4LFBL

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 10
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfbL00
1CKNB 3CCQA 3PO2H 4JCVE 1OXUA 3M9BA 4GNXB 4LFBQ 1X3FA 3RR5A 4Y52H 1H95A 3AEVA 3HOXG 1S72A 4JYAQ 4KI0A 5JEAJ 1SMXA 1WFQA 2F52A 3ERSX 4DV0Q 1VQ4A 1YNXA 4AQYQ 4QIWE 5FJ8H 1PV4A 2E8GA 5LMUQ 1N36Q 1Q12A 4A3FG 1WOCA 1J5EL 3BJUA 2IX1A 3H3VI 1L1OA 1O7IA 1SRUA 2N8NA 4LFCL 3S14H 3S17H 4A3GG 5ELNA 4A3CG 3J80i 2PQAB 1WYDA 4MZ9A 1XTDA 1W2BA 3I4MG 3HKSA 4GKKQ 5IWAL 4JI8L 2VUMH 1P16A 2UXBL 3CXCA 1GVPA 3RZDH 2EXDA 4JBKA 3GTPH 5GAEC 3CCMA 4KHPQ 1UE6A 3M4PA 2KCMA 1S40A 2OCEA 4A3KH 4LF9L 1E7ZA 2VS1A 2V1CC 4AQYL 2Q2TA 4DR2Q 2NVXH 1L1OC 1SLJA 2B63G 1WJJA 2WFWA 4QGUA 2MNAA 4BY1G 4DR3Q 1XNRQ 2YU9H 1LYLA 1QVCA 4L5QA 4DKAC 2IT1A 4DPGA 1NTGA 3KDFB 1FGUA 2QEXA 1IYJB 3MXNB 4NPSA 2OQKA 3KLWA 1Q81C 1GO3E 3I4OA 3CD6A 1LUZA 4KHZA 3GTMH 1BBUA 1Q1BA 1XNRL 4B3MQ 4B3SQ 1K9MC 2VL6A 1CKOA 4APVA 1CUKA 1B7YB 1EIFA 2GVBA 3J80c 4DV1Q 1YI2A 4IPGA 5BR8L 4HIOA 5M5WH 4LF5Q 2KHJA 4BBRH 1J5EQ 3PO2G 4DV4L 2I5MX 2LXJA 2KENA 2Q2HA 2NVQH 1PH4A 1I94Q 3W5OA 3DLLA 5C4XG 1EWIA 2B3GA 1VS0A 4AH6A 3I4NH 1SROA 4JI2Q 3NEMA 2ES2A 1TWAH 2JA8G 3STBC 2Z0SA 4LF4Q 3PUZA 2OWOA 1Y1VH 2R7ZG 2K52A 2B29A 1B70B 2R6GA 3K81C 3T1YQ 1N34L 4JC0A 1HZBA 3U4VA 3HOVG 3PV0A 4A3LG 1FVIA 1KRSA 4RMFA 1X3EA 2VQFQ 4DR2L 4P75A 1YHQA 3J81i 4A3BG 1XMQQ 1N8RC 3E9IA 1PYBA 3MEFA 4YCUA 2UUAL 1RL2A 3BZKA 3CP0A 2HQLA 4YWMA 3UDIA 2JA5H 4DV5L 4A3JH 2HT1A 4R4OA 5IYBG 2JA6G 1KXLA 2BH8A 2NVTH 5C44H 4PZ8A 1C7YA 2I5LX 1JT8A 3GTKH 2NN6I 3CW2C 1QVFA 4LF7L 2ZTDA 2UXDQ 2A1AA 4DR5L 3CF5A 1W3SA 4C3IH 5JJKA 4PZ7A 1BKBA 2D0PA 5IYDH 3U4ZA 4JI7L 4UY8C 3CCRA 1PH1A 2OTLA 3JC66 4TVAB 4DV1L 2A19A 3K8AA 2MO1A 2UUCQ 3RNUA 4JI4Q 4YCWA 3GDEA 1QZGA 4OO1I 2VUMG 4BXXG 5H1SE 2AWOA 2WAQG 3EN2A 3GTQH 3PSIA 1KRTA 4A3DH 4B3TQ 2XTIA 4LF6L 2YV5A 4BA2I 1PVOA 2CQOA 5AJ3Q 4A3BH 2JQOA 1HNZL 1IBKL 2DGYA 4GKJQ 3RN5A 2B63H 1I6HH 3PF5A 4C3HH 1M90C 3PIPA 1EIYB 2JEBI 4P73A 1VQHA 5IY0A 1Y1VG 2Y0SG 3KDFA 2JA8H 4UP9A 1VQNA 3TS2A 3T1HL 1VQLA 2MO0A 4GLAC 2CWPA 1Y1WH 3TRZA 4DUZQ 5IP7G 1UE1A 3FKIG 1EYGA 4IPCA 3VDYA 4JI0Q 3KF8B 1C9OA 4GN4B 1OXSC 2ZM6Q 2BA1A 4XIGS 2NZHA 2KBNA 1D7QA 1SR3A 2GVAA 4QL5A 4B3RL 1HNWQ 4FDBA 1HR0L 4DUYQ 5HGQA 4L5RC 2UUBQ 4X66L 1VCIA 3S1RH 1D8LA 2Y0SE 3NELA 3TS0A 1E1OA 2F4VL 3I55A 4DV5Q 1QUQB 1Y14B 4HJ7A 1S3OA 2ATWA 4X62Q 4BA1I 4GOPB 4YWLA 2QGQA 1E22A 3W1GA 5ELOA 1BBWA 1Q86C 4IFDG 3CCJA 4J15A 1L1OB 5C0XI 4XTCS 4NXNL 1PH3A 5J3BA 2R92H 4BBSH 3HOZG 2ASBA 3CCUA 2PQAA 2A8VA 1IBKQ 3EBEA 4WJ4A 4B3RQ 3HOZH 1TWGH 1NJIC 3LGJA 3S15H 4RG1A 1YIJA 2JA7H 5C44G 4POGA 5IYBH 1B8AA 2HIVA 2PNHA 1QZHA 3J7A5 1SFOH 1KHIA 1NMFA 4GKJL 2R93H 3CCVA 4KLKA 5LMNQ 1V43A 1KC8C 1JJGA 2YTXA 3T1HQ 1DGSA 1VQ5A 4QQBX 4HIKA 4IFDI 5EAYA 1HR0W 3PO3H 2PI2E 4ME3A 4OXPA 4A3FH 2F3IA 1GD7A 1XPRA 3L0OA 4P72A 1TWCH 1U0LA 3PUWA 5C0XJ 3CCLA 1X65A 1XMOQ 2VZAA 5GQOA 3RLFA 2AHOB 4JI3L 3FKIH 3GTLH 3GTJH 4DK6C 1IBLL 4A93G 5HY6A 1KL9A 3ULJA 3OTOQ 2F4VQ 1WCMG 4R4TA 4GS3A 4A3KG 5GAGC 1EOVA 4AYBE 2JK8A 1WCMH 5C3EH 3RN2A 2R93G 3GO5A 4DV3Q 2EQSA 1EQQA 2UUCL 4NXNQ 3F1ZA 1HNZQ 4JBWA 3H15A 3HKZE 5C4XH 3HOWH 2RCNA 2YTYA 4C3JH 3JAMc 5FLMH 1EUJA 1Q1EA 4IOAA 2E2IH 3FHWA 3UE1A 2WB1G 2PMZE 4IFDJ 4A3LH 1OXVA 1YVCA 4HJ9A 4JI7Q 1HNWL 1IXRA 3UDGA 4HIDA 2IY5B 4JI1L 2ZTCA 4ALPA 3S2HH 1I3QH 5IYCH 3M4OH 2N78A 4IOCA 1JMCA 1Q7YC 3S24A 4OO1G 1N33L 1IBML 4A3MG 4LF8Q 4A3EG 4OX9Q 5IP9H 3CC7A 3NBHB 3UE0A 3M4QA 4GN5A 1WI5A 3S1QH 3CMEA 2N3SA 4YHHQ 4HJ8A 1XNQL 3UDFA 4GOPA 3PF4A 2VQFL 3HOUH 3L7ZC 3KOJA 4LWCA 1EFWA 4B3SL 1VQ9A 2R92G 2OTJA 2NN6G 4EX5A 4JI5L 4JV5Q 3ZJYC 1PHJA 4NXML 4YHHL 3F2DA 2BA0A 4YWKA 4LW1A 1BVSA 2C35B 1AH9A 1HJPA 3B6YA 1VQGA 4A93H 1YITA 1C0AA 3K7UC 1PH9A 4YY3L 2AMCB 2K5NA 3PUVA 4DR1L 5M3FH 1HZ9A 1SE8A 4DR3L 2AKWB 1PH8A 1UE5A 4DAMA 3SGIA 1MIUA 5GROA 4X62L 4DR7Q 4JI8Q 3F2BA 4TQUS 4DV6Q 1XNQQ 1HZCA 4DV7Q 1J6QA 1MJCA 5IT9c 2I0QA 1IBLQ 1G291 4LFAQ 1NY4A 4LFCQ 1Z47A 2ZJQA 2CWAA 3E9HA 3KJPA 4LF5L 2VQEQ 1CKNA 2KHIA 4NB3A 4JG2A 3M85A 4A3IH 3OYYA 1VQ6A 3F2CA 4BY7G 1PH2A 4LUZA 4JYAL 4DV2L 2BH2A 4LF7Q 4LNQA 3A0JA 4BY7H 2VW9A 4GN3B 1OTCA 4AIMA 2MFIA 3H0GG 3CPWA 5GADC 1TWHH 4L5SA 2JA7G 2Z6KC 2H5XA 1E3PA 3I4MH 1VQDA 1X54A 3HFZB 5M5YH 3CQZH 1R9TH 4DV7L 1HZAA 5IYCG 4JV5L 1KAWA 1VQAA 3STBD 4EQ5A 4A3JG 1Q8KA 4UP7A 2K14A 4OWXB 3M3YH 2ALYB 3RLNA 4YY3Q 3OTOL 3KFUA 4WJ3M 4PMWA 4GLXA 3E0EA 5M3MH 3CMAA 4KHPL 1VQMA 2K75A 1T9HA 4DAYB 1FL0A 2GN5A 2UU9Q 1MJEA 2UXBQ 1QUQA 1CSQA 3AYHB 3OW2A 3CPFA 1A62A 1NE3A 3I7FA 3BZCA 5FLMG 3CCSA 4HJ5A 2UXDL 1OXTA 2DUDA 2Q2IA 5IP7H 1VQ7A 4PG3A 1FJGL 4JBMA 1GM5A 4HJAA 2JA9A 1K83H 2RHSB 3AFPA 4LFAL 2JE6I 1N33Q 1ASYA 4A75A 4GNXA 3KJOA 4L5TA 1JJCB 4DV0L 3TREA 3S1MH 4DR6L 1FJGQ 3HKZG 1G6PA 1QVGA 2UU9L 4UP8A 3ER0A 4C2MH 2ZJRA 3WWVA 4A4IA 4BBRG 1KIXA 4DNIA 4IJHA 4JOIA 3I2ZA 5AJ3L 4LFBL 1AE2A 1UEBA 2IHEA 2AWNA 2PI2A 2HIXA 1K73C 1K8GA 2RHQB 3KF6A 3PO3G 2KCTA 5M5XH 1Z9FA 3ICEA 1I50H 3F8TA 4GOPC 3CC2A 2WAQE 3HOWG 2WP8J 3CAMA 1JB7A 2R7ZH 1NBWA 4R4CA 3H0GH 4GNXC 4IO9A 3G48A 4Y7NH 1Q82C 1PA6A 1IL2A 4DR4L 1OXXK 5C4JH 3A74A 1VQPA 3H3VH 4LF9Q 1M1KC 1JJ2A 4DK3C 1IZ6A 3A5ZB 4X66Q 3L2PA 4JOIC 3I56A 3GD7A 3PGZA 3ULPA 1K8AC 1PYSB 5IWAQ 3AFQA 4B3ML 3DM3A 4LF4L 4OONA 1P8LA 1VQIA 3Q8DA 1XPOA 3D0FA 2ID0A 5C3EG 2CCZA 1VQKA 4R1JA 4JI1Q 1L0WA 5E7NA 4X65L 4DV2Q 1VQ8A 4AYBG 3M7NA 1A0IA 4A3IG 4A3EH 4NXMQ 1A8VA 4DV6L 5C0XG 3FP9A 1VQFA 1RIPA 1HR0Q 4DV4Q 3PIOA 3U50C 1LTLA 2VNUD 1KQSA 2YYZA 4DR1Q 1LM0A 2K4KA 3HOVH 3HOYG 2E2JH 4A3CH 1G51A 2ZTEA 3G4SA 4LUOA 2D62A 4DV3L 4BXXH 1VQEA 2XGTA 4X64Q 1GKHA 4QY7A 1IBMQ 1E1TA 4LF8L 4OX9L 1VQJA 1YEZA 3PUXA 4IPDA 3EIVA 3K0XA 4OWTB 3T1YL 3CCEA 1N34Q 1N32Q 3KYHC 4H02A 1HNXL 2HHHL 4K0KQ 1L2FA 3J7ZC 3CC4A 4GKKL 1V9PA 4X6AH 4IJLA 1XJVA 1CKMA 2E5LL 4A3MH 1VQBA 2L15A 1X6OA 4JI0L 5IP9G 3K80C 2OQ0A 2K5VA 5BR8Q 2NVYH 4JI6L 3I4NG 1YHBA 4YCVA 1HH2P 5GAHC 2ZJPA 4OWWB 3RZOH 4JI3Q 4MTNA 4HIMA 4DR7L 3JAMi 2UXCQ 4JBJA 2CKZB 4UPAA 4B3TL 4A3GH 3TEHB 4IPHA 5JJIA 5LMNW 1YHAA 4JI2L 1YBYA 1AE3A 4DR5Q 1A63A 1YZ6A 1VQCA 3D31A 4LUVA 4BBSG 1I5FA 5FLXc 5IE8A 3RLOA 1Q46A 3BU2A 5K36G 5LMNL 3HOYH 1X55A 1I94L 2UXCL 4O0AA 4DUYL 4A3DG 2FXQA 1MKHA 3NENA 4JI5Q 1K3RA 3J81j 1ASZA 5JJLA 2IX0A 1JE5A 2LSSA 1NMGA 1X9NA 4DR4Q 1V1QA 5LMUL 2I5HA 2VY3A 1PH5A 2K5HA 3PUYA 3J81c 3GTGH 3PCOB 2D0OA 3S1NH 2QA4A 1HNXQ 2HHHQ 5IYDG 4JI4L 2N49A 3KF6B 4P71A 4R4QA 3GTOH 4X64L 2R7DA 2R7FA 4P74A 1YJNA 1PFSA 1UWVA 1Y1WG 4R4IA 2Q2UA 3S2DH 2RF4A 1SN8A 4DR6Q 2CFMA 2E2HH 2IHFA 3IRBA 2WB1E 2UUBL 5JEAG 2JA5G 2JA6H 3W1BA 2MQHA 5M3FG 2JEAI 2EIFA 1PH7A 4JI6Q 3S16H 4X65Q 2VQEL 3AQQA 4MNOA 1YJ9A 1TXYA 3G6EA 3TQYA 3UDXA 4GLVB 3U58A 1PH6A 1YJWA 2JJQA 4A76A 1KD1C 3HOXH 1N36L 5DLQE 2ZM6L 2NZOA 4BY1H 5FJ8G 3A5UA 1UE7A 2Z6KA 1E24A 2K50A 3HOUG 1N32L 2LXKA 3G71A 5M3MG 1X3GA 3ULLA 4DUZL 4O2DA 1N9WA 4PZ6A 1XPUA 2E5LQ 4LF6Q 1XMQL 2UUAQ 1EQRA 2YTVA 1TWFH 4QJFA 1K0RA 4K0KL 1VQOA 4POFA 1X56A 1CSPA 3K7AH 1U5KA 1XMOL
chains in the Genus database with same CATH superfamily
1CKNB 3CCQA 4A3EB 1GUTA 4JCVE 3RR5A 4Y52H 3D6CA 2K28A 2G5DA 3ND8A 2E75C 3BVZA 3HOXG 1S72A 3BVGA 4A3MB 2P5ZX 1HA6A 4QIWE 5F2DA 2E8GA 5LMUQ 1Q12A 5KIXA 3H3VI 3GTKB 2AUKA 4WRDA 3J7AF 3IFDA 2PQAB 1WYDA 4PMBA 4RGTA 1PTOB 3T16A 2R92B 4XQQA 2VUMH 3CXCA 1YNND 4U673 3SR1A 2GA4B 3L9AX 3R93A 4KHPQ 1S40A 4LF9L 5KEEA 2OCEA 4AQYL 3URYA 4O42A 1SLJA 3S9WA 4BY1G 1WTXA 2YU9H 2EY6A 4DKAC 1NTGA 1FGUA 2JA7B 2DY8A 3NSWA 3CD6A 4DXGA 3GTMH 5EKIA 1F9QA 3VR6A 3LX0A 1K9MC 4LMQD 3NPPA 1SYFA 3GTJB 4DV1Q 1EIFA 4IPGA 5BR8L 5ELFA 2WACA 5M5WH 1J5EQ 2I5MX 3K58A 1HCZA 1SEBD 5A2QE 1I94Q 1WD1A 3IKJA 1G91A 1CZWA 3OW7A 4A3FB 1EWIA 3NEMA 2O4XA 2R7ZG 3ONAB 1B70B 3K81C 4K8IA 3SK6A 3WOFA 2KUMA 4G7ZC 1SFOB 5E1FA 4A3LG 4BY7B 1KRSA 4FVMA 1TS5A 4A3BG 1XMQQ 2UUAL 4YCUA 1RTNA 4KV6A 1RL2A 3CP0A 4YWMA 3NP8A 2JA6G 4DV5L 2HT1A 3EQLC 2CQAA 4A3IB 2BH8A 2NVTH 1SYGA 2I5LX 2F0UA 3KBXA 2LS01 3CW2C 4ID6A 1HFNA 1W3SA 3DEPA 4JI7L 1EFID 2KHSA 2EY2A 3K8AA 2MO1A 1Y8OB 3RNUA 4OO1I 3HP3A 3CQZB 1R9TB 3EN2A 1KRTA 1STYA 1TY2A 4BA2I 2YV5A 2CQOA 5AJ3Q 1CA5A 4A3BH 1HNZL 2NB0A 4X3TA 1I4GA 3RN5A 3IL8A 3PF5A 1M90C 3PIPA 1KDCA 4P73A 4QB4A 4DNTB 4JPBW 5IY0A 5EKLA 3KDFA 4UP9A 1VQNA 2J0TD 1HXYD 2PZTA 4BY1B 1Y1WH 4DUZQ 4IPCA 2E2IB 3DWAA 3LWUA 3KF8B 4GN4B 2BA1A 2KBNA 2RBMA 1TWAB 1E0BA 3SDZA 4B9WA 4X66L 3K59A 3C1FA 1E1OA 2F4VL 1Y14B 4Z9CB 3DWQA 4X62Q 4IFDG 1Q86C 4J15A 5C0XI 5J3BA 1I4QA 3TP6A 3CCUA 1SMYC 4X3SA 2R7ZB 1TWGH 1NJIC 1V1PA 4POGA 1C4QA 2HIVA 1G8ZD 1KHIA 3CCVA 2K5QA 4KLKA 4QQBX 3A7LA 4C3HG 3Q23A 4CGYB 2F0MA 2XRQD 3L0OA 4RCNA 5C0XJ 1TWFB 5FO9B 1TQOA 3CCLA 4JI3L 2Z9HA 1JICA 4ZK9B 1B3QA 1EIGA 4DK6C 4G4KA 4A93G 1X3PA 3K5OA 1EYAA 1WCMG 4R4TA 4GS3A 4A3KG 1EOVA 3K5NA 3G7LA 4DV3Q 1Y8NB 1EQQA 3TP7A 4DAVA 2XNAC 3DM1A 1RD9D 3VYSA 2QDLA 4DU9A 1PZJD 2RCNA 3A8KE 3JAMc 1MSGA 5FLMH 1EUJA 4IOAA 2PMZE 2EYLA 1FD7D 4JI7Q 1YNNC 5TSSA 4HIDA 3UDGA 2N55A 2IY5B 4IQZA 4KY7A 5IGDA 5IYCH 1SE2A 4HN7A 3P75A 1Q7YC 1IBML 3CC7A 2F0EA 3M4QA 2E2JB 4HJ8A 1D1KA 1JR0D 3QO2A 2ZXPA 1VQ9A 2OTJA 1STHA 2NN6G 4NXML 3QG1A 4CKBA 4A3GB 1RF2D 2C35B 1W6KA 1S5ED 1C0AA 2MP1A 4ME5A 2AMCB 3EJIA 1SE8A 1UE5A 4KK7A 4HCSA 4X62L 3F2BA 3RUZA 1J6QA 2I0QA 5IT9c 1IKLA 3D3RA 1NY4A 2H4OA 4LFCQ 1BOSA 2ZJQA 3C3LA 2VQEQ 1WVLA 3OYYA 3TSSA 4JK1C 