4UP8A 1XMOL 4OXPA 1IBLL 3K80C 1TWGH 1UEBA 3AQQA 5J3BA 4DAYB 2HT1A 1Y14B 3S17H 2ZM6L 4KHPQ 1X3GA 1NBWA 1Q7YC 1XPUA 2MO0A 1PH8A 4RG1A 1CKNB 2VQFQ 2DGYA 1KL9A 1OXXK 4AQYQ 4AH6A 1EFWA 2JA8G 3S1NH 1VQLA 1HR0W 4BY7G 2YU9H 2VUMH 2PI2A 3CCSA 3PUXA 1PA6A 4A3DH 1N8RC 4A75A 1VQEA 2OWOA 3J80i 3UE1A 1HR0Q 3CMAA 4LF7Q 4K0KL 3CMEA 2MQHA 2BA1A 5AJ3L 2UXDL 5GAEC 4LFBQ 2ALYB 4DR6Q 4JI0Q 2QGQA 1IBKQ 3CAMA 2I5HA 5M5XH 1N34Q 4A3EG 1HNWL 1OTCA 2ATWA 4DV5L 1EIFA 4JI2Q 4EX5A 4YY3L 4A76A 4JI4Q 2JA5H 3PUVA 1XNRQ 3GDEA 3VDYA 1XMQL 1PHJA 3FKIG 2F4VQ 4WJ4A 4A93G 5C44G 2AMCB 3LGJA 4PG3A 4BXXH 2IT1A 2DUDA 1JE5A 1ASYA 5M3MG 1X3FA 4A3FH 1YHAA 4XIGS 1D7QA 2CQOA 2LXKA 1IBMQ 4OX9L 3J7ZC 5IYCG 1NJIC 3H3VI 1DGSA 1KRSA 4R4OA 4R1JA 2VUMG 1V9PA 3HOUG 3AYHB 4Y7NH 4L5SA 1BVSA 1FJGQ 1L1OC 5GADC 1M1KC 2Y0SE 1KHIA 5JJKA 3A5ZB 2D0OA 3G4SA 4K0KQ 4LF8L 2UUAL 4JYAQ 4TVAB 3RZOH 4LFBL 2ZTCA 3DLLA 3HKSA 2R7DA 3RZDH 4LFAQ 2NZOA 5IWAQ 2R92H 5LMNL 2MO1A 3FKIH 5JEAJ 1UE5A 2VL6A 3KF6B 3G6EA 3S1QH 2MFIA 3KFUA 3FP9A 4IPCA 1Q1EA 2NZHA 4MTNA 4GS3A 3M3YH 5M3FG 3HOYH 2NVTH 3D0FA 1GM5A 4GLAC 3KLWA 1Q86C 1VQ9A 2YTYA 4AYBE 1HNXQ 2WB1E 4DK6C 3HOYG 3TRZA 3A0JA 4JBKA 2ID0A 1PVOA 3PIPA 3D31A 5IP7G 4OONA 2AWOA 2MNAA 3RLNA 2R92G 1KAWA 4DV2L 2I0QA 3HOWG 4DV1L 1CSQA 1SRUA 2UXCQ 3S1RH 1QZGA 3H0GH 3S2HH 1PFSA 1HZ9A 3I4MG 2OTJA 4R4QA 4LFCQ 4YCUA 4DR2Q 1Y1WH 4A3JG 1N36Q 1FL0A 2RHQB 4A3BG 1YIJA 1CKNA 5LMUL 4LF6Q 1HZAA 3W1GA 2ZJPA 4TQUS 3EN2A 4MNOA 2CWPA 2OQKA 3CCMA 4O0AA 2K75A 4DV7L 1PH2A 2LSSA 3A74A 4J15A 1XNRL 3BZCA 1XMQQ 4A3LG 4DR7Q 1HZCA 4BXXG 3MXNB 3GTKH 2PQAA 3RR5A 4HJAA 4YWLA 3PO2H 3KDFB 1WCMH 5HY6A 1VQIA 3U4ZA 4JBJA 4JI3L 1KRTA 5FLXc 5M3FH 2JA5G 1C0AA 4LNQA 1MKHA 1E3PA 1I6HH 2E8GA 2HIVA 1PH5A 2UXCL 1VQHA 3CCLA 4A3DG 3OW2A 1QVFA 1OXVA 1FJGL 1A8VA 1MIUA 3I4OA 1VQ4A 5ELOA 1V43A 5FJ8G 4B3SL 4A3BH 1IZ6A 2EXDA 2R6GA 1X9NA 4OWWB 4HJ8A 2GVAA 2PI2E 4NXML 1BBWA 2OQ0A 4L5QA 1PH7A 2EIFA 4A3GG 2CKZB 5C4XG 2F3IA 3PV0A 4PZ8A 1X65A 4Y52H 1BKBA 4XTCS 5BR8L 4JV5Q 3ZJYC 4YHHQ 2K5HA 4P74A 4DUYQ 4DR5Q 5FJ8H 4L5RC 1O7IA 1B7YB 2K50A 3F8TA 3K7UC 1SROA 4GLVB 4PMWA 3M4OH 2RF4A 4PZ7A 3JAMc 1VQ5A 4JI8L 4C3JH 4JI6L 1U0LA 3S24A 1KIXA 4GKJQ 3ULLA 3RN2A 4DKAC 3HOVG 3S14H 3PO2G 2B3GA 4DV4Q 2YTXA 1VQ7A 4JG2A 4GN5A 4JI7Q 2JK8A 2D0PA 2ZJRA 2NN6G 2Z0SA 1IXRA 1YHBA 5IYBH 2NVYH 3G71A 1N9WA 1VQMA 3CC4A 4YWKA 1SE8A 1WOCA 2FXQA 3HKZE 1SMXA 1J5EQ 1K83H 3CCEA 3HOZH 1JJ2A 2KBNA 3BJUA 3BU2A 1XNQL 4X66L 5C3EH 3AFQA 5C0XI 3E0EA 4UPAA 2UUBL 4JBMA 4JV5L 1G291 4QJFA 4DR5L 4LF5L 2BH2A 5JEAG 2ES2A 1JB7A 3Q8DA 2ZJQA 2WB1G 4IJLA 3E9IA 3HOXH 3RNUA 3NENA 4B3RQ 4DV7Q 4R4TA 4IPHA 4BBSG 2AHOB 2JA9A 1EQQA 3UE0A 4IFDJ 4GKJL 5IP7H 1EWIA 3J81j 3T1HL 1P16A 3PF4A 1IYJB 1TWFH 4JI1Q 3PIOA 5C44H 2N49A 2E2IH 4X65L 3CCQA 1H95A 3UDIA 3CW2C 3GTLH 1Q82C 1R9TH 1N33Q 5HGQA 4GKKQ 3STBD 1T9HA 2E2HH 2Q2TA 4NXNL 5ELNA 5IP9H 2E5LQ 1SLJA 2YV5A 4HJ5A 4A3EH 3CF5A 1YZ6A 4LUOA 3U4VA 1YJNA 1PH4A 2XGTA 3K8AA 4DPGA 2PMZE 4X62L 1L0WA 3B6YA 4DV3L 1N32L 4A3CH 3HKZG 1I94L 2C35B 3J80c 4NXMQ 1SR3A 3UDGA 1NE3A 3GTOH 3WWVA 1K8AC 4LWCA 4B3TQ 1YNXA 1XMOQ 5BR8Q 1KC8C 2Q2UA 2R7FA 1P8LA 3PUZA 3JAMi 1A63A 1S40A 2L15A 4HIDA 3T1HQ 1SN8A 2Z6KC 2UU9Q 4H02A 1AE2A 3HFZB 2F52A 4UY8C 2CCZA 1XTDA 3OTOQ 4GOPA 1KD1C 3PCOB 1Q81C 2YTVA 1HR0L 2WAQG 2VQEQ 3GO5A 5AJ3Q 1AE3A 4MZ9A 3MEFA 3CCUA 1GD7A 3U58A 4JI5L 1PH3A 2GN5A 4OO1G 4LF7L 4POGA 4DV4L 5GAHC 3HOZG 3GTPH 1HNWQ 4JI7L 1VQ6A 1YVCA 4RMFA 2R93H 1TXYA 1IBKL 4JYAL 3I55A 3L2PA 1K9MC 1YBYA 3OYYA 4A4IA 3PGZA 4DR1Q 2IY5B 3RN5A 2JQOA 1K73C 4IFDI 4QY7A 1UE7A 1G51A 2JA7H 4JBWA 4A3LH 3JC66 4UP7A 4HIKA 2IX0A 3G48A 2UUBQ 3L0OA 1E1TA 2K52A 1LYLA 3CCRA 3S1MH 3I56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ L;  3I4N H;  1GO3 E;  4LF4 Q;  1OXT A;  3K0X A;  1S3O A;  2JA8 H;  3UDX A;  4POF A;  1NY4 A;  3RLO A;  4B3R L;  1YJ9 A;  4KHP L;  1VQD A;  1A0I A;  3H0G G;  3CP0 A;  1X55 A;  5C0X G;  2VQF L;  4AQY L;  1KXL A;  4A3I G;  1A62 A;  1PV4 A;  2R7Z H;  1VQP A;  1XPR A;  3HOU H;  4LFA L;  1LTL A;  1WI5 A;  5LMN Q;  3U50 C;  1W2B A;  3S2D H;  1UE1 A;  1VQJ A;  1CUK A;  1CKM A;  1U5K A;  1Q1B A;  2EQS A;  1JJG A;  4A3C G;  1B70 B;  4JC0 A;  1HZB A;  2AKW B;  1VQB A;  3RLF A;  5M3M H;  4FDB A;  3CC7 A;  4DR1 L;  4A3F G;  2JA7 G;  4IFD G;  5K36 G;  2JEB I;  2UXD Q;  2IX1 A;  4YWM A;  1ASZ A;  4DR6 L;  2K4K A;  2KEN A;  3E9H A;  2CWA A;  5EAY A;  4WJ3 M;  1E1O A;  2WAQ E;  4EQ5 A;  4LF9 Q;  4IOC A;  4LUZ A;  1V1Q A;  4L5T A;  1HNX L;  1E24 A;  2XTI A;  4B3T L;  1IBM L;  4OX9 Q;  1OXS C;  4GOP C;  2HIX A;  2B29 A;  2WP8 J;  4A3M G;  4IO9 A;  1K3R A;  4IJH A;  4JCV E;  4DV0 Q;  4DUZ L;  1L1O B;  1RIP A;  2UUC Q;  4A3J H;  3STB C;  2D62 A;  1Q12 A;  3KF6 A;  1VS0 A;  4LFC L;  5JJI A;  4KLK A;  3M7N A;  2RHS B;  1YIT A;  2B63 G;  4HIO A;  2OCE A;  4P71 A;  4A3I H;  3I2Z A;  4UP9 A;  1EYG A;  4GNX B;  4DR2 L;  5LMU Q;  1X3E A;  4YCV A;  2UUA Q;  4IPD A;  4JI5 Q;  2B63 H;  3GTG H;  3I4M H;  2RCN A;  1EOV A;  2JE6 I;  3PF5 A;  2E2J H;  1X56 A;  1XPO A;  5IWA L;  1J6Q A;  1SFO H;  4LF8 Q;  3CPF A;  3CD6 A;  2A1A A;  5LMN W;  3GTQ H;  3TS0 A;  3HOW H;  3I7F A;  5IT9 c;  3K7A H;  3T1Y L;  4A3M H;  4DR7 L;  1E22 A;  4BBR H;  1W3S A;  4APV A;  4P75 A;  3CPW A;  5DLQ E;  4OWX B;  4JI3 Q;  1VCI A;  5IP9 G;  2BH8 A;  2ZTE A;  3HOV H;  1QVC A;  4DR4 Q;  5JJL A;  1PH6 A;  2HQL A;  4DV0 L;  2UUC L;  1QVG A;  3W1B A;  1YJW A;  2VZA A;  3CQZ H;  4LF4 L;  4LUV A;  5IYD G;  2IHE A;  1UE6 A;  2WFW A;  1Z9F A;  3ER0 A;  5E7N A;  5IE8 A;  2NVQ H;  4DV2 Q;  4KI0 A;  4BY7 H;  5FLM G;  3GTJ H;  4DV6 L;  3L7Z C;  4ALP A;  2R7Z G;  1G6P A;  4IPG A;  2H5X A;  2VY3 A;  4P73 A;  4KHZ A;  1K0R A;  2Y0S G;  2Z6K A;  1Y1W G;  2NVX H;  4DV1 Q;  4OO1 I;  1TWH H;  4GNX C;  5C4X H;  1QUQ B;  1VQG A;  3AFP A;  2Q2H A;  3KJP A;  4X64 Q;  3KJO A;  4BY1 H;  5GRO A;  3EIV A;  1Q46 A;  1N36 L;  3TEH B;  1VQ8 A;  3T1Y Q;  2CFM A;  1VQO A;  4LF6 L;  1EIY B;  2JA6 H;  4DAM A;  5FLM H;  3BZK