4LFBL

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 10
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfbL00
3PO3G 3HOZH 4OWXB 1SE8A 4BY7G 1HH2P 3S24A 4JI7Q 3CMAA 4LF4Q 4KHZA 1I94Q 4DV1L 4QGUA 1QUQA 2NZOA 4IFDI 3E9IA 2KBNA 1A62A 5FLXc 3S2HH 1TWAH 2VZAA 4KI0A 3J81j 1L0WA 4LNQA 3FKIG 4GNXC 1QZHA 4JCVE 4HJ9A 1XJVA 3HOUH 3VDYA 3ULLA 2VW9A 4A3JH 2Z6KA 3I4MG 1K8GA 2ZM6Q 4AQYQ 4A3GG 4X6AH 3M9BA 4JI6L 4JI1L 4QY7A 5DLQE 4X66L 4A3CH 1XPRA 2XGTA 1KAWA 1A0IA 2D62A 3UE0A 4A3FG 5IYBG 1PH6A 5M5WH 1CKNB 2VQEQ 3CCEA 4GS3A 2UXDQ 3TREA 1Y1VG 4C3IH 4WJ3M 1SRUA 2HIXA 3A74A 4PG3A 4DV4Q 3KJOA 1PH8A 3CC4A 4GKJL 3D31A 3RZDH 4LFCL 3CCQA 3I56A 1MJCA 3K7AH 4YCVA 1OXUA 4BBSH 1O7IA 4DR5L 4BA1I 4GKKL 4AYBE 4BBRH 3T1YL 4K0KL 1PVOA 2OQKA 2DUDA 3HKZG 1NY4A 4H02A 4UPAA 5IP9G 4APVA 4YY3Q 2QEXA 5LMUL 4NB3A 4HIMA 1N34Q 3W1BA 3KDFB 4B3SQ 3TS0A 2UU9L 4HIDA 3K8AA 5JEAJ 4L5SA 4QQBX 2MO0A 3CCUA 4YWLA 2VUMH 1VQMA 3L2PA 1N33Q 3CCJA 1T9HA 4OX9L 2IX0A 4DR1Q 1PH9A 2I0QA 1IZ6A 1M1KC 1XPUA 3CAMA 1V9PA 1K8AC 1Q86C 4IO9A 2ZJPA 2K5HA 2F4VL 2N8NA 2D0OA 3CCMA 3KJPA 3RN2A 1VQ6A 3CCRA 5GROA 2B29A 4DK6C 1PA6A 1AH9A 3LGJA 1VQDA 4A3MG 4JBKA 3I4NG 4A3IH 3H15A 4JV5L 4QJFA 2PI2A 4MZ9A 5GADC 1Q46A 4J15A 4LFAL 3UDFA 1VQ4A 4DV1Q 1FGUA 1TWCH 3AQQA 3GO5A 4P74A 1P16A 3DLLA 2NVXH 2R92G 4NXNL 4DV2Q 2GVBA 1FL0A 1VQOA 3I4OA 4IJHA 5ELOA 5C0XJ 1K73C 4O0AA 1X3FA 4B3MQ 4DR4Q 4A93G 1OXSC 2Y0SE 1X3EA 5C3EH 5IYDH 4IOAA 1CSPA 2VY3A 1WJJA 1Y14B 1PFSA 1YJWA 3W5OA 4X65L 2K75A 1IBML 2NVYH 2R92H 1NTGA 1J5EL 1HR0W 2R7ZG 4ME3A 2MNAA 1E22A 4GLVB 4A93H 3M85A 3BZCA 4OXPA 3ULJA 4DR3Q 2LXJA 4RG1A 4YCWA 3J80i 4JI8L 3CC7A 3NEMA 4LF8Q 4GKJQ 2BH8A 4GN3B 5C4JH 2C35B 1P8LA 4B3RL 1VS0A 2H5XA 3AYHB 3GTJH 2E5LL 4GOPC 4YCUA 4LFCQ 1VQAA 1LM0A 3F8TA 3H3VI 2Z0SA 1WOCA 2IX1A 4X64Q 1BBWA 5BR8L 1HNXQ 3JC66 3HKSA 4GKKQ 2MFIA 4AYBG 4K0KQ 3H3VH 2EXDA 2CQOA 5LMUQ 4R4CA 3KF6A 3K81C 4HJ7A 3HOXG 1B70B 3F2BA 3OW2A 1M90C 2AWOA 2RHSB 2UUAL 2UUCL 2UU9Q 3RLOA 1HNZQ 3J81c 1Q12A 3JAMc 1VQLA 3HOZG 4DR6L 3S16H 3GTOH 4R1JA 2CKZB 1YZ6A 5M5XH 2E8GA 2E2JH 4OX9Q 3HOVH 4DAMA 1I3QH 5J3BA 4LFBL 1RL2A 4DUZL 3PGZA 2KCTA 4JYAL 4IPCA 2JA5H 1X3GA 1PHJA 1L1OB 3HOUG 2PNHA 4YWMA 4UP7A 4PZ6A 4DV0Q 4DUYL 4A3JG 1TWFH 3S1NH 1VQJA 2UXBQ 5AJ3L 1VQCA 2OCEA 3RN5A 4A3BH 4JV5Q 4A3CG 1VQ5A 1YJNA 4NXML 1WYDA 3PUVA 1PV4A 4LFAQ 4B3TQ 1JT8A 4BXXH 2HQLA 4NPSA 2ZJQA 4GOPA 1X65A 1IBLL 1KD1C 2I5MX 3RR5A 2VNUD 2MQHA 1EUJA 2PQAB 2BA1A 4DV7Q 4A3DH 1S40A 4DNIA 1Y1WH 4JI5L 5FLMH 2Y0SG 4TQUS 4LF7Q 1OXXK 1PH1A 2AMCB 4YWKA 3TS2A 2NVQH 1FJGL 2R6GA 1N9WA 1V1QA 3OTOL 5C4XH 3D0FA 5LMNL 4DV3Q 4KLKA 4DV6L 4BBSG 1J5EQ 2NVTH 4BBRG 1N32L 3CF5A 1HNWL 2WB1E 1I5FA 4HIOA 1NMGA 2R93G 2JK8A 3KDFA 4HJ5A 3GD7A 4L5TA 1B8AA 2VUMG 1KHIA 2IHFA 1EOVA 4JI8Q 1XMQL 1JB7A 2UXCL 1E1OA 2QA4A 4DR2L 2AHOB 4A3LG 4C2MH 4YHHQ 4B3RQ 1GO3E 2OQ0A 4HJAA 3BZKA 2E5LQ 3PCOB 2JA8G 1FVIA 5IP7H 3UDGA 1G51A 3S14H 1N36L 4IJLA 4A3EH 5BR8Q 1EFWA 4HIKA 4JI3L 1IBKL 4QIWE 2ASBA 1VQEA 3PSIA 2OTLA 4DR7L 1QUQB 2VQFL 1KIXA 2UUAQ 2UUCQ 5GAHC 4A3LH 1HZCA 3CPFA 5JJKA 1B7YB 2JA8H 4LF6L 1CKOA 4GLAC 3PIPA 4A76A 1YJ9A 1YITA 1XNQL 3S1RH 2VS1A 4AIMA 4A3IG 2YYZA 3HOYH 2HHHQ 2IY5B 4KHPL 1U5KA 3UDXA 5LMNW 3AFPA 3FP9A 1WFQA 2R93H 4LFBQ 2VL6A 5HY6A 4JC0A 4LF5Q 2N49A 1UE1A 4XTCS 3CCLA 1XPOA 3Q8DA 3M3YH 1YI2A 2XTIA 5GAEC 5LMNQ 5C3EG 1XMOL 4MNOA 4EX5A 3U4ZA 4DAYB 5IYDG 1MJEA 4JI0L 1TWGH 4JI4L 1BBUA 5C44H 3S2DH 4P73A 1HZAA 3CC2A 1KC8C 3K0XA 3RZOH 3ZJYC 3B6YA 2ZTCA 1WI5A 1YBYA 1PYSB 4IPGA 1X9NA 4IFDJ 4Y7NH 4LW1A 1X56A 1ASZA 2BH2A 1K83H 1PYBA 1VQHA 4OONA 3I2ZA 3KOJA 1QVGA 1S72A 3CQZH 5FJ8G 4JI5Q 1OXVA 4IOCA 4L5RC 3EBEA 2WFWA 3CCSA 4JI6Q 1UE6A 2KHIA 4JI1Q 4P75A 4X66Q 3BJUA 3K80C 1FJGQ 1X6OA 3OTOQ 1N8RC 2JA6H 2WAQE 4PZ8A 4GNXB 4DV5L 4HJ8A 1VQ7A 2JEAI 3ERSX 1YIJA 5IWAL 3G48A 1VQIA 4DKAC 2WB1G 1Z47A 5FJ8H 1LYLA 2BA0A 3ULPA 1XMQQ 2UXCQ 3K7UC 1G291 3HFZB 1VQ9A 3CD6A 4R4QA 2JQOA 2LSSA 2K50A 4JI2L 1WCMH 1SFOH 4LUZA 1NJIC 3TEHB 2ZM6L 4AQYL 1KQSA 3G6EA 3PF4A 4R4TA 5E7NA 1IL2A 4POFA 1A63A 4R4OA 4DR5Q 2ALYB 2R7DA 5HGQA 4OWWB 3GTGH 1HZBA 2A8VA 3T1YQ 3EIVA 3AFQA 1VQPA 4JBJA 4JI3Q 4LUOA 1X54A 2HIVA 2ID0A 2YTYA 1E3PA 2VQEL 1C7YA 3E0EA 1PH7A 2JA5G 1Q7YC 1NMFA 5M5YH 2LXKA 1CSQA 2F3IA 2JA9A 3G4SA 3E9HA 5ELNA 1PH4A 1RIPA 1GVPA 2CCZA 4A3BG 2UUBL 1ASYA 2L15A 3DM3A 2EIFA 1OXTA 5IT9c 2KCMA 4POGA 2N78A 4BXXG 2B63H 1VQGA 3J81i 3JAMi 1VCIA 2PQAA 3M4QA 2F4VQ 4IPDA 4X62L 1Q82C 1YNXA 3SGIA 3U4VA 1VQ8A 3CPWA 1Y1WG 5FLMG 4A3DG 1G6PA 3RLNA 3PUZA 2DGYA 4DPGA 4JI0Q 2AKWB 1XMOQ 4JI4Q 3L0OA 1YVCA 1J6QA 3S1QH 1VQKA 2ES2A 1SN8A 4TVAB 1A8VA 3PUYA 2K5NA 1GM5A 5C4XG 1EWIA 1CKNA 2I5LX 3PV0A 1MKHA 4DR1L 2FXQA 4DK3C 4NXNQ 2ZJRA 3GTPH 1PH5A 4LWCA 2IHEA 1XNRL 3IRBA 3HOWH 3PO2H 4O2DA 4BY1H 5M3MH 4LF9L 3ICEA 5IYCH 4JBMA 3H0GH 5C0XG 2E2HH 3F2CA 2MO1A 4X65Q 3J7A5 4UP9A 1V43A 1IBMQ 4UP8A 2HT1A 1UWVA 2WAQG 3RLFA 4MTNA 5IP7G 4DV5Q 3KF8B 3GTKH 5IWAQ 4EQ5A 1VQBA 4A3EG 3CP0A 4A3KH 1D8LA 2CWPA 1UE7A 3U50C 1TWHH 3CW2C 5C0XI 1QZGA 2NZHA 4DV2L 2ZTDA 2K5VA 1YEZA 4RMFA 4B3ML 4DR4L 2KHJA 2Q2IA 3PUXA 1AE3A 5GAGC 4JI2Q 3PO3H 1U0LA 3AEVA 1K9MC 3PF5A 2CWAA 4R4IA 3KYHC 3TRZA 4BY7H 4WJ4A 3GTLH 3HOYG 4L5QA 4GN5A 4JOIA 1K0RA 1K3RA 2GVAA 2OTJA 2V1CC 1C9OA 1Q1EA 3FKIH 4QL5A 5K36G 5JJLA 4GOPB 1JJCB 3T1HL 4DR3L 4A75A 1HJPA 2AWNA 2NN6G 3I4MH 4LF8L 1Z9FA 2K52A 2JA7G 4DR6Q 4A3GH 1HR0L 4GN4B 1W2BA 5C44G 3PIOA 2UUBQ 1E24A 2YTXA 3U58A 2Q2TA 4DUZQ 2YTVA 1VQFA 1L2FA 4A3FH 5IYBH 1W3SA 2NN6I 3A5ZB 4X64L 1HNXL 1VQNA 4JYAQ 3NELA 1SR3A 1Y1VH 4LUVA 1S3OA 4X62Q 1OTCA 2RCNA 2EQSA 1BVSA 4DUYQ 3UE1A 3F1ZA 1SLJA 3W1GA 1HNZL 5AJ3Q 4BA2I 2I5HA 1IYJB 1MIUA 1KL9A 4NXMQ 3BU2A 4GNXA 1NE3A 1L1OC 2JA6G 1YHQA 2PMZE 2K14A 1IBLQ 2Q2HA 5GQOA 5IP9H 1XNRQ 3GDEA 3KFUA 1DGSA 2RF4A 1R9TH 1JMCA 4LF9Q 1KRTA 4OO1G 4XIGS 3J7ZC 4C3JH 1D7QA 4DV0L 1WCMG 4IPHA 2UXBL 3RNUA 3I55A 4DV6Q 2YV5A 1PH2A 1HZ9A 2E2IH 4JI7L 4LF4L 1I94L 4OO1I 4B3TL 1N32Q 1HNWQ 4PZ7A 1Q1BA 1PH3A 4UY8C 3M4PA 5H1SE 3WWVA 1YHBA 4DV7L 2D0PA 2ZTEA 4DR2Q 5M3FG 1SMXA 1GKHA 3FHWA 4AH6A 1KXLA 4LF7L 4A3MH 3MXNB 3I4NH 1JJ2A 4Y52H 3J80c 1LUZA 2F52A 1N36Q 3L7ZC 2JE6I 4P71A 4PMWA 4DR7Q 1IBKQ 4DV3L 2B63G 3KLWA 5IE8A 3MEFA 3GTQH 1L1OA 4C3HH 2VQFQ 2UXDL 2IT1A 3ER0A 3PUWA 3M4OH 3T1HQ 3F2DA 5M3FH 1EQQA 2WP8J 2B3GA 1KRSA 4DV4L 1EQRA 4LF6Q 1I6HH 1UE5A 3I7FA 1XNQQ 3A0JA 1LTLA 1JE5A 2QGQA 4YHHL 5JEAG 1HR0Q 1QVCA 3NBHB 2YU9H 3CCVA 4KHPQ 2GN5A 5JJIA 3UDIA 1SROA 1CKMA 1Q81C 4FDBA 2R7ZH 3S15H 2A19A 3HOVG 1UEBA 2Z6KC 1QVFA 4A4IA 2R7FA 3HKZE 4YY3L 1IXRA 2N3SA 3EN2A 2K4KA 5IY0A 3CMEA 1N34L 2OWOA 4B3SL 4JBWA 3HOWG 3S1MH 3PO2G 1H95A 2JEBI 4BY1G 5M3MG 4JOIC 1Q8KA 3STBC 3G71A 5IYCG 4OWTB 3CXCA 1CUKA 3H0GG 1EYGA 2PI2E 1N33L 3STBD 1EIYB 1C0AA 2JA7H 4ALPA 1AE2A 3NENA 1BKBA 2A1AA 3OYYA 1TXYA 2ATWA 2CFMA 2HHHL 3TQYA 4P72A 3GTMH 4A3KG 1JJGA 1I50H 1GD7A 1X55A 1XTDA 3HOXH 2Q2UA 1NBWA 4JG2A 4GLXA 3KF6B 4LF5L 3S17H 3A5UA 1E7ZA 2RHQB 1EIFA 3M7NA 2KENA 4IFDG 1YHAA 2JJQA 1E1TA 5EAYA
chains in the Genus database with same CATH superfamily