3OWFA 1SNMA 1PH2A 4JYAL 3HOXB 4DV2L 1ZYRD 4LNQA 3A0JA 4GN3B 1XXGA 1OTCA 1B53A 1CHPD 4N8FA 1QB5D 1O80A 1X54A 3N6RA 4DV7L 1HZAA 4TKOB 4JV5L 1KAWA 2RKSA 1ZEQX 1K8OA 4G7HC 3OMGA 4UP7A 3I4NB 4ULLA 3DHQA 2PYKA 4GLXA 3K5LA 5M3MH 4N9TA 1WCMB 2X69A 1VQMA 4RGMA 1PTOC 1XWEA 3HRZC 3OW2A 1A62A 1QNKA 4KKSA 2L0CA 1VQ7A 4JBMA 4ZAIA 1NR2A 4OGQC 1GM5A 1KTKA 4XYQA 4HSVA 3AFPA 5J1ZA 4CDEC 4A75A 1KLGD 3MEHA 4F8MA 3S1MH 4DR6L 4R8NA 1QVGA 1TKWB 4Q0FA 3WWVA 3J80E 4DNIA 4IJHA 1NUCA 5M9OA 1SNDA 1K73C 3PO3G 3OIPA 3HOWG 2WP8J 1V1OA 1ZYRC 3CAMA 1NBWA 4F88A 4GNXC 1PA6A 1G6PA 4QCLA 4HEDA 1JJ2A 2B2VA 4DK3C 3FPUB 3A5ZB 4X66Q 2A6HD 3L2PA 3D4DA 3FDTA 1BBXC 1PYSB 1GUWA 3QOJA 1R4QB 4C56C 2OXPA 5M3MB 4OONA 3NWTA 4IN3A 2B2YC 4C3JB 1PFNA 3D0FA 2CCZA 1HPCA 2NTTA 4FF3A 1SYCA 3M7NA 4A3IG 1M4VA 4NXMQ 1VQFA 2F0FA 4DFAA 1V1PB 4DV4Q 3U50C 2VNUD 3K6OA 4EGVA 1T5XD 2F0JA 1GJXA 3P20A 4LF8L 4OX9L 1YEZA 1JB3A 1SMYD 1I4PA 1N32Q 3CCEA 3KYHC 1HNXL 4K0KQ 4X6AH 3J7ZC 4GKKL 3M4OB 2FJ2A 2KEEA 4KTAA 3I90A 1XYIA 1X6OA 1S5DD 2X6GA 4JI6L 3I4NG 2PZUA 5GAHC 4OWWB 4JI3Q 4MTNA 5EPLA 3JAMi 4A3GH 4KJOA 5LMNW 4DR5Q 1VQCA 3D31A 5FLXc 1NNXA 5IE8A 3RLOA 2JP1A 4O0AA 4A3DG 3J81j 1K83B 1GUOA 1X9NA 1JWSD 1NMGA 1CT1D 4ZUJA 5LMUL 4RKBA 2VY3A 1NAPA 1PH5A 1KNAA 5E4XA 5ELDA 2Q8RE 3MFYA 3VA5A 3E6ZX 1FGBD 1LTTD 4L6TB 3HOYB 4RHSA 2MHVA 2R7DA 3E3XA 1B44D 3S2DH 2N88A 3V05A 4DR6Q 2K03A 2E2HH 1CZGA 1EZ6A 2QF7A 5J39A 3T56B 5JEAG 2BCOA 2MQHA 1HRJA 2EIFA 2R93B 1PH7A 4JI6Q 1TXYA 2AUJD 2JXMB 1PH6A 3GTOB 1KD1C 3HOXH 1N36L 1EZ8A 2NZOA 2O5JC 1N32L 4IUUA 3HOUG 2LXKA 5M3MG 1CA6A 1X3GA 5DM63 1KDBA 1N9WA 3GP7A 4PZ6A 4QIWB 1GUSA 3GTMB 1AEXA 4C3HB 4FNFA 1XMQL 1EQRA 2UUAQ 1E2WA 3I73A 2K32A 1JQYD 1TWFH 4QJFA 2PZWA 1K0RA 1X56A 3H94A 3S1RB 1H9SB 1CQFA 1STNA 2A73B 3M7GA 4C2MB 3PO2H 5CBEE 3J7AV 4KKUA 2MPMA 4JYAQ 1SMXA 3SK4A 4KHVA 1VQ4A 1YNXA 4AQYQ 1J5EL 2VUMB 1WOCA 2IX1A 4U68A 1O7IA 3S14H 4A3CG 2B8FA 5D3DA 2ICIA 4A3JB 1W2BA 1TR5A 3BYTB 5IWAL 1DZ1A 5I9PA 3RZDH 5FO8B 1X3QA 1E2VA 4JBKA 3GTPH 3CCMA 3FEWX 2IX3A 1MD2D 1UE6A 1E7ZA 2V1CC 2SOBA 1Y1VB 2F0VA 2ZXRA 3FMCA 2WFWA 4DR3Q 1XNRQ 1QVCA 2Z6BA 4L5QA 1EIHA 4HTHA 3KDFB 1IYJB 2XIWA 3MXNB 2QILA 2RQXA 5K36H 1FNUA 5C5LA 3OSOA 4V0BA 3J80L 3VYTA 4B3SQ 2MUYA 1CKOA 4APVA 1SYDA 4HIOA 4LF5Q 2KHJA 4BBRH 2OT2A 3OMCA 1Y69U 2KENA 4J8QA 2QW7A 1PH4A 3W5OA 3DLLA 5FKAC 1SROA 1STGA 1TWAH 5I6YA 3TZDA 1Y1VH 2VB2X 4B08A 3LWEA 2R6GA 5A35A 1N34L 3HOUB 4JC0A 2NZ1D 3U4VA 3O13A 3PV0A 2VQFQ 2A74C 4P75A 3E9IA 5JEAH 4A3JH 4PZ8A 1C7YA 1JT8A 2NN6I 1B3AA 5J22A 1B9MA 2A6HC 3EROA 3U4ZA 3CCRA 4TVAB 4YCWA 3GDEA 1O78A 2VUMG 3RMHA 4BXXG 3OOCA 2WAQG 2M9VA 3GTQH 3PSIA 3GV6A 4A3DH 3KLSA 4B3TQ 5C3EB 2EVBA 5D65A 4KJNA 3AB9A 1IBKL 4HMIA 3J7YW 1F77A 4ILWA 1BCPC 2J4XA 2A6ED 3Q22A 1EIYB 3MA2B 1X32A 3GTLB 1LT4D 1Y1VG 2JA8H 1RJTA 5FLXE 4ZYSA 1QNUA 2K04A 2PW5A 2CWPA 2NBFA 4A3BB 5IP7G 3FKIG 1EYGA 1KAAA 4Q5VA 2F0QA 3VDYA 4JI0Q 1C9OA 1IHZA 4XIGS 2B2WA 1D7QA 2X6LA 2CH4W 2GVAA 1HNWQ 4FDBA 4XDXA 5HGQA 2UUBQ 2C5CA 2KA7A 2D9UA 1SDFA 1QUQB 4M1UB 2ATWA 3I4LA 4C3JG 3A8IE 4BA1I 5KGUA 1QG7A 1E22A 1BBWA 2R92H 3HOZG 2A8VA 3S2HB 1IBKQ 3EBEA 5C3XA 3SXHA 2NYZD 3L3OC 3QOLA 3S15H 2SNMA 2JA7H 1DYQA 4NP5A 1HTPA 5JOBA 1B8AA 2PNHA 1QZHA 4GKJL 2Q8TA 2WV6D 1JJGA 1V43A 3C46A 1AP0A 1XX8A 2YTXA 1JCKB 1EEID 4HIKA 1HR0W 3DEOA 3PO3H 5HURA 4A3FH 2F3IA 2AQ1B 1K28A 2AQ2B 2Z1CA 1XPRA 4PV1C 4P72A 5JPNC 4H13C 3KLSX 2VZAA 5CR3A 2F0GA 1B1ZA 3HEJA 3GTLH 4M8AA 3GTJH 4CHTB 3Q6SA 3QWNA 4CJ2C 5HY6A 3ULJA 3OTOQ 4XT3B 1M8AA 3AU7A 4K8JA 2DJFC 4CDCC 5M3FB 2EJMA 3DXJC 5C3EH 1MI2A 5C6AA 5COYA 3SK5A 3JAML 4EVOA 3PQIA 1PXUA 3DUZA 1JOOA 3HOWH 3J81E 1SXTA 3NHHA 1QJOA 2YTYA 4C3JH 5CV5A 3UE1A 3T53B 3A56A 5CV6A 4A3LH 1IXRA 1LLRD 2NUCA 4BBRB 1I3QH 3CU7A 4J6HA 2M00A 2WINB 2HD3A 1JMCA 3FKIB 1V8QA 1D6EC 1N33L 4A3MG 5IP9H 2K01A 3UE0A 4GN5A 2K05A 3CMEA 4YHHQ 1SNOA 2OEOA 4IURA 1AZPA 3HOUH 4LWCA 4B3SL 2R92G 4HR7B 4JI5L 3ZJYC 1PHJA 3QR8A 1EY6A 2BA0A 2EYFA 3B6YA 1VQGA 2J7ZA 4DR1L 1HZ9A 3HOZB 4DR3L 2AKWB 1RODA 4X3UA 3SGIA 2CHBD 3BVMA 2KCCA 2F0PA 4TQUS 4O1NA 4DV7Q 3CRKC 4IUNA 1IBLQ 1G291 1CFMA 1O7ZA 3FRPB 4HAEA 3KJPA 2KHIA 4JG2A 1EL0A 3S14B 4WORA 1I4RA 3P1HA 5JPMC 4LF7Q 4AIMA 2MFIA 3H0GG 4L5SA 3BZDB 4IUTA 1E3PA 1LTBD 4HCEA 1L0YB 1O7YA 1VQDA 5M5YH 5IYCG 3STBD 5KNBA 4A3JG 2LFNA 2HDLA 2KECA 5IGEA 4OWXB 4PMWA 1BF4A 3CMAA 1T9HA 4DAYB 1FL0A 4BBSB 3E0JA 1CSQA 1VF5C 3AYHB 1NE3A 2NTSA 2UXDL 1OXTA 2DUDA 3T51B 2Q2IA 4PG3A 1FJGL 1GOZA 3F2UA 1K83H 1CQVA 4K6LA 2XVSA 3M3YB 4GNXA 4L5TA 4HSPA 4DV0L 3TREA 1LTRD 5CBAE 1J8IA 1F9RA 4C2MH 3ER0A 4BBRG 4A4IA 2DNCA 1KIXA 4ZUIA 1PZID 3I2ZA 5AJ3L 2BOSA 2AWNA 4KY5A 4XT1B 2RHQB 5I4DA 2K7VA 1Z9FA 3ICEA 2Q8IB 3CC2A 1RDPD 4NKLA 5JJZA 3IAYA 2R61A 5C4JH 2A69C 3H3VH 1M1KC 1LV9A 4JOIC 3ULPA 5IT9L 1K8AC 5C3WA 4K2KA 4B3ML 1P8LA 5EBDA 3Q8DA 1VQKA 5KYIA 1L0WA 4X65L 2D2CC 2K5WA 1SE4A 1DM0B 1A8VA 5FK9C 1T5EA 5LHY1 4DV6L 1HR0Q 3PIOA 1A2UA 4XXEA 5T1IA 2BE5C 4DR1Q 1KQSA 1TWHB 4A3CH 2O5IC 4DV3L 4X64Q 1GKHA 5LL6S 3PUXA 2QEJC 3EIVA 3K0XA 4F7XA 4B9XA 1HQMC 3H0GB 1SSOA 2HHHL 1L2FA 2WAQB 4IJLA 4K6DA 1EYDA 2F0WA 2E5LL 1CKMA 4JI0L 1QVFA 2L15A 3FVQA 5IP9G 5BR8Q 3ITPA 1DOKA 3NBHA 1TVXA 1YHBA 2KQ3A 1GHKA 2UXCQ 4JBJA 2A68C 2WKCA 4B3TL 1Q90A 1YZ6A 3V2TA 4BBSG 1I5FA 1Q46A 2EYJA 1A6XA 3NQIA 5LMNL 3HOYH 2FXQA 1MKHA 3J81L 1SNQA 3NXWA 5JJLA 3NUCA 1JE5A 2LSSA 2RDFA 3CRLC 1IKMA 3GQBA 2B2WC 4HMJA 4FP5D 5IYDG 1A3TA 4JI4L 1SE3A 2WB1B 1BXTA 4R4QA 4X64L 3WDNA 5JVG3 1F9SA 1YJNA 3AMUA 1RTOA 2RF4A 4A93B 2CFMA 1ZXTA 1VMCA 4LJZC 2JA6H 2JEAI 1U4LA 2NVQB 2XWBB 3U58A 4GLVB 3OPOA 2JJQA 2EOTA 4A76A 5DLQE 5IIFA 3GV3A 2ZM6L 5FJ8G 3A5UA 5NUCA 3G71A 4O2DA 3K57A 3T4AC 1XPUA 1UNSA 5CV9A 2E5LQ 4LF6Q 1LTID 1ICFB 4K0KL 2TSSA 1QWYA 1XMOL 1KLUD 1OXUA 1II3A 2F0NA 3M9BA 4LFBQ 1X3FA 1GUGA 2EPBA 4WFN3 1IYVA 3QJYA 1BR9A 4KI0A 1WFQA 2F52A 3ERSX 4DV0Q 2L5TA 1EQVA 1EOTA 5FJ8H 4A3GG 3MXGA 4LFCL 3MVVA 3J80i 4MZ9A 1XTDA 3I4MG 1ESFA 3HKSA 4GKKQ 2UXBL 1GVPA 5I2YA 1WD0A 4IUPA 3LNNA 2RDGA 3M4PA 2KCMA 4A3KH 2VS1A 2Q2TA 2Y0SB 4DGZA 4OIJA 2NVXH 2B63G 1WJJA 2F0HA 2PCFB 5D14A 1LYLA 4RGOS 1JWMD 4DPGA 2EXZA 2L4NA 1TS3A 3HG9A 1WTVA 4NPSA 5KNDA 2OQKA 3I4OA 1LUZA 1BBUA 1Q1BA 2F4IA 1H9KA 1YNJC 4OEMB 1B50A 4ZKCB 3J80c 3PO2G 4DV4L 2Z4HA 2F3WA 5ELBA 4FXDA 3MHBA 5C4XG 1Z7TA 4JI2Q 2ES2A 1SNPA 3V96A 2B29A 4QUCA 3T1YQ 4N8X1 1HZBA 5KRUA 4RKLA 4UDUC 3HOVG 1K3BC 5BN3A 1FVIA 1U4RA 1X3EA 3S2DB 1WTWA 1YHQA 3NTKA 5EGTA 1PYBA 3H09A 1TWGB 4IUVA 3NTIA 4C3IB 1KXLA 1SJHD 1B9NA 4P2CB 3E5SA 1FYCA 3GTKH 4LF7L 2IJ0A 2ZTDA 3CHBD 2A1AA 3HKZB 5JJKA 4PZ7A 2D0PA 1SAPA 5IYDH 1PLFA 4UY8C 1PH1A 1WTQA 4IFDH 2UUCQ 3MXUA 4ZLTF 1BQQT 5H1SE 2AWOA 2ZT9C 1AZQA 1ESRA 4ZCKA 2XTIA 3VR5A 4LF6L 2RDHA 2JQOA 4RCOA 4RWSC 1J9OA 2DNEA 1MHWC 1CK1A 1RCVD 1I6HH 2G9HD 4ODGA 4CBVA 1OO9B 2EYOA 4ZKBB 1PFBA 2JEBI 3A54A 1VQHA 4FF4A 2Y0SG 2B63B 2PNRC 3DMUA 5FOBB 3T1HL 1VQLA 2MO0A 1AFPA 4GLAC 3BS1A 5CORA 3NWSA 1ENAA 2B2UC 3I91A 1OXSC 1CM9A 1SR3A 1ENCA 1GXDC 4DUYQ 1VCIA 3K0YA 1D8LA 2Y0SE 3U9OA 3NELA 4X3KA 1Y1WB 1EWCA 1H9RA 1S3OA 1EQTA 4GOPB 2QGQA 4YIJA 5C4ZA 3CCJA 1L1OB 4CJ1B 4XTCS 4NXNL 1PH3A 2ASBA 1I50B 2NVTB 1GUNA 3HOZH 1TS4A 2XWJB 4RG1A 1YIJA 2EZVA 1Q3LA 2MGSA 4V190 3J7A5 1I4XA 1SFOH 2F0TA 2CH4A 5LMNQ 1KC8C 3T1HQ 1DGSA 4C3IG 4IFDI 2XN9C 2PI2E 4ME3A 4OXPA 3S1MB 2K33A 4NDXA 4GZYC 3EVQA 3S15B 4MTKA 3PUWA 4J1MA 1XMOQ 2L55A 3FKIH 3I3CA 4FYDA 5JVH3 1IBLL 1YNJD 3MC0B 2L12A 1UUPA 2B8GA 3SEBA 1I4HA 4AYBE 3NK9A 1WCMH 3ZYYX 2EQSA 4XQNA 2UUCL 3I70A 5D3IB 2JYOA 4NXNQ 4FXKC 2EJGC 3H15A 3R8BA 3HKZE 3PIP3 3ND9A 1IYUA 5L37A 1Q1EA 3FHWA 3G6JB 2WB1G 4E6IA 1OXVA 4HJ9A 3SE0A 4JI1L 3S2HH 4EQNA 2B39A 1PTOH 4RA8A 3S24A 2A6EC 5M5XB 1I6VC 4LF8Q 4A3EG 4OX9Q 3NBHB 2HCCA 4IUQA 3TDQA 3S1QH 2N3SA 4UHVA 1XNQL 3UDFA 3PF4A 1PZKD 3L7ZC 3KOJA 4LK1C 1ET9A 4EX5A 1JWUD 1PRTD 1ILQA 4FO2A 4YWKA 3VR2A 1HJPA 1VDZA 2F1MA 4QMGA 1PH9A 3BYYB 4YY3L 2K5NA 3S1QB 1PH8A 1G2TA 4DN4M 5GROA 1CHQD 4RGNA 4DR7Q 2JA8B 1XNQQ 1HZCA 4QUFA 1MJCA 4LFAQ 1IW7C 2CW0C 1Z47A 4LF5L 1EY8A 3NBIA 4NB3A 2FHTA 3F2CA 2HUGA 4LUZA 4BY7H 2IPKD 2F0OA 3W3AA 2QDBA 1DONA 2HDMA 3GTQB 1DOMA 3CPWA 4G57A 1EY0A 2JA7G 1ICWA 2H5XA 3HFZB 1KABA 1VQAA 4EQ5A 2BDOA 2IL8A 3M3YH 1HTLD 5IODA 3RLNA 3KFUA 4KKTA 5FO7B 1D1IA 1DXMA 1F2ZA 1QOHA 5KYLA 2GN5A 2EDGA 1MJEA 2UXBQ 1QUQA 2D5DA 3CPFA 3I7FA 3CCSA 3GTGB 2KVMA 5FLMG 1B2TA 1L0XB 2Z8LA 3TBIB 2A69D 2NN6H 4C1NK 2JA9A 2RHSB 4LFAL 1O7LA 2JE6I 1N33Q 1NCVA 4FF2A 1JJCB 2VXWA 2EE1A 2OF1A 4EQOA 3N52A 4UP8A 2ZJRA 3IFTA 2F3VA 3K7AB 4JOIA 1AE2A 1UEBA 2IHEA 4ZRZA 1IL8A 2PI2A 4TSSA 1A2TA 3KF6A 1I50H 2AQ3B 1F2MA 2ENBA 2R7ZH 4IO9A 1IL2A 1Q82C 3G48A 4Y7NH 4DR4L 2RSOA 1OXXK 2DN8A 1F2LA 4LF9Q 1IW7D 2CW0D 5IGBA 3I56A 3PGZA 5IWAQ 4ZQ3A 3HOVB 3AFQA 2RVLA 1XPOA 4R1JA 3HZXA 4JI1Q 5E7NA 4DV2Q 1VQ8A 4AYBG 4K5XA 4A3EH 5C0XG 1DOLA 1RIPA 3EFXD 1LTLA 1MSHA 4RH6A 2YYZA 3RZOB 1LM0A 2K4KA 3HOVH 2ZTEA 2D62A 1EEFD 1Z6HA 4TRDA 4BXXH 2XGTA 4QY7A 1IBMQ 3P7JA 4IPDA 5AFWA 4OWTB 1N34Q 5T1GA 2O2LD 1I6HB 5JAVA 3CC4A 1STEA 1WTPA 1XJVA 1VQBA 1LT3D 4XQJA 2K5VA 2NVYH 4YCVA 2ZJPA 5EPJA 1QCBD 5CMDA 2CKZB 2H1EA 2E74C 4UPAA 4IPHA 1PMRA 1YHAA 1A63A 4LUVA 3TP8A 3BU2A 4KN4C 3VA7A 4NMZA 4JI5Q 3NENA 3A7AB 1K3RA 1ASZA 3UI2A 2IX0A 1KDAA 3KK7A 4DR4Q 3OIQA 2I5HA 3PUYA 3J81c 3GTGH 2F0DA 2V4DA 2TMPA 2IWHA 2D0OA 3S1NH 2QA4A 1PYWD 