A;  1YI2 A;  4DR3 L;  3I4N G;  1L1O A;  1FVI A;  2VW9 A;  1D8L A;  4YCW A;  2QEX A;  2A8V A;  2N3S A;  1NTG A;  3S15 H;  5GQO A;  2F4V L;  2K14 A;  3EBE A;  4JOI A;  4NPS A;  2HHH L;  2JEA I;  2K5V A;  4PZ6 A;  4LF9 L;  3F2C A;  1XJV A;  3NEM A;  4JI6 Q;  4P72 A;  1MJE A;  4A93 H;  2PQA B;  4B3M Q;  3K81 C;  3PUY A;  3KDF A;  1AH9 A;  2YYZ A;  5M5Y H;  4DV6 Q;  1QUQ A;  2BA0 A;  4DR4 L;  1S72 A;  3TRE A;  4NB3 A;  5C0X J;  4DUZ Q;  1HJP A;  1C7Y A;  1Z47 A;  3ULJ A;  3J7A 5;  3S16 H;  2ASB A;  1X54 A;  4O2D A;  4X66 Q;  4GLX A;  3TS2 A;  1GVP A;  2KCM A;  2I5L X;  1J5E L;  4GN4 B;  1TWC H;  2V1C C;  2A19 A;  4A3K G;  1EQR A;  2QA4 A;  2LXJ A;  2JA6 G;  1PYS B;  2K5N A;  4B3S Q;  4HJ7 A;  2KHJ A;  3NBH B;  4GN3 B;  3W5O A;  4BY1 G;  2VS1 A;  3F2B A;  2UXB L;  3HOX G;  4LF5 Q;  3GD7 A;  5C3E G;  3J81 c;  3CCV A;  5IY0 A;  1I50 H;  1Y1V H;  5GAG C;  2IHF A;  4DUY L;  3FHW A;  1VQA A;  1Q8K A;  4LW1 A;  1YEZ A;  5IYC H;  1BBU A;  1WYD A;  2ZM6 Q;  2I5M X;  4A3K H;  2HHH Q;  4QQB X;  4YHH L;  5IYB G;  3M4P A;  1X6O A;  5M5W H;  4HJ9 A;  4GOP B;  4B3M L;  4JI8 Q;  4QIW E;  1PH1 A;  3DM3 A;  3H3V H;  4QL5 A;  4IOA A;  2N78 A;  4C3I H;  3KYH C;  1N33 L;  2PNH A;  1TWA H;  3CCJ A;  3KF8 B;  3M4Q A;  1JMC A;  1I3Q H;  4GNX A;  3J81 i;  2R93 G;  4BA1 I;  5C4J H;  1CSP A;  1NMG A;  2KCT A;  1VQC A;  1CKO A;  3M9B A;  1C9O A;  1I94 Q;  1UWV A;  4YY3 Q;  4JI2 L;  3PSI A;  2GVB A;  4X62 Q;  1VQK A;  2UXB Q;  1Y1V G;  2AWN A;  4QGU A;  4OWT B;  3ULP A;  4X64 L;  1M90 C;  2Q2I A;  1WJJ A;  2VNU D;  3PO3 G;  3F2D A;  2NN6 I;  1XNQ Q;  4BA2 I;  2OTL A;  4BBS H;  3UDF A;  4JOI C;  4DNI A;  2JJQ A;  1GKH A;  1QZH A;  4X6A H;  2UU9 L;  4C3H H;  1YHQ A;  4DR3 Q;  3H15 A;  4DK3 C;  4A3G H;  1IBL Q;  3ERS X;  1IL2 A;  3SGI A;  1HH2 P;  3OTO L;  1K8G A;  4R4I A;  3PO3 H;  1B8A A;  3PUW A;  3TQY A;  2VQE L;  1VQF A;  4JI1 L;  1FGU A;  4C2M H;  1KQS A;  4AIM A;  4X65 Q;  5IYD H;  3A5U A;  1OXU A;  4GKK L;  4R4C A;  3CC2 A;  4ME3 A;  3CXC A;  1E7Z A;  4HIM A;  1JT8 A;  1PH9 A;  1PYB A;  1L2F A;  1JJC B;  3F1Z A;  1MJC A;  3AEV A;  3NEL A;  1WCM G;  2KHI A;  1EUJ A;  2N8N A;  4NXN Q;  1WFQ A;  3IRB A;  4AYB G;  5H1S E;  4DV3 Q;  2E5L L;  4JI0 L;  1VQN A;  1LM0 A;  3KOJ A;  1N34 L;  3ICE A;  1N32 Q;  3M85 A;  4BBR G;  4DV5 Q;  1I5F A;  2ZTD A;  4JI4 L;  1NMF A;  1LUZ A;  1HNZ Q;  3GTM H;  1RL2 A;  4UP8 A;  1XMO L;  4OXP A;  1IBL L;  3K80 C;  1TWG H;  1UEB A;  3AQQ A;  5J3B A;  4DAY B;  2HT1 A;  1Y14 B;  3S17 H;  2ZM6 L;  4KHP Q;  1X3G A;  1NBW A;  1Q7Y C;  1XPU A;  2MO0 A;  1PH8 A;  4RG1 A;  1CKN B;  2VQF Q;  2DGY A;  1KL9 A;  1OXX K;  4AQY Q;  4AH6 A;  1EFW A;  2JA8 G;  3S1N H;  1VQL A;  1HR0 W;  4BY7 G;  2YU9 H;  2VUM H;  2PI2 A;  3CCS A;  3PUX A;  1PA6 A;  4A3D H;  1N8R C;  4A75 A;  1VQE A;  2OWO A;  3J80 i;  3UE1 A;  1HR0 Q;  3CMA A;  4LF7 Q;  4K0K L;  3CME A;  2MQH A;  2BA1 A;  5AJ3 L;  2UXD L;  5GAE C;  4LFB Q;  2ALY B;  4DR6 Q;  4JI0 Q;  2QGQ A;  1IBK Q;  3CAM A;  2I5H A;  5M5X H;  1N34 Q;  4A3E G;  1HNW L;  1OTC A;  2ATW A;  4DV5 L;  1EIF A;  4JI2 Q;  4EX5 A;  4YY3 L;  4A76 A;  4JI4 Q;  2JA5 H;  3PUV A;  1XNR Q;  3GDE A;  3VDY A;  1XMQ L;  1PHJ A;  3FKI G;  2F4V Q;  4WJ4 A;  4A93 G;  5C44 G;  2AMC B;  3LGJ A;  4PG3 A;  4BXX H;  2IT1 A;  2DUD A;  1JE5 A;  1ASY A;  5M3M G;  1X3F A;  4A3F H;  1YHA A;  4XIG S;  1D7Q A;  2CQO A;  2LXK A;  1IBM Q;  4OX9 L;  3J7Z C;  5IYC G;  1NJI C;  3H3V I;  1DGS A;  1KRS A;  4R4O A;  4R1J A;  2VUM G;  1V9P A;  3HOU G;  3AYH B;  4Y7N H;  4L5S A;  1BVS A;  1FJG Q;  1L1O C;  5GAD C;  1M1K C;  2Y0S E;  1KHI A;  5JJK A;  3A5Z B;  2D0O A;  3G4S A;  4K0K Q;  4LF8 L;  2UUA L;  4JYA Q;  4TVA B;  3RZO H;  4LFB L;  2ZTC A;  3DLL A;  3HKS A;  2R7D A;  3RZD H;  4LFA Q;  2NZO A;  5IWA Q;  2R92 H;  5LMN L;  2MO1 A;  3FKI H;  5JEA J;  1UE5 A;  2VL6 A;  3KF6 B;  3G6E A;  3S1Q H;  2MFI A;  3KFU A;  3FP9 A;  4IPC A;  1Q1E A;  2NZH A;  4MTN A;  4GS3 A;  3M3Y H;  5M3F G;  3HOY H;  2NVT H;  3D0F A;  1GM5 A;  4GLA C;  3KLW A;  1Q86 C;  1VQ9 A;  2YTY A;  4AYB E;  1HNX Q;  2WB1 E;  4DK6 C;  3HOY G;  3TRZ A;  3A0J A;  4JBK A;  2ID0 A;  1PVO A;  3PIP A;  3D31 A;  5IP7 G;  4OON A;  2AWO A;  2MNA A;  3RLN A;  2R92 G;  1KAW A;  4DV2 L;  2I0Q A;  3HOW G;  4DV1 L;  1CSQ A;  1SRU A;  2UXC Q;  3S1R H;  1QZG A;  3H0G H;  3S2H H;  1PFS A;  1HZ9 A;  3I4M G;  2OTJ A;  4R4Q A;  4LFC Q;  4YCU A;  4DR2 Q;  1Y1W H;  4A3J G;  1N36 Q;  1FL0 A;  2RHQ B;  4A3B G;  1YIJ A;  1CKN A;  5LMU L;  4LF6 Q;  1HZA A;  3W1G A;  2ZJP A;  4TQU S;  3EN2 A;  4MNO A;  2CWP A;  2OQK A;  3CCM A;  4O0A A;  2K75 A;  4DV7 L;  1PH2 A;  2LSS A;  3A74 A;  4J15 A;  1XNR L;  3BZC A;  1XMQ Q;  4A3L G;  4DR7 Q;  1HZC A;  4BXX G;  3MXN B;  3GTK H;  2PQA A;  3RR5 A;  4HJA A;  4YWL A;  3PO2 H;  3KDF B;  1WCM H;  5HY6 A;  1VQI A;  3U4Z A;  4JBJ A;  4JI3 L;  1KRT A;  5FLX c;  5M3F H;  2JA5 G;  1C0A A;  4LNQ A;  1MKH A;  1E3P A;  1I6H H;  2E8G A;  2HIV A;  1PH5 A;  2UXC L;  1VQH A;  3CCL A;  4A3D G;  3OW2 A;  1QVF A;  1OXV A;  1FJG L;  1A8V A;  1MIU A;  3I4O A;  1VQ4 A;  5ELO A;  1V43 A;  5FJ8 G;  4B3S L;  4A3B H;  1IZ6 A;  2EXD A;  2R6G A;  1X9N A;  4OWW B;  4HJ8 A;  2GVA A;  2PI2 E;  4NXM L;  1BBW A;  2OQ0 A;  4L5Q A;  1PH7 A;  2EIF A;  4A3G G;  2CKZ B;  5C4X G;  2F3I A;  3PV0 A;  4PZ8 A;  1X65 A;  4Y52 H;  1BKB A;  4XTC S;  5BR8 L;  4JV5 Q;  3ZJY C;  4YHH Q;  2K5H A;  4P74 A;  4DUY Q;  4DR5 Q;  5FJ8 H;  4L5R C;  1O7I A;  1B7Y B;  2K50 A;  3F8T A;  3K7U C;  1SRO A;  4GLV B;  4PMW A;  3M4O H;  2RF4 A;  4PZ7 A;  3JAM c;  1VQ5 A;  4JI8 L;  4C3J H;  4JI6 L;  1U0L A;  3S24 A;  1KIX A;  4GKJ Q;  3ULL A;  3RN2 A;  4DKA C;  3HOV G;  3S14 H;  3PO2 G;  2B3G A;  4DV4 Q;  2YTX A;  1VQ7 A;  4JG2 A;  4GN5 A;  4JI7 Q;  2JK8 A;  2D0P A;  2ZJR A;  2NN6 G;  2Z0S A;  1IXR A;  1YHB A;  5IYB H;  2NVY H;  3G71 A;  1N9W A;  1VQM A;  3CC4 A;  4YWK A;  1SE8 A;  1WOC A;  2FXQ A;  3HKZ E;  