2EYHA 4OWXB 3KBXA 1QNKA 4M1UB 4BY7G 4JI7Q 1UNSA 1I94Q 4FF4A 5DAUA 2KBNA 3IFTA 4KI0A 4LNQA 3J81j 3WOEA 3V2TA 2L0CA 1I3QB 4HJ9A 3ULLA 3PQIA 4QIWB 4KY7A 1K8GA 1JOKA 1TQOA 4QY7A 2ZT9C 3SK6A 4A3CH 4BS9A 1XPRA 2XGTA 3OSOA 2B2TC 2F0HA 1GUGA 3IFDA 1A0IA 1YNND 1TS3A 4HCSA 5M5WH 1CKNB 2UXDQ 3PMFA 2LY7A 5HGTA 2C9OA 3SR1A 1SRUA 3A74A 1PH8A 2IL8A 1LT5D 1ENAA 3EVQA 3RZDH 4A3DB 1LTBD 3NTHA 4BBSH 4BA1I 4BBRH 5EKIA 3HKZG 5LMUL 4HIMA 4UPAA 1VQ6A 3QB3A 3W1BA 2UU9L 3J80L 1KAAA 4KN7C 4KTAA 3CCJA 3T16A 1DYQA 1U4RA 4DGZA 2IX0A 4KD4A 1G2TA 2BDOA 1M1KC 1V9PA 3FPUB 4MN3A 3NHHA 3S14B 3VR5A 1PTOB 3MXNA 4A3MG 3I4NG 1Z6HA 4A3IH 4JV5L 2JP1A 4MTKA 1VQ4A 4DV1Q 1FGUA 3AQQA 3GO5A 2NVXH 1CK1A 5DNFA 1VQOA 1FL0A 3AMUA 3I4OA 4C1NI 5C0XJ 4O0AA 1STGA 3EROA 4QB4A 1X3EA 3R8BA 1JWMD 1SDFA 5I2XA 1YJWA 4K2LA 2JA7B 1B9MA 1TIID 2N88A 1HR0W 1TWGB 4E6IA 1AN8A 4CGYB 4QUCA 2B2YC 4ABNA 3VYSA 4YCWA 3CC7A 2DY7A 2XIWA 4LF8Q 2RSNA 5C4JH 2WKCA 1VS0A 3MHBA 1I6VC 4GOPC 4YCUA 2IJ0A 1LM0A 3F8TA 1EYCA 3J80E 5BR8L 1MBYA 3IKJA 5IGCA 4AYBG 2RDFA 1B70B 3OW2A 2AWOA 5JOBA 1R4QB 4XQJA 1R4PB 2NUCA 4F7XA 3S16H 1MSGA 2E8GA 4OX9Q 1SFOB 3U9SA 4B9WA 1UUPA 3H91A 1H9JA 4DK0A 1PHJA 3MWYW 4YWMA 4UP7A 4PZ6A 2MP1A 1EL0A 1SMYC 1F2YA 2UXBQ 4A3BH 1QILA 2WV6D 4A3CG 4NXML 2Q8TA 3C1EA 4LFAQ 2K03A 1JT8A 4RKBA 4NPSA 4K8IA 1X65A 4JK1C 1KD1C 1LTSD 2VNUD 4KY5A 1KTKA 2BA1A 4DNIA 1BCPC 1Y1WH 5I9OA 1YNJD 4JI5L 2Y0SG 3GV3A 3MXUA 1BDOA 2A69C 1OXXK 3TS2A 1SMYD 1FJGL 3I8ZA 3OTOL 5C4XH 5D3DA 3D0FA 4DV6L 4BBSG 3LWEA 1J5EQ 1ILPA 4BBRG 1N32L 5K5PA 1PMRA 4HIOA 1I5FA 5CV6A 3KDFA 4HJ5A 1B8AA 4I7ZC 1XMQL 1JB7A 1E1OA 2QA4A 3GTPB 2AHOB 3DXJC 1UEAB 1GO3E 4HJAA 3BZKA 2E5LQ 5M3MB 1FVIA 3Q0AA 3MTSA 3UDGA 1BUVT 3RUZA 1S5FD 1VQEA 2VQFL 5ELFA 1KIXA 2PMZB 2UUCQ 4A3KB 1A3TA 4M8AA 5JJKA 1OO9B 4LF6L 3PIPA 4A3IG 1SYDA 2IY5B 3UDXA 2XN9C 3PO3B 4LFBQ 5DM73 1TY2A 4LF5Q 4S3SA 4XTCS 2KCNA 2NN6H 2XTIA 5LMNQ 4MNOA 5IGFA 1M8AA 5C44H 2FHTA 3RZOH 3ZJYC 4A3GB 1DZ1A 2ZTCA 1WI5A 1X9NA 1ASZA 2BH2A 2F0OA 4A3FB 3CQZH 1OXVA 4L5RC 3EBEA 2WFWA 3LNNA 3NBHA 2KHIA 4P75A 2PCFB 1NSNS 1X6OA 1N8RC 2JA6H 4HJ8A 1S5BD 3G48A 5BN4A 4LMQD 1VQIA 3RMHA 2G9DA 4ZKBB 2UXCQ 1WCMH 3TEHB 2ZM6L 1CZWA 1DXMA 4C3JB 1A63A 2EXZA 1HZBA 2XSCA 2G5DA 3SK8A 3AFQA 1RCVD 4O42A 4XYOA 3W3AA 2F0UA 2VQEL 1EQVA 3CHBD 1C7YA 2F0PA 1Q7YC 5M5YH 4G7ZC 2LXKA 1EU4A 4J1MA 1B50A 1PH4A 2A68D 3QIAA 2UUBL 4A3BG 5IT9c 4POGA 3SHLA 3BDCA 2N78A 2B63H 2O2LD 1I4RA 3MZ5A 2MGSA 1EY7A 1VCIA 3M4QA 4EVOA 1X3QA 1V1PB 4OELB 1VQ8A 1Y1WG 4RGOS 3RLNA 3PUZA 4C3HB 1XMOQ 1C48A 4NW2A 4Z9CB 1YVCA 3QOJA 3S1QH 1B3AA 2ES2A 1SN8A 3JAME 5C4XG 2K5NA 1E0BA 1PRTB 1CKNA 1HPCA 2GA4B 5CBEE 1EY8A 1U4LA 2AQ1B 4OHJA 5C4HA 3C3LA 4JBMA 2E2HH 3F2CA 3J7A5 1NNXA 4FNFA 5ELBA 4CDCC 4UP8A 1UWVA 2WAQG 1J8IA 4MTNA 3GTKH 5IWAQ 1VQBA 1RHPA 1D8LA 1B9NA 3N52A 2CWPA 5EBCA 1TWHH 1JB3A 4DV2L 1YEZA 1B53A 1SE4A 3KBGA 4B3ML 1QJOA 2KHJA 4DR4L 4LAAA 3VR3A 2WINB 5GAGC 1I50B 1F9QA 4JI2Q 3HOXB 3TSSA 5KRUA 3PO2B 1LLRD 3KYHC 4L6TB 3H0GB 4HEDA 3DUZA 1K3RA 3A8IE 2F0MA 1C9OA 2L11A 5FO7B 3T1HL 4Q0FA 4DA2A 2M2LA 2NN6G 1VF5C 4RGTA 1Z9FA 1BBXC 1HR0L 3OOCA 4DFAA 1W2BA 5C44G 1E24A 2E2DC 1G91A 2Z1CA 4X64L 1EY5A 5A35A 3NELA 1SR3A 1Y1VH 4K8JA 1S3OA 1S5CD 4X62Q 1OTCA 1BVSA 2XWJB 1AEXA 3K0YA 1SLJA 4BA2I 2F3VA 1STYA 2I5HA 3I91A 4C3IB 4NXMQ 4GNXA 1PZJD 3KLSA 2QDBA 4HMJA 1Y8NB 2JA6G 3SE0A 1DM0B 2CH4W 2PZUA 1EZ8A 4WORA 1XNRQ 3GDEA 1Q3LA 1A2UA 2RF4A 4DN4M 4DV0L 2VUMB 1WCMG 3I55A 3ND8A 4DV6Q 4FF3A 4CBVA 1PH2A 4JI7L 1EIHA 1I94L 2M00A 4XYQA 2PW7A 2H1EA 1N32Q 4UY8C 5H1SE 4ODGA 3UI2A 2D0PA 2F0KA 5M3FG 1GKHA 2ENBA 2WKDA 4X3SA 3HP3A 3MXNB 2F52A 3CKIB 2B2UC 2JE6I 3K58A 1H9RA 1STBA 2PNRC 2B63G 2VQFQ 2UXDL 3E3XA 4OL7A 1TWCB 2B3GA 1KRSA 4L8JA 4LF6Q 4K6LA 1SSOA 2YU9H 2GN5A 5JJIA 5C3EB 3UDIA 4PMCA 1Q81C 1SBBB 5EKKA 3S15H 1UEBA 1MSHA 1IXRA 3S1MH 2JEBI 5C5LA 4JOIC 1Q8KA 3ND9A 2QW7A 1PXUA 3DHQA 1HRJA 3NENA 2A1AA 2ATWA 3EJIA 3GTJB 4KKUA 4P72A 1TY0A 2EYMA 1GD7A 1XTDA 2K28A 2Q2UA 4JG2A 2PO4A 3K5LA 3S17H 4I7AA 2RHQB 1EIFA 3I3CA 5EAYA 3HOZH 3I73A 3TP8A 1SE8A 1HH2P 2L12A 3S24A 4DV1L 4QGUA 3HZXA 3GTOB 4IFDI 3S2HH 2KHSA 1TWAH 5M5XB 3VR2A 2R3ZA 2BE5C 4A3JH 2Z6KA 4HSVA 2ZM6Q 4X6AH 1KAWA 3UE0A 1PH6A 1JE4A 1HCZA 2VQEQ 4GS3A 2F0LA 3TREA 1Y1VG 1WD1A 4PG3A 3CC4A 1I4QA 2J7ZA 2BE5D 1PTOF 1SYFA 1K8MA 1PYWD 1OXUA 2XWBB 4DR5L 2NVQB 2L5TA 2OQKA 1NY4A 1N34Q 1EY6A 4ZCKA 4NB3A 3KDFB 4FYDA 1E2VA 2V4DA 3K8AA 1CA5A 1D6EC 1ML0D 2XNAC 2MO0A 1EU3A 1N33Q 1T9HA 2LFNA 4EQNA 4OX9L 1B3QA 3DWAA 1XPUA 3K6OA 1FR3A 3CAMA 4FP5D 4EQPA 2Q8RE 2K5HA 1EEID 5BN5A 2F4VL 2D0OA 3O13A 3KJPA 5JPNC 3CCRA 1EY4A 3A7AB 4DK6C 2PQEA 1PA6A 4JBKA 1MD2D 4QJFA 4KHVA 4J15A 2JA8B 4LFAL 3UDFA 1D1IA 1SNPA 3J7AV 1CA6A 1S5DD 1P16A 5KYLA 1AZQA 2R92G 4K14A 3NQIA 4DV2Q 5F2DA 5FKAC 5EPLA 4A93G 1X3FA 4B3MQ 4DR4Q 2EY1A 4DK1A 4DAVA 3NXWA 5IYDH 2QKIC 2VY3A 1Y14B 1E2ZA 1EIGA 1SJED 4X65L 2K75A 1XYIA 3M3YB 4ZUIA 1TKWB 1J5EL 4ME3A 3S2DB 1E22A 1STNA 4LK1C 4OXPA 3ULJA 3M85A 1GXDC 4ME5A 3J80i 1B4OA 2KOLA 4GKJQ 4GN3B 1KNAA 1K83B 1G8ZD 3AYHB 2E5LL 4LFCQ 3TN2A 1RTNA 2Z0SA 5CV8A 1WOCA 2DY8A 3ZYYX 4X64Q 3JC66 3HKSA 2MFIA 2EXDA 4R4CA 5C4ZA 2UUCL 1SNMA 3J81c 3LWUA 1G2SA 3I72A 3HOZG 2RSOA 4DR6L 3KLSX 1DCZA 5J3BA 4LFBL 2KCTA 3NUCA 4KJOA 5ELDA 2JA5H 3M7GA 1JWUD 4DV0Q 4A3JG 1TWFH 2SEBD 4CJ1B 3S1NH 5AJ3L 1TS4A 2OCEA 5KYIA 4N9PA 4XQNA 1PV4A 4BXXH 3QG1A 1NUCA 1IBLL 3HOVB 2E2JB 2I5MX 5G3LD 3RR5A 1U4PA 1BQQT 3FEWX 1Y69U 1O78A 2AQ2B 1PH1A 2QILA 2RVLA 2DNCA 4KLKA 4JPBW 3X3MA 2QCPX 1HFNA 2NVTH 1QOHA 2WB1E 2JK8A 1PFBA 2UXCL 4HAEA 2RCFA 3F2UA 4A3LG 4C2MH 3M4YA 1D5ZC 4BY1B 3D8GA 3P7JA 1NR4A 4A3EH 1EFWA 1V1OA 4QIWE 2ASBA 1NCVA 2RDGA 2HQEA 3CPFA 1CKOA 1JCKB 1XNQL 2K32A 2KCCA 3E0JA 3HOYH 1U5KA 2D5DA 2LKVA 3FP9A 2VL6A 5HY6A 4BY7B 3GTLB 3OWFA 5I9PA 3CCLA 5BN3A 3RD4A 3Q8DA 4NDXA 1XMOL 5IYDG 4EX5A 4DAYB 4XDXA 3R3OA 3CC2A 1STHA 3K0XA 3HS0C 3DEPA 3B6YA 1SNCA 1LT6D 1YBYA 4IFDJ 4CHTB 4Y7NH 1PYBA 2FFKB 1CQFA 1QVGA 3L3OC 4RCNA 1GHJA 3K80C 1FGBD 2NB0A 3KK7A 4GNXB 4PZ8A 1YIJA 3FRPB 3NE5B 4FF1A 5IWAL 1WVLA 5E1FA 4JVZA 2B2VA 2H4OA 1GUSA 1JR0D 5CC4A 3I70A 3ERQA 1G291 3HKZB 4JI2L 2L1BA 4ULLA 1PLFA 1NJIC 3PF4A 2DN8A 1MI2A 1IL2A 4POFA 2NTTA 4DR5Q 5HGQA 4OWWB 3GTGH 3NPPA 1VQPA 5FO9B 1PRTF 2E75C 2ID0A 2J0TD 2JA5G 1ET6A 3NTIA 1F9RA 1NMFA 3G4SA 3E9HA 4V0BA 2K1BA 2VXWA 1EY9A 1GVPA 2F0TA 4A3MB 4BXXG 1VQGA 3JAMi 2PQAA 4B9XA 2F4VQ 4IPDA 4PNYA 4X62L 4FF2A 1G6PA 2EJGC 2DGYA 4JI4Q 2B8FA 3FMCA 2MPMA 5C6AA 1PDQA 4KJNA 3NP8A 1I6HB 4TVAB 1PTOC 3PUYA 2K04A 4DK3C 2QF7A 1GUTA 1BNZA 1PH5A 1XNRL 3HOWH 2B39A 3PO2H 4O2DA 3SVMA 1BO0A 1PFNA 1KABA 3ICEA 5T1IA 3H0GH 2KQ3A 4X65Q 4UP9A 1V43A 3DEOA 1HA5A 4R8NA 4DV5Q 2HDMA 3KF8B 1PTOD 4A3EG 1AP0A 1UE7A 1QZGA 3CW2C 1EZ6A 1H9KA 2NZHA 2ZTDA 2K5VA 3BG3A 3R93A 4RMFA 1ESFA 1BCPD 4AYBB 2WACA 2Q2IA 3PUXA 2A69D 3R2TA 3AEVA 2NWGA 1F9SA 2CW0C 1F77A 3HOYG 4L5QA 1HA6A 1RDPD 2GVAA 3L9AX 5CR3A 1Q1EA 3FKIH 5JJLA 2ZXRA 3AB9A 4A75A 1HJPA 2AWNA 3SK4A 3I4MH 2FMMA 2K52A 4DR6Q 2AQ3B 4GN4B 2YTXA 1B2TA 1AZPA 2C5CA 1L2FA 1W3SA 4U68A 2NN6I 3A5ZB 4LUVA 2EQSA 4UAIA 1WTHA 5M5WB 1HNZL 3QWNA 5AJ3Q 3C1FA 5COYA 3W2DA 1MIUA 1KL9A 3ITPA 3BU2A 3I4LA 3WDNA 1YHQA 1HFGA 4CDDC 1G6ZA 2PMZE 3RZDB 1IBLQ 3CRKC 2MHVA 2BOSA 5KNBA 1DGSA 3BDLA 1R9TH 4LF9Q 4OO1G 4BBRB 2MUYA 1IKLA 1TS2A 4XIGS 3T56B 5IT9L 5KNDA 3J7ZC 1KDAA 2K5QA 1Q8IA 2YV5A 4BWGB 2E2IH 3T53B 1RTOA 3DWQA 1B1ZA 1PH3A 1Q1BA 3IAYA 1AFPA 2VB3X 3HRZC 3VYTA 3WWVA 1ICFB 1YHBA 4DV7L 2E76C 3FHWA 3NWTA 1FNVA 4LF7L 2A74C 3L7ZC 4A3IB 3MEFA 2JXMB 3M4OH 5C3XA 3P75A 5M3FH 2SOBA 2NVXB 3BVMA 1EQRA 3A8KE 1UE5A 1F2MA 4K6DA 4RA8A 