1HNXQ 5I2XA 1SJED 3GTOH 1EU3A 2FFKB 1PFSA 1Y1WG 1JORA 2Q2UA 2RCFA 1HQRD 2B2VC 1Q8IA 2UUBL 2JA5G 2E2HB 1LT5D 5M3FG 1FNVA 1UEAB 3S16H 4X65Q 2VQEL 3AQQA 4MNOA 2M2LA 1YJ9A 1HHVA 2PQEA 1MGSA 3UDXA 3G6EA 1YJWA 3OHXC 5IGGA 1NR4A 1U9RA 2Z6KA 1E24A 1EYCA 2L1BA 4DUZL 4DAYA 3VYUA 4LAAA 2FINB 1HUNA 2EY5A 4POFA 3SVMA 4F87A 5IOCA 1RKNA 5EBCA 5EKKA 3CKIB 2NVXB 4GNXB 1PRTC 3BDOA 5HGTA 2BE5D 1H95A 3AEVA 2F0IA 5JEAJ 2JN4A 1TT2A 1HUMA 2HQEA 2FMMA 1D5ZC 1PV4A 2B2TA 1N36Q 4GKJQ 4A3FG 1PVOA 1R4PB 3BJUA 1L1OA 1SRUA 2N8NA 3S17H 1U4MA 5ELNA 4RHRA 1EWHA 1XTCD 2PMZB 1SYBA 4JI8L 4BS9A 1P16A 4CJ0B 3JAME 4RFBA 1TIID 2EXDA 5GAEC 1ML0D 2IW3A 4DR2Q 2JA6B 1L1OC 3KBGA 2MNAA 4QGUA 2E2DC 4K2LA 1H9SA 4OHJA 2XSCA 4C1NI 2L11A 4WJWA 3R2TA 4R8IA 2IT1A 1QE6A 1Q81C 4OL7A 2QEXA 3KLWA 1GO3E 5ELEA 4KHZA 1XNRL 4B3MQ 2VL6A 1CUKA 1B7YB 4PNYA 2GVBA 4PQXA 1YI2A 1ILPA 1EY4A 2LXJA 2Q2HA 2NVQH 5I9OA 4L8JA 1LO5D 2EYMA 2B3GA 1VS0A 4AH6A 3NTHA 3I4NH 2JA8G 1PRTF 3STBC 2Z0SA 4LF4Q 5IT9E 3PUZA 3I4MB 2OWOA 4CKEA 2K52A 1EY9A 4KMUC 3QB3A 4R9WA 3R3OA 3I8ZA 3BG3A 4RMFA 4DR2L 4S3SA 3J81i 1N8RC 5EQ0A 3MEFA 3BZKA 1JOQA 3UDIA 2HQLA 2JA5H 3MXNA 4R4OA 5IYBG 5C4HA 5C44H 1S5FD 5C0XH 3VYRA 2UXDQ 1LABA 2PPBC 4DR5L 3CF5A 1G2SA 4C3IH 1BKBA 1TWCB 2F0KA 2DY7A 2OTLA 2CVRA 1SNCA 3JC66 4DV1L 2A19A 3U9SA 2QKIC 3D6WA 1GHJA 1DJRD 4BWGB 1QZGA 4JI4Q 2QCPX 3BDCA 1LACA 3PO2B 1ET6A 5CYUA 2DGYA 2B63H 4H7BA 4EQPA 1BUVT 2LKVA 3RZDB 1NSNS 1EU4A 4C3HH 2SNSA 2I46A 1LTGD 4K5WA 3TS2A 3Q24A 3TRZA 3A8JE 1UE1A 1D2BA 2FMCA 2K1BA 4H44C 2ZM6Q 1D5XC 2NZHA 4KD4A 1CTMA 4QL5A 2F0SA 4B3RL 2JSOA 1HR0L 4DNRB 4OO1H 4L5RC 3S1RH 2KCNA 5CV4A 4A3KB 1STAA 3TS0A 3PMFA 2SDFA 3I55A 1D5MC 4DV5Q 4HJ7A 2A5HA 4YWLA 3W1GA 5ELOA 4BBSH 4DF7A 2PW7A 2EYPA 3C2PA 2PQAA 2K6AA 3Q0AA 4WJ4A 4B3RQ 3MFGA 3MXPA 1TY0A 3LGJA 5C44G 5IYBH 1JE4A 1H9JA 3KUPA 2ZXOA 1NMFA 2R93H 3R2IA 3A55A 3MWYW 1VQ5A 1C48A 5EAYA 4RAUC 1TS2A 2BDNA 2XRSD 1GD7A 2SEBD 1TWCH 1WTHA 1U0LA 1X65A 3HGBA 1C8CA 5GQOA 3RLFA 2AHOB 4JVZA 1BCPB 4IZ8A 3VR3A 1KL9A 2KJXA 5CGKA 2F4VQ 4CDFC 3K5MA 5EPKA 5DNFA 5GAGC 1DCZA 2JK8A 3RN2A 2R93G 3GO5A 1BO0A 4DK1A 4JW0A 3SHLA 4H0LC 3F1ZA 1HNZQ 1Y8PB 4JBWA 4KY6A 5C4XH 1F2YA 2E2IH 3NE5B 5DEHA 3X3NA 1FNWA 1RHPA 4IFDJ 1YVCA 3KF8A 4CKCA 1HNWL 1H9MA 4ALPA 2ZTCA 2PO4A 3M4OH 2N78A 4IOCA 2B2UA 5K5PA 1K0SA 4OO1G 2JA5B 5E4WC 5CV7A 3T13A 4NW2A 2EY1A 2WKDA 1WI5A 3D4RA 5CC4A 1PTOD 4GOPA 2VQFL 1BCPD 1BNZA 1FR3A 3FPPA 1EFWA 1VMPA 3X3MA 1S4ZA 2MJ8A 5A2QL 1EY7A 1ZKOA 4JV5Q 1PDQA 2I07B 4YHHL 3F2DA 5E3FA 4LW1A 1BVSA 1AH9A 4A93H 1QILA 1YITA 3K7UC 3PUVA 5M3FH 5LL6X 4DAMA 1MIUA 4JI8Q 4DV6Q 2NWGA 5C44B 1A15A 1I3QB 2CWAA 3E9HA 1CKNA 1LTSD 3M85A 4A3IH 1VQ6A 3S17B 4BY7G 1ENFA 2BH2A 2RA4A 5EJWA 2VW9A 1SYEA 1VF7A 2KOLA 1E2ZA 3PO3B 3MAQA 1WTRA 5GADC 1TWHH 3HOWB 2Z6KC 3HS0C 3I4MH 3CQZH 1R9TH 1HFGA 1JC7A 1UAPA 1Q8KA 5C4XB 2K14A 5ISRA 4I65A 4FF1A 2ALYB 2C9OA 4YY3Q 4MHEA 3OTOL 4WJ3M 5IGCA 3E0EA 1HA5A 2HCIA 3TP5A 4KHPL 2K75A 2E76C 4DAPA 5M5WB 2UU9Q 1KNEA 4L63B 1TU2B 1A3UA 4ABNA 4K5VA 3BZCA 4HJ5A 5C4JB 1BCPF 1PRTB 3TN2A 5IP7H 1PTOF 4K14A 4HJAA 3D8GA 4UAIA 2LY7A 2WIIB 1ASYA 2B2TC 5FLXL 4OELB 3KJOA 1S5BD 1FJGQ 3HKZG 2UU9L 3MTSA 2A68D 4I7ZC 4G7OC 3TZUA 5BN4A 4LFBL 1ONLA 3I72A 1B4OA 1U4PA 2HIXA 1K8GA 2EJFC 2Z4IA 1MBYA 2KCTA 5M5XH 3F8TA 4GOPC 2WAQE 2K5DA 1JB7A 4R4CA 3H0GH 1VQPA 3TMEA 3A74A 5C5MA 1WTOA 5G3LF 1W6JA 1IZ6A 3OWEB 3GD7A 1PFMA 2G9DA 1S5CD 3DM3A 4LF4L 4A3DB 1VQIA 2ID0A 5C3EG 2YU9B 1EY5A 4FXGC 1LTAD 3C1EA 1A0IA 3FP9A 3EA6A 5M5YB 2R3ZA 4Y7NB 3MZ5A 2NVYB 3HOYG 5DAUA 2E2JH 1G51A 3G4SA 4LUOA 1VQEA 3PIO3 3S1NB 1E1TA 1VQJA 4DK0A 3T1YL 4H02A 1V9PA 1G6ZA 1SBBB 5ELCA 4A3MH 3K80C 2DJGC 1BDOA 2OQ0A 3H6MA 4QF4A 3S16B 1HH2P 3RZOH 4N9PA 3M4YA 4HIMA 3BDLA 4DR7L 1DD2A 2LMCB 3QIAA 2F0LA 5JJIA 3TEHB 5I6WA 4JI2L 1YBYA 1AE3A 2RSNA 3ERQA 5K36G 4KN7C 1X55A 1I94L 2UXCL 4MN3A 5IGFA 4DUYL 4I7AA 2KEDA 3H3VC 1V1QA 4AYBB 3W2DA 1AW7A 2K5HA 5BN5A 3PCOB 5G3LD 4DXFA 2HHHQ 1A3VA 4IALA 2N49A 3KF6B 4P71A 3SK8A 4CDDC 2R7FA 4P74A 1UWVA 4R4IA 4OIKA 4XYOA 4KD3A 3KLRA 1SN8A 3D4WA 1CI3M 2IHFA 1JOKA 3IRBA 2WB1E 1K8MA 3W1BA 3NQTA 5KNCA 3VR4A 2VB3X 3DWPA 3TQYA 3GTPB 3H91A 4PMCA 2B2YA 4BY1H 1UE7A 1F9PA 2K50A 3ULLA 3RD4A 4DA2A 3WOEA 2L9HA 1LT6D 1AN8A 2YTVA 2F03A 4MIUA 5CV8A 5DM73 1STBA 2EYHA 1VQOA 2ICEC 1CSPA 3K7AH 1U5KA
chains in the Genus database with same CATH topology
1CKNB 3CCQA 3PO2H 4JCVE 1OXUA 3M9BA 4GNXB 4LFBQ 1X3FA 3RR5A 4Y52H 1H95A 3AEVA 3HOXG 1S72A 4JYAQ 4KI0A 5JEAJ 1SMXA 1WFQA 2F52A 3ERSX 4DV0Q 1VQ4A 1YNXA 4AQYQ 4QIWE 5FJ8H 1PV4A 2E8GA 5LMUQ 1N36Q 1Q12A 4A3FG 1WOCA 1J5EL 3BJUA 2IX1A 3H3VI 1L1OA 1O7IA 1SRUA 2N8NA 4LFCL 3S14H 3S17H 4A3GG 5ELNA 4A3CG 3J80i 2PQAB 1WYDA 4MZ9A 1XTDA 1W2BA 3I4MG 3HKSA 4GKKQ 5IWAL 4JI8L 2VUMH 1P16A 2UXBL 3CXCA 1GVPA 3RZDH 2EXDA 4JBKA 3GTPH 5GAEC 3CCMA 4KHPQ 1UE6A 3M4PA 2KCMA 1S40A 2OCEA 4A3KH 4LF9L 1E7ZA 2VS1A 2V1CC 4AQYL 2Q2TA 4DR2Q 2NVXH 1L1OC 1SLJA 2B63G 1WJJA 2WFWA 4QGUA 2MNAA 4BY1G 4DR3Q 1XNRQ 2YU9H 1LYLA 1QVCA 4L5QA 4DKAC 2IT1A 4DPGA 1NTGA 3KDFB 1FGUA 2QEXA 1IYJB 3MXNB 4NPSA 2OQKA 3KLWA 1Q81C 1GO3E 3I4OA 3CD6A 1LUZA 4KHZA 3GTMH 1BBUA 1Q1BA 1XNRL 4B3MQ 4B3SQ 1K9MC 2VL6A 1CKOA 4APVA 1CUKA 1B7YB 1EIFA 2GVBA 3J80c 4DV1Q 1YI2A 4IPGA 5BR8L 4HIOA 5M5WH 4LF5Q 2KHJA 4BBRH 1J5EQ 3PO2G 4DV4L 2I5MX 2LXJA 2KENA 2Q2HA 2NVQH 1PH4A 1I94Q 3W5OA 3DLLA 5C4XG 1EWIA 2B3GA 1VS0A 4AH6A 3I4NH 1SROA 4JI2Q 3NEMA 2ES2A 1TWAH 2JA8G 3STBC 2Z0SA 4LF4Q 3PUZA 2OWOA 1Y1VH 2R7ZG 2K52A 2B29A 1B70B 2R6GA 3K81C 3T1YQ 1N34L 4JC0A 1HZBA 3U4VA 3HOVG 3PV0A 4A3LG 1FVIA 1KRSA 4RMFA 1X3EA 2VQFQ 4DR2L 4P75A 1YHQA 3J81i 4A3BG 1XMQQ 1N8RC 3E9IA 1PYBA 3MEFA 4YCUA 2UUAL 1RL2A 3BZKA 3CP0A 2HQLA 4YWMA 3UDIA 2JA5H 4DV5L 4A3JH 2HT1A 4R4OA 5IYBG 2JA6G 1KXLA 2BH8A 2NVTH 5C44H 4PZ8A 1C7YA 2I5LX 1JT8A 3GTKH 2NN6I 3CW2C 1QVFA 4LF7L 2ZTDA 2UXDQ 2A1AA 4DR5L 3CF5A 1W3SA 4C3IH 5JJKA 4PZ7A 1BKBA 2D0PA 5IYDH 3U4ZA 4JI7L 4UY8C 3CCRA 1PH1A 2OTLA 3JC66 4TVAB 4DV1L 2A19A 3K8AA 2MO1A 2UUCQ 3RNUA 4JI4Q 4YCWA 3GDEA 1QZGA 4OO1I 2VUMG 4BXXG 5H1SE 2AWOA 2WAQG 3EN2A 3GTQH 3PSIA 1KRTA 4A3DH 4B3TQ 2XTIA 4LF6L 2YV5A 4BA2I 1PVOA 2CQOA 5AJ3Q 4A3BH 2JQOA 1HNZL 1IBKL 2DGYA 4GKJQ 3RN5A 2B63H 1I6HH 3PF5A 4C3HH 1M90C 3PIPA 1EIYB 2JEBI 4P73A 1VQHA 5IY0A 1Y1VG 2Y0SG 3KDFA 2JA8H 4UP9A 1VQNA 3TS2A 3T1HL 1VQLA 2MO0A 4GLAC 2CWPA 1Y1WH 3TRZA 4DUZQ 5IP7G 1UE1A 3FKIG 1EYGA 4IPCA 3VDYA 4JI0Q 3KF8B 1C9OA 4GN4B 1OXSC 2ZM6Q 2BA1A 4XIGS 2NZHA 2KBNA 1D7QA 1SR3A 2GVAA 4QL5A 4B3RL 1HNWQ 4FDBA 1HR0L 4DUYQ 5HGQA 4L5RC 2UUBQ 4X66L 1VCIA 3S1RH 1D8LA 2Y0SE 3NELA 3TS0A 1E1OA 2F4VL 3I55A 4DV5Q 1QUQB 1Y14B 4HJ7A 1S3OA 2ATWA 4X62Q 4BA1I 4GOPB 4YWLA 2QGQA 1E22A 3W1GA 5ELOA 1BBWA 1Q86C 4IFDG 3CCJA 4J15A 1L1OB 5C0XI 4XTCS 4NXNL 1PH3A 5J3BA 2R92H 4BBSH 3HOZG 2ASBA 3CCUA 2PQAA 2A8VA 1IBKQ 3EBEA 4WJ4A 4B3RQ 3HOZH 1TWGH 1NJIC 3LGJA 3S15H 4RG1A 1YIJA 2JA7H 5C44G 4POGA 5IYBH 1B8AA 2HIVA 2PNHA 1QZHA 3J7A5 1SFOH 1KHIA 1NMFA 4GKJL 2R93H 3CCVA 4KLKA 5LMNQ 1V43A 1KC8C 1JJGA 2YTXA 3T1HQ 1DGSA 1VQ5A 4QQBX 4HIKA 4IFDI 5EAYA 1HR0W 3PO3H 2PI2E 4ME3A 4OXPA 4A3FH 2F3IA 1GD7A 1XPRA 3L0OA 4P72A 1TWCH 1U0LA 3PUWA 5C0XJ 3CCLA 1X65A 1XMOQ 2VZAA 5GQOA 3RLFA 2AHOB 4JI3L 3FKIH 3GTLH 3GTJH 4DK6C 1IBLL 4A93G 5HY6A 1KL9A 3ULJA 3OTOQ 2F4VQ 1WCMG 4R4TA 4GS3A 4A3KG 5GAGC 1EOVA 4AYBE 2JK8A 1WCMH 5C3EH 3RN2A 2R93G 3GO5A 4DV3Q 2EQSA 1EQQA 2UUCL 4NXNQ 3F1ZA 1HNZQ 4JBWA 3H15A 3HKZE 5C4XH 3HOWH 2RCNA 2YTYA 4C3JH 3JAMc 5FLMH 1EUJA 1Q1EA 4IOAA 2E2IH 3FHWA 3UE1A 2WB1G 2PMZE 4IFDJ 4A3LH 1OXVA 1YVCA 4HJ9A 4JI7Q 1HNWL 1IXRA 3UDGA 4HIDA 2IY5B 4JI1L 2ZTCA 4ALPA 3S2HH 1I3QH 5IYCH 3M4OH 2N78A 4IOCA 1JMCA 1Q7YC 3S24A 4OO1G 1N33L 1IBML 4A3MG 4LF8Q 4A3EG 4OX9Q 5IP9H 3CC7A 3NBHB 3UE0A 3M4QA 4GN5A 1WI5A 3S1QH 3CMEA 2N3SA 4YHHQ 4HJ8A 1XNQL 3UDFA 4GOPA 3PF4A 2VQFL 3HOUH 3L7ZC 3KOJA 4LWCA 1EFWA 4B3SL 1VQ9A 2R92G 2OTJA 2NN6G 4EX5A 4JI5L 4JV5Q 3ZJYC 1PHJA 4NXML 4YHHL 3F2DA 2BA0A 4YWKA 4LW1A 1BVSA 2C35B 1AH9A 1HJPA 3B6YA 1VQGA 4A93H 1YITA 1C0AA 3K7UC 1PH9A 4YY3L 2AMCB 2K5NA 3PUVA 4DR1L 5M3FH 1HZ9A 1SE8A 4DR3L 2AKWB 1PH8A 1UE5A 4DAMA 3SGIA 1MIUA 5GROA 4X62L 4DR7Q 4JI8Q 3F2BA 4TQUS 4DV6Q 1XNQQ 1HZCA 4DV7Q 1J6QA 1MJCA 5IT9c 2I0QA 1IBLQ 1G291 4LFAQ 1NY4A 4LFCQ 1Z47A 2ZJQA 2CWAA 3E9HA 3KJPA 4LF5L 2VQEQ 1CKNA 2KHIA 4NB3A 4JG2A 3M85A 4A3IH 3OYYA 1VQ6A 3F2CA 4BY7G 1PH2A 4LUZA 4JYAL 4DV2L 2BH2A 4LF7Q 4LNQA 3A0JA 4BY7H 2VW9A 4GN3B 1OTCA 4AIMA 2MFIA 3H0GG 3CPWA 5GADC 1TWHH 4L5SA 2JA7G 2Z6KC 2H5XA 1E3PA 3I4MH 1VQDA 1X54A 3HFZB 5M5YH 3CQZH 1R9TH 4DV7L 1HZAA 5IYCG 4JV5L 1KAWA 1VQAA 3STBD 4EQ5A 4A3JG 1Q8KA 4UP7A 2K14A 4OWXB 3M3YH 2ALYB 3RLNA 4YY3Q 3OTOL 3KFUA 4WJ3M 4PMWA 4GLXA 3E0EA 5M3MH 3CMAA 4KHPL 1VQMA 2K75A 1T9HA 4DAYB 1FL0A 2GN5A 2UU9Q 1MJEA 2UXBQ 1QUQA 1CSQA 3AYHB 3OW2A 3CPFA 1A62A 1NE3A 3I7FA 3BZCA 5FLMG 3CCSA 4HJ5A 2UXDL 1OXTA 2DUDA 2Q2IA 5IP7H 1VQ7A 4PG3A 1FJGL 4JBMA 1GM5A 4HJAA 2JA9A 1K83H 2RHSB 3AFPA 4LFAL 2JE6I 1N33Q 1ASYA 4A75A 4GNXA 3KJOA 4L5TA 1JJCB 4DV0L 3TREA 3S1MH 4DR6L 1FJGQ 3HKZG 1G6PA 1QVGA 2UU9L 4UP8A 3ER0A 4C2MH 2ZJRA 3WWVA 4A4IA 4BBRG 1KIXA 4DNIA 4IJHA 4JOIA 3I2ZA 5AJ3L 4LFBL 1AE2A 1UEBA 2IHEA 2AWNA 2PI2A 2HIXA 1K73C 1K8GA 2RHQB 3KF6A 3PO3G 2KCTA 5M5XH 1Z9FA 3ICEA 1I50H 3F8TA 4GOPC 3CC2A 2WAQE 3HOWG 2WP8J 3CAMA 1JB7A 2R7ZH 1NBWA 4R4CA 3H0GH 4GNXC 4IO9A 