1SMX A;  1J5E Q;  1K83 H;  3CCE A;  3HOZ H;  1JJ2 A;  2KBN A;  3BJU A;  3BU2 A;  1XNQ L;  4X66 L;  5C3E H;  3AFQ A;  5C0X I;  3E0E A;  4UPA A;  2UUB L;  4JBM A;  4JV5 L;  1G29 1;  4QJF A;  4DR5 L;  4LF5 L;  2BH2 A;  5JEA G;  2ES2 A;  1JB7 A;  3Q8D A;  2ZJQ A;  2WB1 G;  4IJL A;  3E9I A;  3HOX H;  3RNU A;  3NEN A;  4B3R Q;  4DV7 Q;  4R4T A;  4IPH A;  4BBS G;  2AHO B;  2JA9 A;  1EQQ A;  3UE0 A;  4IFD J;  4GKJ L;  5IP7 H;  1EWI A;  3J81 j;  3T1H L;  1P16 A;  3PF4 A;  1IYJ B;  1TWF H;  4JI1 Q;  3PIO A;  5C44 H;  2N49 A;  2E2I H;  4X65 L;  3CCQ A;  1H95 A;  3UDI A;  3CW2 C;  3GTL H;  1Q82 C;  1R9T H;  1N33 Q;  5HGQ A;  4GKK Q;  3STB D;  1T9H A;  2E2H H;  2Q2T A;  4NXN L;  5ELN A;  5IP9 H;  2E5L Q;  1SLJ A;  2YV5 A;  4HJ5 A;  4A3E H;  3CF5 A;  1YZ6 A;  4LUO A;  3U4V A;  1YJN A;  1PH4 A;  2XGT A;  3K8A A;  4DPG A;  2PMZ E;  4X62 L;  1L0W A;  3B6Y A;  4DV3 L;  1N32 L;  4A3C H;  3HKZ G;  1I94 L;  2C35 B;  3J80 c;  4NXM Q;  1SR3 A;  3UDG A;  1NE3 A;  3GTO H;  3WWV A;  1K8A C;  4LWC A;  4B3T Q;  1YNX A;  1XMO Q;  5BR8 Q;  1KC8 C;  2Q2U A;  2R7F A;  1P8L A;  3PUZ A;  3JAM i;  1A63 A;  1S40 A;  2L15 A;  4HID A;  3T1H Q;  1SN8 A;  2Z6K C;  2UU9 Q;  4H02 A;  1AE2 A;  3HFZ B;  2F52 A;  4UY8 C;  2CCZ A;  1XTD A;  3OTO Q;  4GOP A;  1KD1 C;  3PCO B;  1Q81 C;  2YTV A;  1HR0 L;  2WAQ G;  2VQE Q;  3GO5 A;  5AJ3 Q;  1AE3 A;  4MZ9 A;  3MEF A;  3CCU A;  1GD7 A;  3U58 A;  4JI5 L;  1PH3 A;  2GN5 A;  4OO1 G;  4LF7 L;  4POG A;  4DV4 L;  5GAH C;  3HOZ G;  3GTP H;  1HNW Q;  4JI7 L;  1VQ6 A;  1YVC A;  4RMF A;  2R93 H;  1TXY A;  1IBK L;  4JYA L;  3I55 A;  3L2P A;  1K9M C;  1YBY A;  3OYY A;  4A4I A;  3PGZ A;  4DR1 Q;  2IY5 B;  3RN5 A;  2JQO A;  1K73 C;  4IFD I;  4QY7 A;  1UE7 A;  1G51 A;  2JA7 H;  4JBW A;  4A3L H;  3JC6 6;  4UP7 A;  4HIK A;  2IX0 A;  3G48 A;  2UUB Q;  3L0O A;  1E1T A;  2K52 A;  1LYL A;  3CCR A;  3S1M H;  3I56 A; 
#chains in the Genus database with same CATH topology
 3I4N H;  1EZ6 A;  2EYP A;  4B3R L;  1QJO A;  4C3H G;  1VQD A;  3BS1 A;  4FF2 A;  1HTP A;  1X55 A;  1KXL A;  1VQP A;  1SAP A;  1LTL A;  5LMN Q;  1Y8O B;  3U50 C;  4UHV A;  2EQS A;  1CKM A;  4YIJ A;  1Q1B A;  1DYQ A;  2B2V A;  5EBC A;  1BNZ A;  1B70 B;  4A3C G;  4JC0 A;  2AKW B;  1LT5 D;  1VQB A;  3H09 A;  3CC7 A;  2UXD Q;  2IX1 A;  2K4K A;  3I73 A;  2SNS A;  4CDD C;  2CWA A;  2ZXR A;  1F2M A;  4ME5 A;  3SK6 A;  2SDF A;  4L5T A;  1HNX L;  4B3T L;  2F0J A;  4KJN A;  3T53 B;  4GOP C;  2WP8 J;  4DV0 Q;  1L1O B;  1XWE A;  1SJH D;  4O42 A;  1Q12 A;  2NTT A;  5JJI A;  4TSS A;  4UDU C;  1QB5 D;  3C46 A;  1YIT A;  1X3E A;  2B63 H;  1ILQ A;  3GTG H;  1U9R A;  1EOV A;  5CBA E;  3GV6 A;  5JAV A;  1DCZ A;  2J0T D;  2LS0 1;  2Z6B A;  1X56 A;  1V1P B;  1QWY A;  3T1Y L;  3K7A H;  3HZX A;  2ZXO A;  4A3M H;  4DR7 L;  1E22 A;  4EQP A;  4PMB A;  1VMP A;  4B08 A;  3CPW A;  2MUY A;  2F3W A;  3I70 A;  3HOV H;  1RTO A;  3W1B A;  4FF3 A;  4QCL A;  4QIW B;  1UE6 A;  4ZQ3 A;  3ER0 A;  1FR3 A;  2A73 B;  4BY7 H;  3W2D A;  2F0P A;  2H5X A;  2FMC A;  4KHZ A;  1K0R A;  3T56 B;  1Y1W G;  2NVX H;  1TWH H;  3R2I A;  4A3I B;  5C4X H;  3K0Y A;  1VQG A;  1SYF A;  3KJO A;  5KRU A;  1Z7T A;  1K3B C;  3T1Y Q;  2CFM A;  1LV9 A;  2NB0 A;  1EIY B;  5FLM H;  2Z9H A;  1SE3 A;  3SXH A;  1YI2 A;  1SSO A;  1II3 A;  1RDP D;  4DR3 L;  3IAY A;  2RBM A;  1L1O A;  5TSS A;  4YCW A;  2A8V A;  5CYU A;  4N8F A;  3GV3 A;  1JOK A;  2M2L A;  4JOI A;  3J7A V;  3VR6 A;  2JEA I;  4PZ6 A;  4LF9 L;  5CV6 A;  4CJ0 B;  4FF1 A;  2D2C C;  4B3M Q;  3K81 C;  3PUY A;  3KDF A;  1AH9 A;  4RH6 A;  2BA0 A;  1SMY C;  1C7Y A;  4NB3 A;  3SE0 A;  2EY5 A;  2NVQ B;  4O2D A;  4GLX A;  3TS2 A;  2I5L X;  1YNJ D;  5M9O A;  2B2V C;  2EE1 A;  3NBH B;  2J4X A;  1WVL A;  1SNQ A;  5I2Y A;  5JVH 3;  1SND A;  1Y8N B;  1VQA A;  1Q8K A;  5IYC H;  1YEZ A;  4WJW A;  2F4V Q;  1WYD A;  2ZM6 Q;  4YHH L;  5IYB G;  3Q6S A;  2F0E A;  3MXU A;  4HJ9 A;  4GOP B;  3NTH A;  2QDB A;  4C3I H;  3KYH C;  1N33 L;  3QOJ A;  3CCJ A;  2X6L A;  1ICW A;  1TQO A;  3QJY A;  4DAV A;  5C4J H;  4ZUI A;  3A8K E;  3BYY B;  1NMG A;  5DAU A;  1CKO A;  3M9B A;  1UWV A;  2KEC A;  3BZD B;  2AWN A;  4OWT B;  3KLS X;  4X64 L;  2VNU D;  1DZ1 A;  3F2D A;  5EKI A;  1IW7 C;  4JOI C;  2JJQ A;  3P20 A;  1GKH A;  4EQO A;  1ZEQ X;  4X6A H;  4K8J A;  1YHQ A;  1I4X A;  1K8M A;  3E5S A;  2QF7 A;  5KNB A;  4G7O C;  1IL2 A;  4IUV A;  4R4I A;  2RCF A;  3QIA A;  1B8A A;  3PO3 H;  4A3D B;  2E2I B;  5BN4 A;  1JR0 D;  3NUC A;  3GTL B;  5IYD H;  2BE5 D;  2DN8 A;  4HIM A;  1PYB A;  1F9P A;  3S1R B;  1JJC B;  1Y1W B;  4M8A A;  3AEV A;  1EUJ A;  1PRT B;  2K03 A;  2NWG A;  4JI0 L;  1VQN A;  1N32 Q;  3DEO A;  3M85 A;  2ZTD A;  2JA6 B;  3H3V C;  1LUZ A;  2A69 C;  1RL2 A;  1XMO L;  3S1M B;  1TWG H;  2HT1 A;  4K5W A;  4IUU A;  2R7Z B;  2ZM6 L;  1PH8 A;  1BDO A;  4AQY Q;  1EFW A;  1KL9 A;  3J81 E;  1S4Z A;  3S1N H;  5KNC A;  2J7Z A;  4CJ1 B;  2MGS A;  3PUX A;  4HCE A;  1N8R C;  4A75 A;  1CI3 M;  4K0K L;  3CME A;  2MQH A;  3GTP B;  5AJ3 L;  5GAE C;  4LFB Q;  1CHP D;  3CAM A;  2I5H A;  2O2L D;  4A3E G;  1OTC A;  1EIF A;  5I6Y A;  3VDY A;  1XMQ L;  4WJ4 A;  3FKI G;  4ZKC B;  4NMZ A;  1O78 A;  3LGJ A;  2IT1 A;  2CH4 A;  2N55 A;  4A3F H;  1X3F A;  1BUV T;  4OX9 L;  1NJI C;  1DGS A;  5C0X H;  1V8Q A;  5L37 A;  1MD2 D;  2WAC A;  5CMD A;  3X3M A;  1NNX A;  1BVS A;  4DF7 A;  4JVZ A;  2EZV A;  3H91 A;  4L63 B;  2F0K A;  4J1M A;  4LF8 L;  2XRS D;  4TVA B;  4KMU C;  1KDA A;  1EIH A;  4QMG A;  4LFA Q;  1HCZ A;  5COR A;  1STY A;  2R92 H;  2MO1 A;  3KF6 B;  2VXW A;  4EQN A;  2E74 C;  4IPC A;  4MHE A;  3GTO B;  1LTI D;  1CT1 D;  2KOL A;  5JPN C;  1DON A;  3KLW A;  3OOC A;  4OEL B;  3T13 A;  4C3I G;  3J81 L;  1EY8 A;  3IKJ A;  2YTY A;  4AYB E;  3OSO A;  4N9T A;  3A0J A;  5G3L F;  4JBK A;  2K1B A;  4ZYS A;  3PIP A;  3D31 A;  2CQA A;  3OIP A;  2AWO A;  3BVG A;  3S1R H;  3S2H H;  5A35 A;  1DOL A;  4LFC Q;  5EPL A;  1N36 Q;  