2KEEA 1XNQQ 2QGQA 4EGVA 3H6MA 3OIQA 3HG9A 3K57A 5CORA 1SROA 3A54A 2CVRA 2R7ZH 2Z6KC 4A4IA 2N3SA 3EN2A 1N34L 3HOWG 3CMEA 1EYDA 1SYCA 1ZYRC 3PO2G 4DU9A 3GTQB 1CUKA 1SYEA 3H0GG 1EYGA 1N33L 4ALPA 1BKBA 5C4JB 1QCBD 2CFMA 4I65A 4XQQA 3TQYA 3TP6A 2CHBD 3GTMH 1JJGA 2D9UA 1GJXA 1ONLA 2IX3A 1QNUA 2JJQA 1E1TA 2B2YA 4TSSA 4EQOA 2F0EA 2SDFA 4LF4Q 2KJXA 3CMAA 1T5EA 3S16B 2L9HA 4K5XA 5FLXc 2VZAA 4XT3B 1L0WA 3FKIG 1QZHA 4FXGC 1JOQA 4JCVE 3T4AC 1XJVA 3HOUH 2VW9A 5FK9C 3I4MG 4JI6L 5DLQE 4J8QA 4X66L 3TZUA 3J7AF 3D6WA 1ZEQX 2LMCB 4WJ3M 1K3BC 4DAYA 3G7LA 4GKJL 5LHY1 4LFCL 3CCQA 1Y1WB 3I56A 3K7AH 4YCVA 1O7IA 3TP5A 2RDHA 1PVOA 2DUDA 2R93H 5C4XB 1W6KA 1D7QA 3TS0A 2SNSA 4IZ8A 4YWLA 4G4KA 3L2PA 3MAQA 1FYCA 2I0QA 2WAQB 3TZDA 1K8AC 1Q86C 2ZJPA 1LO5D 2N8NA 1PRTC 4CKEA 3CCMA 5GROA 1AH9A 1PZID 1VQDA 3LGJA 3H15A 4MZ9A 4C1NK 5GADC 4P74A 3DLLA 5FO8B 4X3KA 1EYAA 5ELEA 5ELOA 1K73C 1WTWA 3NWSA 1CQVA 2G9HD 2RQXA 2F0NA 1CSPA 1WJJA 2F0QA 2XRSD 4H7BA 3C2PA 2NVYH 2R92H 5D3IB 1A3UA 1NTGA 4KKTA 2KECA 2O5IC 2MNAA 2R7ZG 2K33A 2EVBA 5C44B 4A93H 4DXGA 3CU7A 1C4QA 1GUNA 3RZOB 4RGNA 5KEEA 1K28A 2F3WA 4GZYC 1VQAA 2DJFC 3D6CA 3MFYA 1BBWA 4GKKQ 4K0KQ 2CQOA 2A73B 1M90C 2RHSB 3RLOA 3SK5A 1WD0A 1HNZQ 1E2WA 3KF8A 4QMGA 5D14A 4R1JA 2CKZB 1YZ6A 3HOVH 2E2JH 1WCMB 4DAMA 1I3QH 4WFN3 1RL2A 3HGBA 3OMCA 4NKLA 3PGZA 4JYAL 4HTHA 1L1OB 1RF2D 2Z4HA 3HOUG 4TRDA 4DUYL 5IODA 1VQJA 3C46A 5LL6S 1A15A 1M4VA 4FVMA 1YJNA 5M5YB 2JYOA 2JN4A 2HQLA 2MQHA 4RWSC 2O5JC 3QOLA 2PQAB 4IUTA 4DV7Q 1SNDA 4KV6A 2B63B 4A3DH 5FLMH 4LF7Q 2PZTA 2AMCB 3SDZA 4RHRA 2R6GA 3Q6SA 1DD2A 4K5WA 3VYRA 4IUUA 2Z8LA 2EYOA 1HNWL 2R93G 1NMGA 3GD7A 4L5TA 1XTCD 1EOVA 4JI8Q 4DR2L 3MFGA 5C0XH 5IGBA 4B3RQ 3PCOB 4OIKA 2JA8G 1PZKD 5IP7H 2DJGC 2HCCA 4K5VA 2K5WA 3Q24A 2EZVA 3S14H 2E2HB 1N36L 2IW3A 4IJLA 3OIPA 2K7VA 1IBKL 4DR7L 1PTOH 3PSIA 3K5NA 1QUQB 4PQXA 1HQRD 3MA2B 2UUAQ 1Q90A 4R9WA 5GAHC 4A3LH 1LABA 4F8MA 1TWHB 1B7YB 5JVH3 1SXTA 4GLAC 4A76A 1YJ9A 2CQAA 2VS1A 2B2VC 2YYZA 1HTPA 1WFQA 5KGUA 1WTOA 4JC0A 1GHKA 5K36H 1UE1A 3OMGA 5D65A 5GAEC 1MJEA 1TVXA 4JI4L 2JA7H 1A2TA 1RJTA 1TWGH 1BBUA 2NYZD 1KC8C 4NMZA 1KDBA 1O80A 3H3VC 3S1RB 2KA7A 1PYSB 1I4PA 4IPGA 3J81L 1X56A 1C8CA 1ICWA 4OONA 3I2ZA 3KOJA 1S72A 3MXPA 5FJ8G 3CRLC 4DF7A 4KKSA 1Y1VB 3CCSA 4JI6Q 5JAVA 4X66Q 3BJUA 1VF7A 2E74C 2PZWA 2JEAI 2QDLA 4X3UA 4DV5L 2F0WA 1Y8PB 4QCLA 1IW7C 5IGEA 1EEFD 2WB1G 1Z47A 4QF4A 1LYLA 2BA0A 3ULPA 3OHXC 3K7UC 2A6EC 3HFZB 3CD6A 4CDFC 3PIO3 1SFOH 4AQYL 3T51B 1I4XA 4R4OA 3HOVG 2R7DA 5TSSA 2A8VA 3EIVA 4JBJA 4JI3Q 4LUOA 1S5ED 2HIVA 2YTYA 4Q5VA 1E3PA 1D2BA 5IOCA 4DNRB 3E0EA 5J22A 1PH7A 3K59A 1CHQD 4N8X1 2AUJD 1CSQA 2F3IA 1RIPA 2CCZA 5EJWA 1ASYA 2L15A 3DM3A 2EIFA 1OXTA 3GV6A 2EYPA 2KCMA 2KEDA 4KK7A 1YNXA 3SGIA 4A3DG 3CPWA 5FLMG 2EDGA 4JI0Q 1W6JA 4J6HA 3L0OA 5JEAH 2OT2A 3J81E 4DAPA 1VQKA 3R2IA 1IKMA 2I5LX 3PV0A 4DR1L 4CKCA 2YU9B 3GTPH 4LWCA 2IHEA 4HSPA 2FINB 3IRBA 3N6RA 4WRDA 5CV5A 3S15B 5M3MH 4LF9L 5IYCH 3S1MB 5J39A 5C0XG 2MO1A 2OXPA 3IL8A 3BZDB 4ZK9B 1KNEA 1D5XC 3RLFA 5IP7G 1SJHD 3FDTA 2WIIB 3WOFA 4EQ5A 1YNNC 3CP0A 4A3KH 3GP7A 1FD7D 1ZXTA 2F0FA 5CBAE 3TP7A 3FVQA 1AE3A 3PO3H 1U0LA 2VB2X 3S17B 1K9MC 4B08A 4IUNA 3TRZA 1EWCA 4HN7A 4GN5A 4JOIA 1STEA 3HOZB 1K0RA 2V1CC 2EJFC 3MEHA 4QL5A 5EBDA 5K36G 4GOPB 1JJCB 2NBFA 4DR3L 3S2HB 1KLUD 1TWAB 1TU2B 1U4MA 2JA7G 4A3GH 4A3JB 4CKBA 3NK9A 1VQFA 4A3FH 5IYBH 1CZGA 2JSOA 1HNXL 4JYAQ 3GQBA 4KN4C 4DUYQ 1DOMA 3TMEA 1CM9A 1IYJB 4ZRZA 2BDNA 4X3TA 1NE3A 1JOOA 4IUPA 3Q23A 1ENFA 1EWHA 1EOTA 1JWSD 2Q2HA 4H44C 5GQOA 5IP9H 5E4WC 1KRTA 1LTAD 4C3JH 4C56C 2HCIA 1JICA 1RD9D 4IPHA 3RNUA 1TT2A 2B2WA 2EPBA 4LF4L 1BCPB 1AW7A 1XWEA 3NQTA 4OO1I 4B3TL 3BVZA 1HNWQ 4PZ7A 3M4PA 4OO1H 4DR2Q 3DM1A 1SMXA 2EY2A 1JJ2A 3J80c 1LUZA 1N36Q 4P71A 4PMWA 4DR7Q 1IBKQ 4DV3L 1IL8A 1ET9A 1SE3A 1A3VA 1VMPA 3GTQH 1L1OA 1EFID 4C3HH 1I4GA 2IT1A 3ER0A 3PUWA 1EQQA 2WP8J 3NSWA 1CT1D 1FNUA 1WTQA 1JE5A 4YHHL 5JEAG 1MHWC 1PFMA 3CCVA 3VA7A 1WTPA 3I4NB 1CKMA 4RGMA 4FDBA 2RA4A 1NAPA 3HKZE 2OWOA 1ESRA 2K4KA 4JBWA 2EE1A 5CMDA 5M3MG 1H9SB 3STBC 3G71A 5IYCG 4OWTB 1HHVA 3EA6A 1EIYB 3BYYB 3P1HA 1AE2A 2X6LA 3OYYA 1TXYA 2HHHL 5EKLA 5LL6X 1V8QA 4A3KG 2Q8IB 1I50H 1X55A 3HOXH 1NBWA 4GLXA 3OWEB 1X32A 1YNJC 2EYFA 3A5UA 2KENA 2RBMA 1YHAA 3STBD 3PO3G 3K5MA 1VDZA 3P20A 1IYVA 4KHZA 1QUQA 2NZOA 3E9IA 4RKLA 1A62A 4GNXC 5EPKA 3OPOA 3VDYA 2FJ2A 2TMPA 5E3FA 2HD3A 4AQYQ 4A3GG 2JA5B 3M9BA 1KLGD 4JI1L 3QJYA 4P2CB 1TWFB 3S1NB 2D62A 4ZUJA 4A3FG 5IYBG 3CCEA 4TKOB 1GOZA 2IWHA 4C3IH 5FOBB 2HIXA 4DV4Q 1O7ZA 3KJOA 3V96A 2L55A 3D31A 3MXGA 5ELCA 2A6HC 1MJCA 2CW0D 1GUOA 5KIXA 5ISRA 4GKKL 4AYBE 3T1YL 4K0KL 4H02A 5IP9G 4YY3Q 4HIDA 2QEXA 4APVA 4B3SQ 2VUMH 1T5XD 3NBIA 2NVTB 5JEAJ 4L5SA 1JC7A 1J9OA 2M9VA 4C3JG 1BF4A 4QQBX 3CCUA 1U9RA 2Y0SB 1JORA 1VQMA 2EJMA 2A6HD 4C2MB 4DR1Q 1PH9A 1VMCA 1IZ6A 2AUKA 1QWYA 5C5MA 4BBSB 1Y8OB 2A5HA 4IO9A 2B2TA 4A3EB 1BOSA 3DWPA 5EQ0A 3RN2A 4IUVA 5NUCA 2RKSA 3I90A 2B29A 1QG7A 4KD3A 1LV9A 2PI2A 1Q46A 2ZXPA 1TWCH 1HTLD 1I4HA 4NXNL 1TR5A 3VYUA 2GVBA 3HOYB 2ZXOA 4C3HG 4IJHA 4F88A 1H9MA 3JAML 5DM63 1L0XB 1OXSC 2Y0SE 4N9TA 5C3EH 4IOAA 4RFBA 1PFSA 1D1KA 4CJ2C 3W5OA 5EPJA 1IBML 1B44D 4MHEA 4NP5A 4FXDA 2K5DA 2P5ZX 4GLVB 3AU7A 1O7LA 4DR3Q 3BZCA 2IPKD 5L37A 2LXJA 4JI8L 1IYUA 3NEMA 3PIP3 1LTGD 4UDUC 2BH8A 4Y7NB 2C35B 1P8LA 3EQLC 4B3RL 4U673 2H5XA 1F9PA 3GTJH 2A68C 5FLXL 4WJWA 3H3VI 3VR6A 1Z7TA 2IX1A 1HNXQ 1RODA 4IN3A 3H3VH 5LMUQ 1CHPD 3KF6A 3K81C 4HJ7A 3HOXG 4ZYSA 3F2BA 1IHZA 2UUAL 2UU9Q 2LS01 1Q12A 3TDQA 3JAMc 2Z4IA 1VQLA 3GTOH 4DNTB 1MGSA 1GUWA 5M5XH 1LACA 2MJ8A 4DUZL 5IT9E 2F0SA 2X69A 3TBIB 4IPCA 1DOKA 1X3GA 3GTGB 4HMIA 2PNHA 1ZYRD 3D3RA 5A2QL 3G6JB 2D2CC 1VQCA 4JW0A 3RN5A 4JV5Q 1VQ5A 1WYDA 3PUVA 1NR2A 4B3TQ 2ZJQA 2HUGA 4GOPA 1K8OA 2SNMA 1EUJA 1WTXA 5J1ZA 4C3IG 1CI3M 1S40A 5JVG3 4TQUS 4YWKA 1ILQA 2NVQH 1N9WA 3E6ZX 3A55A 1KDCA 4DV3Q 4A3BB 3MVVA 1DOLA 5JJZA 4IURA 2B8GA 4N8FA 5JPMC 3CF5A 5IGDA 2VUMG 5FLXE 1KHIA 2IHFA 2Z6BA 2FMCA 2CH4A 4DXFA 1LTTD 3HOWB 4YHHQ 2OQ0A 3J7YW 5IGGA 1G51A 5G3LF 4HCEA 5BR8Q 3HEJA 4JI3L 3V05A 4HIKA 2OTLA 1EY0A 5I6YA 5DEHA 1SYBA 1SEBD 2OF1A 3T13A 1HZCA 5I2YA 2JA8H 4G7OC 1YITA 3S1RH 4IUQA 4AIMA 2HHHQ 3QR8A 4KHPL 5LMNW 3AFPA 1O7YA 3LX0A 1HUMA 2EYLA 2N49A 5A2QE 1XPOA 4K2KA 3M3YH 1YI2A 1EQTA 4ZAIA 3FKIB 5C3EG 4JI0L 3U4ZA 3H09A 4OIJA 3S2DH 4P73A 1HZAA 4RHSA 3I4MB 1ENCA 2QEJC 4FO2A 3ONAB 4CJ0B 4LW1A 5I4DA 1K83H 1VQHA 1LT3D 2PYKA 2XRQD 4HR7B 1PRTD 4JI5Q 4IOCA 2EOTA 1UE6A 4JI1Q 3NTKA 1FJGQ 3OTOQ 2WAQE 4PMBA 1VQ7A 3ERSX 4DKAC 4XT1B 4OGQC 1H9SA 5FJ8H 1XMQQ 2OEOA 1VQ9A 4R4QA 1LTRD 2JQOA 2K50A 2LSSA 4ZLTF 3CQZB 3QO2A 4LUZA 4PV1C 1KQSA 1R9TB 4UHVA 4F87A 3G6EA 4R4TA 5E7NA 5CGKA 4ZQ3A 2ALYB 1II3A 3T1YQ 2JA6B 3A7LA 5IIFA 1X54A 4XXEA 1HXYD 1FNWA 2F0GA 3BYTB 2E2IB 3U9OA 3VA5A 4G57A 2JA9A 3D4RA 3BS1A 2NTSA 5ELNA 4RCOA 1CFMA 1HQMC 1TS5A 4IALA 3URYA 4RAUC 2BCOA 3J81i 3X3NA 1ZKOA 1Q82C 3Q22A 3U4VA 5M9OA 1CTMA 2F0JA 4L63B 4H0LC 2J4XA 4DPGA 2AKWB 5C3WA 3M4OB 5M3FB 1J6QA 1SNOA 1A8VA 1A6XA 1GM5A 1L0YB 1EWIA 4NXNQ 1MKHA 2FXQA 2ZJRA 4R8IA 3D4DA 2ICIA 2R7ZB 1F2LA 4O1NA 4BY1H 4ILWA 3SEBA 2NZ1D 1DONA 4OEMB 1IBMQ 4V190 2HT1A 2N55A 3S1QB 1D5MC 3BDOA 4LJZC 3SXHA 4YIJA 3S9WA 1SNQA 3U50C 5C0XI 2X6GA 5AFWA 1WTVA 1JQYD 3GTMB 4IFDH 2I07B 1LT4D 2Z9HA 1S4ZA 3PF5A 1K0SA 3A56A 2CWAA 4R4IA 5HURA 2TSSA 4BY7H 4WJ4A 3GTLH 5E4XA 2HDLA 3FPPA 4RH6A 1XX8A 4H13C 4ID6A 2OTJA 3GTKB 4FXKC 3E5SA 3VR4A 2KUMA 2B2WC 4LF8L 3HOUB 3MC0B 2UUBQ 3PIOA 2F1MA 5CV7A 2Q2TA 3U58A 4DUZQ 2YTVA 3K5OA 1VQNA 1BCPF 1SE2A 2K6AA 2RCNA 1HUNA 3UE1A 3F1ZA 3W1GA 4QUFA 1DJRD 1L1OC 2K14A 1LTID 3K7AB 5I6WA 5CYUA 3KFUA 1BXTA 1JMCA 5EGTA 2DNEA 3EFXD 2R93B 3KLRA 3DMUA 2I46A 2F0VA 2UXBL 3H94A 1F2ZA 1X3PA 1HZ9A 2K05A 3D4WA 2F0DA 4CDEC 1UAPA 2XVSA 2ZTEA 5T1GA 2KVMA 4AH6A 1KXLA 4A3MH 3I4NH 4Y52H 1BR9A 1SYGA 1WTRA 3BVGA 3KUPA 1SAPA 1RKNA 4KY6A 3KLWA 5IE8A 1IW7D 2R61A 1V1PA 2F4IA 1XXGA 3F2DA 3T1HQ 4G7HC 4DV4L 2A6ED 1I6HH 3A8JE 3I7FA 3A0JA 1LTLA 2EY5A 1HR0Q 1QVCA 3NBHB 2PPBC 4KHPQ 2L4NA 2F0IA 4MIUA 2A19A 1QVFA 2EY6A 2R7FA 4KMUC 4YY3L 5IY0A 2NVYB 2R92B 4B3SL 1H95A 4BY1G 2F03A 2PW5A 4A93B 3CXCA 2ICEC 2K01A 2PI2E 1C0AA 1QE6A 5CV4A 3OW7A 1QB5D 4IQZA 5KNCA 4ZKCB 4LF5L 2B2UA 3KF6B 1E7ZA 2O4XA 1STAA 3M7NA 4IFDG 2EYJA 4RG1A 2WB1B 1V1QA 5CV9A 5LMNL