3G48A 4Y7NH 1Q82C 1PA6A 1IL2A 4DR4L 1OXXK 5C4JH 3A74A 1VQPA 3H3VH 4LF9Q 1M1KC 1JJ2A 4DK3C 1IZ6A 3A5ZB 4X66Q 3L2PA 4JOIC 3I56A 3GD7A 3PGZA 3ULPA 1K8AC 1PYSB 5IWAQ 3AFQA 4B3ML 3DM3A 4LF4L 4OONA 1P8LA 1VQIA 3Q8DA 1XPOA 3D0FA 2ID0A 5C3EG 2CCZA 1VQKA 4R1JA 4JI1Q 1L0WA 5E7NA 4X65L 4DV2Q 1VQ8A 4AYBG 3M7NA 1A0IA 4A3IG 4A3EH 4NXMQ 1A8VA 4DV6L 5C0XG 3FP9A 1VQFA 1RIPA 1HR0Q 4DV4Q 3PIOA 3U50C 1LTLA 2VNUD 1KQSA 2YYZA 4DR1Q 1LM0A 2K4KA 3HOVH 3HOYG 2E2JH 4A3CH 1G51A 2ZTEA 3G4SA 4LUOA 2D62A 4DV3L 4BXXH 1VQEA 2XGTA 4X64Q 1GKHA 4QY7A 1IBMQ 1E1TA 4LF8L 4OX9L 1VQJA 1YEZA 3PUXA 4IPDA 3EIVA 3K0XA 4OWTB 3T1YL 3CCEA 1N34Q 1N32Q 3KYHC 4H02A 1HNXL 2HHHL 4K0KQ 1L2FA 3J7ZC 3CC4A 4GKKL 1V9PA 4X6AH 4IJLA 1XJVA 1CKMA 2E5LL 4A3MH 1VQBA 2L15A 1X6OA 4JI0L 5IP9G 3K80C 2OQ0A 2K5VA 5BR8Q 2NVYH 4JI6L 3I4NG 1YHBA 4YCVA 1HH2P 5GAHC 2ZJPA 4OWWB 3RZOH 4JI3Q 4MTNA 4HIMA 4DR7L 3JAMi 2UXCQ 4JBJA 2CKZB 4UPAA 4B3TL 4A3GH 3TEHB 4IPHA 5JJIA 5LMNW 1YHAA 4JI2L 1YBYA 1AE3A 4DR5Q 1A63A 1YZ6A 1VQCA 3D31A 4LUVA 4BBSG 1I5FA 5FLXc 5IE8A 3RLOA 1Q46A 3BU2A 5K36G 5LMNL 3HOYH 1X55A 1I94L 2UXCL 4O0AA 4DUYL 4A3DG 2FXQA 1MKHA 3NENA 4JI5Q 1K3RA 3J81j 1ASZA 5JJLA 2IX0A 1JE5A 2LSSA 1NMGA 1X9NA 4DR4Q 1V1QA 5LMUL 2I5HA 2VY3A 1PH5A 2K5HA 3PUYA 3J81c 3GTGH 3PCOB 2D0OA 3S1NH 2QA4A 1HNXQ 2HHHQ 5IYDG 4JI4L 2N49A 3KF6B 4P71A 4R4QA 3GTOH 4X64L 2R7DA 2R7FA 4P74A 1YJNA 1PFSA 1UWVA 1Y1WG 4R4IA 2Q2UA 3S2DH 2RF4A 1SN8A 4DR6Q 2CFMA 2E2HH 2IHFA 3IRBA 2WB1E 2UUBL 5JEAG 2JA5G 2JA6H 3W1BA 2MQHA 5M3FG 2JEAI 2EIFA 1PH7A 4JI6Q 3S16H 4X65Q 2VQEL 3AQQA 4MNOA 1YJ9A 1TXYA 3G6EA 3TQYA 3UDXA 4GLVB 3U58A 1PH6A 1YJWA 2JJQA 4A76A 1KD1C 3HOXH 1N36L 5DLQE 2ZM6L 2NZOA 4BY1H 5FJ8G 3A5UA 1UE7A 2Z6KA 1E24A 2K50A 3HOUG 1N32L 2LXKA 3G71A 5M3MG 1X3GA 3ULLA 4DUZL 4O2DA 1N9WA 4PZ6A 1XPUA 2E5LQ 4LF6Q 1XMQL 2UUAQ 1EQRA 2YTVA 1TWFH 4QJFA 1K0RA 4K0KL 1VQOA 4POFA 1X56A 1CSPA 3K7AH 1U5KA 1XMOL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKN B;  3CCQ A;  3PO2 H;  4JCV E;  1OXU A;  3M9B A;  4GNX B;  4LFB Q;  1X3F A;  3RR5 A;  4Y52 H;  1H95 A;  3AEV A;  3HOX G;  1S72 A;  4JYA Q;  4KI0 A;  5JEA J;  1SMX A;  1WFQ A;  2F52 A;  3ERS X;  4DV0 Q;  1VQ4 A;  1YNX A;  4AQY Q;  4QIW E;  5FJ8 H;  1PV4 A;  2E8G A;  5LMU Q;  1N36 Q;  1Q12 A;  4A3F G;  1WOC A;  1J5E L;  3BJU A;  2IX1 A;  3H3V I;  1L1O A;  1O7I A;  1SRU A;  2N8N A;  4LFC L;  3S14 H;  3S17 H;  4A3G G;  5ELN A;  4A3C G;  3J80 i;  2PQA B;  1WYD A;  4MZ9 A;  1XTD A;  1W2B A;  3I4M G;  3HKS A;  4GKK Q;  5IWA L;  4JI8 L;  2VUM H;  1P16 A;  2UXB L;  3CXC A;  1GVP A;  3RZD H;  2EXD A;  4JBK A;  3GTP H;  5GAE C;  3CCM A;  4KHP Q;  1UE6 A;  3M4P A;  2KCM A;  1S40 A;  2OCE A;  4A3K H;  4LF9 L;  1E7Z A;  2VS1 A;  2V1C C;  4AQY L;  2Q2T A;  4DR2 Q;  2NVX H;  1L1O C;  1SLJ A;  2B63 G;  1WJJ A;  2WFW A;  4QGU A;  2MNA A;  4BY1 G;  4DR3 Q;  1XNR Q;  2YU9 H;  1LYL A;  1QVC A;  4L5Q A;  4DKA C;  2IT1 A;  4DPG A;  1NTG A;  3KDF B;  1FGU A;  2QEX A;  1IYJ B;  3MXN B;  4NPS A;  2OQK A;  3KLW A;  1Q81 C;  1GO3 E;  3I4O A;  3CD6 A;  1LUZ A;  4KHZ A;  3GTM H;  1BBU A;  1Q1B A;  1XNR L;  4B3M Q;  4B3S Q;  1K9M C;  2VL6 A;  1CKO A;  4APV A;  1CUK A;  1B7Y B;  1EIF A;  2GVB A;  3J80 c;  4DV1 Q;  1YI2 A;  4IPG A;  5BR8 L;  4HIO A;  5M5W H;  4LF5 Q;  2KHJ A;  4BBR H;  1J5E Q;  3PO2 G;  4DV4 L;  2I5M X;  2LXJ A;  2KEN A;  2Q2H A;  2NVQ H;  1PH4 A;  1I94 Q;  3W5O A;  3DLL A;  5C4X G;  1EWI A;  2B3G A;  1VS0 A;  4AH6 A;  3I4N H;  1SRO A;  4JI2 Q;  3NEM A;  2ES2 A;  1TWA H;  2JA8 G;  3STB C;  2Z0S A;  4LF4 Q;  3PUZ A;  2OWO A;  1Y1V H;  2R7Z G;  2K52 A;  2B29 A;  1B70 B;  2R6G A;  3K81 C;  3T1Y Q;  1N34 L;  4JC0 A;  1HZB A;  3U4V A;  3HOV G;  3PV0 A;  4A3L G;  1FVI A;  1KRS A;  4RMF A;  1X3E A;  2VQF Q;  4DR2 L;  4P75 A;  1YHQ A;  3J81 i;  4A3B G;  1XMQ Q;  1N8R C;  3E9I A;  1PYB A;  3MEF A;  4YCU A;  2UUA L;  1RL2 A;  3BZK A;  3CP0 A;  2HQL A;  4YWM A;  3UDI A;  2JA5 H;  4DV5 L;  4A3J H;  2HT1 A;  4R4O A;  5IYB G;  2JA6 G;  1KXL A;  2BH8 A;  2NVT H;  5C44 H;  4PZ8 A;  1C7Y A;  2I5L X;  1JT8 A;  3GTK H;  2NN6 I;  3CW2 C;  1QVF A;  4LF7 L;  2ZTD A;  2UXD Q;  2A1A A;  4DR5 L;  3CF5 A;  1W3S A;  4C3I H;  5JJK A;  4PZ7 A;  1BKB A;  2D0P A;  5IYD H;  3U4Z A;  4JI7 L;  4UY8 C;  3CCR A;  1PH1 A;  2OTL A;  3JC6 6;  4TVA B;  4DV1 L;  2A19 A;  3K8A A;  2MO1 A;  2UUC Q;  3RNU A;  4JI4 Q;  4YCW A;  3GDE A;  1QZG A;  4OO1 I;  2VUM G;  4BXX G;  5H1S E;  2AWO A;  2WAQ G;  3EN2 A;  3GTQ H;  3PSI A;  1KRT A;  4A3D H;  4B3T Q;  2XTI A;  4LF6 L;  2YV5 A;  4BA2 I;  1PVO A;  2CQO A;  5AJ3 Q;  4A3B H;  2JQO A;  1HNZ L;  1IBK L;  2DGY A;  4GKJ Q;  3RN5 A;  2B63 H;  1I6H H;  3PF5 A;  4C3H H;  1M90 C;  3PIP A;  1EIY B;  2JEB I;  4P73 A;  1VQH A;  5IY0 A;  1Y1V G;  2Y0S G;  3KDF A;  2JA8 H;  4UP9 A;  1VQN A;  3TS2 A;  3T1H L;  1VQL A;  2MO0 A;  4GLA C;  2CWP A;  1Y1W H;  3TRZ A;  4DUZ Q;  5IP7 G;  1UE1 A;  3FKI G;  1EYG A;  4IPC A;  3VDY A;  4JI0 Q;  3KF8 B;  1C9O A;  4GN4 B;  1OXS C;  2ZM6 Q;  2BA1 A;  4XIG S;  2NZH A;  2KBN A;  1D7Q A;  1SR3 A;  2GVA A;  4QL5 A;  4B3R L;  1HNW Q;  4FDB A;  1HR0 L;  4DUY Q;  5HGQ A;  4L5R C;  2UUB Q;  4X66 L;  1VCI A;  3S1R H;  1D8L A;  2Y0S E;  3NEL A;  3TS0 A;  1E1O A;  2F4V L;  3I55 A;  4DV5 Q;  1QUQ B;  1Y14 B;  4HJ7 A;  1S3O A;  2ATW A;  4X62 Q;  4BA1 I;  4GOP B;  4YWL A;  2QGQ A;  1E22 A;  3W1G A;  5ELO A;  1BBW A;  1Q86 C;  4IFD G;  3CCJ A;  4J15 A;  1L1O B;  5C0X I;  4XTC S;  4NXN L;  1PH3 A;  5J3B A;  2R92 H;  4BBS H;  3HOZ G;  2ASB A;  3CCU A;  2PQA A;  2A8V A;  1IBK Q;  3EBE A;  4WJ4 A;  4B3R Q;  3HOZ H;  1TWG H;  1NJI C;  3LGJ A;  3S15 H;  4RG1 A;  1YIJ A;  2JA7 H;  5C44 G;  4POG A;  5IYB H;  1B8A A;  2HIV A;  2PNH A;  1QZH A;  3J7A 5;  1SFO H;  1KHI A;  1NMF A;  4GKJ L;  2R93 H;  3CCV A;  4KLK A;  5LMN Q;  1V43 A;  1KC8 C;  1JJG A;  2YTX A;  3T1H Q;  1DGS A;  1VQ5 A;  4QQB X;  4HIK A;  4IFD I;  5EAY A;  1HR0 W;  3PO3 H;  2PI2 E;  4ME3 A;  4OXP A;  4A3F H;  2F3I A;  1GD7 A;  1XPR A;  3L0O A;  4P72 A;  1TWC H;  1U0L A;  3PUW A;  5C0X J;  3CCL A;  1X65 A;  1XMO Q;  2VZA A;  5GQO A;  3RLF A;  2AHO B;  4JI3 L;  3FKI H;  3GTL H;  3GTJ H;  4DK6 C;  1IBL L;  4A93 G;  5HY6 A;  1KL9 A;  3ULJ A;  3OTO Q;  2F4V Q;  1WCM G;  4R4T A;  4GS3 A;  4A3K G;  5GAG C;  1EOV A;  4AYB E;  2JK8 A;  1WCM H;  5C3E H;  3RN2 A;  2R93 G;  3GO5 A;  4DV3 Q;  2EQS A;  1EQQ A;  2UUC L;  4NXN Q;  3F1Z A;  1HNZ Q;  4JBW A;  3H15 A;  3HKZ E;  5C4X H;  3HOW H;  2RCN A;  2YTY A;  4C3J H;  3JAM c;  5FLM H;  1EUJ A;  1Q1E A;  4IOA A;  2E2I H;  3FHW A;  3UE1 A;  2WB1 G;  2PMZ E;  4IFD J;  4A3L H;  1OXV A;  1YVC A;  4HJ9 A;  4JI7 Q;  1HNW L;  1IXR A;  3UDG A;  4HID A;  2IY5 B;  4JI1 L;  2ZTC A;  4ALP A;  3S2H H;  1I3Q H;  5IYC H;  3M4O H;  2N78 A;  4IOC A;  1JMC A;  1Q7Y C;  3S24 A;  4OO1 G;  1N33 L;  1IBM L;  4A3M G;  4LF8 Q;  4A3E G;  4OX9 Q;  5IP9 H;  3CC7 A;  3NBH B;  3UE0 A;  3M4Q A;  4GN5 A;  1WI5 A;  3S1Q H;  3CME A;  2N3S A;  4YHH Q;  4HJ8 A;  1XNQ L;  3UDF A;  4GOP A;  3PF4 A;  2VQF L;  3HOU H;  3L7Z C;  3KOJ A;  4LWC A;  1EFW A;  4B3S L;  1VQ9 A;  2R92 G;  2OTJ A;  2NN6 G;  4EX5 A;  4JI5 L;  4JV5 Q;  3ZJY C;  1PHJ A;  4NXM L;  4YHH L;  3F2D A;  2BA0 A;  4YWK A;  4LW1 A;  1BVS A;  2C35 B;  1AH9 A;  1HJP A;  3B6Y A;  1VQG A;  4A93 H;  1YIT A;  1C0A A;  3K7U C;  1PH9 A;  4YY3 L;  2AMC B;  2K5N A;  3PUV A;  4DR1 L;  5M3F H;  1HZ9 A;  1SE8 A;  4DR3 L;  2AKW B;  1PH8 A;  1UE5 A;  4DAM A;  3SGI A;  1MIU A;  5GRO A;  4X62 L;  4DR7 Q;  4JI8 Q;  3F2B A;  4TQU S;  4DV6 Q;  1XNQ Q;  1HZC A;  4DV7 Q;  1J6Q A;  1MJC A;  5IT9 c;  2I0Q A;  1IBL Q;  1G29 1;  4LFA Q;  1NY4 A;  4LFC Q;  1Z47 A;  2ZJQ A;  2CWA A;  3E9H A;  3KJP A;  4LF5 L;  2VQE Q;  1CKN A;  2KHI A;  4NB3 A;  4JG2 A;  3M85 A;  4A3I H;  3OYY A;  1VQ6 A;  3F2C A;  4BY7 G;  1PH2 A;  4LUZ A;  4JYA L;  4DV2 L;  2BH2 A;  4LF7 Q;  4LNQ A;  3A0J A;  4BY7 H;  2VW9 A;  4GN3 B;  1OTC A;  4AIM A;  2MFI A;  3H0G G;  3CPW A;  5GAD C;  1TWH H;  4L5S A;  2JA7 G;  2Z6K C;  2H5X A;  1E3P A;  3I4M H;  1VQD A;  1X54 A;  3HFZ B;  5M5Y H;  3CQZ H;  1R9T H;  4DV7 L;  1HZA A;  5IYC G;  4JV5 L;  1KAW A;  1VQA A;  3STB D;  4EQ5 A;  4A3J G;  1Q8K A;  4UP7 A;  2K14 A;  4OWX B;  3M3Y H;  2ALY B;  3RLN A;  4YY3 Q;  3OTO L;  3KFU A;  4WJ3 M;  4PMW A;  4GLX A;  3E0E A;  5M3M H;  3CMA A;  4KHP L;  1VQM A;  2K75 A;  1T9H A;  4DAY B;  1FL0 A;  2GN5 A;  2UU9 Q;  1MJE A;  2UXB Q;  1QUQ A;  1CSQ A;  3AYH B;  3OW2 A;  3CPF A;  1A62 A;  1NE3 A;  3I7F A;  3BZC A;  5FLM G;  3CCS A;  4HJ5 A;  2UXD L;  1OXT A;  2DUD A;  2Q2I A;  5IP7 H;  1VQ7 A;  4PG3 A;  1FJG L;  4JBM A;  1GM5 A;  4HJA A;  2JA9 A;  1K83 H;  2RHS B;  3AFP A;  4LFA L;  2JE6 I;  1N33 Q;  1ASY A;  4A75 A;  4GNX A;  3KJO A;  4L5T A;  1JJC B;  4DV0 L;  3TRE A;  3S1M H;  4DR6 L;  1FJG Q;  3HKZ G;  1G6P A;  1QVG A;  2UU9 L;  4UP8 A;  3ER0 A;  4C2M H;  2ZJR A;  3WWV A;  4A4I A;  4BBR G;  1KIX A;  4DNI A;  4IJH A;  4JOI A;  3I2Z A;  5AJ3 L;  4LFB L;  1AE2 A;  1UEB A;  2IHE A;  2AWN A;  2PI2 A;  2HIX A;  1K73 C;  1K8G A;  2RHQ B;  3KF6 A;  3PO3 G;  2KCT A;  5M5X H;  1Z9F A;  3ICE A;  1I50 H;  3F8T A;  4GOP C;  3CC2 A;  2WAQ E;  3HOW G;  2WP8 J;  3CAM A;  1JB7 