1FL0 A;  2RHQ B;  3HG9 A;  4X3S A;  3TDQ A;  1HZA A;  4R8N A;  1B1Z A;  4MNO A;  1E2W A;  4MIU A;  4O0A A;  1TWG B;  2KCC A;  4HCS A;  1PH2 A;  2LSS A;  3M3Y B;  3I4N B;  1CHQ D;  1EWC A;  3GTK H;  4YWL A;  1EEF D;  5CV8 A;  3PO2 H;  1ENC A;  1JJG A;  1WCM H;  4DR4 Q;  4N9P A;  1KRT A;  1I4H A;  3NBI A;  1MKH A;  1E3P A;  1I6H H;  1PH5 A;  1VQH A;  4S3S A;  3VYU A;  4OL7 A;  2HQE A;  1QVF A;  4C2M B;  2B2T A;  1OXV A;  4DA2 A;  2VB2 X;  4B3S L;  2R6G A;  4OWW B;  1TWH B;  2GVA A;  2QKI C;  3VYS A;  1BBW A;  2JN4 A;  4A3G G;  2CKZ B;  1R4P B;  4B9W A;  3D3R A;  4Y52 H;  3I8Z A;  4PZ8 A;  1BKB A;  1JIC A;  1A3V A;  1DM0 B;  3ZJY C;  1SJE D;  4DR5 Q;  3MXG A;  2HDL A;  3GTM B;  5G3L D;  5IOD A;  1DOK A;  1B7Y B;  1SRO A;  1X3P A;  4GLV B;  4PMW A;  2XRQ D;  2WAQ B;  4JI8 L;  3FRP B;  4JPB W;  1KIX A;  3ULL A;  3HOV G;  4DKA C;  3DWP A;  3G7L A;  4WFN 3;  4H13 C;  4KJO A;  2ZJR A;  2Z0S A;  1IXR A;  1VQM A;  2NVY H;  2MJ8 A;  1GHK A;  2SNM A;  3HKZ E;  3U9O A;  3H6M A;  3BU2 A;  3DEP A;  4PV1 C;  1WTV A;  1XNQ L;  4A3M B;  3E0E A;  4UPA A;  3Q24 A;  2O5I C;  4CKB A;  3I4L A;  1HXY D;  4LF5 L;  4BBS B;  3DM1 A;  1JB7 A;  2WB1 G;  4IJL A;  2XWB B;  2A5H A;  3SDZ A;  3A7L A;  4BBS G;  2JP1 A;  5IP7 H;  2LY7 A;  3MWY W;  4XQQ A;  1TWF H;  2SEB D;  1RCV D;  4B9X A;  2N49 A;  4RWS C;  4X65 L;  3CCQ A;  3CW2 C;  4WRD A;  5M5W B;  5FK9 C;  1F2Y A;  1D1I A;  2NVX B;  2E2H H;  3OMC A;  5ELN A;  3CF5 A;  4OHJ A;  1YJN A;  1PH4 A;  1SFO B;  1HPC A;  2F0S A;  2C35 B;  3FKI B;  1AFP A;  1IL8 A;  1SR3 A;  3KLS A;  1NE3 A;  3WWV A;  3I90 A;  1K8A C;  4LWC A;  4B3T Q;  1XMO Q;  1H9R A;  2F0T A;  3G6J B;  1GOZ A;  2Q2U A;  3PUZ A;  4RGM A;  1A63 A;  1FNV A;  1EIG A;  2UU9 Q;  1RD9 D;  2CCZ A;  1PFM A;  2YTV A;  5AJ3 Q;  4MZ9 A;  3MEF A;  5LL6 X;  2KHS A;  1D5M C;  4JI5 L;  4F8M A;  4POG A;  1F2Z A;  4OIJ A;  2B2T C;  3F2U A;  3L2P A;  1LT3 D;  3OYY A;  3M4Y A;  4RAU C;  3ND8 A;  4IFD I;  4UP7 A;  4HIK A;  2UUB Q;  1EY0 A;  3K7A B;  1LYL A;  3CCR A;  3S1M H;  1PLF A;  2RDH A;  4V19 0;  1YJ9 A;  1HA6 A;  4X3U A;  1XXG A;  1STG A;  5M3F B;  3CP0 A;  5C0X G;  1A62 A;  1EU3 A;  2B8G A;  2FFK B;  3HOU H;  1SEB D;  3NTK A;  1J9O A;  3MZ5 A;  1W2B A;  4G7Z C;  1UE1 A;  1CUK A;  1EFI D;  5M3M H;  4DR1 L;  5DM6 3;  4IFD G;  1H9J A;  4HR7 B;  1Z6H A;  4YWM A;  1ASZ A;  1HUN A;  5C4X B;  2PCF B;  2KEN A;  4HED A;  3E9H A;  5EAY A;  2WAQ E;  2B2Y C;  3FPP A;  1R4Q B;  4LF9 Q;  5DNF A;  4IOC A;  1H9M A;  1E2Z A;  4ULL A;  1E24 A;  3ITP A;  2XTI A;  2IL8 A;  4IQZ A;  1K3R A;  4DUZ L;  3Q22 A;  1GUO A;  3STB C;  2D62 A;  3KF6 A;  4AYB B;  4KLK A;  3M7N A;  2RHS B;  2ZT9 C;  3I2Z A;  1EYG A;  2QCP X;  4DR2 L;  2UUA Q;  4IPD A;  1CQV A;  2RCN A;  3TZD A;  3S2D H;  1XPO A;  1J6Q A;  1QIL A;  5JJZ A;  5LMN W;  3HRZ C;  1WD0 A;  3CD6 A;  3HOW H;  5IT9 c;  4ZKB B;  5JPM C;  1WTP A;  1GHJ A;  1W3S A;  4FO2 A;  1CTM A;  2KED A;  3RD4 A;  4OWX B;  4JI3 Q;  2F03 A;  1KDC A;  2BH8 A;  2ZTE A;  1QVC A;  5ELE A;  5JJL A;  1E2V A;  4DV0 L;  1F2L A;  1Q8I A;  4LF4 L;  4RGT A;  5IYD G;  1SMY D;  4L6T B;  1MHW C;  5E7N A;  4OO1 H;  4DV2 Q;  4U68 A;  5CV5 A;  3SK5 A;  2TSS A;  4ALP A;  2PO4 A;  4IPG A;  1NCV A;  2VY3 A;  1IKL A;  1JE4 A;  4C3I B;  2Y0S G;  2WV6 D;  1YNJ C;  1QUQ B;  3AFP A;  1LTB D;  1ET9 A;  4X64 Q;  4BY1 H;  5GRO A;  3DUZ A;  5IGE A;  4KHV A;  1D5X C;  3BZK A;  2OF1 A;  3SEB A;  3M4O B;  1FVI A;  5GQO A;  2K14 A;  3GTK B;  4OEM B;  2K5V A;  3VR3 A;  1GUT A;  4JI6 Q;  4G4K A;  1MJE A;  2QEJ C;  2EY6 A;  4NP5 A;  3R3O A;  5M5Y H;  4C3J G;  3J7A 5;  3ULJ A;  5KGU A;  3E6Z X;  3LX0 A;  4HSP A;  1J5E L;  4GN4 B;  1TWC H;  2V1C C;  2JA6 G;  3OWE B;  3FEW X;  3NK9 A;  5CGK A;  5D3I B;  3R93 A;  4GN3 B;  2JA5 B;  2F4I A;  4O1N A;  2VS1 A;  4BY1 G;  3W5O A;  3HOX G;  4N8X 1;  3GQB A;  4LF5 Q;  5C3E G;  3CCV A;  4C3H B;  3FPU B;  5IY0 A;  1Y1V H;  5GAG C;  2IHF A;  5I4D A;  4IAL A;  1STN A;  1SYD A;  4QQB X;  2HHH Q;  2MP1 A;  1X6O A;  4B3M L;  1EYA A;  4QL5 A;  2BE5 C;  1S5D D;  3K5L A;  1GUG A;  2FIN B;  1TWA H;  3KF8 B;  3M4Q A;  4C1N K;  2H1E A;  4Q0F A;  1ZYR D;  2R93 G;  1I94 Q;  3PMF A;  4YY3 Q;  2GVB A;  2Z4I A;  4X62 Q;  2M9V A;  1VQK A;  2UXB Q;  1PRT D;  4QGU A;  2M00 A;  1K83 B;  2Q2I A;  4DFA A;  1L0X B;  3A7A B;  4BBS H;  4DNI A;  2UU9 L;  2CW0 C;  3H15 A;  3ERS X;  1QNU A;  4QUC A;  1HH2 P;  3SGI A;  3S16 B;  2NUC A;  1K8G A;  1BCP D;  3PUW A;  2F0G A;  1BQQ T;  1TWF B;  4C2M H;  3K57 A;  4Q5V A;  4AIM A;  3H94 A;  4NDX A;  1JCK B;  4XT1 B;  4ME3 A;  1YNN D;  1E7Z A;  4IUQ A;  1U4R A;  2KA7 A;  1L2F A;  1MJC A;  2KHI A;  2N8N A;  5FOB B;  3VA5 A;  2A68 C;  3OIQ A;  3IRB A;  4AYB G;  3NPP A;  1MSH A;  1W6K A;  3BDL A;  3VR2 A;  1I5F A;  4DK1 A;  4JI4 L;  1NMF A;  4A3K B;  3GTM H;  4ABN A;  4OXP A;  1IBL L;  1VDZ A;  1O7L A;  1UEB A;  1Y14 B;  4CKC A;  2A6E C;  1Q7Y C;  4K6D A;  2MO0 A;  2HCC A;  4RG1 A;  1I3Q B;  2VQF Q;  2EYL A;  2JA8 G;  1VQL A;  2RVL A;  3CCS A;  1XTC D;  4LF7 Q;  4EVO A;  2PZT A;  5CV4 A;  3MA2 B;  2ALY B;  2A6H D;  2NYZ D;  3IFT A;  2BCO A;  2ATW A;  1LTR D;  4MTK A;  4YY3 L;  2MPM A;  3PUV A;  5IT9 E;  2K33 A;  1F77 A;  1HQR D;  2AMC B;  4BXX H;  3URY A;  2BDN A;  1ASY A;  5M3M G;  3VYR A;  1YHA A;  2CQO A;  2LXK A;  1IBM Q;  5IYC G;  4R4O A;  2VUM G;  3BVM A;  1V9P A;  3HOU G;  4RCN A;  3AYH B;  1B2T A;  1FGB D;  1FJG Q;  5JJK A;  3A5Z B;  2E2H B;  1D6E C;  1I6H B;  4LFB L;  2ZTC A;  3DLL A;  3HKS A;  3OPO A;  2R7D A;  3RZD H;  4LMQ D;  5ELF A;  2NZO A;  1JOR A;  3NP8 A;  3FKI H;  3G6E A;  1UE5 A;  1CZG A;  5KIX A;  2NZH A;  2PMZ B;  2Z1C A;  2NVT H;  3LNN A;  3D0F A;  3QG1 A;  1JOO A;  1G91 A;  2F0Q A;  2KCN A;  3TRZ A;  5LL6 S;  1NUC A;  5FO7 B;  1A3T A;  2F0V A;  5IP7 G;  1JQY D;  1RF2 D;  1KAW A;  3H0G B;  3P7J A;  4EGV A;  4DV1 L;  1CSQ A;  2UXC Q;  1QZG A;  1DJR D;  1PMR A;  3I4M G;  1AZQ A;  4YCU