chains in the Genus database with same CATH topology
3PO3G 3HOZH 4OWXB 1SE8A 4BY7G 1HH2P 3S24A 4JI7Q 3CMAA 4LF4Q 4KHZA 1I94Q 4DV1L 4QGUA 1QUQA 2NZOA 4IFDI 3E9IA 2KBNA 1A62A 5FLXc 3S2HH 1TWAH 2VZAA 4KI0A 3J81j 1L0WA 4LNQA 3FKIG 4GNXC 1QZHA 4JCVE 4HJ9A 1XJVA 3HOUH 3VDYA 3ULLA 2VW9A 4A3JH 2Z6KA 3I4MG 1K8GA 2ZM6Q 4AQYQ 4A3GG 4X6AH 3M9BA 4JI6L 4JI1L 4QY7A 5DLQE 4X66L 4A3CH 1XPRA 2XGTA 1KAWA 1A0IA 2D62A 3UE0A 4A3FG 5IYBG 1PH6A 5M5WH 1CKNB 2VQEQ 3CCEA 4GS3A 2UXDQ 3TREA 1Y1VG 4C3IH 4WJ3M 1SRUA 2HIXA 3A74A 4PG3A 4DV4Q 3KJOA 1PH8A 3CC4A 4GKJL 3D31A 3RZDH 4LFCL 3CCQA 3I56A 1MJCA 3K7AH 4YCVA 1OXUA 4BBSH 1O7IA 4DR5L 4BA1I 4GKKL 4AYBE 4BBRH 3T1YL 4K0KL 1PVOA 2OQKA 2DUDA 3HKZG 1NY4A 4H02A 4UPAA 5IP9G 4APVA 4YY3Q 2QEXA 5LMUL 4NB3A 4HIMA 1N34Q 3W1BA 3KDFB 4B3SQ 3TS0A 2UU9L 4HIDA 3K8AA 5JEAJ 4L5SA 4QQBX 2MO0A 3CCUA 4YWLA 2VUMH 1VQMA 3L2PA 1N33Q 3CCJA 1T9HA 4OX9L 2IX0A 4DR1Q 1PH9A 2I0QA 1IZ6A 1M1KC 1XPUA 3CAMA 1V9PA 1K8AC 1Q86C 4IO9A 2ZJPA 2K5HA 2F4VL 2N8NA 2D0OA 3CCMA 3KJPA 3RN2A 1VQ6A 3CCRA 5GROA 2B29A 4DK6C 1PA6A 1AH9A 3LGJA 1VQDA 4A3MG 4JBKA 3I4NG 4A3IH 3H15A 4JV5L 4QJFA 2PI2A 4MZ9A 5GADC 1Q46A 4J15A 4LFAL 3UDFA 1VQ4A 4DV1Q 1FGUA 1TWCH 3AQQA 3GO5A 4P74A 1P16A 3DLLA 2NVXH 2R92G 4NXNL 4DV2Q 2GVBA 1FL0A 1VQOA 3I4OA 4IJHA 5ELOA 5C0XJ 1K73C 4O0AA 1X3FA 4B3MQ 4DR4Q 4A93G 1OXSC 2Y0SE 1X3EA 5C3EH 5IYDH 4IOAA 1CSPA 2VY3A 1WJJA 1Y14B 1PFSA 1YJWA 3W5OA 4X65L 2K75A 1IBML 2NVYH 2R92H 1NTGA 1J5EL 1HR0W 2R7ZG 4ME3A 2MNAA 1E22A 4GLVB 4A93H 3M85A 3BZCA 4OXPA 3ULJA 4DR3Q 2LXJA 4RG1A 4YCWA 3J80i 4JI8L 3CC7A 3NEMA 4LF8Q 4GKJQ 2BH8A 4GN3B 5C4JH 2C35B 1P8LA 4B3RL 1VS0A 2H5XA 3AYHB 3GTJH 2E5LL 4GOPC 4YCUA 4LFCQ 1VQAA 1LM0A 3F8TA 3H3VI 2Z0SA 1WOCA 2IX1A 4X64Q 1BBWA 5BR8L 1HNXQ 3JC66 3HKSA 4GKKQ 2MFIA 4AYBG 4K0KQ 3H3VH 2EXDA 2CQOA 5LMUQ 4R4CA 3KF6A 3K81C 4HJ7A 3HOXG 1B70B 3F2BA 3OW2A 1M90C 2AWOA 2RHSB 2UUAL 2UUCL 2UU9Q 3RLOA 1HNZQ 3J81c 1Q12A 3JAMc 1VQLA 3HOZG 4DR6L 3S16H 3GTOH 4R1JA 2CKZB 1YZ6A 5M5XH 2E8GA 2E2JH 4OX9Q 3HOVH 4DAMA 1I3QH 5J3BA 4LFBL 1RL2A 4DUZL 3PGZA 2KCTA 4JYAL 4IPCA 2JA5H 1X3GA 1PHJA 1L1OB 3HOUG 2PNHA 4YWMA 4UP7A 4PZ6A 4DV0Q 4DUYL 4A3JG 1TWFH 3S1NH 1VQJA 2UXBQ 5AJ3L 1VQCA 2OCEA 3RN5A 4A3BH 4JV5Q 4A3CG 1VQ5A 1YJNA 4NXML 1WYDA 3PUVA 1PV4A 4LFAQ 4B3TQ 1JT8A 4BXXH 2HQLA 4NPSA 2ZJQA 4GOPA 1X65A 1IBLL 1KD1C 2I5MX 3RR5A 2VNUD 2MQHA 1EUJA 2PQAB 2BA1A 4DV7Q 4A3DH 1S40A 4DNIA 1Y1WH 4JI5L 5FLMH 2Y0SG 4TQUS 4LF7Q 1OXXK 1PH1A 2AMCB 4YWKA 3TS2A 2NVQH 1FJGL 2R6GA 1N9WA 1V1QA 3OTOL 5C4XH 3D0FA 5LMNL 4DV3Q 4KLKA 4DV6L 4BBSG 1J5EQ 2NVTH 4BBRG 1N32L 3CF5A 1HNWL 2WB1E 1I5FA 4HIOA 1NMGA 2R93G 2JK8A 3KDFA 4HJ5A 3GD7A 4L5TA 1B8AA 2VUMG 1KHIA 2IHFA 1EOVA 4JI8Q 1XMQL 1JB7A 2UXCL 1E1OA 2QA4A 4DR2L 2AHOB 4A3LG 4C2MH 4YHHQ 4B3RQ 1GO3E 2OQ0A 4HJAA 3BZKA 2E5LQ 3PCOB 2JA8G 1FVIA 5IP7H 3UDGA 1G51A 3S14H 1N36L 4IJLA 4A3EH 5BR8Q 1EFWA 4HIKA 4JI3L 1IBKL 4QIWE 2ASBA 1VQEA 3PSIA 2OTLA 4DR7L 1QUQB 2VQFL 1KIXA 2UUAQ 2UUCQ 5GAHC 4A3LH 1HZCA 3CPFA 5JJKA 1B7YB 2JA8H 4LF6L 1CKOA 4GLAC 3PIPA 4A76A 1YJ9A 1YITA 1XNQL 3S1RH 2VS1A 4AIMA 4A3IG 2YYZA 3HOYH 2HHHQ 2IY5B 4KHPL 1U5KA 3UDXA 5LMNW 3AFPA 3FP9A 1WFQA 2R93H 4LFBQ 2VL6A 5HY6A 4JC0A 4LF5Q 2N49A 1UE1A 4XTCS 3CCLA 1XPOA 3Q8DA 3M3YH 1YI2A 2XTIA 5GAEC 5LMNQ 5C3EG 1XMOL 4MNOA 4EX5A 3U4ZA 4DAYB 5IYDG 1MJEA 4JI0L 1TWGH 4JI4L 1BBUA 5C44H 3S2DH 4P73A 1HZAA 3CC2A 1KC8C 3K0XA 3RZOH 3ZJYC 3B6YA 2ZTCA 1WI5A 1YBYA 1PYSB 4IPGA 1X9NA 4IFDJ 4Y7NH 4LW1A 1X56A 1ASZA 2BH2A 1K83H 1PYBA 1VQHA 4OONA 3I2ZA 3KOJA 1QVGA 1S72A 3CQZH 5FJ8G 4JI5Q 1OXVA 4IOCA 4L5RC 3EBEA 2WFWA 3CCSA 4JI6Q 1UE6A 2KHIA 4JI1Q 4P75A 4X66Q 3BJUA 3K80C 1FJGQ 1X6OA 3OTOQ 1N8RC 2JA6H 2WAQE 4PZ8A 4GNXB 4DV5L 4HJ8A 1VQ7A 2JEAI 3ERSX 1YIJA 5IWAL 3G48A 1VQIA 4DKAC 2WB1G 1Z47A 5FJ8H 1LYLA 2BA0A 3ULPA 1XMQQ 2UXCQ 3K7UC 1G291 3HFZB 1VQ9A 3CD6A 4R4QA 2JQOA 2LSSA 2K50A 4JI2L 1WCMH 1SFOH 4LUZA 1NJIC 3TEHB 2ZM6L 4AQYL 1KQSA 3G6EA 3PF4A 4R4TA 5E7NA 1IL2A 4POFA 1A63A 4R4OA 4DR5Q 2ALYB 2R7DA 5HGQA 4OWWB 3GTGH 1HZBA 2A8VA 3T1YQ 3EIVA 3AFQA 1VQPA 4JBJA 4JI3Q 4LUOA 1X54A 2HIVA 2ID0A 2YTYA 1E3PA 2VQEL 1C7YA 3E0EA 1PH7A 2JA5G 1Q7YC 1NMFA 5M5YH 2LXKA 1CSQA 2F3IA 2JA9A 3G4SA 3E9HA 5ELNA 1PH4A 1RIPA 1GVPA 2CCZA 4A3BG 2UUBL 1ASYA 2L15A 3DM3A 2EIFA 1OXTA 5IT9c 2KCMA 4POGA 2N78A 4BXXG 2B63H 1VQGA 3J81i 3JAMi 1VCIA 2PQAA 3M4QA 2F4VQ 4IPDA 4X62L 1Q82C 1YNXA 3SGIA 3U4VA 1VQ8A 3CPWA 1Y1WG 5FLMG 4A3DG 1G6PA 3RLNA 3PUZA 2DGYA 4DPGA 4JI0Q 2AKWB 1XMOQ 4JI4Q 3L0OA 1YVCA 1J6QA 3S1QH 1VQKA 2ES2A 1SN8A 4TVAB 1A8VA 3PUYA 2K5NA 1GM5A 5C4XG 1EWIA 1CKNA 2I5LX 3PV0A 1MKHA 4DR1L 2FXQA 4DK3C 4NXNQ 2ZJRA 3GTPH 1PH5A 4LWCA 2IHEA 1XNRL 3IRBA 3HOWH 3PO2H 4O2DA 4BY1H 5M3MH 4LF9L 3ICEA 5IYCH 4JBMA 3H0GH 5C0XG 2E2HH 3F2CA 2MO1A 4X65Q 3J7A5 4UP9A 1V43A 1IBMQ 4UP8A 2HT1A 1UWVA 2WAQG 3RLFA 4MTNA 5IP7G 4DV5Q 3KF8B 3GTKH 5IWAQ 4EQ5A 1VQBA 4A3EG 3CP0A 4A3KH 1D8LA 2CWPA 1UE7A 3U50C 1TWHH 3CW2C 5C0XI 1QZGA 2NZHA 4DV2L 2ZTDA 2K5VA 1YEZA 4RMFA 4B3ML 4DR4L 2KHJA 2Q2IA 3PUXA 1AE3A 5GAGC 4JI2Q 3PO3H 1U0LA 3AEVA 1K9MC 3PF5A 2CWAA 4R4IA 3KYHC 3TRZA 4BY7H 4WJ4A 3GTLH 3HOYG 4L5QA 4GN5A 4JOIA 1K0RA 1K3RA 2GVAA 2OTJA 2V1CC 1C9OA 1Q1EA 3FKIH 4QL5A 5K36G 5JJLA 4GOPB 1JJCB 3T1HL 4DR3L 4A75A 1HJPA 2AWNA 2NN6G 3I4MH 4LF8L 1Z9FA 2K52A 2JA7G 4DR6Q 4A3GH 1HR0L 4GN4B 1W2BA 5C44G 3PIOA 2UUBQ 1E24A 2YTXA 3U58A 2Q2TA 4DUZQ 2YTVA 1VQFA 1L2FA 4A3FH 5IYBH 1W3SA 2NN6I 3A5ZB 4X64L 1HNXL 1VQNA 4JYAQ 3NELA 1SR3A 1Y1VH 4LUVA 1S3OA 4X62Q 1OTCA 2RCNA 2EQSA 1BVSA 4DUYQ 3UE1A 3F1ZA 1SLJA 3W1GA 1HNZL 5AJ3Q 4BA2I 2I5HA 1IYJB 1MIUA 1KL9A 4NXMQ 3BU2A 4GNXA 1NE3A 1L1OC 2JA6G 1YHQA 2PMZE 2K14A 1IBLQ 2Q2HA 5GQOA 5IP9H 1XNRQ 3GDEA 3KFUA 1DGSA 2RF4A 1R9TH 1JMCA 4LF9Q 1KRTA 4OO1G 4XIGS 3J7ZC 4C3JH 1D7QA 4DV0L 1WCMG 4IPHA 2UXBL 3RNUA 3I55A 4DV6Q 2YV5A 1PH2A 1HZ9A 2E2IH 4JI7L 4LF4L 1I94L 4OO1I 4B3TL 1N32Q 1HNWQ 4PZ7A 1Q1BA 1PH3A 4UY8C 3M4PA 5H1SE 3WWVA 1YHBA 4DV7L 2D0PA 2ZTEA 4DR2Q 5M3FG 1SMXA 1GKHA 3FHWA 4AH6A 1KXLA 4LF7L 4A3MH 3MXNB 3I4NH 1JJ2A 4Y52H 3J80c 1LUZA 2F52A 1N36Q 3L7ZC 2JE6I 4P71A 4PMWA 4DR7Q 1IBKQ 4DV3L 2B63G 3KLWA 5IE8A 3MEFA 3GTQH 1L1OA 4C3HH 2VQFQ 2UXDL 2IT1A 3ER0A 3PUWA 3M4OH 3T1HQ 3F2DA 5M3FH 1EQQA 2WP8J 2B3GA 1KRSA 4DV4L 1EQRA 4LF6Q 1I6HH 1UE5A 3I7FA 1XNQQ 3A0JA 1LTLA 1JE5A 2QGQA 4YHHL 5JEAG 1HR0Q 1QVCA 3NBHB 2YU9H 3CCVA 4KHPQ 2GN5A 5JJIA 3UDIA 1SROA 1CKMA 1Q81C 4FDBA 2R7ZH 3S15H 2A19A 3HOVG 1UEBA 2Z6KC 1QVFA 4A4IA 2R7FA 3HKZE 4YY3L 1IXRA 2N3SA 3EN2A 2K4KA 5IY0A 3CMEA 1N34L 2OWOA 4B3SL 4JBWA 3HOWG 3S1MH 3PO2G 1H95A 2JEBI 4BY1G 5M3MG 4JOIC 1Q8KA 3STBC 3G71A 5IYCG 4OWTB 3CXCA 1CUKA 3H0GG 1EYGA 2PI2E 1N33L 3STBD 1EIYB 1C0AA 2JA7H 4ALPA 1AE2A 3NENA 1BKBA 2A1AA 3OYYA 1TXYA 2ATWA 2CFMA 2HHHL 3TQYA 4P72A 3GTMH 4A3KG 1JJGA 1I50H 1GD7A 1X55A 1XTDA 3HOXH 2Q2UA 1NBWA 4JG2A 4GLXA 3KF6B 4LF5L 3S17H 3A5UA 1E7ZA 2RHQB 1EIFA 3M7NA 2KENA 4IFDG 1YHAA 2JJQA 1E1TA 5EAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 G;  3HOZ H;  4OWX B;  1SE8 A;  4BY7 G;  1HH2 P;  3S24 A;  4JI7 Q;  3CMA A;  4LF4 Q;  4KHZ A;  1I94 Q;  4DV1 L;  4QGU A;  1QUQ A;  2NZO A;  4IFD I;  3E9I A;  2KBN A;  1A62 A;  5FLX c;  3S2H H;  1TWA H;  2VZA A;  4KI0 A;  3J81 j;  1L0W A;  4LNQ A;  3FKI G;  4GNX C;  1QZH A;  4JCV E;  4HJ9 A;  1XJV A;  3HOU H;  3VDY A;  3ULL A;  2VW9 A;  4A3J H;  2Z6K A;  3I4M G;  1K8G A;  2ZM6 Q;  4AQY Q;  4A3G G;  4X6A H;  3M9B A;  4JI6 L;  4JI1 L;  4QY7 A;  5DLQ E;  4X66 L;  4A3C H;  1XPR A;  2XGT A;  1KAW A;  1A0I A;  2D62 A;  3UE0 A;  4A3F G;  5IYB G;  1PH6 A;  5M5W H;  1CKN B;  2VQE Q;  3CCE A;  4GS3 A;  2UXD Q;  3TRE A;  1Y1V G;  4C3I H;  4WJ3 M;  1SRU A;  2HIX A;  3A74 A;  4PG3 A;  4DV4 Q;  3KJO A;  1PH8 A;  3CC4 A;  4GKJ L;  3D31 A;  3RZD H;  4LFC L;  3CCQ A;  3I56 A;  1MJC A;  3K7A H;  4YCV A;  1OXU A;  4BBS H;  1O7I A;  4DR5 L;  4BA1 I;  4GKK L;  4AYB E;  4BBR H;  3T1Y L;  4K0K L;  1PVO A;  2OQK A;  2DUD A;  3HKZ G;  1NY4 A;  4H02 A;  4UPA A;  5IP9 G;  4APV A;  4YY3 Q;  2QEX A;  5LMU L;  4NB3 A;  4HIM A;  1N34 Q;  3W1B A;  3KDF B;  4B3S Q;  3TS0 A;  2UU9 L;  4HID A;  3K8A A;  5JEA J;  4L5S A;  4QQB X;  2MO0 A;  3CCU A;  4YWL A;  2VUM H;  1VQM A;  3L2P A;  1N33 Q;  3CCJ A;  1T9H A;  4OX9 L;  2IX0 A;  4DR1 Q;  1PH9 A;  2I0Q A;  1IZ6 A;  1M1K C;  1XPU A;  3CAM A;  1V9P A;  1K8A C;  1Q86 C;  4IO9 A;  2ZJP A;  2K5H A;  2F4V L;  2N8N A;  2D0O A;  3CCM A;  3KJP A;  3RN2 A;  1VQ6 A;  3CCR A;  5GRO A;  2B29 A;  4DK6 C;  1PA6 A;  1AH9 A;  3LGJ A;  1VQD A;  4A3M G;  4JBK A;  3I4N G;  4A3I H;  3H15 A;  4JV5 L;  4QJF A;  2PI2 A;  4MZ9 A;  5GAD C;  1Q46 A;  4J15 A;  4LFA L;  3UDF A;  1VQ4 A;  4DV1 Q;  1FGU A;  1TWC H;  3AQQ A;  3GO5 A;  4P74 A;  1P16 A;  3DLL A;  2NVX H;  2R92 G;  4NXN L;  4DV2 Q;  2GVB A;  1FL0 A;  1VQO A;  3I4O A;  4IJH A;  5ELO A;  5C0X J;  1K73 C;  4O0A A;  1X3F A;  4B3M Q;  4DR4 Q;  4A93 G;  1OXS C;  2Y0S E;  1X3E A;  5C3E H;  5IYD H;  4IOA A;  1CSP A;  2VY3 A;  1WJJ A;  1Y14 B;  1PFS A;  1YJW A;  3W5O A;  4X65 L;  2K75 A;  1IBM L;  2NVY H;  2R92 H;  1NTG A;  1J5E L;  1HR0 W;  2R7Z G;  4ME3 A;  2MNA A;  1E22 A;  4GLV B;  4A93 H;  3M85 A;  3BZC A;  4OXP A;  3ULJ A;  4DR3 Q;  2LXJ A;  4RG1 A;  4YCW A;  3J80 i;  4JI8 L;  3CC7 A;  3NEM A;  4LF8 Q;  4GKJ Q;  2BH8 A;  4GN3 B;  5C4J H;  2C35 B;  1P8L A;  4B3R L;  1VS0 A;  2H5X A;  3AYH B;  3GTJ H;  2E5L L;  4GOP C;  4YCU A;  4LFC Q;  1VQA A;  1LM0 A;  3F8T A;  3H3V I;  2Z0S A;  1WOC A;  2IX1 A;  4X64 Q;  1BBW A;  5BR8 L;  1HNX Q;  3JC6 6;  3HKS A;  4GKK Q;  2MFI A;  4AYB G;  4K0K Q;  3H3V H;  2EXD A;  2CQO A;  5LMU Q;  4R4C A;  3KF6 A;  3K81 C;  4HJ7 A;  3HOX G;  1B70 B;  3F2B A;  3OW2 A;  1M90 C;  2AWO A;  2RHS B;  2UUA L;  2UUC L;  2UU9 Q;  3RLO A;  1HNZ Q;  3J81 c;  1Q12 A;  3JAM c;  1VQL A;  3HOZ G;  4DR6 L;  3S16 H;  3GTO H;  4R1J A;  2CKZ B;  1YZ6 A;  5M5X H;  2E8G A;  2E2J H;  4OX9 Q;  3HOV H;  4DAM A;  1I3Q H;  5J3B A;  4LFB L;  1RL2 A;  4DUZ L;  3PGZ A;  2KCT A;  4JYA L;  4IPC A;  2JA5 H;  1X3G A;  1PHJ A;  1L1O B;  3HOU G;  2PNH A;  4YWM A;  4UP7 A;  4PZ6 A;  4DV0 Q;  4DUY L;  4A3J G;  1TWF H;  3S1N H;  1VQJ A;  2UXB Q;  5AJ3 L;  1VQC A;  2OCE A;  3RN5 A;  4A3B H;  4JV5 Q;  4A3C G;  1VQ5 A;  1YJN A;  4NXM L;  1WYD A;  3PUV A;  1PV4 A;  4LFA Q;  4B3T Q;  1JT8 A;  4BXX H;  2HQL A;  4NPS A;  2ZJQ A;  4GOP A;  1X65 A;  1IBL L;  1KD1 C;  2I5M X;  3RR5 A;  2VNU D;  2MQH A;  1EUJ A;  2PQA B;  2BA1 A;  4DV7 Q;  4A3D H;  1S40 A;  4DNI A;  1Y1W H;  4JI5 L;  5FLM H;  2Y0S G;  4TQU S;  4LF7 Q;  1OXX K;  1PH1 A;  2AMC B;  4YWK A;  3TS2 A;  2NVQ H;  1FJG L;  2R6G A;  1N9W A;  1V1Q A;  3OTO L;  5C4X H;  3D0F A;  5LMN L;  4DV3 Q;  4KLK A;  4DV6 L;  4BBS G;  1J5E Q;  2NVT H;  4BBR G;  1N32 L;  3CF5 A;  1HNW L;  2WB1 E;  1I5F A;  4HIO A;  1NMG A;  2R93 G;  2JK8 A;  3KDF A;  4HJ5 A;  3GD7 A;  4L5T A;  1B8A A;  2VUM G;  1KHI A;  2IHF A;  1EOV A;  4JI8 Q;  1XMQ L;  1JB7 A;  2UXC L;  1E1O A;  2QA4 A;  4DR2 L;  2AHO B;  4A3L G;  4C2M H;  4YHH Q;  4B3R Q;  1GO3 E;  2OQ0 A;  4HJA A;  3BZK A;  2E5L Q;  3PCO B;  2JA8 G;  1FVI A;  5IP7 H;  3UDG A;  1G51 A;  3S14 H;  1N36 L;  4IJL A;  4A3E H;  5BR8 Q;  1EFW A;  4HIK A;  4JI3 L;  1IBK L;  4QIW E;  2ASB A;  1VQE A;  3PSI A;  2OTL A;  4DR7 L;  1QUQ B;  2VQF L;  1KIX A;  2UUA Q;  2UUC Q;  5GAH C;  4A3L H;  1HZC A;  3CPF A;  5JJK A;  1B7Y B;  2JA8 H;  4LF6 L;  1CKO A;  4GLA C;  3PIP A;  4A76 A;  1YJ9 A;  1YIT A;  1XNQ L;  3S1R H;  2VS1 A;  4AIM A;  4A3I G;  2YYZ A;  3HOY H;  2HHH Q;  2IY5 B;  4KHP L;  1U5K A;  3UDX A;  5LMN W;  3AFP A;  3FP9 A;  1WFQ A;  2R93 H;  4LFB Q;  2VL6 A;  5HY6 A;  4JC0 A;  4LF5 Q;  2N49 A;  1UE1 A;  4XTC S;  3CCL A;  1XPO A;  3Q8D A;  3M3Y H;  1YI2 A;  2XTI A;  5GAE C;  5LMN Q;  5C3E G;  1XMO L;  4MNO A;  4EX5 A;  3U4Z A;  4DAY B;  5IYD G;  1MJE A;  4JI0 L;  1TWG H;  4JI4 L;  1BBU A;  5C44 H;  3S2D H;  4P73 A;  1HZA A;  3CC2 A;  1KC8 C;  3K0X A;  3RZO H;  3ZJY C;  3B6Y A;  2ZTC A;  1WI5 A;  1YBY A;  1PYS B;  4IPG A;  1X9N A;  4IFD J;  4Y7N H;  4LW1 A;  1X56 A;  1ASZ A;  2BH2 A;  1K83 H;  1PYB A;  1VQH A;  4OON A;  3I2Z A;  3KOJ A;  1QVG A;  1S72 A;  3CQZ H;  5FJ8 G;  4JI5 Q;  1OXV A;  4IOC A;  4L5R C;  3EBE A;  2WFW A;  3CCS A;  4JI6 Q;  1UE6 A;  2KHI A;  4JI1 Q;  4P75 A;  4X66 Q;  3BJU A;  3K80 C;  1FJG Q;  1X6O A;  3OTO Q;  1N8R C;  2JA6 H;  2WAQ E;  4PZ8 A;  4GNX B;  4DV5 L;  4HJ8 A;  1VQ7 A;  2JEA I;  3ERS X;  1YIJ A;  5IWA L;  3G48 A;  1VQI A;  4DKA C;  2WB1 G;  1Z47 A;  5FJ8 H;  1LYL A;  2BA0 A;  3ULP A;  1XMQ Q;  2UXC Q;  3K7U C;  1G29 1;  3HFZ B;  1VQ9 A;  3CD6 A;  4R4Q A;  2JQO A;  2LSS A;  2K50 A;  4JI2 L;  1WCM H;  1SFO H;  4LUZ A;  1NJI C;  3TEH B;  2ZM6 L;  4AQY L;  1KQS A;  3G6E A;  3PF4 A;  4R4T A;  5E7N A;  1IL2 A;  4POF A;  1A63 A;  4R4O A;  4DR5 Q;  2ALY B;  2R7D A;  5HGQ A;  4OWW B;  3GTG H;  1HZB A;  2A8V A;  3T1Y Q;  3EIV A;  3AFQ A;  1VQP A;  4JBJ A;  4JI3 Q;  4LUO A;  1X54 A;  2HIV A;  2ID0 A;  2YTY A;  1E3P A;  2VQE L;  1C7Y A;  3E0E A;  1PH7 A;  2JA5 G;  1Q7Y C;  1NMF A;  5M5Y H;  2LXK A;  1CSQ A;  2F3I A;  2JA9 A;  3G4S A;  3E9H A;  5ELN A;  1PH4 A;  1RIP A;  1GVP A;  2CCZ A;  4A3B G;  2UUB L;  1ASY A;  2L15 A;  3DM3 A;  2EIF A;  1OXT A;  5IT9 c;  2KCM A;  4POG A;  2N78 A;  4BXX G;  2B63 H;  1VQG A;  3J81 i;  3JAM i;  1VCI A;  2PQA A;  3M4Q A;  2F4V Q;  4IPD A;  4X62 L;  1Q82 C;  1YNX A;  3SGI A;  3U4V A;  1VQ8 A;  3CPW A;  1Y1W G;  5FLM G;  4A3D G;  1G6P A;  3RLN A;  3PUZ A;  2DGY A;  4DPG A;  4JI0 Q;  2AKW B;  1XMO Q;  4JI4 Q;  3L0O A;  1YVC A;  1J6Q A;  3S1Q H;  1VQK A;  2ES2 A;  1SN8 A;  