A;  2R7Z H;  1NBW A;  4R4C A;  3H0G H;  4GNX C;  4IO9 A;  3G48 A;  4Y7N H;  1Q82 C;  1PA6 A;  1IL2 A;  4DR4 L;  1OXX K;  5C4J H;  3A74 A;  1VQP A;  3H3V H;  4LF9 Q;  1M1K C;  1JJ2 A;  4DK3 C;  1IZ6 A;  3A5Z B;  4X66 Q;  3L2P A;  4JOI C;  3I56 A;  3GD7 A;  3PGZ A;  3ULP A;  1K8A C;  1PYS B;  5IWA Q;  3AFQ A;  4B3M L;  3DM3 A;  4LF4 L;  4OON A;  1P8L A;  1VQI A;  3Q8D A;  1XPO A;  3D0F A;  2ID0 A;  5C3E G;  2CCZ A;  1VQK A;  4R1J A;  4JI1 Q;  1L0W A;  5E7N A;  4X65 L;  4DV2 Q;  1VQ8 A;  4AYB G;  3M7N A;  1A0I A;  4A3I G;  4A3E H;  4NXM Q;  1A8V A;  4DV6 L;  5C0X G;  3FP9 A;  1VQF A;  1RIP A;  1HR0 Q;  4DV4 Q;  3PIO A;  3U50 C;  1LTL A;  2VNU D;  1KQS A;  2YYZ A;  4DR1 Q;  1LM0 A;  2K4K A;  3HOV H;  3HOY G;  2E2J H;  4A3C H;  1G51 A;  2ZTE A;  3G4S A;  4LUO A;  2D62 A;  4DV3 L;  4BXX H;  1VQE A;  2XGT A;  4X64 Q;  1GKH A;  4QY7 A;  1IBM Q;  1E1T A;  4LF8 L;  4OX9 L;  1VQJ A;  1YEZ A;  3PUX A;  4IPD A;  3EIV A;  3K0X A;  4OWT B;  3T1Y L;  3CCE A;  1N34 Q;  1N32 Q;  3KYH C;  4H02 A;  1HNX L;  2HHH L;  4K0K Q;  1L2F A;  3J7Z C;  3CC4 A;  4GKK L;  1V9P A;  4X6A H;  4IJL A;  1XJV A;  1CKM A;  2E5L L;  4A3M H;  1VQB A;  2L15 A;  1X6O A;  4JI0 L;  5IP9 G;  3K80 C;  2OQ0 A;  2K5V A;  5BR8 Q;  2NVY H;  4JI6 L;  3I4N G;  1YHB A;  4YCV A;  1HH2 P;  5GAH C;  2ZJP A;  4OWW B;  3RZO H;  4JI3 Q;  4MTN A;  4HIM A;  4DR7 L;  3JAM i;  2UXC Q;  4JBJ A;  2CKZ B;  4UPA A;  4B3T L;  4A3G H;  3TEH B;  4IPH A;  5JJI A;  5LMN W;  1YHA A;  4JI2 L;  1YBY A;  1AE3 A;  4DR5 Q;  1A63 A;  1YZ6 A;  1VQC A;  3D31 A;  4LUV A;  4BBS G;  1I5F A;  5FLX c;  5IE8 A;  3RLO A;  1Q46 A;  3BU2 A;  5K36 G;  5LMN L;  3HOY H;  1X55 A;  1I94 L;  2UXC L;  4O0A A;  4DUY L;  4A3D G;  2FXQ A;  1MKH A;  3NEN A;  4JI5 Q;  1K3R A;  3J81 j;  1ASZ A;  5JJL A;  2IX0 A;  1JE5 A;  2LSS A;  1NMG A;  1X9N A;  4DR4 Q;  1V1Q A;  5LMU L;  2I5H A;  2VY3 A;  1PH5 A;  2K5H A;  3PUY A;  3J81 c;  3GTG H;  3PCO B;  2D0O A;  3S1N H;  2QA4 A;  1HNX Q;  2HHH Q;  5IYD G;  4JI4 L;  2N49 A;  3KF6 B;  4P71 A;  4R4Q A;  3GTO H;  4X64 L;  2R7D A;  2R7F A;  4P74 A;  1YJN A;  1PFS A;  1UWV A;  1Y1W G;  4R4I A;  2Q2U A;  3S2D H;  2RF4 A;  1SN8 A;  4DR6 Q;  2CFM A;  2E2H H;  2IHF A;  3IRB A;  2WB1 E;  2UUB L;  5JEA G;  2JA5 G;  2JA6 H;  3W1B A;  2MQH A;  5M3F G;  2JEA I;  2EIF A;  1PH7 A;  4JI6 Q;  3S16 H;  4X65 Q;  2VQE L;  3AQQ A;  4MNO A;  1YJ9 A;  1TXY A;  3G6E A;  3TQY A;  3UDX A;  4GLV B;  3U58 A;  1PH6 A;  1YJW A;  2JJQ A;  4A76 A;  1KD1 C;  3HOX H;  1N36 L;  5DLQ E;  2ZM6 L;  2NZO A;  4BY1 H;  5FJ8 G;  3A5U A;  1UE7 A;  2Z6K A;  1E24 A;  2K50 A;  3HOU G;  1N32 L;  2LXK A;  3G71 A;  5M3M G;  1X3G A;  3ULL A;  4DUZ L;  4O2D A;  1N9W A;  4PZ6 A;  1XPU A;  2E5L Q;  4LF6 Q;  1XMQ L;  2UUA Q;  1EQR A;  2YTV A;  1TWF H;  4QJF A;  1K0R A;  4K0K L;  1VQO A;  4POF A;  1X56 A;  1CSP A;  3K7A H;  1U5K A;  1XMO L; 
#chains in the Genus database with same CATH topology
 1CKN B;  3CCQ A;  4A3E B;  1GUT A;  4JCV E;  3RR5 A;  4Y52 H;  3D6C A;  2K28 A;  2G5D A;  3ND8 A;  2E75 C;  3BVZ A;  3HOX G;  1S72 A;  3BVG A;  4A3M B;  2P5Z X;  1HA6 A;  4QIW E;  5F2D A;  2E8G A;  5LMU Q;  1Q12 A;  5KIX A;  3H3V I;  3GTK B;  2AUK A;  4WRD A;  3J7A F;  3IFD A;  2PQA B;  1WYD A;  4PMB A;  4RGT A;  1PTO B;  3T16 A;  2R92 B;  4XQQ A;  2VUM H;  3CXC A;  1YNN D;  4U67 3;  3SR1 A;  2GA4 B;  3L9A X;  3R93 A;  4KHP Q;  1S40 A;  4LF9 L;  5KEE A;  2OCE A;  4AQY L;  3URY A;  4O42 A;  1SLJ A;  3S9W A;  4BY1 G;  1WTX A;  2YU9 H;  2EY6 A;  4DKA C;  1NTG A;  1FGU A;  2JA7 B;  2DY8 A;  3NSW A;  3CD6 A;  4DXG A;  3GTM H;  5EKI A;  1F9Q A;  3VR6 A;  3LX0 A;  1K9M C;  4LMQ D;  3NPP A;  1SYF A;  3GTJ B;  4DV1 Q;  1EIF A;  4IPG A;  5BR8 L;  5ELF A;  2WAC A;  5M5W H;  1J5E Q;  2I5M X;  3K58 A;  1HCZ A;  1SEB D;  5A2Q E;  1I94 Q;  1WD1 A;  3IKJ A;  1G91 A;  1CZW A;  3OW7 A;  4A3F B;  1EWI A;  3NEM A;  2O4X A;  2R7Z G;  3ONA B;  1B70 B;  3K81 C;  4K8I A;  3SK6 A;  3WOF A;  2KUM A;  4G7Z C;  1SFO B;  5E1F A;  4A3L G;  4BY7 B;  1KRS A;  4FVM A;  1TS5 A;  4A3B G;  1XMQ Q;  2UUA L;  4YCU A;  1RTN A;  4KV6 A;  1RL2 A;  3CP0 A;  4YWM A;  3NP8 A;  2JA6 G;  4DV5 L;  2HT1 A;  3EQL C;  2CQA A;  4A3I B;  2BH8 A;  2NVT H;  1SYG A;  2I5L X;  2F0U A;  3KBX A;  2LS0 1;  3CW2 C;  4ID6 A;  1HFN A;  1W3S A;  3DEP A;  4JI7 L;  1EFI D;  2KHS A;  2EY2 A;  3K8A A;  2MO1 A;  1Y8O B;  3RNU A;  4OO1 I;  3HP3 A;  3CQZ B;  1R9T B;  3EN2 A;  1KRT A;  1STY A;  1TY2 A;  4BA2 I;  2YV5 A;  2CQO A;  5AJ3 Q;  1CA5 A;  4A3B H;  1HNZ L;  2NB0 A;  4X3T A;  1I4G A;  3RN5 A;  3IL8 A;  3PF5 A;  1M90 C;  3PIP A;  1KDC A;  4P73 A;  4QB4 A;  4DNT B;  4JPB W;  5IY0 A;  5EKL A;  3KDF A;  4UP9 A;  1VQN A;  2J0T D;  1HXY D;  2PZT A;  4BY1 B;  1Y1W H;  4DUZ Q;  4IPC A;  2E2I B;  3DWA A;  3LWU A;  3KF8 B;  4GN4 B;  2BA1 A;  2KBN A;  2RBM A;  1TWA B;  1E0B A;  3SDZ A;  4B9W A;  4X66 L;  3K59 A;  3C1F A;  1E1O A;  2F4V L;  1Y14 B;  4Z9C B;  3DWQ A;  4X62 Q;  4IFD G;  1Q86 C;  4J15 A;  5C0X I;  5J3B A;  1I4Q A;  3TP6 A;  3CCU A;  1SMY C;  4X3S A;  2R7Z B;  1TWG H;  1NJI C;  1V1P A;  4POG A;  1C4Q A;  2HIV A;  1G8Z D;  1KHI A;  3CCV A;  2K5Q A;  4KLK A;  4QQB X;  3A7L A;  4C3H G;  3Q23 A;  4CGY B;  2F0M A;  2XRQ D;  3L0O A;  4RCN A;  5C0X J;  1TWF B;  5FO9 B;  1TQO A;  3CCL A;  4JI3 L;  2Z9H A;  1JIC A;  4ZK9 B;  1B3Q A;  1EIG A;  4DK6 C;  4G4K A;  4A93 G;  1X3P A;  3K5O A;  1EYA A;  1WCM G;  4R4T A;  4GS3 A;  4A3K G;  1EOV A;  3K5N A;  3G7L A;  4DV3 Q;  1Y8N B;  1EQQ A;  3TP7 A;  4DAV A;  2XNA C;  3DM1 A;  1RD9 D;  3VYS A;  2QDL A;  4DU9 A;  1PZJ D;  2RCN A;  3A8K E;  3JAM c;  1MSG A;  5FLM H;  1EUJ A;  4IOA A;  2PMZ E;  2EYL A;  1FD7 D;  4JI7 Q;  1YNN C;  5TSS A;  4HID A;  3UDG A;  2N55 A;  2IY5 B;  4IQZ A;  4KY7 A;  5IGD A;  5IYC H;  1SE2 A;  4HN7 A;  3P75 A;  1Q7Y C;  1IBM L;  3CC7 A;  2F0E A;  3M4Q A;  2E2J B;  4HJ8 A;  1D1K A;  1JR0 D;  3QO2 A;  2ZXP A;  1VQ9 A;  2OTJ A;  1STH A;  2NN6 G;  4NXM L;  3QG1 A;  4CKB A;  4A3G B;  1RF2 D;  2C35 B;  1W6K A;  1S5E D;  1C0A A;  2MP1 A;  4ME5 A;  2AMC B;  3EJI A;  1SE8 A;  1UE5 A;  4KK7 A;  4HCS A;  4X62 L;  3F2B A;  3RUZ A;  1J6Q A;  2I0Q A;  5IT9 c;  1IKL A;  3D3R A;  1NY4 A;  2H4O A;  4LFC Q;  1BOS A;  2ZJQ A;  3C3L A;  2VQE Q;  1WVL A;  3OYY A;  3TSS A;  4JK1 C;  3OWF A;  1SNM A;  1PH2 A;  4JYA L;  3HOX B;  4DV2 L;  1ZYR D;  4LNQ A;  3A0J A;  4GN3 B;  1XXG A;  1OTC A;  1B53 A;  1CHP D;  4N8F A;  1QB5 D;  1O80 A;  1X54 A;  3N6R A;  4DV7 L;  1HZA A;  4TKO B;  4JV5 L;  1KAW A;  2RKS A;  1ZEQ X;  1K8O A;  4G7H C;  3OMG A;  4UP7 A;  3I4N B;  4ULL A;  3DHQ A;  2PYK A;  4GLX A;  3K5L A;  5M3M H;  4N9T A;  1WCM B;  2X69 A;  1VQM A;  4RGM A;  1PTO C;  1XWE A;  3HRZ C;  3OW2 A;  1A62 A;  1QNK A;  4KKS A;  2L0C A;  1VQ7 A;  4JBM A;  4ZAI A;  1NR2 A;  4OGQ C;  1GM5 A;  1KTK A;  4XYQ A;  4HSV A;  3AFP A;  5J1Z A;  4CDE C;  4A75 A;  1KLG D;  3MEH A;  4F8M A;  3S1M H;  4DR6 L;  4R8N A;  1QVG A;  1TKW B;  4Q0F A;  3WWV A;  3J80 E;  4DNI A;  4IJH A;  1NUC A;  5M9O A;  1SND A;  1K73 C;  3PO3 G;  3OIP A;  3HOW G;  2WP8 J;  1V1O A;  1ZYR C;  3CAM A;  1NBW A;  4F88 A;  4GNX C;  1PA6 A;  1G6P A;  4QCL A;  4HED A;  1JJ2 A;  2B2V A;  4DK3 C;  3FPU B;  3A5Z B;  4X66 Q;  2A6H D;  3L2P A;  3D4D A;  3FDT A;  1BBX C;  1PYS B;  1GUW A;  3QOJ A;  1R4Q B;  4C56 C;  2OXP A;  5M3M B;  4OON A;  3NWT A;  4IN3 A;  2B2Y C;  4C3J B;  1PFN A;  3D0F A;  2CCZ A;  1HPC A;  2NTT A;  4FF3 A;  1SYC A;  3M7N A;  4A3I G;  1M4V A;  4NXM Q;  1VQF A;  2F0F A;  4DFA A;  1V1P B;  4DV4 Q;  3U50 C;  2VNU D;  3K6O A;  4EGV A;  1T5X D;  2F0J A;  1GJX A;  3P20 A;  4LF8 L;  4OX9 L;  1YEZ A;  1JB3 A;  1SMY D;  1I4P A;  1N32 Q;  3CCE A;  3KYH C;  1HNX L;  4K0K Q;  4X6A H;  3J7Z C;  4GKK L;  3M4O B;  2FJ2 A;  2KEE A;  4KTA A;  3I90 A;  1XYI A;  1X6O A;  1S5D D;  2X6G A;  4JI6 L;  3I4N G;  2PZU A;  5GAH C;  4OWW B;  4JI3 Q;  4MTN A;  5EPL A;  3JAM i;  4A3G H;  4KJO A;  5LMN W;  4DR5 Q;  1VQC A;  3D31 A;  5FLX c;  1NNX A;  5IE8 A;  3RLO A;  2JP1 A;  4O0A A;  4A3D G;  3J81 j;  1K83 B;  1GUO A;  1X9N A;  1JWS D;  1NMG A;  1CT1 D;  4ZUJ A;  5LMU L;  4RKB A;  2VY3 A;  1NAP A;  1PH5 A;  1KNA A;  5E4X A;  5ELD A;  2Q8R E;  3MFY A;  3VA5 A;  3E6Z X;  1FGB D;  1LTT D;  4L6T B;  3HOY B;  4RHS A;  2MHV A;  2R7D A;  3E3X A;  1B44 D;  3S2D H;  2N88 A;  3V05 A;  4DR6 Q;  2K03 A;  2E2H H;  1CZG A;  1EZ6 A;  2QF7 A;  5J39 A;  3T56 B;  5JEA G;  2BCO A;  2MQH A;  1HRJ A;  2EIF A;  2R93 B;  1PH7 A;  4JI6 Q;  1TXY A;  2AUJ D;  2JXM B;  1PH6 A;  3GTO B;  1KD1 C;  3HOX H;  1N36 L;  1EZ8 A;  2NZO A;  2O5J C;  1N32 L;  4IUU A;  3HOU G;  2LXK A;  5M3M G;  1CA6 A;  1X3G A;  5DM6 3;  1KDB A;  1N9W A;  3GP7 A;  4PZ6 A;  4QIW B;  1GUS A;  3GTM B;  1AEX A;  4C3H B;  4FNF A;  1XMQ L;  1EQR A;  2UUA Q;  1E2W A;  3I73 A;  2K32 A;  1JQY D;  1TWF H;  4QJF A;  2PZW A;  1K0R A;  1X56 A;  3H94 A;  3S1R B;  1H9S B;  1CQF A;  1STN A;  2A73 B;  3M7G A;  4C2M B;  3PO2 H;  5CBE E;  3J7A V;  4KKU A;  2MPM A;  4JYA Q;  1SMX A;  3SK4 A;  4KHV A;  1VQ4 A;  1YNX A;  4AQY Q;  1J5E L;  2VUM B;  1WOC A;  2IX1 A;  4U68 A;  1O7I A;  3S14 H;  4A3C G;  2B8F A;  5D3D A;  