A;  1FD7 D;  5IOC A;  4DXF A;  1QOH A;  1HTL D;  4A3B G;  5FLX L;  4LF6 Q;  3TME A;  3GP7 A;  4IN3 A;  2OQK A;  2K01 A;  3CCM A;  2IPK D;  3EJI A;  1BF4 A;  1FNU A;  4J15 A;  3A74 A;  2CHB D;  4BXX G;  4KN7 C;  4HJA A;  4I65 A;  3A8J E;  5FLX c;  5HY6 A;  5M3F H;  3U4Z A;  4JBJ A;  4JI3 L;  4E6I A;  1CQF A;  3PO2 B;  5EKK A;  1C0A A;  2E8G A;  1JWS D;  3D4W A;  2EYJ A;  1NR4 A;  3OW2 A;  1MIU A;  1ZXT A;  1VQ4 A;  1V43 A;  2EPB A;  1X9N A;  5ISR A;  1G8Z D;  4NXM L;  1DOM A;  2OQ0 A;  2EIF A;  5M5X B;  5C4X G;  5JEA H;  1ENA A;  1D2B A;  1HFN A;  4XTC S;  4JV5 Q;  3MVV A;  1SNO A;  4L5R C;  4G7H C;  2K50 A;  3F8T A;  2RF4 A;  4JI6 L;  3RN2 A;  1ZYR C;  4GN5 A;  4JI7 Q;  4A3E B;  2JK8 A;  2D0P A;  1GUS A;  2NN6 G;  2PNR C;  2R61 A;  3BDC A;  1YHB A;  4KD4 A;  3BG3 A;  3TP6 A;  3CC4 A;  1SE8 A;  1WOC A;  1EY4 A;  2FXQ A;  2KVM A;  1SMX A;  3HOZ H;  3CCE A;  4X66 L;  1LAB A;  4K5X A;  5C3E H;  4PMC A;  3AFQ A;  3DWQ A;  2DJF C;  2NTS A;  1IKM A;  4OIK A;  4JBM A;  4QJF A;  4DR5 L;  2BH2 A;  1G6Z A;  1TII D;  3CRL C;  3NEN A;  1LTT D;  3WDN A;  5ELB A;  1M4V A;  3UE0 A;  1SNC A;  1MI2 A;  1MBY A;  5C44 H;  1SE4 A;  1PZJ D;  4KV6 A;  3P1H A;  1Q82 C;  1PTO B;  1R9T H;  1N33 Q;  4GKK Q;  3STB D;  1T9H A;  2Q2T A;  5EPJ A;  1E0B A;  4NXN L;  5IP9 H;  1GUW A;  1A3U A;  3ND9 A;  4HJ5 A;  3FVQ A;  4HN7 A;  3ONA B;  3TP7 A;  1L0W A;  1I4G A;  1UUP A;  4A3C H;  1HRJ A;  1FYC A;  2KUM A;  3KBG A;  1EYD A;  5FKA C;  1L0Y B;  2A6E D;  1Y8P B;  3QR8 A;  1P8L A;  5DEH A;  3JAM i;  1VF7 A;  3EA6 A;  2C9O A;  3T1H Q;  2Z6K C;  3R8B A;  4UY8 C;  1AE2 A;  3HFZ B;  2F52 A;  1EY5 A;  1XTD A;  3OTO Q;  1HR0 L;  1Q81 C;  2K05 A;  4CDC C;  2YU9 B;  3U58 A;  2LKV A;  4BY7 B;  1GD7 A;  3X3N A;  2GN5 A;  4OO1 G;  2EOT A;  3O13 A;  3HOZ G;  1CA6 A;  4JI7 L;  1VQ6 A;  1YVC A;  1I4R A;  1TXY A;  4QF4 A;  4BWG B;  2JQO A;  2PPB C;  2EXZ A;  2KQ3 A;  5KYI A;  1K73 C;  3PIP 3;  2F3V A;  1UE7 A;  1G51 A;  4A3F B;  1Y1V B;  1IYV A;  2JA7 H;  5CR3 A;  1BCP F;  4A3L H;  3G48 A;  2K52 A;  1HNZ L;  1GO3 E;  1OXT A;  1S5C D;  3K0X A;  2JA8 H;  2PQE A;  4K14 A;  1NY4 A;  2WKC A;  3RLO A;  2K6A A;  3PIO 3;  4KHP L;  1A0I A;  3H0G G;  4FVM A;  2VQF L;  1JWU D;  2F0F A;  4A3I G;  1PV4 A;  1XPR A;  4DK0 A;  3HOZ B;  1LT6 D;  1PXU A;  3SVM A;  1PRT F;  1VQJ A;  4FYD A;  4A3F G;  3VA7 A;  3RLF A;  3FMC A;  2IWH A;  5K36 G;  2JEB I;  4DR6 L;  1O7Y A;  4H44 C;  4WJ3 M;  1E1O A;  3JAM E;  1QE6 A;  2XSC A;  1TS3 A;  4LUZ A;  1VMC A;  1IBM L;  1OXS C;  4PNY A;  3VYT A;  2B29 A;  4A3M G;  4JCV E;  4IJH A;  2UUC Q;  1RIP A;  1KAB A;  3K6O A;  1WTX A;  3V05 A;  3W3A A;  4HIO A;  1TS4 A;  2C5C A;  2OCE A;  4P71 A;  4A3I H;  4UP9 A;  2XWJ B;  3EVQ A;  4YCV A;  2WII B;  4JI5 Q;  1SYG A;  2XVS A;  3I4M H;  2OEO A;  4K6L A;  3PF5 A;  1SYB A;  5IWA L;  3QOL A;  5EJW A;  4G57 A;  4APV A;  5D3D A;  2ENB A;  3K5O A;  4L8J A;  1VCI A;  3SR1 A;  3J7Y W;  3NBH A;  2F0D A;  3DMU A;  1QVG A;  1YJW A;  4A3G B;  4LUV A;  1GJX A;  2WFW A;  1Z9F A;  5IE8 A;  2X69 A;  2NVQ H;  1BCP C;  4KI0 A;  3GTJ H;  1M8A A;  1OO9 B;  2NBF A;  3L7Z C;  1AEX A;  4RKL A;  2L12 A;  2KJX A;  4GNX C;  2Q2H A;  1EOT A;  3EIV A;  1Q46 A;  2Q8T A;  1N36 L;  3TEH B;  1TS5 A;  4BY1 B;  1H9K A;  1HHV A;  2EY2 A;  2JA6 H;  4I7A A;  4DAM A;  3K5N A;  3VR4 A;  1C4Q A;  3I4N G;  5IT9 L;  2OXP A;  1D8L A;  2N3S A;  4WOR A;  3S15 H;  4NPS A;  3C3L A;  2HHH L;  4RKB A;  3F2C A;  3NEM A;  4A93 H;  2ZXP A;  3HS0 C;  2YYZ A;  5C4J B;  4DV6 Q;  4DR4 L;  2AUK A;  4DUZ Q;  3S16 H;  1JC7 A;  1HJP A;  1Z47 A;  2B2W A;  4X66 Q;  4XYQ A;  1GVP A;  2F0I A;  2KCM A;  2L11 A;  1EQR A;  2LXJ A;  1A2T A;  2K5N A;  1TWC B;  1ENF A;  1PZI D;  2KHJ A;  1EY7 A;  4HJ7 A;  3OMG A;  2NZ1 D;  2F0H A;  1LT4 D;  2EY1 A;  1BBU A;  4KKT A;  2I5M X;  4A3K H;  2B39 A;  2HDM A;  3M4P A;  3NQI A;  1T5X D;  5M5W H;  4H0L C;  4QIW E;  3DM3 A;  4IOA A;  2N78 A;  2O4X A;  3LWU A;  2PNH A;  1YNN C;  3ERO A;  1I3Q H;  4GNX A;  3I4M B;  1ILP A;  3DXJ C;  2EYH A;  3V2T A;  1C8C A;  1K8O A;  3GTG B;  2R92 B;  3RZO B;  3D6W A;  4RA8 A;  3R2T A;  1FNW A;  1Y1V G;  3JAM L;  3ULP A;  1K28 A;  1ONL A;  1WJJ A;  1XNQ Q;  2EYO A;  4BA2 I;  1ESR A;  2OTL A;  4DXG A;  1BCP B;  1B53 A;  2AQ2 B;  4UAI A;  4A3G H;  4XQN A;  3J80 L;  2EJM A;  5EGT A;  2E2D C;  3OTO L;  3GTJ B;  3LWE A;  4JI1 L;  2DY8 A;  1FGU A;  4HTH A;  4TKO B;  4X65 Q;  1KQS A;  5FO9 B;  1EY6 A;  3A5U A;  1OXU A;  4GKK L;  2WKD A;  3CC2 A;  2A6H C;  1PH9 A;  1SNM A;  4JYA Q;  3F1Z A;  4DN4 M;  3KUP A;  3SK8 A;  1WFQ A;  1TY2 A;  2PZW A;  5HGT A;  4DV3 Q;  1LM0 A;  3KOJ A;  3ICE A;  4BBR G;  1S5E D;  5C4H A;  3VR5 A;  1STE A;  3S15 B;  1V1P A;  4UP8 A;  3K80 C;  1I6V C;  4A93 B;  4DAY B;  3AQQ A;  3K58 A;  3QO2 A;  1RJT A;  4KHP Q;  3U9S A;  3HOU B;  5EBD A;  1HR0 W;  2YU9 H;  2VUM H;  3C1E A;  2PI2 A;  1PA6 A;  4K2L A;  4A3D H;  3J80 i;  3UE1 A;  3CMA A;  4XDX A;  2UXD L;  2NN6 H;  4DR6 Q;  2QGQ A;  3CKI B;  1CA5 A;  1HNW L;  2VB3 X;  4A76 A;  4JI4 Q;  3MFY A;  3NSW A;  4A93 G;  1K0S A;  5C44 G;  5F2D A;  1D7Q A;  4J8Q A;  5ELD A;  1KLU D;  5I9O A;  3H3V I;  2Q8R E;  1KRS A;  3NWS A;  1U4L A;  3BDO A;  4RGN A;  4Y7N H;  4L5S A;  5GAD C;  2Y0S E;  1KHI A;  1KNE A;  2D0O A;  3MXN A;  3G4S A;  4CGY B;  1NR2 A;  4OGQ C;  4K0K Q;  2AQ3 B;  4H7B A;  2RA4 A;  3RZO H;  2RDG A;  3HOW B;  3J7A F;  4F88 A;  3MFG A;  5JEA J;  3GTQ B;  3S1Q H;  2VL6 A;  3HOY B;  2MFI A;  3KFU A;  3FP9 A;  2BOS A;  1TKW B;  4GS3 A;  3M3Y H;  5M3F G;  1GM5 A;  2NVT B;  4GLA C;  1DD2 A;  1VQ9 A;  3NXW A;  3A8I E;  3N52 A;  3HOX B;  4XYO A;  1B4O A;  2WB1 E;  2CH4 W;  4ODG A;  5IGG A;  2ID0 A;  4I7Z C;  1PVO A;  3A56 A;  1EYC A;  2ICI A;  4OON A;  5KEE A;  5AFW A;  2R92 G;  1B9M A;  4RGO S;  2FHT A;  2KEE A;  4DV2 L;  3HOW G;  3MEH A;  4RCO A;  3H0G H;  4ZAI A;  3TBI B;  3CU7 A;  4KD3 A;  2OTJ A;  4DNR B;  1IHZ A;  3TN2 A;  1Y1W H;  1D1K A;  2QDL A;  1YIJ A;  2JA7 B;  3EN2 A;  2CWP A;  2L5T A;  4IUR A;  4DV7 L;  1XNR L;  3TZU A;  3BZC A;  1XMQ Q;  4A3L G;  5BN3 A;  1HZC A;  2G9H D;  3MXN B;  4CHT B;  2E76 C;  5E3F A;  1KNA A;  3KDF B;  1UEA B;  1VQI A;  4FF4 A;  3QB3 A;  3HOV B;  1EU4 A;  2HIV A;  2UXC L;  3T4A C;  2NVY B;  3CCL A;  1SXT A;  1FJG L;  1A8V A;  4A3B H;  1EL0 A;  2EXD A;  1LTA D;  5C3X A;  4HJ8 A;  2PI2 E;  2D9U A;  3NQT A;  5IGB A;  4L5Q A;  1PH7 A;  2IJ0 A;  1JWM D;  5NUC A;  1X65 A;  4YHH Q;  1U4P A;  2K5H A;  4P74 A;  4DUY Q;  5FJ8 H;  2RSO A;  1O7I A;  3RMH A;  2F1M A;  1TR5 A;  1PZK D;  5EKL A;  3MAQ A;  4PZ7 A;  3JAM c;  2WB1 B;  4Y7N B;  3S14 B;  1TWA B;  4ZUJ A;  4GKJ Q;  1W6J A;  3PO2 G;  2B3G A;  4M1U B;  1WTQ A;  3OHX C;  4IUP A;  4K5V A;  2HUG A;  5IYB H;  1X3Q A;  3G71 A;  4Z9C B;  4YWK A;  2D5D A;  5I2X A;  1J5E Q;  1K83 H;  3ERQ A;  1JJ2 A;  1EEI D;  3EFX D;  2UUB L;  5C3E B;  1UNS A;  4CKE A;  3T16 A;  3C2P A;  1EZ8 A;  2ES2 A;  2ZJQ A;  3Q8D A;  3HOX H;  1ML0 D;  3E9I A;  3RNU A;  2RQX A;  2A74 C;  2DNC A;  3KBX A;  4HAE A;  4B3R Q;  4IFD J;  1EQQ A;  3UI2 A;  4X3K A;  4GKJ L;  2PW7 A;  3J81 j;  1KDB A;  3AB9 A;  1P16 A;  1IYJ B;  4PQX A;  1F9S A;  5HGQ A;  4A3J B;  1WTO A;  4ID6 A;  1PTO H;  1R9T B;  3T51 B;  2E5L Q;  1YZ6 A;  4J6H A;  4LUO A;  5C5M A;  1BO0 A;  3K8A A;  4DPG A;  4X62 L;  4DV3 L;  1PTO D;  1N32 L;  3HKZ G;  5FO8 B;  1I94 L;  1H9S A;  1SYE A;  3MHB A;  5IGC A;  3N6R A;  5K5P A;  3UDG A;  5I9P A;  3AU7 A;  3FDT A;  1STA A;  1STB A;  5BR8 Q;  4DU9 A;  1SNP A;  1S40 A;  2F0M A;  1SN8 A;  1KD1 C;  4HSV A;  2EYF A;  3CHB D;  1AE3 A;  3E3X A;  3CCU A;  4A3B B;  1PH3 A;  2PYK A;  4DV4 L;  5GAH C;  5M3M B;  2R93 H;  1IBK L;  1SDF A;  3I55 A;  1NAP A;  1BOS A;  1YBY A;  3L3O C;  4DR1 Q;  4DAY A;  3RN5 A;  1A2U A;  1KTK A;  2GA4 B;  2HD3 A;  2DY7 A;  5IGF A;  1EQT A;  3JC6 6;  2K32 A;  2I46 A;  3I56 A;  1HA5 A;  3D4R A;  4CDF C;  4LF4 Q;  2LFN A;  1S3O A;  3UDX A;  4POF A;  1LTG D;  1QG7 A;  5D65 A;  2JA8 B;  1KAA A;  3IL8 A;  1RHP A;  1AZP A;  4AQY L;  1AW7 A;  2OT2 A;  2R7Z H;  3NHH A;  2K04 A;  2B2U A;  4LFA L;  1WI5 A;  1U5K A;  1TY0 A;  2DNE A;  1HZB A;  1RTN A;  1ROD A;  4FDB A;  4JW0 A;  1JOQ A;  2JA7 G;  4XQJ A;  2A69 D;  2L0C A;  1PTO C;  5LHY 1;  5JVG 3;  3OWF A;  4EQ5 A;  1CFM A;  2EJG C;  2K5D A;  1V1Q A;  3OW7 A;  1KLG D;  4OX9 Q;  2HIX A;  4IO9 A;  4A3J H;  1CM9 A;  4LFC L;  1VS0 A;  1MGS A;  2B63 G;  4KY6 A;  3SHL A;  4GNX B;  5LMU Q;  1CK1 A;  2JE6 I;  2HCI A;  2E2J H;  4LF8 Q;  1SFO H;  3CPF A;  3E0J A;  2A1A A;  3GTQ H;  2BDO A;  3TS0 A;  1NSN S;  3I7F A;  4IUN A;  2L1B A;  4R9W A;  4XXE A;  4KN4 C;  4BBR H;  4P75 A;  2PW5 A;  3Q23 A;  5DLQ E;  3CRK C;  5T1I A;  5IP9 G;  2Y0S B;  5K36 H;  2PZU A;  1PH6 A;  2ICE C;  2HQL A;  2UUC L;  2XN9 C;  1QCB D;  2N88 A;  2VZA A;  3HGB A;  3CQZ H;  4ZLT F;  2VUM B;  2IHE A;  4KKU A;  2TMP A;  1G2S A;  5FLM G;  4DV6 L;  4K2K A;  2R7Z G;  1G6P A;  4P73 A;  2Z6K A;  4DV1 Q;  1Q90 A;  4OO1 I;  3KJP A;  5IGD A;  1U4M A;  1WTW A;  4KTA A;  1VQ8 A;  2Q8I B;  1VQO A;  5DM7 3;  4LF6 L;  4KY7 A;  4LAA A;  5BN5 A;  2VW9 A;  2QEX A;  1NTG A;  2F4V L;  3EBE A;  1XJV A;  4C3J B;  4P72 A;  2PQA B;  4R8I A;  2EDG A;  5J39 A;  3S17 B;  2R3Z A;  4QB4 A;  1QUQ A;  1WCM B;  1S72 A;  3TRE A;  5C0X J;  2ASB A;  2K28 A;  1X54 A;  3NE5 B;  3HP3 A;  5JOB A;  1MSG A;  1BBX C;  2A19 A;  4A3K G;  2QA4 A;  3S1Q B;  1PYS B;  4B3S Q;  2UXB L;  3F2B A;  3GD7 A;  1GXD C;  3J81 c;  1I50 H;  1ESF A;  4DUY L;  4DGZ A;  3FHW A;  4LW1 A;  5E4X A;  1O7Z A;  2EJF C;  1B50 A;  3L9A X;  5C44 B;  5E4W C;  1EQV A;  1PDQ A;  5A2Q E;  4JI8 Q;  1PH1 A;  4ZRZ A;  3H3V H;  1BXT A;  3KK7 A;  1WTH A;  2B2Y A;  1JMC A;  3J81 i;  3TP5 A;  4BA1 I;  5M5Y B;  1CSP A;  2E2J B;  2KCT A;  3EQL C;  1VQC A;  2K5Q A;  1C9O A;  1EWH A;  1SBB B;  3D4D A;  3RZD B;  4JI2 L;  3PSI A;  5I6W A;  1STH A;  1TS2 A;  1B3Q A;  5J1Z A;  4BBR B;  1M90 C;  2CVR A;  3PO3 G;  2NN6 I;  3UDF A;  1QZH A;  4C3H H;  4DR3 Q;  1ICF B;  4DK3 C;  1IBL Q;  2Z8L A;  2SOB A;  3BYT B;  3TQY A;  2VQE L;  1VQF A;  3WOE A;  4CJ2 C;  1I4P A;  4R4C A;  1JT8 A;  3CXC A;  1WTR A;  2AQ1 B;  2V4D A;  2L9H A;  4FXG C;  3PQI A;  1X32 A;  5CV9 A;  3NEL A;  1WCM G;  4CBV A;  4NXN Q;  5H1S E;  3WOF A;  4P2C B;  2E5L L;  2P5Z X;  3A55 A;  1N34 L;  4DV5 Q;  4KKS A;  1HNZ Q;  4ZCK A;  4LJZ C;  5CBE E;  5J3B A;  5KND A;  5KYL A;  3S17 H;  1X3G A;  1NBW A;  1XPU A;  3S1N B;  1CKN B;  2K7V A;  2DGY A;  4RHR A;  1OXX K;  2QIL A;  4AH6 A;  4BY7 G;  3KLR A;  3NWT A;  1VQE A;  2OWO A;  1HR0 Q;  2BA1 A;  4MN3 A;  5IIF A;  4JI0 Q;  1IBK Q;  1QNK A;  1N34 Q;  5M5X H;  4DV5 L;  4JI2 Q;  4EX5 A;  2JA5 H;  1V1O A;  1XNR Q;  3GDE A;  2EYM A;  1PHJ A;  2CW0 D;  1A6X A;  2F0L A;  3P75 A;  3HKZ B;  3SK4 A;  4PG3 A;  1AP0 A;  2DUD A;  4RFB A;  3ZYY X;  1JE5 A;  2JYO A;  4CDE C;  1XX8 A;  4XIG S;  3J80 E;  3PO3 B;  3J7Z C;  1Y69 U;  1J8I A;  4R1J A;  1I4Q A;  4XT3 B;  2MHV A;  1L1O C;  2EVB A;  4FP5 D;  1M1K C;  4RHS A;  3Q0A A;  2A68 D;  2UUA L;  1S5B D;  2B63 B;  2O5J C;  5IWA Q;  5LMN L;  2F0U A;  1Q1E A;  1D5Z C;  4MTN A;  2IX3 A;  1LTS D;  3HOY H;  2FMM A;  4HMJ A;  5EPK A;  4K8I A;  1Q86 C;  1T5E A;  1H9S B;  1HNX Q;  4C1N I;  4DK6 C;  3HOY G;  2MNA A;  3RLN A;  1IYU A;  3S2H B;  1CZW A;  5CV7 A;  2I0Q A;  4KY5 A;  1SRU A;  1JB3 A;  2WIN B;  4BS9 A;  1PFS A;  1HZ9 A;  1TT2 A;  4IUT A;  4R4Q A;  1XYI A;  4DR2 Q;  4A3J G;  3MXP A;  5COY A;  5C4Z A;  1CKN A;  5LMU L;  1PFN A;  4IZ8 A;  3W1G A;  1PYW D;  4TQU S;  2ZJP A;  2AUJ D;  2L4N A;  3S2D B;  2K75 A;  2G5D A;  3DWA A;  3TSS A;  4X3T A;  1ET6 A;  4DR7 Q;  3TP8 A;  2B2U C;  2PQA A;  3RR5 A;  1LAC A;  3DHQ A;  3I3C A;  2JA5 G;  1HUM A;  1RKN A;  4U67 3;  1DXM A;  1TU2 B;  4LNQ A;  1GUN A;  2B2W C;  2G9D A;  3K59 A;  2FJ2 A;  4A3D G;  1PTO F;  2L55 A;  5D14 A;  2I07 B;  2RDF A;  