4TVA B;  1A8V A;  3PUY A;  2K5N A;  1GM5 A;  5C4X G;  1EWI A;  1CKN A;  2I5L X;  3PV0 A;  1MKH A;  4DR1 L;  2FXQ A;  4DK3 C;  4NXN Q;  2ZJR A;  3GTP H;  1PH5 A;  4LWC A;  2IHE A;  1XNR L;  3IRB A;  3HOW H;  3PO2 H;  4O2D A;  4BY1 H;  5M3M H;  4LF9 L;  3ICE A;  5IYC H;  4JBM A;  3H0G H;  5C0X G;  2E2H H;  3F2C A;  2MO1 A;  4X65 Q;  3J7A 5;  4UP9 A;  1V43 A;  1IBM Q;  4UP8 A;  2HT1 A;  1UWV A;  2WAQ G;  3RLF A;  4MTN A;  5IP7 G;  4DV5 Q;  3KF8 B;  3GTK H;  5IWA Q;  4EQ5 A;  1VQB A;  4A3E G;  3CP0 A;  4A3K H;  1D8L A;  2CWP A;  1UE7 A;  3U50 C;  1TWH H;  3CW2 C;  5C0X I;  1QZG A;  2NZH A;  4DV2 L;  2ZTD A;  2K5V A;  1YEZ A;  4RMF A;  4B3M L;  4DR4 L;  2KHJ A;  2Q2I A;  3PUX A;  1AE3 A;  5GAG C;  4JI2 Q;  3PO3 H;  1U0L A;  3AEV A;  1K9M C;  3PF5 A;  2CWA A;  4R4I A;  3KYH C;  3TRZ A;  4BY7 H;  4WJ4 A;  3GTL H;  3HOY G;  4L5Q A;  4GN5 A;  4JOI A;  1K0R A;  1K3R A;  2GVA A;  2OTJ A;  2V1C C;  1C9O A;  1Q1E A;  3FKI H;  4QL5 A;  5K36 G;  5JJL A;  4GOP B;  1JJC B;  3T1H L;  4DR3 L;  4A75 A;  1HJP A;  2AWN A;  2NN6 G;  3I4M H;  4LF8 L;  1Z9F A;  2K52 A;  2JA7 G;  4DR6 Q;  4A3G H;  1HR0 L;  4GN4 B;  1W2B A;  5C44 G;  3PIO A;  2UUB Q;  1E24 A;  2YTX A;  3U58 A;  2Q2T A;  4DUZ Q;  2YTV A;  1VQF A;  1L2F A;  4A3F H;  5IYB H;  1W3S A;  2NN6 I;  3A5Z B;  4X64 L;  1HNX L;  1VQN A;  4JYA Q;  3NEL A;  1SR3 A;  1Y1V H;  4LUV A;  1S3O A;  4X62 Q;  1OTC A;  2RCN A;  2EQS A;  1BVS A;  4DUY Q;  3UE1 A;  3F1Z A;  1SLJ A;  3W1G A;  1HNZ L;  5AJ3 Q;  4BA2 I;  2I5H A;  1IYJ B;  1MIU A;  1KL9 A;  4NXM Q;  3BU2 A;  4GNX A;  1NE3 A;  1L1O C;  2JA6 G;  1YHQ A;  2PMZ E;  2K14 A;  1IBL Q;  2Q2H A;  5GQO A;  5IP9 H;  1XNR Q;  3GDE A;  3KFU A;  1DGS A;  2RF4 A;  1R9T H;  1JMC A;  4LF9 Q;  1KRT A;  4OO1 G;  4XIG S;  3J7Z C;  4C3J H;  1D7Q A;  4DV0 L;  1WCM G;  4IPH A;  2UXB L;  3RNU A;  3I55 A;  4DV6 Q;  2YV5 A;  1PH2 A;  1HZ9 A;  2E2I H;  4JI7 L;  4LF4 L;  1I94 L;  4OO1 I;  4B3T L;  1N32 Q;  1HNW Q;  4PZ7 A;  1Q1B A;  1PH3 A;  4UY8 C;  3M4P A;  5H1S E;  3WWV A;  1YHB A;  4DV7 L;  2D0P A;  2ZTE A;  4DR2 Q;  5M3F G;  1SMX A;  1GKH A;  3FHW A;  4AH6 A;  1KXL A;  4LF7 L;  4A3M H;  3MXN B;  3I4N H;  1JJ2 A;  4Y52 H;  3J80 c;  1LUZ A;  2F52 A;  1N36 Q;  3L7Z C;  2JE6 I;  4P71 A;  4PMW A;  4DR7 Q;  1IBK Q;  4DV3 L;  2B63 G;  3KLW A;  5IE8 A;  3MEF A;  3GTQ H;  1L1O A;  4C3H H;  2VQF Q;  2UXD L;  2IT1 A;  3ER0 A;  3PUW A;  3M4O H;  3T1H Q;  3F2D A;  5M3F H;  1EQQ A;  2WP8 J;  2B3G A;  1KRS A;  4DV4 L;  1EQR A;  4LF6 Q;  1I6H H;  1UE5 A;  3I7F A;  1XNQ Q;  3A0J A;  1LTL A;  1JE5 A;  2QGQ A;  4YHH L;  5JEA G;  1HR0 Q;  1QVC A;  3NBH B;  2YU9 H;  3CCV A;  4KHP Q;  2GN5 A;  5JJI A;  3UDI A;  1SRO A;  1CKM A;  1Q81 C;  4FDB A;  2R7Z H;  3S15 H;  2A19 A;  3HOV G;  1UEB A;  2Z6K C;  1QVF A;  4A4I A;  2R7F A;  3HKZ E;  4YY3 L;  1IXR A;  2N3S A;  3EN2 A;  2K4K A;  5IY0 A;  3CME A;  1N34 L;  2OWO A;  4B3S L;  4JBW A;  3HOW G;  3S1M H;  3PO2 G;  1H95 A;  2JEB I;  4BY1 G;  5M3M G;  4JOI C;  1Q8K A;  3STB C;  3G71 A;  5IYC G;  4OWT B;  3CXC A;  1CUK A;  3H0G G;  1EYG A;  2PI2 E;  1N33 L;  3STB D;  1EIY B;  1C0A A;  2JA7 H;  4ALP A;  1AE2 A;  3NEN A;  1BKB A;  2A1A A;  3OYY A;  1TXY A;  2ATW A;  2CFM A;  2HHH L;  3TQY A;  4P72 A;  3GTM H;  4A3K G;  1JJG A;  1I50 H;  1GD7 A;  1X55 A;  1XTD A;  3HOX H;  2Q2U A;  1NBW A;  4JG2 A;  4GLX A;  3KF6 B;  4LF5 L;  3S17 H;  3A5U A;  1E7Z A;  2RHQ B;  1EIF A;  3M7N A;  2KEN A;  4IFD G;  1YHA A;  2JJQ A;  1E1T A;  5EAY A; 
#chains in the Genus database with same CATH topology
 2EYH A;  4OWX B;  3KBX A;  1QNK A;  4M1U B;  4BY7 G;  4JI7 Q;  1UNS A;  1I94 Q;  4FF4 A;  5DAU A;  2KBN A;  3IFT A;  4KI0 A;  4LNQ A;  3J81 j;  3WOE A;  3V2T A;  2L0C A;  1I3Q B;  4HJ9 A;  3ULL A;  3PQI A;  4QIW B;  4KY7 A;  1K8G A;  1JOK A;  1TQO A;  4QY7 A;  2ZT9 C;  3SK6 A;  4A3C H;  4BS9 A;  1XPR A;  2XGT A;  3OSO A;  2B2T C;  2F0H A;  1GUG A;  3IFD A;  1A0I A;  1YNN D;  1TS3 A;  4HCS A;  5M5W H;  1CKN B;  2UXD Q;  3PMF A;  2LY7 A;  5HGT A;  2C9O A;  3SR1 A;  1SRU A;  3A74 A;  1PH8 A;  2IL8 A;  1LT5 D;  1ENA A;  3EVQ A;  3RZD H;  4A3D B;  1LTB D;  3NTH A;  4BBS H;  4BA1 I;  4BBR H;  5EKI A;  3HKZ G;  5LMU L;  4HIM A;  4UPA A;  1VQ6 A;  3QB3 A;  3W1B A;  2UU9 L;  3J80 L;  1KAA A;  4KN7 C;  4KTA A;  3CCJ A;  3T16 A;  1DYQ A;  1U4R A;  4DGZ A;  2IX0 A;  4KD4 A;  1G2T A;  2BDO A;  1M1K C;  1V9P A;  3FPU B;  4MN3 A;  3NHH A;  3S14 B;  3VR5 A;  1PTO B;  3MXN A;  4A3M G;  3I4N G;  1Z6H A;  4A3I H;  4JV5 L;  2JP1 A;  4MTK A;  1VQ4 A;  4DV1 Q;  1FGU A;  3AQQ A;  3GO5 A;  2NVX H;  1CK1 A;  5DNF A;  1VQO A;  1FL0 A;  3AMU A;  3I4O A;  4C1N I;  5C0X J;  4O0A A;  1STG A;  3ERO A;  4QB4 A;  1X3E A;  3R8B A;  1JWM D;  1SDF A;  5I2X A;  1YJW A;  4K2L A;  2JA7 B;  1B9M A;  1TII D;  2N88 A;  1HR0 W;  1TWG B;  4E6I A;  1AN8 A;  4CGY B;  4QUC A;  2B2Y C;  4ABN A;  3VYS A;  4YCW A;  3CC7 A;  2DY7 A;  2XIW A;  4LF8 Q;  2RSN A;  5C4J H;  2WKC A;  1VS0 A;  3MHB A;  1I6V C;  4GOP C;  4YCU A;  2IJ0 A;  1LM0 A;  3F8T A;  1EYC A;  3J80 E;  5BR8 L;  1MBY A;  3IKJ A;  5IGC A;  4AYB G;  2RDF A;  1B70 B;  3OW2 A;  2AWO A;  5JOB A;  1R4Q B;  4XQJ A;  1R4P B;  2NUC A;  4F7X A;  3S16 H;  1MSG A;  2E8G A;  4OX9 Q;  1SFO B;  3U9S A;  4B9W A;  1UUP A;  3H91 A;  1H9J A;  4DK0 A;  1PHJ A;  3MWY W;  4YWM A;  4UP7 A;  4PZ6 A;  2MP1 A;  1EL0 A;  1SMY C;  1F2Y A;  2UXB Q;  4A3B H;  1QIL A;  2WV6 D;  4A3C G;  4NXM L;  2Q8T A;  3C1E A;  4LFA Q;  2K03 A;  1JT8 A;  4RKB A;  4NPS A;  4K8I A;  1X65 A;  4JK1 C;  1KD1 C;  1LTS D;  2VNU D;  4KY5 A;  1KTK A;  2BA1 A;  4DNI A;  1BCP C;  1Y1W H;  5I9O A;  1YNJ D;  4JI5 L;  2Y0S G;  3GV3 A;  3MXU A;  1BDO A;  2A69 C;  1OXX K;  3TS2 A;  1SMY D;  1FJG L;  3I8Z A;  3OTO L;  5C4X H;  5D3D A;  3D0F A;  4DV6 L;  4BBS G;  3LWE A;  1J5E Q;  1ILP A;  4BBR G;  1N32 L;  5K5P A;  1PMR A;  4HIO A;  1I5F A;  5CV6 A;  3KDF A;  4HJ5 A;  1B8A A;  4I7Z C;  1XMQ L;  1JB7 A;  1E1O A;  2QA4 A;  3GTP B;  2AHO B;  3DXJ C;  1UEA B;  1GO3 E;  4HJA A;  3BZK A;  2E5L Q;  5M3M B;  1FVI A;  3Q0A A;  3MTS A;  3UDG A;  1BUV T;  3RUZ A;  1S5F D;  1VQE A;  2VQF L;  5ELF A;  1KIX A;  2PMZ B;  2UUC Q;  4A3K B;  1A3T A;  4M8A A;  5JJK A;  1OO9 B;  4LF6 L;  3PIP A;  4A3I G;  1SYD A;  2IY5 B;  3UDX A;  2XN9 C;  3PO3 B;  4LFB Q;  5DM7 3;  1TY2 A;  4LF5 Q;  4S3S A;  4XTC S;  2KCN A;  2NN6 H;  2XTI A;  5LMN Q;  4MNO A;  5IGF A;  1M8A A;  5C44 H;  2FHT A;  3RZO H;  3ZJY C;  4A3G B;  1DZ1 A;  2ZTC A;  1WI5 A;  1X9N A;  1ASZ A;  2BH2 A;  2F0O A;  4A3F B;  3CQZ H;  1OXV A;  4L5R C;  3EBE A;  2WFW A;  3LNN A;  3NBH A;  2KHI A;  4P75 A;  2PCF B;  1NSN S;  1X6O A;  1N8R C;  2JA6 H;  4HJ8 A;  1S5B D;  3G48 A;  5BN4 A;  4LMQ D;  1VQI A;  3RMH A;  2G9D A;  4ZKB B;  2UXC Q;  1WCM H;  3TEH B;  2ZM6 L;  1CZW A;  1DXM A;  4C3J B;  1A63 A;  2EXZ A;  1HZB A;  2XSC A;  2G5D A;  3SK8 A;  3AFQ A;  1RCV D;  4O42 A;  4XYO A;  3W3A A;  2F0U A;  2VQE L;  1EQV A;  3CHB D;  1C7Y A;  2F0P A;  1Q7Y C;  5M5Y H;  4G7Z C;  2LXK A;  1EU4 A;  4J1M A;  1B50 A;  1PH4 A;  2A68 D;  3QIA A;  2UUB L;  4A3B G;  5IT9 c;  4POG A;  3SHL A;  3BDC A;  2N78 A;  2B63 H;  2O2L D;  1I4R A;  3MZ5 A;  2MGS A;  1EY7 A;  