2ICI A;  4A3J B;  1W2B A;  1TR5 A;  3BYT B;  5IWA L;  1DZ1 A;  5I9P A;  3RZD H;  5FO8 B;  1X3Q A;  1E2V A;  4JBK A;  3GTP H;  3CCM A;  3FEW X;  2IX3 A;  1MD2 D;  1UE6 A;  1E7Z A;  2V1C C;  2SOB A;  1Y1V B;  2F0V A;  2ZXR A;  3FMC A;  2WFW A;  4DR3 Q;  1XNR Q;  1QVC A;  2Z6B A;  4L5Q A;  1EIH A;  4HTH A;  3KDF B;  1IYJ B;  2XIW A;  3MXN B;  2QIL A;  2RQX A;  5K36 H;  1FNU A;  5C5L A;  3OSO A;  4V0B A;  3J80 L;  3VYT A;  4B3S Q;  2MUY A;  1CKO A;  4APV A;  1SYD A;  4HIO A;  4LF5 Q;  2KHJ A;  4BBR H;  2OT2 A;  3OMC A;  1Y69 U;  2KEN A;  4J8Q A;  2QW7 A;  1PH4 A;  3W5O A;  3DLL A;  5FKA C;  1SRO A;  1STG A;  1TWA H;  5I6Y A;  3TZD A;  1Y1V H;  2VB2 X;  4B08 A;  3LWE A;  2R6G A;  5A35 A;  1N34 L;  3HOU B;  4JC0 A;  2NZ1 D;  3U4V A;  3O13 A;  3PV0 A;  2VQF Q;  2A74 C;  4P75 A;  3E9I A;  5JEA H;  4A3J H;  4PZ8 A;  1C7Y A;  1JT8 A;  2NN6 I;  1B3A A;  5J22 A;  1B9M A;  2A6H C;  3ERO A;  3U4Z A;  3CCR A;  4TVA B;  4YCW A;  3GDE A;  1O78 A;  2VUM G;  3RMH A;  4BXX G;  3OOC A;  2WAQ G;  2M9V A;  3GTQ H;  3PSI A;  3GV6 A;  4A3D H;  3KLS A;  4B3T Q;  5C3E B;  2EVB A;  5D65 A;  4KJN A;  3AB9 A;  1IBK L;  4HMI A;  3J7Y W;  1F77 A;  4ILW A;  1BCP C;  2J4X A;  2A6E D;  3Q22 A;  1EIY B;  3MA2 B;  1X32 A;  3GTL B;  1LT4 D;  1Y1V G;  2JA8 H;  1RJT A;  5FLX E;  4ZYS A;  1QNU A;  2K04 A;  2PW5 A;  2CWP A;  2NBF A;  4A3B B;  5IP7 G;  3FKI G;  1EYG A;  1KAA A;  4Q5V A;  2F0Q A;  3VDY A;  4JI0 Q;  1C9O A;  1IHZ A;  4XIG S;  2B2W A;  1D7Q A;  2X6L A;  2CH4 W;  2GVA A;  1HNW Q;  4FDB A;  4XDX A;  5HGQ A;  2UUB Q;  2C5C A;  2KA7 A;  2D9U A;  1SDF A;  1QUQ B;  4M1U B;  2ATW A;  3I4L A;  4C3J G;  3A8I E;  4BA1 I;  5KGU A;  1QG7 A;  1E22 A;  1BBW A;  2R92 H;  3HOZ G;  2A8V A;  3S2H B;  1IBK Q;  3EBE A;  5C3X A;  3SXH A;  2NYZ D;  3L3O C;  3QOL A;  3S15 H;  2SNM A;  2JA7 H;  1DYQ A;  4NP5 A;  1HTP A;  5JOB A;  1B8A A;  2PNH A;  1QZH A;  4GKJ L;  2Q8T A;  2WV6 D;  1JJG A;  1V43 A;  3C46 A;  1AP0 A;  1XX8 A;  2YTX A;  1JCK B;  1EEI D;  4HIK A;  1HR0 W;  3DEO A;  3PO3 H;  5HUR A;  4A3F H;  2F3I A;  2AQ1 B;  1K28 A;  2AQ2 B;  2Z1C A;  1XPR A;  4PV1 C;  4P72 A;  5JPN C;  4H13 C;  3KLS X;  2VZA A;  5CR3 A;  2F0G A;  1B1Z A;  3HEJ A;  3GTL H;  4M8A A;  3GTJ H;  4CHT B;  3Q6S A;  3QWN A;  4CJ2 C;  5HY6 A;  3ULJ A;  3OTO Q;  4XT3 B;  1M8A A;  3AU7 A;  4K8J A;  2DJF C;  4CDC C;  5M3F B;  2EJM A;  3DXJ C;  5C3E H;  1MI2 A;  5C6A A;  5COY A;  3SK5 A;  3JAM L;  4EVO A;  3PQI A;  1PXU A;  3DUZ A;  1JOO A;  3HOW H;  3J81 E;  1SXT A;  3NHH A;  1QJO A;  2YTY A;  4C3J H;  5CV5 A;  3UE1 A;  3T53 B;  3A56 A;  5CV6 A;  4A3L H;  1IXR A;  1LLR D;  2NUC A;  4BBR B;  1I3Q H;  3CU7 A;  4J6H A;  2M00 A;  2WIN B;  2HD3 A;  1JMC A;  3FKI B;  1V8Q A;  1D6E C;  1N33 L;  4A3M G;  5IP9 H;  2K01 A;  3UE0 A;  4GN5 A;  2K05 A;  3CME A;  4YHH Q;  1SNO A;  2OEO A;  4IUR A;  1AZP A;  3HOU H;  4LWC A;  4B3S L;  2R92 G;  4HR7 B;  4JI5 L;  3ZJY C;  1PHJ A;  3QR8 A;  1EY6 A;  2BA0 A;  2EYF A;  3B6Y A;  1VQG A;  2J7Z A;  4DR1 L;  1HZ9 A;  3HOZ B;  4DR3 L;  2AKW B;  1ROD A;  4X3U A;  3SGI A;  2CHB D;  3BVM A;  2KCC A;  2F0P A;  4TQU S;  4O1N A;  4DV7 Q;  3CRK C;  4IUN A;  1IBL Q;  1G29 1;  1CFM A;  1O7Z A;  3FRP B;  4HAE A;  3KJP A;  2KHI A;  4JG2 A;  1EL0 A;  3S14 B;  4WOR A;  1I4R A;  3P1H A;  5JPM C;  4LF7 Q;  4AIM A;  2MFI A;  3H0G G;  4L5S A;  3BZD B;  4IUT A;  1E3P A;  1LTB D;  4HCE A;  1L0Y B;  1O7Y A;  1VQD A;  5M5Y H;  5IYC G;  3STB D;  5KNB A;  4A3J G;  2LFN A;  2HDL A;  2KEC A;  5IGE A;  4OWX B;  4PMW A;  1BF4 A;  3CMA A;  1T9H A;  4DAY B;  1FL0 A;  4BBS B;  3E0J A;  1CSQ A;  1VF5 C;  3AYH B;  1NE3 A;  2NTS A;  2UXD L;  1OXT A;  2DUD A;  3T51 B;  2Q2I A;  4PG3 A;  1FJG L;  1GOZ A;  3F2U A;  1K83 H;  1CQV A;  4K6L A;  2XVS A;  3M3Y B;  4GNX A;  4L5T A;  4HSP A;  4DV0 L;  3TRE A;  1LTR D;  5CBA E;  1J8I A;  1F9R A;  4C2M H;  3ER0 A;  4BBR G;  4A4I A;  2DNC A;  1KIX A;  4ZUI A;  1PZI D;  3I2Z A;  5AJ3 L;  2BOS A;  2AWN A;  4KY5 A;  4XT1 B;  2RHQ B;  5I4D A;  2K7V A;  1Z9F A;  3ICE A;  2Q8I B;  3CC2 A;  1RDP D;  4NKL A;  5JJZ A;  3IAY A;  2R61 A;  5C4J H;  2A69 C;  3H3V H;  1M1K C;  1LV9 A;  4JOI C;  3ULP A;  5IT9 L;  1K8A C;  5C3W A;  4K2K A;  4B3M L;  1P8L A;  5EBD A;  3Q8D A;  1VQK A;  5KYI A;  1L0W A;  4X65 L;  2D2C C;  2K5W A;  1SE4 A;  1DM0 B;  1A8V A;  5FK9 C;  1T5E A;  5LHY 1;  4DV6 L;  1HR0 Q;  3PIO A;  1A2U A;  4XXE A;  5T1I A;  2BE5 C;  4DR1 Q;  1KQS A;  1TWH B;  4A3C H;  2O5I C;  4DV3 L;  4X64 Q;  1GKH A;  5LL6 S;  3PUX A;  2QEJ C;  3EIV A;  3K0X A;  4F7X A;  4B9X A;  1HQM C;  3H0G B;  1SSO A;  2HHH L;  1L2F A;  2WAQ B;  4IJL A;  4K6D A;  1EYD A;  2F0W A;  2E5L L;  1CKM A;  4JI0 L;  1QVF A;  2L15 A;  3FVQ A;  5IP9 G;  5BR8 Q;  3ITP A;  1DOK A;  3NBH A;  1TVX A;  1YHB A;  2KQ3 A;  1GHK A;  2UXC Q;  4JBJ A;  2A68 C;  2WKC A;  4B3T L;  1Q90 A;  1YZ6 A;  3V2T A;  4BBS G;  1I5F A;  1Q46 A;  2EYJ A;  1A6X A;  3NQI A;  5LMN L;  3HOY H;  2FXQ A;  1MKH A;  3J81 L;  1SNQ A;  3NXW A;  5JJL A;  3NUC A;  1JE5 A;  2LSS A;  2RDF A;  3CRL C;  1IKM A;  3GQB A;  2B2W C;  4HMJ A;  4FP5 D;  5IYD G;  1A3T A;  4JI4 L;  1SE3 A;  2WB1 B;  1BXT A;  4R4Q A;  4X64 L;  3WDN A;  5JVG 3;  1F9S A;  1YJN A;  3AMU A;  1RTO A;  2RF4 A;  4A93 B;  2CFM A;  1ZXT A;  1VMC A;  4LJZ C;  2JA6 H;  2JEA I;  1U4L A;  2NVQ B;  2XWB B;  3U58 A;  4GLV B;  3OPO A;  2JJQ A;  2EOT A;  4A76 A;  5DLQ E;  5IIF A;  3GV3 A;  2ZM6 L;  5FJ8 G;  3A5U A;  5NUC A;  3G71 A;  4O2D A;  3K57 A;  3T4A C;  1XPU A;  1UNS A;  5CV9 A;  2E5L Q;  4LF6 Q;  1LTI D;  1ICF B;  4K0K L;  2TSS A;  1QWY A;  1XMO L;  1KLU D;  1OXU A;  1II3 A;  2F0N A;  3M9B A;  4LFB Q;  1X3F A;  1GUG A;  2EPB A;  4WFN 3;  1IYV A;  3QJY A;  1BR9 A;  4KI0 A;  1WFQ A;  2F52 A;  3ERS X;  4DV0 Q;  2L5T A;  1EQV A;  1EOT A;  5FJ8 H;  4A3G G;  3MXG A;  4LFC L;  3MVV A;  3J80 i;  4MZ9 A;  1XTD A;  3I4M G;  1ESF A;  3HKS A;  4GKK Q;  2UXB L;  1GVP A;  5I2Y A;  1WD0 A;  4IUP A;  3LNN A;  2RDG A;  3M4P A;  2KCM A;  4A3K H;  2VS1 A;  2Q2T A;  2Y0S B;  4DGZ A;  4OIJ A;  2NVX H;  2B63 G;  1WJJ A;  2F0H A;  2PCF B;  5D14 A;  1LYL A;  4RGO S;  1JWM D;  4DPG A;  2EXZ A;  2L4N A;  1TS3 A;  3HG9 A;  1WTV A;  4NPS A;  5KND A;  2OQK A;  3I4O A;  1LUZ A;  1BBU A;  1Q1B A;  2F4I A;  1H9K A;  1YNJ C;  4OEM B;  1B50 A;  4ZKC B;  3J80 c;  3PO2 G;  4DV4 L;  2Z4H A;  2F3W A;  5ELB A;  4FXD A;  3MHB A;  5C4X G;  1Z7T A;  4JI2 Q;  2ES2 A;  1SNP A;  3V96 A;  2B29 A;  4QUC A;  3T1Y Q;  4N8X 1;  1HZB A;  5KRU A;  4RKL A;  4UDU C;  3HOV G;  1K3B C;  5BN3 A;  1FVI A;  1U4R A;  1X3E A;  3S2D B;  1WTW A;  1YHQ A;  3NTK A;  5EGT A;  1PYB A;  3H09 A;  1TWG B;  4IUV A;  3NTI A;  4C3I B;  1KXL A;  1SJH D;  1B9N A;  4P2C B;  3E5S A;  1FYC A;  3GTK H;  4LF7 L;  2IJ0 A;  2ZTD A;  3CHB D;  2A1A A;  3HKZ B;  5JJK A;  4PZ7 A;  2D0P A;  1SAP A;  5IYD H;  1PLF A;  4UY8 C;  1PH1 A;  1WTQ A;  4IFD H;  2UUC Q;  3MXU A;  4ZLT F;  1BQQ T;  5H1S E;  2AWO A;  2ZT9 C;  1AZQ A;  1ESR A;  4ZCK A;  2XTI A;  3VR5 A;  4LF6 L;  2RDH A;  2JQO A;  4RCO A;  4RWS C;  1J9O A;  2DNE A;  1MHW C;  1CK1 A;  1RCV D;  1I6H H;  2G9H D;  4ODG A;  4CBV A;  1OO9 B;  2EYO A;  4ZKB B;  1PFB A;  2JEB I;  3A54 A;  1VQH A;  4FF4 A;  2Y0S G;  2B63 B;  2PNR C;  3DMU A;  5FOB B;  3T1H L;  1VQL A;  2MO0 A;  1AFP A;  4GLA C;  3BS1 A;  5COR A;  3NWS A;  1ENA A;  2B2U C;  3I91 A;  1OXS C;  1CM9 A;  1SR3 A;  1ENC A;  1GXD C;  4DUY Q;  1VCI A;  3K0Y A;  1D8L A;  2Y0S E;  3U9O A;  3NEL A;  4X3K A;  1Y1W B;  1EWC A;  1H9R A;  1S3O A;  1EQT A;  4GOP B;  2QGQ A;  4YIJ A;  5C4Z A;  3CCJ A;  1L1O B;  4CJ1 B;  4XTC S;  4NXN L;  1PH3 A;  2ASB A;  1I50 B;  2NVT B;  1GUN A;  3HOZ H;  1TS4 A;  2XWJ B;  4RG1 A;  1YIJ A;  2EZV A;  1Q3L A;  2MGS A;  4V19 0;  3J7A 5;  1I4X A;  1SFO H;  2F0T A;  2CH4 A;  5LMN Q;  1KC8 C;  3T1H Q;  1DGS A;  4C3I G;  4IFD I;  2XN9 C;  2PI2 E;  4ME3 A;  4OXP A;  3S1M B;  2K33 A;  4NDX A;  4GZY C;  3EVQ A;  3S15 B;  4MTK A;  3PUW A;  4J1M A;  1XMO Q;  2L55 A;  3FKI H;  3I3C A;  4FYD A;  5JVH 3;  1IBL L;  1YNJ D;  3MC0 B;  2L12 A;  1UUP A;  2B8G A;  3SEB A;  1I4H A;  4AYB E;  3NK9 A;  1WCM H;  3ZYY X;  2EQS A;  4XQN A;  2UUC L;  3I70 A;  5D3I B;  2JYO A;  4NXN Q;  4FXK C;  2EJG C;  3H15 A;  3R8B A;  3HKZ E;  3PIP 3;  3ND9 A;  1IYU A;  5L37 A;  1Q1E A;  3FHW A;  3G6J B;  2WB1 G;  4E6I A;  1OXV A;  4HJ9 A;  3SE0 A;  4JI1 L;  3S2H H;  4EQN A;  2B39 A;  1PTO H;  4RA8 A;  3S24 A;  2A6E C;  5M5X B;  1I6V C;  4LF8 Q;  4A3E G;  4OX9 Q;  3NBH B;  2HCC A;  4IUQ A;  3TDQ A;  3S1Q H;  2N3S A;  4UHV A;  1XNQ L;  3UDF A;  3PF4 A;  1PZK D;  3L7Z C;  3KOJ A;  4LK1 C;  1ET9 A;  4EX5 A;  1JWU D;  1PRT D;  1ILQ A;  4FO2 A;  4YWK A;  3VR2 A;  1HJP A;  1VDZ A;  2F1M A;  4QMG A;  1PH9 A;  3BYY B;  4YY3 L;  2K5N A;  3S1Q B;  1PH8 A;  1G2T A;  4DN4 M;  5GRO A;  1CHQ D;  4RGN A;  4DR7 Q;  2JA8 B;  1XNQ Q;  1HZC A;  4QUF A;  1MJC A;  4LFA Q;  1IW7 C;  2CW0 C;  1Z47 A;  4LF5 L;  1EY8 A;  3NBI A;  4NB3 A;  2FHT A;  3F2C A;  2HUG A;  4LUZ A;  4BY7 H;  2IPK D;  2F0O A;  3W3A A;  2QDB A;  1DON A;  2HDM A;  3GTQ B;  1DOM A;  3CPW A;  4G57 A;  1EY0 A;  2JA7 G;  1ICW A;  2H5X A;  