3I4O A;  3M7G A;  4ILW A;  5E1F A;  5ELO A;  5FJ8 G;  2IW3 A;  2RSN A;  1IZ6 A;  1EY9 A;  4QUF A;  1B44 D;  4LK1 C;  1AN8 A;  5T1G A;  2X6G A;  2F3I A;  3PV0 A;  5CC4 A;  5EQ0 A;  5BR8 L;  1B3A A;  2XIW A;  5FLX E;  3K7U C;  3M4O H;  5J22 A;  4ZK9 B;  2JXM B;  1VQ5 A;  2E75 C;  3I91 A;  4C3J H;  1U0L A;  3S24 A;  3V96 A;  3S14 H;  4DV4 Q;  2YTX A;  4DNT B;  1VF5 C;  4JG2 A;  1VQ7 A;  2XNA C;  5C5L A;  1Q3L A;  1N9W A;  4FXK C;  3K5M A;  3HEJ A;  2KBN A;  3BJU A;  1ZKO A;  4NKL A;  5C0X I;  4HMI A;  1A15 A;  3C1F A;  4JV5 L;  1G29 1;  1C48 A;  3AMU A;  1IW7 D;  5JEA G;  4TRD A;  1HQM C;  3D8G A;  4DV7 Q;  4GZY C;  4R4T A;  4IPH A;  2LMC B;  2AHO B;  2JA9 A;  5C6A A;  3MTS A;  3CQZ B;  1EWI A;  3T1H L;  1LO5 D;  1HFG A;  2H4O A;  4JI1 Q;  3PIO A;  2E2I H;  3PF4 A;  1H95 A;  5C3W A;  3UDI A;  1WD1 A;  3GTL H;  1B9N A;  1SLJ A;  2YV5 A;  4A3E H;  1G2T A;  5HUR A;  4C56 C;  3U4V A;  2K5W A;  2XGT A;  1LLR D;  2PMZ E;  3B6Y A;  1BR9 A;  3J80 c;  4NXM Q;  2F0W A;  1F9Q A;  3GTO H;  4FXD A;  5ELC A;  1SYC A;  1YNX A;  1SE2 A;  1KC8 C;  3I72 A;  2R7F A;  2QW7 A;  4JK1 C;  4F87 A;  5A2Q L;  2L15 A;  4FNF A;  4HID A;  4H02 A;  3BVZ A;  2B8F A;  3S9W A;  1F9R A;  4GOP A;  3PCO B;  3QWN A;  3NTI A;  1S5F D;  2DJG C;  2WAQ G;  2VQE Q;  3GO5 A;  4KK7 A;  2F0N A;  1UAP A;  4LF7 L;  3GTP H;  1HNW Q;  2F0O A;  4RMF A;  4JYA L;  2JSO A;  3MC0 B;  1PFB A;  1K9M C;  2R93 B;  1PRT C;  3RUZ A;  4DAP A;  4A4I A;  1O80 A;  2RKS A;  2Z4H A;  3A54 A;  3PGZ A;  2IY5 B;  4V0B A;  3KF8 A;  4QY7 A;  3IFD A;  1I50 B;  1TVX A;  4IFD H;  4JBW A;  3D6C A;  2IX0 A;  3L0O A;  1E1T A;  4F7X A;  4NW2 A; 
#chains in the Genus database with same CATH homology
 1HNZ L;  3I4N H;  1GO3 E;  4LF4 Q;  1OXT A;  3K0X A;  1S3O A;  2JA8 H;  3UDX A;  4POF A;  1NY4 A;  3RLO A;  4B3R L;  1YJ9 A;  4KHP L;  1VQD A;  1A0I A;  3H0G G;  3CP0 A;  1X55 A;  5C0X G;  2VQF L;  4AQY L;  1KXL A;  4A3I G;  1A62 A;  1PV4 A;  2R7Z H;  1VQP A;  1XPR A;  3HOU H;  4LFA L;  1LTL A;  1WI5 A;  5LMN Q;  3U50 C;  1W2B A;  3S2D H;  1UE1 A;  1VQJ A;  1CUK A;  1CKM A;  1U5K A;  1Q1B A;  2EQS A;  1JJG A;  4A3C G;  1B70 B;  4JC0 A;  1HZB A;  2AKW B;  1VQB A;  3RLF A;  5M3M H;  4FDB A;  3CC7 A;  4DR1 L;  4A3F G;  2JA7 G;  4IFD G;  5K36 G;  2JEB I;  2UXD Q;  2IX1 A;  4YWM A;  1ASZ A;  4DR6 L;  2K4K A;  2KEN A;  3E9H A;  2CWA A;  5EAY A;  4WJ3 M;  1E1O A;  2WAQ E;  4EQ5 A;  4LF9 Q;  4IOC A;  4LUZ A;  1V1Q A;  4L5T A;  1HNX L;  1E24 A;  2XTI A;  4B3T L;  1IBM L;  4OX9 Q;  1OXS C;  4GOP C;  2HIX A;  2B29 A;  2WP8 J;  4A3M G;  4IO9 A;  1K3R A;  4IJH A;  4JCV E;  4DV0 Q;  4DUZ L;  1L1O B;  1RIP A;  2UUC Q;  4A3J H;  3STB C;  2D62 A;  1Q12 A;  3KF6 A;  1VS0 A;  4LFC L;  5JJI A;  4KLK A;  3M7N A;  2RHS B;  1YIT A;  2B63 G;  4HIO A;  2OCE A;  4P71 A;  4A3I H;  3I2Z A;  4UP9 A;  1EYG A;  4GNX B;  4DR2 L;  5LMU Q;  1X3E A;  4YCV A;  2UUA Q;  4IPD A;  4JI5 Q;  2B63 H;  3GTG H;  3I4M H;  2RCN A;  1EOV A;  2JE6 I;  3PF5 A;  2E2J H;  1X56 A;  1XPO A;  5IWA L;  1J6Q A;  1SFO H;  4LF8 Q;  3CPF A;  3CD6 A;  2A1A A;  5LMN W;  3GTQ H;  3TS0 A;  3HOW H;  3I7F A;  5IT9 c;  3K7A H;  3T1Y L;  4A3M H;  4DR7 L;  1E22 A;  4BBR H;  1W3S A;  4APV A;  4P75 A;  3CPW A;  5DLQ E;  4OWX B;  4JI3 Q;  1VCI A;  5IP9 G;  2BH8 A;  2ZTE A;  3HOV H;  1QVC A;  4DR4 Q;  5JJL A;  1PH6 A;  2HQL A;  4DV0 L;  2UUC L;  1QVG A;  3W1B A;  1YJW A;  2VZA A;  3CQZ H;  4LF4 L;  4LUV A;  5IYD G;  2IHE A;  1UE6 A;  2WFW A;  1Z9F A;  3ER0 A;  5E7N A;  5IE8 A;  2NVQ H;  4DV2 Q;  4KI0 A;  4BY7 H;  5FLM G;  3GTJ H;  4DV6 L;  3L7Z C;  4ALP A;  2R7Z G;  1G6P A;  4IPG A;  2H5X A;  2VY3 A;  4P73 A;  4KHZ A;  1K0R A;  2Y0S G;  2Z6K A;  1Y1W G;  2NVX H;  4DV1 Q;  4OO1 I;  1TWH H;  4GNX C;  5C4X H;  1QUQ B;  1VQG A;  3AFP A;  2Q2H A;  3KJP A;  4X64 Q;  3KJO A;  4BY1 H;  5GRO A;  3EIV A;  1Q46 A;  1N36 L;  3TEH B;  1VQ8 A;  3T1Y Q;  2CFM A;  1VQO A;  4LF6 L;  1EIY B;  2JA6 H;  4DAM A;  5FLM H;  3BZK A;  1YI2 A;  4DR3 L;  3I4N G;  1L1O A;  1FVI A;  2VW9 A;  1D8L A;  4YCW A;  2QEX A;  2A8V A;  2N3S A;  1NTG A;  3S15 H;  5GQO A;  2F4V L;  2K14 A;  3EBE A;  4JOI A;  4NPS A;  2HHH L;  2JEA I;  2K5V A;  4PZ6 A;  4LF9 L;  3F2C A;  1XJV A;  3NEM A;  4JI6 Q;  4P72 A;  1MJE A;  4A93 H;  2PQA B;  4B3M Q;  3K81 C;  3PUY A;  3KDF A;  1AH9 A;  2YYZ A;  5M5Y H;  4DV6 Q;  1QUQ A;  2BA0 A;  4DR4 L;  1S72 A;  3TRE A;  4NB3 A;  5C0X J;  4DUZ Q;  1HJP A;  1C7Y A;  1Z47 A;  3ULJ A;  3J7A 5;  3S16 H;  2ASB A;  1X54 A;  4O2D A;  4X66 Q;  4GLX A;  3TS2 A;  1GVP A;  2KCM A;  2I5L X;  1J5E L;  4GN4 B;  1TWC H;  2V1C C;  2A19 A;  4A3K G;  1EQR A;  2QA4 A;  2LXJ A;  2JA6 G;  1PYS B;  2K5N A;  4B3S Q;  4HJ7 A;  2KHJ A;  3NBH B;  4GN3 B;  3W5O A;  4BY1 G;  2VS1 A;  3F2B A;  2UXB L;  3HOX G;  4LF5 Q;  3GD7 A;  5C3E G;  3J81 c;  3CCV A;  5IY0 A;  1I50 H;  1Y1V H;  5GAG C;  2IHF A;  4DUY L;  3FHW A;  1VQA A;  1Q8K A;  4LW1 A;  1YEZ A;  5IYC H;  1BBU A;  1WYD A;  2ZM6 Q;  2I5M X;  4A3K H;  2HHH Q;  4QQB X;  4YHH L;  5IYB G;  3M4P A;  1X6O A;  5M5W H;  4HJ9 A;  4GOP B;  4B3M L;  4JI8 Q;  4QIW E;  1PH1 A;  3DM3 A;  3H3V H;  4QL5 A;  4IOA A;  2N78 A;  4C3I H;  3KYH C;  1N33 L;  2PNH A;  1TWA H;  3CCJ A;  3KF8 B;  3M4Q A;  1JMC A;  1I3Q H;  4GNX A;  3J81 i;  2R93 G;  4BA1 I;  5C4J H;  1CSP A;  1NMG A;  2KCT A;  1VQC A;  1CKO A;  3M9B A;  1C9O A;  1I94 Q;  1UWV A;  4YY3 Q;  4JI2 L;  3PSI A;  2GVB A;  4X62 Q;  1VQK A;  2UXB Q;  1Y1V G;  2AWN A;  4QGU A;  4OWT B;  3ULP A;  4X64 L;  1M90 C;  2Q2I A;  1WJJ A;  2VNU D;  3PO3 G;  3F2D A;  2NN6 I;  1XNQ Q;  4BA2 I;  2OTL A;  4BBS H;  3UDF A;  4JOI C;  4DNI A;  2JJQ A;  1GKH A;  1QZH A;  4X6A H;  2UU9 L;  4C3H H;  1YHQ A;  4DR3 Q;  3H15 A;  4DK3 C;  4A3G H;  1IBL Q;  3ERS X;  1IL2 A;  3SGI A;  1HH2 P;  3OTO L;  1K8G A;  4R4I A;  3PO3 H;  1B8A A;  3PUW A;  3TQY A;  2VQE L;  1VQF A;  4JI1 L;  1FGU A;  4C2M H;  1KQS A;  4AIM A;  4X65 Q;  5IYD