1VCI A;  3M4Q A;  4EVO A;  1X3Q A;  1V1P B;  4OEL B;  1VQ8 A;  1Y1W G;  4RGO S;  3RLN A;  3PUZ A;  4C3H B;  1XMO Q;  1C48 A;  4NW2 A;  4Z9C B;  1YVC A;  3QOJ A;  3S1Q H;  1B3A A;  2ES2 A;  1SN8 A;  3JAM E;  5C4X G;  2K5N A;  1E0B A;  1PRT B;  1CKN A;  1HPC A;  2GA4 B;  5CBE E;  1EY8 A;  1U4L A;  2AQ1 B;  4OHJ A;  5C4H A;  3C3L A;  4JBM A;  2E2H H;  3F2C A;  3J7A 5;  1NNX A;  4FNF A;  5ELB A;  4CDC C;  4UP8 A;  1UWV A;  2WAQ G;  1J8I A;  4MTN A;  3GTK H;  5IWA Q;  1VQB A;  1RHP A;  1D8L A;  1B9N A;  3N52 A;  2CWP A;  5EBC A;  1TWH H;  1JB3 A;  4DV2 L;  1YEZ A;  1B53 A;  1SE4 A;  3KBG A;  4B3M L;  1QJO A;  2KHJ A;  4DR4 L;  4LAA A;  3VR3 A;  2WIN B;  5GAG C;  1I50 B;  1F9Q A;  4JI2 Q;  3HOX B;  3TSS A;  5KRU A;  3PO2 B;  1LLR D;  3KYH C;  4L6T B;  3H0G B;  4HED A;  3DUZ A;  1K3R A;  3A8I E;  2F0M A;  1C9O A;  2L11 A;  5FO7 B;  3T1H L;  4Q0F A;  4DA2 A;  2M2L A;  2NN6 G;  1VF5 C;  4RGT A;  1Z9F A;  1BBX C;  1HR0 L;  3OOC A;  4DFA A;  1W2B A;  5C44 G;  1E24 A;  2E2D C;  1G91 A;  2Z1C A;  4X64 L;  1EY5 A;  5A35 A;  3NEL A;  1SR3 A;  1Y1V H;  4K8J A;  1S3O A;  1S5C D;  4X62 Q;  1OTC A;  1BVS A;  2XWJ B;  1AEX A;  3K0Y A;  1SLJ A;  4BA2 I;  2F3V A;  1STY A;  2I5H A;  3I91 A;  4C3I B;  4NXM Q;  4GNX A;  1PZJ D;  3KLS A;  2QDB A;  4HMJ A;  1Y8N B;  2JA6 G;  3SE0 A;  1DM0 B;  2CH4 W;  2PZU A;  1EZ8 A;  4WOR A;  1XNR Q;  3GDE A;  1Q3L A;  1A2U A;  2RF4 A;  4DN4 M;  4DV0 L;  2VUM B;  1WCM G;  3I55 A;  3ND8 A;  4DV6 Q;  4FF3 A;  4CBV A;  1PH2 A;  4JI7 L;  1EIH A;  1I94 L;  2M00 A;  4XYQ A;  2PW7 A;  2H1E A;  1N32 Q;  4UY8 C;  5H1S E;  4ODG A;  3UI2 A;  2D0P A;  2F0K A;  5M3F G;  1GKH A;  2ENB A;  2WKD A;  4X3S A;  3HP3 A;  3MXN B;  2F52 A;  3CKI B;  2B2U C;  2JE6 I;  3K58 A;  1H9R A;  1STB A;  2PNR C;  2B63 G;  2VQF Q;  2UXD L;  3E3X A;  4OL7 A;  1TWC B;  2B3G A;  1KRS A;  4L8J A;  4LF6 Q;  4K6L A;  1SSO A;  2YU9 H;  2GN5 A;  5JJI A;  5C3E B;  3UDI A;  4PMC A;  1Q81 C;  1SBB B;  5EKK A;  3S15 H;  1UEB A;  1MSH A;  1IXR A;  3S1M H;  2JEB I;  5C5L A;  4JOI C;  1Q8K A;  3ND9 A;  2QW7 A;  1PXU A;  3DHQ A;  1HRJ A;  3NEN A;  2A1A A;  2ATW A;  3EJI A;  3GTJ B;  4KKU A;  4P72 A;  1TY0 A;  2EYM A;  1GD7 A;  1XTD A;  2K28 A;  2Q2U A;  4JG2 A;  2PO4 A;  3K5L A;  3S17 H;  4I7A A;  2RHQ B;  1EIF A;  3I3C A;  5EAY A;  3HOZ H;  3I73 A;  3TP8 A;  1SE8 A;  1HH2 P;  2L12 A;  3S24 A;  4DV1 L;  4QGU A;  3HZX A;  3GTO B;  4IFD I;  3S2H H;  2KHS A;  1TWA H;  5M5X B;  3VR2 A;  2R3Z A;  2BE5 C;  4A3J H;  2Z6K A;  4HSV A;  2ZM6 Q;  4X6A H;  1KAW A;  3UE0 A;  1PH6 A;  1JE4 A;  1HCZ A;  2VQE Q;  4GS3 A;  2F0L A;  3TRE A;  1Y1V G;  1WD1 A;  4PG3 A;  3CC4 A;  1I4Q A;  2J7Z A;  2BE5 D;  1PTO F;  1SYF A;  1K8M A;  1PYW D;  1OXU A;  2XWB B;  4DR5 L;  2NVQ B;  2L5T A;  2OQK A;  1NY4 A;  1N34 Q;  1EY6 A;  4ZCK A;  4NB3 A;  3KDF B;  4FYD A;  1E2V A;  2V4D A;  3K8A A;  1CA5 A;  1D6E C;  1ML0 D;  2XNA C;  2MO0 A;  1EU3 A;  1N33 Q;  1T9H A;  2LFN A;  4EQN A;  4OX9 L;  1B3Q A;  3DWA A;  1XPU A;  3K6O A;  1FR3 A;  3CAM A;  4FP5 D;  4EQP A;  2Q8R E;  2K5H A;  1EEI D;  5BN5 A;  2F4V L;  2D0O A;  3O13 A;  3KJP A;  5JPN C;  3CCR A;  1EY4 A;  3A7A B;  4DK6 C;  2PQE A;  1PA6 A;  4JBK A;  1MD2 D;  4QJF A;  4KHV A;  4J15 A;  2JA8 B;  4LFA L;  3UDF A;  1D1I A;  1SNP A;  3J7A V;  1CA6 A;  1S5D D;  1P16 A;  5KYL A;  1AZQ A;  2R92 G;  4K14 A;  3NQI A;  4DV2 Q;  5F2D A;  5FKA C;  5EPL A;  4A93 G;  1X3F A;  4B3M Q;  4DR4 Q;  2EY1 A;  4DK1 A;  4DAV A;  3NXW A;  5IYD H;  2QKI C;  2VY3 A;  1Y14 B;  1E2Z A;  1EIG A;  1SJE D;  4X65 L;  2K75 A;  1XYI A;  3M3Y B;  4ZUI A;  1TKW B;  1J5E L;  4ME3 A;  3S2D B;  1E22 A;  1STN A;  4LK1 C;  4OXP A;  3ULJ A;  3M85 A;  1GXD C;  4ME5 A;  3J80 i;  1B4O A;  2KOL A;  4GKJ Q;  4GN3 B;  1KNA A;  1K83 B;  1G8Z D;  3AYH B;  2E5L L;  4LFC Q;  3TN2 A;  1RTN A;  2Z0S A;  5CV8 A;  1WOC A;  2DY8 A;  3ZYY X;  4X64 Q;  3JC6 6;  3HKS A;  2MFI A;  2EXD A;  4R4C A;  5C4Z A;  2UUC L;  1SNM A;  3J81 c;  3LWU A;  1G2S A;  3I72 A;  3HOZ G;  2RSO A;  4DR6 L;  3KLS X;  1DCZ A;  5J3B A;  4LFB L;  2KCT A;  3NUC A;  4KJO A;  5ELD A;  2JA5 H;  3M7G A;  1JWU D;  4DV0 Q;  4A3J G;  1TWF H;  2SEB D;  4CJ1 B;  3S1N H;  5AJ3 L;  1TS4 A;  2OCE A;  5KYI A;  4N9P A;  4XQN A;  1PV4 A;  4BXX H;  3QG1 A;  1NUC A;  1IBL L;  3HOV B;  2E2J B;  2I5M X;  5G3L D;  3RR5 A;  1U4P A;  1BQQ T;  3FEW X;  1Y69 U;  1O78 A;  2AQ2 B;  1PH1 A;  2QIL A;  2RVL A;  2DNC A;  4KLK A;  4JPB W;  3X3M A;  2QCP X;  1HFN A;  2NVT H;  1QOH A;  2WB1 E;  2JK8 A;  1PFB A;  2UXC L;  4HAE A;  2RCF A;  3F2U A;  4A3L G;  4C2M H;  3M4Y A;  1D5Z C;  4BY1 B;  3D8G A;  3P7J A;  1NR4 A;  4A3E H;  1EFW A;  1V1O A;  4QIW E;  2ASB A;  1NCV A;  2RDG A;  2HQE A;  3CPF A;  1CKO A;  1JCK B;  1XNQ L;  2K32 A;  2KCC A;  3E0J A;  3HOY H;  1U5K A;  2D5D A;  2LKV A;  3FP9 A;  2VL6 A;  5HY6 A;  4BY7 B;  3GTL B;  3OWF A;  5I9P A;  3CCL A;  5BN3 A;  3RD4 A;  3Q8D A;  4NDX A;  1XMO L;  5IYD G;  4EX5 A;  4DAY B;  4XDX A;  3R3O A;  3CC2 A;  1STH A;  3K0X A;  3HS0 C;  3DEP A;  3B6Y A;  1SNC A;  1LT6 D;  1YBY A;  4IFD J;  4CHT B;  4Y7N H;  1PYB A;  2FFK B;  1CQF A;  1QVG A;  3L3O C;  4RCN A;  1GHJ A;  3K80 C;  1FGB D;  2NB0 A;  3KK7 A;  4GNX B;  4PZ8 A;  1YIJ A;  3FRP B;  3NE5 B;  4FF1 A;  5IWA L;  1WVL A;  5E1F A;  4JVZ A;  2B2V A;  2H4O A;  1GUS A;  1JR0 D;  5CC4 A;  3I70 A;  3ERQ A;  1G29 1;  3HKZ B;  4JI2 L;  2L1B A;  4ULL A;  1PLF A;  1NJI C;  3PF4 A;  2DN8 A;  1MI2 A;  1IL2 A;  4POF A;  2NTT A;  4DR5 Q;  5HGQ A;  4OWW B;  3GTG H;  3NPP A;  1VQP A;  5FO9 B;  1PRT F;  2E75 C;  2ID0 A;  2J0T D;  2JA5 G;  1ET6 A;  3NTI A;  1F9R A;  1NMF A;  3G4S A;  3E9H A;  4V0B A;  2K1B A;  2VXW A;  1EY9 A;  1GVP A;  2F0T A;  4A3M B;  4BXX G;  1VQG A;  3JAM i;  2PQA A;  4B9X A;  2F4V Q;  4IPD A;  4PNY A;  4X62 L;  4FF2 A;  1G6P A;  2EJG C;  2DGY A;  4JI4 Q;  2B8F A;  3FMC A;  2MPM A;  5C6A A;  1PDQ A;  4KJN A;  3NP8 A;  1I6H B;  4TVA B;  1PTO C;  3PUY A;  2K04 A;  4DK3 C;  2QF7 A;  1GUT A;  1BNZ A;  1PH5 A;  1XNR L;  3HOW H;  2B39 A;  3PO2 H;  4O2D A;  3SVM A;  1BO0 A;  1PFN A;  1KAB A;  3ICE A;  5T1I A;  3H0G H;  2KQ3 A;  4X65 Q;  4UP9 A;  1V43 A;  3DEO A;  1HA5 A;  4R8N A;  4DV5 Q;  2HDM A;  3KF8 B;  1PTO D;  4A3E G;  1AP0 A;  1UE7 A;  1QZG A;  3CW2 C;  1EZ6 A;  1H9K A;  2NZH A;  2ZTD A;  2K5V A;  3BG3 A;  3R93 A;  4RMF A;  1ESF A;  1BCP D;  4AYB B;  2WAC A;  2Q2I A;  3PUX A;  2A69 D;  3R2T A;  3AEV A;  2NWG A;  1F9S A;  2CW0 C;  1F77 A;  3HOY G;  4L5Q A;  1HA6 A;  1RDP D;  2GVA A;  3L9A X;  5CR3 A;  1Q1E A;  3FKI H;  5JJL A;  2ZXR A;  3AB9 A;  4A75 A;  1HJP A;  2AWN A;  3SK4 A;  3I4M H;  2FMM A;  2K52 A;  4DR6 Q;  2AQ3 B;  4GN4 B;  2YTX A;  1B2T A;  1AZP A;  2C5C A;  1L2F A;  1W3S A;  4U68 A;  2NN6 I;  3A5Z B;  4LUV A;  2EQS A;  4UAI A;  1WTH A;  5M5W B;  1HNZ L;  3QWN A;  5AJ3 Q;  3C1F A;  5COY A;  3W2D A;  1MIU A;  1KL9 A;  3ITP A;  3BU2 A;  3I4L A;  3WDN A;  1YHQ A;  1HFG A;  4CDD C;  1G6Z A;  2PMZ E;  3RZD B;  1IBL Q;  3CRK C;  2MHV A;  2BOS A;  5KNB A;  1DGS A;  3BDL A;  1R9T H;  4LF9 Q;  4OO1 G;  4BBR B;  2MUY A;  1IKL A;  1TS2 A;  4XIG S;  3T56 B;  5IT9 L;  5KND A;  3J7Z C;  1KDA A;  2K5Q A;  1Q8I A;  2YV5 A;  