3HFZ B;  1KAB A;  1VQA A;  4EQ5 A;  2BDO A;  2IL8 A;  3M3Y H;  1HTL D;  5IOD A;  3RLN A;  3KFU A;  4KKT A;  5FO7 B;  1D1I A;  1DXM A;  1F2Z A;  1QOH A;  5KYL A;  2GN5 A;  2EDG A;  1MJE A;  2UXB Q;  1QUQ A;  2D5D A;  3CPF A;  3I7F A;  3CCS A;  3GTG B;  2KVM A;  5FLM G;  1B2T A;  1L0X B;  2Z8L A;  3TBI B;  2A69 D;  2NN6 H;  4C1N K;  2JA9 A;  2RHS B;  4LFA L;  1O7L A;  2JE6 I;  1N33 Q;  1NCV A;  4FF2 A;  1JJC B;  2VXW A;  2EE1 A;  2OF1 A;  4EQO A;  3N52 A;  4UP8 A;  2ZJR A;  3IFT A;  2F3V A;  3K7A B;  4JOI A;  1AE2 A;  1UEB A;  2IHE A;  4ZRZ A;  1IL8 A;  2PI2 A;  4TSS A;  1A2T A;  3KF6 A;  1I50 H;  2AQ3 B;  1F2M A;  2ENB A;  2R7Z H;  4IO9 A;  1IL2 A;  1Q82 C;  3G48 A;  4Y7N H;  4DR4 L;  2RSO A;  1OXX K;  2DN8 A;  1F2L A;  4LF9 Q;  1IW7 D;  2CW0 D;  5IGB A;  3I56 A;  3PGZ A;  5IWA Q;  4ZQ3 A;  3HOV B;  3AFQ A;  2RVL A;  1XPO A;  4R1J A;  3HZX A;  4JI1 Q;  5E7N A;  4DV2 Q;  1VQ8 A;  4AYB G;  4K5X A;  4A3E H;  5C0X G;  1DOL A;  1RIP A;  3EFX D;  1LTL A;  1MSH A;  4RH6 A;  2YYZ A;  3RZO B;  1LM0 A;  2K4K A;  3HOV H;  2ZTE A;  2D62 A;  1EEF D;  1Z6H A;  4TRD A;  4BXX H;  2XGT A;  4QY7 A;  1IBM Q;  3P7J A;  4IPD A;  5AFW A;  4OWT B;  1N34 Q;  5T1G A;  2O2L D;  1I6H B;  5JAV A;  3CC4 A;  1STE A;  1WTP A;  1XJV A;  1VQB A;  1LT3 D;  4XQJ A;  2K5V A;  2NVY H;  4YCV A;  2ZJP A;  5EPJ A;  1QCB D;  5CMD A;  2CKZ B;  2H1E A;  2E74 C;  4UPA A;  4IPH A;  1PMR A;  1YHA A;  1A63 A;  4LUV A;  3TP8 A;  3BU2 A;  4KN4 C;  3VA7 A;  4NMZ A;  4JI5 Q;  3NEN A;  3A7A B;  1K3R A;  1ASZ A;  3UI2 A;  2IX0 A;  1KDA A;  3KK7 A;  4DR4 Q;  3OIQ A;  2I5H A;  3PUY A;  3J81 c;  3GTG H;  2F0D A;  2V4D A;  2TMP A;  2IWH A;  2D0O A;  3S1N H;  2QA4 A;  1PYW D;  1HNX Q;  5I2X A;  1SJE D;  3GTO H;  1EU3 A;  2FFK B;  1PFS A;  1Y1W G;  1JOR A;  2Q2U A;  2RCF A;  1HQR D;  2B2V C;  1Q8I A;  2UUB L;  2JA5 G;  2E2H B;  1LT5 D;  5M3F G;  1FNV A;  1UEA B;  3S16 H;  4X65 Q;  2VQE L;  3AQQ A;  4MNO A;  2M2L A;  1YJ9 A;  1HHV A;  2PQE A;  1MGS A;  3UDX A;  3G6E A;  1YJW A;  3OHX C;  5IGG A;  1NR4 A;  1U9R A;  2Z6K A;  1E24 A;  1EYC A;  2L1B A;  4DUZ L;  4DAY A;  3VYU A;  4LAA A;  2FIN B;  1HUN A;  2EY5 A;  4POF A;  3SVM A;  4F87 A;  5IOC A;  1RKN A;  5EBC A;  5EKK A;  3CKI B;  2NVX B;  4GNX B;  1PRT C;  3BDO A;  5HGT A;  2BE5 D;  1H95 A;  3AEV A;  2F0I A;  5JEA J;  2JN4 A;  1TT2 A;  1HUM A;  2HQE A;  2FMM A;  1D5Z C;  1PV4 A;  2B2T A;  1N36 Q;  4GKJ Q;  4A3F G;  1PVO A;  1R4P B;  3BJU A;  1L1O A;  1SRU A;  2N8N A;  3S17 H;  1U4M A;  5ELN A;  4RHR A;  1EWH A;  1XTC D;  2PMZ B;  1SYB A;  4JI8 L;  4BS9 A;  1P16 A;  4CJ0 B;  3JAM E;  4RFB A;  1TII D;  2EXD A;  5GAE C;  1ML0 D;  2IW3 A;  4DR2 Q;  2JA6 B;  1L1O C;  3KBG A;  2MNA A;  4QGU A;  2E2D C;  4K2L A;  1H9S A;  4OHJ A;  2XSC A;  4C1N I;  2L11 A;  4WJW A;  3R2T A;  4R8I A;  2IT1 A;  1QE6 A;  1Q81 C;  4OL7 A;  2QEX A;  3KLW A;  1GO3 E;  5ELE A;  4KHZ A;  1XNR L;  4B3M Q;  2VL6 A;  1CUK A;  1B7Y B;  4PNY A;  2GVB A;  4PQX A;  1YI2 A;  1ILP A;  1EY4 A;  2LXJ A;  2Q2H A;  2NVQ H;  5I9O A;  4L8J A;  1LO5 D;  2EYM A;  2B3G A;  1VS0 A;  4AH6 A;  3NTH A;  3I4N H;  2JA8 G;  1PRT F;  3STB C;  2Z0S A;  4LF4 Q;  5IT9 E;  3PUZ A;  3I4M B;  2OWO A;  4CKE A;  2K52 A;  1EY9 A;  4KMU C;  3QB3 A;  4R9W A;  3R3O A;  3I8Z A;  3BG3 A;  4RMF A;  4DR2 L;  4S3S A;  3J81 i;  1N8R C;  5EQ0 A;  3MEF A;  3BZK A;  1JOQ A;  3UDI A;  2HQL A;  2JA5 H;  3MXN A;  4R4O A;  5IYB G;  5C4H A;  5C44 H;  1S5F D;  5C0X H;  3VYR A;  2UXD Q;  1LAB A;  2PPB C;  4DR5 L;  3CF5 A;  1G2S A;  4C3I H;  1BKB A;  1TWC B;  2F0K A;  2DY7 A;  2OTL A;  2CVR A;  1SNC A;  3JC6 6;  4DV1 L;  2A19 A;  3U9S A;  2QKI C;  3D6W A;  1GHJ A;  1DJR D;  4BWG B;  1QZG A;  4JI4 Q;  2QCP X;  3BDC A;  1LAC A;  3PO2 B;  1ET6 A;  5CYU A;  2DGY A;  2B63 H;  4H7B A;  4EQP A;  1BUV T;  2LKV A;  3RZD B;  1NSN S;  1EU4 A;  4C3H H;  2SNS A;  2I46 A;  1LTG D;  4K5W A;  3TS2 A;  3Q24 A;  3TRZ A;  3A8J E;  1UE1 A;  1D2B A;  2FMC A;  2K1B A;  4H44 C;  2ZM6 Q;  1D5X C;  2NZH A;  4KD4 A;  1CTM A;  4QL5 A;  2F0S A;  4B3R L;  2JSO A;  1HR0 L;  4DNR B;  4OO1 H;  4L5R C;  3S1R H;  2KCN A;  5CV4 A;  4A3K B;  1STA A;  3TS0 A;  3PMF A;  2SDF A;  3I55 A;  1D5M C;  4DV5 Q;  4HJ7 A;  2A5H A;  4YWL A;  3W1G A;  5ELO A;  4BBS H;  4DF7 A;  2PW7 A;  2EYP A;  3C2P A;  2PQA A;  2K6A A;  3Q0A A;  4WJ4 A;  4B3R Q;  3MFG A;  3MXP A;  1TY0 A;  3LGJ A;  5C44 G;  5IYB H;  1JE4 A;  1H9J A;  3KUP A;  2ZXO A;  1NMF A;  2R93 H;  3R2I A;  3A55 A;  3MWY W;  1VQ5 A;  1C48 A;  5EAY A;  4RAU C;  1TS2 A;  2BDN A;  2XRS D;  1GD7 A;  2SEB D;  1TWC H;  1WTH A;  1U0L A;  1X65 A;  3HGB A;  1C8C A;  5GQO A;  3RLF A;  2AHO B;  4JVZ A;  1BCP B;  4IZ8 A;  3VR3 A;  1KL9 A;  2KJX A;  5CGK A;  2F4V Q;  4CDF C;  3K5M A;  5EPK A;  5DNF A;  5GAG C;  1DCZ A;  2JK8 A;  3RN2 A;  2R93 G;  3GO5 A;  1BO0 A;  4DK1 A;  4JW0 A;  3SHL A;  4H0L C;  3F1Z A;  1HNZ Q;  1Y8P B;  4JBW A;  4KY6 A;  5C4X H;  1F2Y A;  2E2I H;  3NE5 B;  5DEH A;  3X3N A;  1FNW A;  1RHP A;  4IFD J;  1YVC A;  3KF8 A;  4CKC A;  1HNW L;  1H9M A;  4ALP A;  2ZTC A;  2PO4 A;  3M4O H;  2N78 A;  4IOC A;  2B2U A;  5K5P A;  1K0S A;  4OO1 G;  2JA5 B;  5E4W C;  5CV7 A;  3T13 A;  4NW2 A;  2EY1 A;  2WKD A;  1WI5 A;  3D4R A;  5CC4 A;  1PTO D;  4GOP A;  2VQF L;  1BCP D;  1BNZ A;  1FR3 A;  3FPP A;  1EFW A;  1VMP A;  3X3M A;  1S4Z A;  2MJ8 A;  5A2Q L;  1EY7 A;  1ZKO A;  4JV5 Q;  1PDQ A;  2I07 B;  4YHH L;  3F2D A;  5E3F A;  4LW1 A;  1BVS A;  1AH9 A;  4A93 H;  1QIL A;  1YIT A;  3K7U C;  3PUV A;  5M3F H;  5LL6 X;  4DAM A;  1MIU A;  4JI8 Q;  4DV6 Q;  2NWG A;  5C44 B;  1A15 A;  1I3Q B;  2CWA A;  3E9H A;  1CKN A;  1LTS D;  3M85 A;  4A3I H;  1VQ6 A;  3S17 B;  4BY7 G;  1ENF A;  2BH2 A;  2RA4 A;  5EJW A;  2VW9 A;  1SYE A;  1VF7 A;  2KOL A;  1E2Z A;  3PO3 B;  3MAQ A;  1WTR A;  5GAD C;  1TWH H;  3HOW B;  2Z6K C;  3HS0 C;  3I4M H;  3CQZ H;  1R9T H;  1HFG A;  1JC7 A;  1UAP A;  1Q8K A;  5C4X B;  2K14 A;  5ISR A;  4I65 A;  4FF1 A;  2ALY B;  2C9O A;  4YY3 Q;  4MHE A;  3OTO L;  4WJ3 M;  5IGC A;  3E0E A;  1HA5 A;  2HCI A;  3TP5 A;  4KHP L;  2K75 A;  2E76 C;  4DAP A;  5M5W B;  2UU9 Q;  1KNE A;  4L63 B;  1TU2 B;  1A3U A;  4ABN A;  4K5V A;  3BZC A;  4HJ5 A;  5C4J B;  1BCP F;  1PRT B;  3TN2 A;  5IP7 H;  1PTO F;  4K14 A;  4HJA A;  3D8G A;  4UAI A;  2LY7 A;  2WII B;  1ASY A;  2B2T C;  5FLX L;  4OEL B;  3KJO A;  1S5B D;  1FJG Q;  3HKZ G;  2UU9 L;  3MTS A;  2A68 D;  4I7Z C;  4G7O C;  3TZU A;  5BN4 A;  4LFB L;  1ONL A;  3I72 A;  1B4O A;  1U4P A;  2HIX A;  1K8G A;  2EJF C;  2Z4I A;  1MBY A;  2KCT A;  5M5X H;  3F8T A;  4GOP C;  2WAQ E;  2K5D A;  1JB7 A;  4R4C A;  3H0G H;  1VQP A;  3TME A;  3A74 A;  5C5M A;  1WTO A;  5G3L F;  1W6J A;  1IZ6 A;  3OWE B;  3GD7 A;  1PFM A;  2G9D A;  1S5C D;  3DM3 A;  4LF4 L;  4A3D B;  1VQI A;  2ID0 A;  5C3E G;  2YU9 B;  1EY5 A;  4FXG C;  1LTA D;  3C1E A;  1A0I A;  3FP9 A;  3EA6 A;  5M5Y B;  2R3Z A;  4Y7N B;  3MZ5 A;  2NVY B;  3HOY G;  5DAU A;  2E2J H;  1G51 A;  3G4S A;  4LUO A;  1VQE A;  3PIO 3;  3S1N B;  1E1T A;  1VQJ A;  4DK0 A;  3T1Y L;  4H02 A;  1V9P A;  1G6Z A;  1SBB B;  5ELC A;  4A3M H;  3K80 C;  2DJG C;  1BDO A;  2OQ0 A;  3H6M A;  4QF4 A;  3S16 B;  1HH2 P;  3RZO H;  4N9P A;  3M4Y A;  4HIM A;  3BDL A;  4DR7 L;  1DD2 A;  2LMC B;  3QIA A;  2F0L A;  5JJI A;  3TEH B;  5I6W A;  4JI2 L;  1YBY A;  1AE3 A;  2RSN A;  3ERQ A;  5K36 G;  4KN7 C;  1X55 A;  1I94 L;  2UXC L;  4MN3 A;  5IGF A;  4DUY L;  4I7A A;  2KED A;  3H3V C;  1V1Q A;  4AYB B;  3W2D A;  1AW7 A;  2K5H A;  5BN5 A;  3PCO B;  5G3L D;  4DXF A;  2HHH Q;  1A3V A;  4IAL A;  2N49 A;  3KF6 B;  4P71 A;  3SK8 A;  4CDD C;  2R7F A;  4P74 A;  1UWV A;  4R4I A;  4OIK A;  4XYO A;  4KD3 A;  3KLR A;  1SN8 A;  3D4W A;  1CI3 M;  2IHF A;  1JOK A;  3IRB A;  2WB1 E;  1K8M A;  3W1B A;  3NQT A;  5KNC A;  3VR4 A;  2VB3 X;  3DWP A;  3TQY A;  3GTP B;  3H91 A;  4PMC A;  2B2Y A;  4BY1 H;  1UE7 A;  1F9P A;  2K50 A;  3ULL A;  3RD4 A;  4DA2 A;  3WOE A;  2L9H A;  1LT6 D;  1AN8 A;  2YTV A;  2F03 A;  4MIU A;  5CV8 A;  5DM7 3;  1STB A;  2EYH A;  1VQO A;  2ICE C;  1CSP A;  3K7A H;  1U5K A; 
#chains in the Genus database with same CATH homology