H;  3A5U A;  1OXU A;  4GKK L;  4R4C A;  3CC2 A;  4ME3 A;  3CXC A;  1E7Z A;  4HIM A;  1JT8 A;  1PH9 A;  1PYB A;  1L2F A;  1JJC B;  3F1Z A;  1MJC A;  3AEV A;  3NEL A;  1WCM G;  2KHI A;  1EUJ A;  2N8N A;  4NXN Q;  1WFQ A;  3IRB A;  4AYB G;  5H1S E;  4DV3 Q;  2E5L L;  4JI0 L;  1VQN A;  1LM0 A;  3KOJ A;  1N34 L;  3ICE A;  1N32 Q;  3M85 A;  4BBR G;  4DV5 Q;  1I5F A;  2ZTD A;  4JI4 L;  1NMF A;  1LUZ A;  1HNZ Q;  3GTM H;  1RL2 A;  4UP8 A;  1XMO L;  4OXP A;  1IBL L;  3K80 C;  1TWG H;  1UEB A;  3AQQ A;  5J3B A;  4DAY B;  2HT1 A;  1Y14 B;  3S17 H;  2ZM6 L;  4KHP Q;  1X3G A;  1NBW A;  1Q7Y C;  1XPU A;  2MO0 A;  1PH8 A;  4RG1 A;  1CKN B;  2VQF Q;  2DGY A;  1KL9 A;  1OXX K;  4AQY Q;  4AH6 A;  1EFW A;  2JA8 G;  3S1N H;  1VQL A;  1HR0 W;  4BY7 G;  2YU9 H;  2VUM H;  2PI2 A;  3CCS A;  3PUX A;  1PA6 A;  4A3D H;  1N8R C;  4A75 A;  1VQE A;  2OWO A;  3J80 i;  3UE1 A;  1HR0 Q;  3CMA A;  4LF7 Q;  4K0K L;  3CME A;  2MQH A;  2BA1 A;  5AJ3 L;  2UXD L;  5GAE C;  4LFB Q;  2ALY B;  4DR6 Q;  4JI0 Q;  2QGQ A;  1IBK Q;  3CAM A;  2I5H A;  5M5X H;  1N34 Q;  4A3E G;  1HNW L;  1OTC A;  2ATW A;  4DV5 L;  1EIF A;  4JI2 Q;  4EX5 A;  4YY3 L;  4A76 A;  4JI4 Q;  2JA5 H;  3PUV A;  1XNR Q;  3GDE A;  3VDY A;  1XMQ L;  1PHJ A;  3FKI G;  2F4V Q;  4WJ4 A;  4A93 G;  5C44 G;  2AMC B;  3LGJ A;  4PG3 A;  4BXX H;  2IT1 A;  2DUD A;  1JE5 A;  1ASY A;  5M3M G;  1X3F A;  4A3F H;  1YHA A;  4XIG S;  1D7Q A;  2CQO A;  2LXK A;  1IBM Q;  4OX9 L;  3J7Z C;  5IYC G;  1NJI C;  3H3V I;  1DGS A;  1KRS A;  4R4O A;  4R1J A;  2VUM G;  1V9P A;  3HOU G;  3AYH B;  4Y7N H;  4L5S A;  1BVS A;  1FJG Q;  1L1O C;  5GAD C;  1M1K C;  2Y0S E;  1KHI A;  5JJK A;  3A5Z B;  2D0O A;  3G4S A;  4K0K Q;  4LF8 L;  2UUA L;  4JYA Q;  4TVA B;  3RZO H;  4LFB L;  2ZTC A;  3DLL A;  3HKS A;  2R7D A;  3RZD H;  4LFA Q;  2NZO A;  5IWA Q;  2R92 H;  5LMN L;  2MO1 A;  3FKI H;  5JEA J;  1UE5 A;  2VL6 A;  3KF6 B;  3G6E A;  3S1Q H;  2MFI A;  3KFU A;  3FP9 A;  4IPC A;  1Q1E A;  2NZH A;  4MTN A;  4GS3 A;  3M3Y H;  5M3F G;  3HOY H;  2NVT H;  3D0F A;  1GM5 A;  4GLA C;  3KLW A;  1Q86 C;  1VQ9 A;  2YTY A;  4AYB E;  1HNX Q;  2WB1 E;  4DK6 C;  3HOY G;  3TRZ A;  3A0J A;  4JBK A;  2ID0 A;  1PVO A;  3PIP A;  3D31 A;  5IP7 G;  4OON A;  2AWO A;  2MNA A;  3RLN A;  2R92 G;  1KAW A;  4DV2 L;  2I0Q A;  3HOW G;  4DV1 L;  1CSQ A;  1SRU A;  2UXC Q;  3S1R H;  1QZG A;  3H0G H;  3S2H H;  1PFS A;  1HZ9 A;  3I4M G;  2OTJ A;  4R4Q A;  4LFC Q;  4YCU A;  4DR2 Q;  1Y1W H;  4A3J G;  1N36 Q;  1FL0 A;  2RHQ B;  4A3B G;  1YIJ A;  1CKN A;  5LMU L;  4LF6 Q;  1HZA A;  3W1G A;  2ZJP A;  4TQU S;  3EN2 A;  4MNO A;  2CWP A;  2OQK A;  3CCM A;  4O0A A;  2K75 A;  4DV7 L;  1PH2 A;  2LSS A;  3A74 A;  4J15 A;  1XNR L;  3BZC A;  1XMQ Q;  4A3L G;  4DR7 Q;  1HZC A;  4BXX G;  3MXN B;  3GTK H;  2PQA A;  3RR5 A;  4HJA A;  4YWL A;  3PO2 H;  3KDF B;  1WCM H;  5HY6 A;  1VQI A;  3U4Z A;  4JBJ A;  4JI3 L;  1KRT A;  5FLX c;  5M3F H;  2JA5 G;  1C0A A;  4LNQ A;  1MKH A;  1E3P A;  1I6H H;  2E8G A;  2HIV A;  1PH5 A;  2UXC L;  1VQH A;  3CCL A;  4A3D G;  3OW2 A;  1QVF A;  1OXV A;  1FJG L;  1A8V A;  1MIU A;  3I4O A;  1VQ4 A;  5ELO A;  1V43 A;  5FJ8 G;  4B3S L;  4A3B H;  1IZ6 A;  2EXD A;  2R6G A;  1X9N A;  4OWW B;  4HJ8 A;  2GVA A;  2PI2 E;  4NXM L;  1BBW A;  2OQ0 A;  4L5Q A;  1PH7 A;  2EIF A;  4A3G G;  2CKZ B;  5C4X G;  2F3I A;  3PV0 A;  4PZ8 A;  1X65 A;  4Y52 H;  1BKB A;  4XTC S;  5BR8 L;  4JV5 Q;  3ZJY C;  4YHH Q;  2K5H A;  4P74 A;  4DUY Q;  4DR5 Q;  5FJ8 H;  4L5R C;  1O7I A;  1B7Y B;  2K50 A;  3F8T A;  3K7U C;  1SRO A;  4GLV B;  4PMW A;  3M4O H;  2RF4 A;  4PZ7 A;  3JAM c;  1VQ5 A;  4JI8 L;  4C3J H;  4JI6 L;  1U0L A;  3S24 A;  1KIX A;  4GKJ Q;  3ULL A;  3RN2 A;  4DKA C;  3HOV G;  3S14 H;  3PO2 G;  2B3G A;  4DV4 Q;  2YTX A;  1VQ7 A;  4JG2 A;  4GN5 A;  4JI7 Q;  2JK8 A;  2D0P A;  2ZJR A;  2NN6 G;  2Z0S A;  1IXR A;  1YHB A;  5IYB H;  2NVY H;  3G71 A;  1N9W A;  1VQM A;  3CC4 A;  4YWK A;  1SE8 A;  1WOC A;  2FXQ A;  3HKZ E;  1SMX A;  1J5E Q;  1K83 H;  3CCE A;  3HOZ H;  1JJ2 A;  2KBN A;  3BJU A;  3BU2 A;  1XNQ L;  4X66 L;  5C3E H;  3AFQ A;  5C0X I;  3E0E A;  4UPA A;  2UUB L;  4JBM A;  4JV5 L;  1G29 1;  4QJF A;  4DR5 L;  4LF5 L;  2BH2 A;  5JEA G;  2ES2 A;  1JB7 A;  3Q8D A;  2ZJQ A;  2WB1 G;  4IJL A;  3E9I A;  3HOX H;  3RNU A;  3NEN A;  4B3R Q;  4DV7 Q;  4R4T A;  4IPH A;  4BBS G;  2AHO B;  2JA9 A;  1EQQ A;  3UE0 A;  4IFD J;  4GKJ L;  5IP7 H;  1EWI A;  3J81 j;  3T1H L;  1P16 A;  3PF4 A;  1IYJ B;  1TWF H;  4JI1 Q;  3PIO A;  5C44 H;  2N49 A;  2E2I H;  4X65 L;  3CCQ A;  1H95 A;  3UDI A;  3CW2 C;  3GTL H;  1Q82 C;  1R9T H;  1N33 Q;  5HGQ A;  4GKK Q;  3STB D;  1T9H A;  2E2H H;  2Q2T A;  4NXN L;  5ELN A;  5IP9 H;  2E5L Q;  1SLJ A;  2YV5 A;  4HJ5 A;  4A3E H;  3CF5 A;  1YZ6 A;  4LUO A;  3U4V A;  1YJN A;  1PH4 A;  2XGT A;  3K8A A;  4DPG A;  2PMZ E;  4X62 L;  1L0W A;  3B6Y A;  4DV3 L;  1N32 L;  4A3C H;  3HKZ G;  1I94 L;  2C35 B;  3J80 c;  4NXM Q;  1SR3 A;  3UDG A;  1NE3 A;  3GTO H;  3WWV A;  1K8A C;  4LWC A;  4B3T Q;  1YNX A;  1XMO Q;  5BR8 Q;  1KC8 C;  2Q2U A;  2R7F A;  1P8L A;  3PUZ A;  3JAM i;  1A63 A;  1S40 A;  2L15 A;  4HID A;  3T1H Q;  1SN8 A;  2Z6K C;  2UU9 Q;  4H02 A;  1AE2 A;  3HFZ B;  2F52 A;  4UY8 C;  2CCZ A;  1XTD A;  3OTO Q;  4GOP A;  1KD1 C;  3PCO B;  1Q81 C;  2YTV A;  1HR0 L;  2WAQ G;  2VQE Q;  3GO5 A;  5AJ3 Q;  1AE3 A;  4MZ9 A;  3MEF A;  3CCU A;  1GD7 A;  3U58 A;  4JI5 L;  1PH3 A;  2GN5 A;  4OO1 G;  4LF7 L;  4POG A;  4DV4 L;  5GAH C;  3HOZ G;  3GTP H;  1HNW Q;  4JI7 L;  1VQ6 A;  1YVC A;  4RMF A;  2R93 H;  1TXY A;  1IBK L;  4JYA L;  3I55 A;  3L2P A;  1K9M C;  1YBY A;  3OYY A;  4A4I A;  3PGZ A;  4DR1 Q;  2IY5 B;  3RN5 A;  2JQO A;  1K73 C;  4IFD I;  4QY7 A;  1UE7 A;  1G51 A;  2JA7 H;  4JBW A;  4A3L H;  3JC6 6;  4UP7 A;  4HIK A;  2IX0 A;  3G48 A;  2UUB Q;  3L0O A;  1E1T A;  2K52 A;  1LYL A;  3CCR A;  3S1M H;  3I56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...