 1CKN B;  3CCQ A;  3PO2 H;  4JCV E;  1OXU A;  3M9B A;  4GNX B;  4LFB Q;  1X3F A;  3RR5 A;  4Y52 H;  1H95 A;  3AEV A;  3HOX G;  1S72 A;  4JYA Q;  4KI0 A;  5JEA J;  1SMX A;  1WFQ A;  2F52 A;  3ERS X;  4DV0 Q;  1VQ4 A;  1YNX A;  4AQY Q;  4QIW E;  5FJ8 H;  1PV4 A;  2E8G A;  5LMU Q;  1N36 Q;  1Q12 A;  4A3F G;  1WOC A;  1J5E L;  3BJU A;  2IX1 A;  3H3V I;  1L1O A;  1O7I A;  1SRU A;  2N8N A;  4LFC L;  3S14 H;  3S17 H;  4A3G G;  5ELN A;  4A3C G;  3J80 i;  2PQA B;  1WYD A;  4MZ9 A;  1XTD A;  1W2B A;  3I4M G;  3HKS A;  4GKK Q;  5IWA L;  4JI8 L;  2VUM H;  1P16 A;  2UXB L;  3CXC A;  1GVP A;  3RZD H;  2EXD A;  4JBK A;  3GTP H;  5GAE C;  3CCM A;  4KHP Q;  1UE6 A;  3M4P A;  2KCM A;  1S40 A;  2OCE A;  4A3K H;  4LF9 L;  1E7Z A;  2VS1 A;  2V1C C;  4AQY L;  2Q2T A;  4DR2 Q;  2NVX H;  1L1O C;  1SLJ A;  2B63 G;  1WJJ A;  2WFW A;  4QGU A;  2MNA A;  4BY1 G;  4DR3 Q;  1XNR Q;  2YU9 H;  1LYL A;  1QVC A;  4L5Q A;  4DKA C;  2IT1 A;  4DPG A;  1NTG A;  3KDF B;  1FGU A;  2QEX A;  1IYJ B;  3MXN B;  4NPS A;  2OQK A;  3KLW A;  1Q81 C;  1GO3 E;  3I4O A;  3CD6 A;  1LUZ A;  4KHZ A;  3GTM H;  1BBU A;  1Q1B A;  1XNR L;  4B3M Q;  4B3S Q;  1K9M C;  2VL6 A;  1CKO A;  4APV A;  1CUK A;  1B7Y B;  1EIF A;  2GVB A;  3J80 c;  4DV1 Q;  1YI2 A;  4IPG A;  5BR8 L;  4HIO A;  5M5W H;  4LF5 Q;  2KHJ A;  4BBR H;  1J5E Q;  3PO2 G;  4DV4 L;  2I5M X;  2LXJ A;  2KEN A;  2Q2H A;  2NVQ H;  1PH4 A;  1I94 Q;  3W5O A;  3DLL A;  5C4X G;  1EWI A;  2B3G A;  1VS0 A;  4AH6 A;  3I4N H;  1SRO A;  4JI2 Q;  3NEM A;  2ES2 A;  1TWA H;  2JA8 G;  3STB C;  2Z0S A;  4LF4 Q;  3PUZ A;  2OWO A;  1Y1V H;  2R7Z G;  2K52 A;  2B29 A;  1B70 B;  2R6G A;  3K81 C;  3T1Y Q;  1N34 L;  4JC0 A;  1HZB A;  3U4V A;  3HOV G;  3PV0 A;  4A3L G;  1FVI A;  1KRS A;  4RMF A;  1X3E A;  2VQF Q;  4DR2 L;  4P75 A;  1YHQ A;  3J81 i;  4A3B G;  1XMQ Q;  1N8R C;  3E9I A;  1PYB A;  3MEF A;  4YCU A;  2UUA L;  1RL2 A;  3BZK A;  3CP0 A;  2HQL A;  4YWM A;  3UDI A;  2JA5 H;  4DV5 L;  4A3J H;  2HT1 A;  4R4O A;  5IYB G;  2JA6 G;  1KXL A;  2BH8 A;  2NVT H;  5C44 H;  4PZ8 A;  1C7Y A;  2I5L X;  1JT8 A;  3GTK H;  2NN6 I;  3CW2 C;  1QVF A;  4LF7 L;  2ZTD A;  2UXD Q;  2A1A A;  4DR5 L;  3CF5 A;  1W3S A;  4C3I H;  5JJK A;  4PZ7 A;  1BKB A;  2D0P A;  5IYD H;  3U4Z A;  4JI7 L;  4UY8 C;  3CCR A;  1PH1 A;  2OTL A;  3JC6 6;  4TVA B;  4DV1 L;  2A19 A;  3K8A A;  2MO1 A;  2UUC Q;  3RNU A;  4JI4 Q;  4YCW A;  3GDE A;  1QZG A;  4OO1 I;  2VUM G;  4BXX G;  5H1S E;  2AWO A;  2WAQ G;  3EN2 A;  3GTQ H;  3PSI A;  1KRT A;  4A3D H;  4B3T Q;  2XTI A;  4LF6 L;  2YV5 A;  4BA2 I;  1PVO A;  2CQO A;  5AJ3 Q;  4A3B H;  2JQO A;  1HNZ L;  1IBK L;  2DGY A;  4GKJ Q;  3RN5 A;  2B63 H;  1I6H H;  3PF5 A;  4C3H H;  1M90 C;  3PIP A;  1EIY B;  2JEB I;  4P73 A;  1VQH A;  5IY0 A;  1Y1V G;  2Y0S G;  3KDF A;  2JA8 H;  4UP9 A;  1VQN A;  3TS2 A;  3T1H L;  1VQL A;  2MO0 A;  4GLA C;  2CWP A;  1Y1W H;  3TRZ A;  4DUZ Q;  5IP7 G;  1UE1 A;  3FKI G;  1EYG A;  4IPC A;  3VDY A;  4JI0 Q;  3KF8 B;  1C9O A;  4GN4 B;  1OXS C;  2ZM6 Q;  2BA1 A;  4XIG S;  2NZH A;  2KBN A;  1D7Q A;  1SR3 A;  2GVA A;  4QL5 A;  4B3R L;  1HNW Q;  4FDB A;  1HR0 L;  4DUY Q;  5HGQ A;  4L5R C;  2UUB Q;  4X66 L;  1VCI A;  3S1R H;  1D8L A;  2Y0S E;  3NEL A;  3TS0 A;  1E1O A;  2F4V L;  3I55 A;  4DV5 Q;  1QUQ B;  1Y14 B;  4HJ7 A;  1S3O A;  2ATW A;  4X62 Q;  4BA1 I;  4GOP B;  4YWL A;  2QGQ A;  1E22 A;  3W1G A;  5ELO A;  1BBW A;  1Q86 C;  4IFD G;  3CCJ A;  4J15 A;  1L1O B;  5C0X I;  4XTC S;  4NXN L;  1PH3 A;  5J3B A;  2R92 H;  4BBS H;  3HOZ G;  2ASB A;  3CCU A;  2PQA A;  2A8V A;  1IBK Q;  3EBE A;  4WJ4 A;  4B3R Q;  3HOZ H;  1TWG H;  1NJI C;  3LGJ A;  3S15 H;  4RG1 A;  1YIJ A;  2JA7 H;  5C44 G;  4POG A;  5IYB H;  1B8A A;  2HIV A;  2PNH A;  1QZH A;  3J7A 5;  1SFO H;  1KHI A;  1NMF A;  4GKJ L;  2R93 H;  3CCV A;  4KLK A;  5LMN Q;  1V43 A;  1KC8 C;  1JJG A;  2YTX A;  3T1H Q;  1DGS A;  1VQ5 A;  4QQB X;  4HIK A;  4IFD I;  5EAY A;  1HR0 W;  3PO3 H;  2PI2 E;  4ME3 A;  4OXP A;  4A3F H;  2F3I A;  1GD7 A;  1XPR A;  3L0O A;  4P72 A;  1TWC H;  1U0L A;  3PUW A;  5C0X J;  3CCL A;  1X65 A;  1XMO Q;  2VZA A;  5GQO A;  3RLF A;  2AHO B;  4JI3 L;  3FKI H;  3GTL H;  3GTJ H;  4DK6 C;  1IBL L;  4A93 G;  5HY6 A;  1KL9 A;  3ULJ A;  3OTO Q;  2F4V Q;  1WCM G;  4R4T A;  4GS3 A;  4A3K G;  5GAG C;  1EOV A;  4AYB E;  2JK8 A;  1WCM H;  5C3E H;  3RN2 A;  2R93 G;  3GO5 A;  4DV3 Q;  2EQS A;  1EQQ A;  2UUC L;  4NXN Q;  3F1Z A;  1HNZ Q;  4JBW A;  3H15 A;  3HKZ E;  5C4X H;  3HOW H;  2RCN A;  2YTY A;  4C3J H;  3JAM c;  5FLM H;  1EUJ A;  1Q1E A;  4IOA A;  2E2I H;  3FHW A;  3UE1 A;  2WB1 G;  2PMZ E;  4IFD J;  4A3L H;  1OXV A;  1YVC A;  4HJ9 A;  4JI7 Q;  1HNW L;  1IXR A;  3UDG A;  4HID A;  2IY5 B;  4JI1 L;  2ZTC A;  4ALP A;  3S2H H;  1I3Q H;  5IYC H;  3M4O H;  2N78 A;  4IOC A;  1JMC A;  1Q7Y C;  3S24 A;  4OO1 G;  1N33 L;  1IBM L;  4A3M G;  4LF8 Q;  4A3E G;  4OX9 Q;  5IP9 H;  3CC7 A;  3NBH B;  3UE0 A;  3M4Q A;  4GN5 A;  1WI5 A;  3S1Q H;  3CME A;  2N3S A;  4YHH Q;  4HJ8 A;  1XNQ L;  3UDF A;  4GOP A;  3PF4 A;  2VQF L;  3HOU H;  3L7Z C;  3KOJ A;  4LWC A;  1EFW A;  4B3S L;  1VQ9 A;  2R92 G;  2OTJ A;  2NN6 G;  4EX5 A;  4JI5 L;  4JV5 Q;  3ZJY C;  1PHJ A;  4NXM L;  4YHH L;  3F2D A;  2BA0 A;  4YWK A;  4LW1 A;  1BVS A;  2C35 B;  1AH9 A;  1HJP A;  3B6Y A;  1VQG A;  4A93 H;  1YIT A;  1C0A A;  3K7U C;  1PH9 A;  4YY3 L;  2AMC B;  2K5N A;  3PUV A;  4DR1 L;  5M3F H;  1HZ9 A;  1SE8 A;  4DR3 L;  2AKW B;  1PH8 A;  1UE5 A;  4DAM A;  3SGI A;  1MIU A;  5GRO A;  4X62 L;  4DR7 Q;  4JI8 Q;  3F2B A;  4TQU S;  4DV6 Q;  1XNQ Q;  1HZC A;  4DV7 Q;  1J6Q A;  1MJC A;  5IT9 c;  2I0Q A;  1IBL Q;  1G29 1;  4LFA Q;  1NY4 A;  4LFC Q;  1Z47 A;  2ZJQ A;  2CWA A;  3E9H A;  3KJP A;  4LF5 L;  2VQE Q;  1CKN A;  2KHI A;  4NB3 A;  4JG2 A;  3M85 A;  4A3I H;  3OYY A;  1VQ6 A;  3F2C A;  4BY7 G;  1PH2 A;  4LUZ A;  4JYA L;  4DV2 L;  2BH2 A;  4LF7 Q;  4LNQ A;  3A0J A;  4BY7 H;  2VW9 A;  4GN3 B;  1OTC A;  4AIM A;  2MFI A;  3H0G G;  3CPW A;  5GAD C;  1TWH H;  4L5S A;  2JA7 G;  2Z6K C;  2H5X A;  1E3P A;  3I4M H;  1VQD A;  1X54 A;  3HFZ B;  5M5Y H;  3CQZ H;  1R9T H;  4DV7 L;  1HZA A;  5IYC G;  4JV5 L;  1KAW A;  1VQA A;  3STB D;  4EQ5 A;  4A3J G;  1Q8K A;  4UP7 A;  2K14 A;  4OWX B;  3M3Y H;  2ALY B;  3RLN A;  4YY3 Q;  3OTO L;  3KFU A;  4WJ3 M;  4PMW A;  4GLX A;  3E0E A;  5M3M H;  3CMA A;  4KHP L;  1VQM A;  2K75 A;  1T9H A;  4DAY B;  1FL0 A;  2GN5 A;  2UU9 Q;  1MJE A;  2UXB Q;  1QUQ A;  1CSQ A;  3AYH B;  3OW2 A;  3CPF A;  1A62 A;  1NE3 A;  3I7F A;  3BZC A;  5FLM G;  3CCS A;  4HJ5 A;  2UXD L;  1OXT A;  2DUD A;  2Q2I A;  5IP7 H;  1VQ7 A;  4PG3 A;  1FJG L;  4JBM A;  1GM5 A;  4HJA A;  2JA9 A;  1K83 H;  2RHS B;  3AFP A;  4LFA L;  2JE6 I;  1N33 Q;  1ASY A;  4A75 A;  4GNX A;  3KJO A;  4L5T A;  1JJC B;  4DV0 L;  3TRE A;  3S1M H;  4DR6 L;  1FJG Q;  3HKZ G;  1G6P A;  1QVG A;  2UU9 L;  4UP8 A;  3ER0 A;  4C2M H;  2ZJR A;  3WWV A;  4A4I A;  4BBR G;  1KIX A;  4DNI A;  4IJH A;  4JOI A;  3I2Z A;  5AJ3 L;  4LFB L;  1AE2 A;  1UEB A;  2IHE A;  2AWN A;  2PI2 A;  2HIX A;  1K73 C;  1K8G A;  2RHQ B;  3KF6 A;  3PO3 G;  2KCT A;  5M5X H;  1Z9F A;  3ICE A;  1I50 H;  3F8T A;  4GOP C;  3CC2 A;  2WAQ E;  3HOW G;  2WP8 J;  3CAM A;  1JB7 A;  2R7Z H;  1NBW A;  4R4C A;  3H0G H;  4GNX C;  4IO9 A;  3G48 A;  4Y7N H;  1Q82 C;  1PA6 A;  1IL2 A;  4DR4 L;  1OXX K;  5C4J H;  3A74 A;  1VQP A;  3H3V H;  4LF9 Q;  1M1K C;  1JJ2 A;  4DK3 C;  1IZ6 A;  3A5Z B;  4X66 Q;  3L2P A;  4JOI C;  3I56 A;  3GD7 A;  3PGZ A;  3ULP A;  1K8A C;  1PYS B;  5IWA Q;  3AFQ A;  4B3M L;  3DM3 A;  4LF4 L;  4OON A;  1P8L A;  1VQI A;  3Q8D A;  1XPO A;  3D0F A;  2ID0 A;  5C3E G;  2CCZ A;  1VQK A;  4R1J A;  4JI1 Q;  1L0W A;  5E7N A;  4X65 L;  4DV2 Q;  1VQ8 A;  4AYB G;  3M7N A;  1A0I A;  4A3I G;  4A3E H;  4NXM Q;  1A8V A;  4DV6 L;  5C0X G;  3FP9 A;  1VQF A;  1RIP A;  1HR0 Q;  4DV4 Q;  3PIO A;  3U50 C;  1LTL A;  2VNU D;  1KQS A;  2YYZ A;  4DR1 Q;  1LM0 A;  2K4K A;  3HOV H;  3HOY G;  2E2J H;  4A3C H;  1G51 A;  2ZTE A;  3G4S A;  4LUO A;  2D62 A;  4DV3 L;  4BXX H;  1VQE A;  2XGT A;  4X64 Q;  1GKH A;  4QY7 A;  1IBM Q;  1E1T A;  4LF8 L;  4OX9 L;  1VQJ A;  1YEZ A;  3PUX A;  4IPD A;  3EIV A;  3K0X A;  4OWT B;  3T1Y L;  3CCE A;  1N34 Q;  1N32 Q;  3KYH C;  4H02 A;  1HNX L;  2HHH L;  4K0K Q;  1L2F A;  3J7Z C;  3CC4 A;  4GKK L;  1V9P A;  4X6A H;  4IJL A;  1XJV A;  1CKM A;  2E5L L;  4A3M H;  1VQB A;  2L15 A;  1X6O A;  4JI0 L;  5IP9 G;  3K80 C;  2OQ0 A;  2K5V A;  5BR8 Q;  2NVY H;  4JI6 L;  3I4N G;  1YHB A;  4YCV A;  1HH2 P;  5GAH C;  2ZJP A;  4OWW B;  3RZO H;  4JI3 Q;  4MTN A;  4HIM A;  4DR7 L;  3JAM i;  2UXC Q;  4JBJ A;  2CKZ B;  4UPA A;  4B3T L;  4A3G H;  3TEH B;  4IPH A;  5JJI A;  5LMN W;  1YHA A;  4JI2 L;  1YBY A;  1AE3 A;  4DR5 Q;  1A63 A;  1YZ6 A;  1VQC A;  3D31 A;  4LUV A;  4BBS G;  1I5F A;  5FLX c;  5IE8 A;  3RLO A;  1Q46 A;  3BU2 A;  5K36 G;  5LMN L;  3HOY H;  1X55 A;  1I94 L;  2UXC L;  4O0A A;  4DUY L;  4A3D G;  2FXQ A;  1MKH A;  3NEN A;  4JI5 Q;  1K3R A;  3J81 j;  1ASZ A;  5JJL A;  2IX0 A;  1JE5 A;  2LSS A;  1NMG A;  1X9N A;  4DR4 Q;  1V1Q A;  5LMU L;  2I5H A;  2VY3 A;  1PH5 A;  2K5H A;  3PUY A;  3J81 c;  3GTG H;  3PCO B;  2D0O A;  3S1N H;  2QA4 A;  1HNX Q;  2HHH Q;  5IYD G;  4JI4 L;  2N49 A;  3KF6 B;  4P71 A;  4R4Q A;  3GTO H;  4X64 L;  2R7D A;  2R7F A;  4P74 A;  1YJN A;  1PFS A;  1UWV A;  1Y1W G;  4R4I A;  2Q2U A;  3S2D H;  2RF4 A;  1SN8 A;  4DR6 Q;  2CFM A;  2E2H H;  2IHF A;  3IRB A;  2WB1 E;  2UUB L;  5JEA G;  2JA5 G;  2JA6 H;  3W1B A;  2MQH A;  5M3F G;  2JEA I;  2EIF A;  1PH7 A;  4JI6 Q;  3S16 H;  4X65 Q;  2VQE L;  3AQQ A;  4MNO A;  1YJ9 A;  1TXY A;  3G6E A;  3TQY A;  3UDX A;  4GLV B;  3U58 A;  1PH6 A;  1YJW A;  2JJQ A;  4A76 A;  1KD1 C;  3HOX H;  1N36 L;  5DLQ E;  2ZM6 L;  2NZO A;  4BY1 H;  5FJ8 G;  3A5U A;  1UE7 A;  2Z6K A;  1E24 A;  2K50 A;  3HOU G;  1N32 L;  2LXK A;  3G71 A;  5M3M G;  1X3G A;  3ULL A;  4DUZ L;  4O2D A;  1N9W A;  4PZ6 A;  1XPU A;  2E5L Q;  4LF6 Q;  1XMQ L;  2UUA Q;  1EQR A;  2YTV A;  1TWF H;  4QJF A;  1K0R A;  4K0K L;  1VQO A;  4POF A;  1X56 A;  1CSP A;  3K7A H;  1U5K A;  1XMO L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...