4BWG B;  2E2I H;  3T53 B;  1RTO A;  3DWQ A;  1B1Z A;  1PH3 A;  1Q1B A;  3IAY A;  1AFP A;  2VB3 X;  3HRZ C;  3VYT A;  3WWV A;  1ICF B;  1YHB A;  4DV7 L;  2E76 C;  3FHW A;  3NWT A;  1FNV A;  4LF7 L;  2A74 C;  3L7Z C;  4A3I B;  3MEF A;  2JXM B;  3M4O H;  5C3X A;  3P75 A;  5M3F H;  2SOB A;  2NVX B;  3BVM A;  1EQR A;  3A8K E;  1UE5 A;  1F2M A;  4K6D A;  4RA8 A;  2KEE A;  1XNQ Q;  2QGQ A;  4EGV A;  3H6M A;  3OIQ A;  3HG9 A;  3K57 A;  5COR A;  1SRO A;  3A54 A;  2CVR A;  2R7Z H;  2Z6K C;  4A4I A;  2N3S A;  3EN2 A;  1N34 L;  3HOW G;  3CME A;  1EYD A;  1SYC A;  1ZYR C;  3PO2 G;  4DU9 A;  3GTQ B;  1CUK A;  1SYE A;  3H0G G;  1EYG A;  1N33 L;  4ALP A;  1BKB A;  5C4J B;  1QCB D;  2CFM A;  4I65 A;  4XQQ A;  3TQY A;  3TP6 A;  2CHB D;  3GTM H;  1JJG A;  2D9U A;  1GJX A;  1ONL A;  2IX3 A;  1QNU A;  2JJQ A;  1E1T A;  2B2Y A;  4TSS A;  4EQO A;  2F0E A;  2SDF A;  4LF4 Q;  2KJX A;  3CMA A;  1T5E A;  3S16 B;  2L9H A;  4K5X A;  5FLX c;  2VZA A;  4XT3 B;  1L0W A;  3FKI G;  1QZH A;  4FXG C;  1JOQ A;  4JCV E;  3T4A C;  1XJV A;  3HOU H;  2VW9 A;  5FK9 C;  3I4M G;  4JI6 L;  5DLQ E;  4J8Q A;  4X66 L;  3TZU A;  3J7A F;  3D6W A;  1ZEQ X;  2LMC B;  4WJ3 M;  1K3B C;  4DAY A;  3G7L A;  4GKJ L;  5LHY 1;  4LFC L;  3CCQ A;  1Y1W B;  3I56 A;  3K7A H;  4YCV A;  1O7I A;  3TP5 A;  2RDH A;  1PVO A;  2DUD A;  2R93 H;  5C4X B;  1W6K A;  1D7Q A;  3TS0 A;  2SNS A;  4IZ8 A;  4YWL A;  4G4K A;  3L2P A;  3MAQ A;  1FYC A;  2I0Q A;  2WAQ B;  3TZD A;  1K8A C;  1Q86 C;  2ZJP A;  1LO5 D;  2N8N A;  1PRT C;  4CKE A;  3CCM A;  5GRO A;  1AH9 A;  1PZI D;  1VQD A;  3LGJ A;  3H15 A;  4MZ9 A;  4C1N K;  5GAD C;  4P74 A;  3DLL A;  5FO8 B;  4X3K A;  1EYA A;  5ELE A;  5ELO A;  1K73 C;  1WTW A;  3NWS A;  1CQV A;  2G9H D;  2RQX A;  2F0N A;  1CSP A;  1WJJ A;  2F0Q A;  2XRS D;  4H7B A;  3C2P A;  2NVY H;  2R92 H;  5D3I B;  1A3U A;  1NTG A;  4KKT A;  2KEC A;  2O5I C;  2MNA A;  2R7Z G;  2K33 A;  2EVB A;  5C44 B;  4A93 H;  4DXG A;  3CU7 A;  1C4Q A;  1GUN A;  3RZO B;  4RGN A;  5KEE A;  1K28 A;  2F3W A;  4GZY C;  1VQA A;  2DJF C;  3D6C A;  3MFY A;  1BBW A;  4GKK Q;  4K0K Q;  2CQO A;  2A73 B;  1M90 C;  2RHS B;  3RLO A;  3SK5 A;  1WD0 A;  1HNZ Q;  1E2W A;  3KF8 A;  4QMG A;  5D14 A;  4R1J A;  2CKZ B;  1YZ6 A;  3HOV H;  2E2J H;  1WCM B;  4DAM A;  1I3Q H;  4WFN 3;  1RL2 A;  3HGB A;  3OMC A;  4NKL A;  3PGZ A;  4JYA L;  4HTH A;  1L1O B;  1RF2 D;  2Z4H A;  3HOU G;  4TRD A;  4DUY L;  5IOD A;  1VQJ A;  3C46 A;  5LL6 S;  1A15 A;  1M4V A;  4FVM A;  1YJN A;  5M5Y B;  2JYO A;  2JN4 A;  2HQL A;  2MQH A;  4RWS C;  2O5J C;  3QOL A;  2PQA B;  4IUT A;  4DV7 Q;  1SND A;  4KV6 A;  2B63 B;  4A3D H;  5FLM H;  4LF7 Q;  2PZT A;  2AMC B;  3SDZ A;  4RHR A;  2R6G A;  3Q6S A;  1DD2 A;  4K5W A;  3VYR A;  4IUU A;  2Z8L A;  2EYO A;  1HNW L;  2R93 G;  1NMG A;  3GD7 A;  4L5T A;  1XTC D;  1EOV A;  4JI8 Q;  4DR2 L;  3MFG A;  5C0X H;  5IGB A;  4B3R Q;  3PCO B;  4OIK A;  2JA8 G;  1PZK D;  5IP7 H;  2DJG C;  2HCC A;  4K5V A;  2K5W A;  3Q24 A;  2EZV A;  3S14 H;  2E2H B;  1N36 L;  2IW3 A;  4IJL A;  3OIP A;  2K7V A;  1IBK L;  4DR7 L;  1PTO H;  3PSI A;  3K5N A;  1QUQ B;  4PQX A;  1HQR D;  3MA2 B;  2UUA Q;  1Q90 A;  4R9W A;  5GAH C;  4A3L H;  1LAB A;  4F8M A;  1TWH B;  1B7Y B;  5JVH 3;  1SXT A;  4GLA C;  4A76 A;  1YJ9 A;  2CQA A;  2VS1 A;  2B2V C;  2YYZ A;  1HTP A;  1WFQ A;  5KGU A;  1WTO A;  4JC0 A;  1GHK A;  5K36 H;  1UE1 A;  3OMG A;  5D65 A;  5GAE C;  1MJE A;  1TVX A;  4JI4 L;  2JA7 H;  1A2T A;  1RJT A;  1TWG H;  1BBU A;  2NYZ D;  1KC8 C;  4NMZ A;  1KDB A;  1O80 A;  3H3V C;  3S1R B;  2KA7 A;  1PYS B;  1I4P A;  4IPG A;  3J81 L;  1X56 A;  1C8C A;  1ICW A;  4OON A;  3I2Z A;  3KOJ A;  1S72 A;  3MXP A;  5FJ8 G;  3CRL C;  4DF7 A;  4KKS A;  1Y1V B;  3CCS A;  4JI6 Q;  5JAV A;  4X66 Q;  3BJU A;  1VF7 A;  2E74 C;  2PZW A;  2JEA I;  2QDL A;  4X3U A;  4DV5 L;  2F0W A;  1Y8P B;  4QCL A;  1IW7 C;  5IGE A;  1EEF D;  2WB1 G;  1Z47 A;  4QF4 A;  1LYL A;  2BA0 A;  3ULP A;  3OHX C;  3K7U C;  2A6E C;  3HFZ B;  3CD6 A;  4CDF C;  3PIO 3;  1SFO H;  4AQY L;  3T51 B;  1I4X A;  4R4O A;  3HOV G;  2R7D A;  5TSS A;  2A8V A;  3EIV A;  4JBJ A;  4JI3 Q;  4LUO A;  1S5E D;  2HIV A;  2YTY A;  4Q5V A;  1E3P A;  1D2B A;  5IOC A;  4DNR B;  3E0E A;  5J22 A;  1PH7 A;  3K59 A;  1CHQ D;  4N8X 1;  2AUJ D;  1CSQ A;  2F3I A;  1RIP A;  2CCZ A;  5EJW A;  1ASY A;  2L15 A;  3DM3 A;  2EIF A;  1OXT A;  3GV6 A;  2EYP A;  2KCM A;  2KED A;  4KK7 A;  1YNX A;  3SGI A;  4A3D G;  3CPW A;  5FLM G;  2EDG A;  4JI0 Q;  1W6J A;  4J6H A;  3L0O A;  5JEA H;  2OT2 A;  3J81 E;  4DAP A;  1VQK A;  3R2I A;  1IKM A;  2I5L X;  3PV0 A;  4DR1 L;  4CKC A;  2YU9 B;  3GTP H;  4LWC A;  2IHE A;  4HSP A;  2FIN B;  3IRB A;  3N6R A;  4WRD A;  5CV5 A;  3S15 B;  5M3M H;  4LF9 L;  5IYC H;  3S1M B;  5J39 A;  5C0X G;  2MO1 A;  2OXP A;  3IL8 A;  3BZD B;  4ZK9 B;  1KNE A;  1D5X C;  3RLF A;  5IP7 G;  1SJH D;  3FDT A;  2WII B;  3WOF A;  4EQ5 A;  1YNN C;  3CP0 A;  4A3K H;  3GP7 A;  1FD7 D;  1ZXT A;  2F0F A;  5CBA E;  3TP7 A;  3FVQ A;  1AE3 A;  3PO3 H;  1U0L A;  2VB2 X;  3S17 B;  1K9M C;  4B08 A;  4IUN A;  3TRZ A;  1EWC A;  4HN7 A;  4GN5 A;  4JOI A;  1STE A;  3HOZ B;  1K0R A;  2V1C C;  2EJF C;  3MEH A;  4QL5 A;  5EBD A;  5K36 G;  4GOP B;  1JJC B;  2NBF A;  4DR3 L;  3S2H B;  1KLU D;  1TWA B;  1TU2 B;  1U4M A;  2JA7 G;  4A3G H;  4A3J B;  4CKB A;  3NK9 A;  1VQF A;  4A3F H;  5IYB H;  1CZG A;  2JSO A;  1HNX L;  4JYA Q;  3GQB A;  4KN4 C;  4DUY Q;  1DOM A;  3TME A;  1CM9 A;  1IYJ B;  4ZRZ A;  2BDN A;  4X3T A;  1NE3 A;  1JOO A;  4IUP A;  3Q23 A;  1ENF A;  1EWH A;  1EOT A;  1JWS D;  2Q2H A;  4H44 C;  5GQO A;  5IP9 H;  5E4W C;  1KRT A;  1LTA D;  4C3J H;  4C56 C;  2HCI A;  1JIC A;  1RD9 D;  4IPH A;  3RNU A;  1TT2 A;  2B2W A;  2EPB A;  4LF4 L;  1BCP B;  1AW7 A;  1XWE A;  3NQT A;  4OO1 I;  4B3T L;  3BVZ A;  1HNW Q;  4PZ7 A;  3M4P A;  4OO1 H;  4DR2 Q;  3DM1 A;  1SMX A;  2EY2 A;  1JJ2 A;  3J80 c;  1LUZ A;  1N36 Q;  4P71 A;  4PMW A;  4DR7 Q;  1IBK Q;  4DV3 L;  1IL8 A;  1ET9 A;  1SE3 A;  1A3V A;  1VMP A;  3GTQ H;  1L1O A;  1EFI D;  4C3H H;  1I4G A;  2IT1 A;  3ER0 A;  3PUW A;  1EQQ A;  2WP8 J;  3NSW A;  1CT1 D;  1FNU A;  1WTQ A;  1JE5 A;  4YHH L;  5JEA G;  1MHW C;  1PFM A;  3CCV A;  3VA7 A;  1WTP A;  3I4N B;  1CKM A;  4RGM A;  4FDB A;  2RA4 A;  1NAP A;  3HKZ E;  2OWO A;  1ESR A;  2K4K A;  4JBW A;  2EE1 A;  5CMD A;  5M3M G;  1H9S B;  3STB C;  3G71 A;  5IYC G;  4OWT B;  1HHV A;  3EA6 A;  1EIY B;  3BYY B;  3P1H A;  1AE2 A;  2X6L A;  3OYY A;  1TXY A;  2HHH L;  5EKL A;  5LL6 X;  1V8Q A;  4A3K G;  2Q8I B;  1I50 H;  1X55 A;  3HOX H;  1NBW A;  4GLX A;  3OWE B;  1X32 A;  1YNJ C;  2EYF A;  3A5U A;  2KEN A;  2RBM A;  1YHA A;  3STB D;  3PO3 G;  3K5M A;  1VDZ A;  3P20 A;  1IYV A;  4KHZ A;  1QUQ A;  2NZO A;  3E9I A;  4RKL A;  1A62 A;  4GNX C;  5EPK A;  3OPO A;  3VDY A;  2FJ2 A;  2TMP A;  5E3F A;  2HD3 A;  4AQY Q;  4A3G G;  2JA5 B;  3M9B A;  1KLG D;  4JI1 L;  3QJY A;  4P2C B;  1TWF B;  3S1N B;  2D62 A;  4ZUJ A;  4A3F G;  5IYB G;  3CCE A;  4TKO B;  1GOZ A;  2IWH A;  4C3I H;  5FOB B;  2HIX A;  4DV4 Q;  1O7Z A;  3KJO A;  3V96 A;  2L55 A;  3D31 A;  3MXG A;  5ELC A;  2A6H C;  1MJC A;  2CW0 D;  1GUO A;  5KIX A;  5ISR A;  4GKK L;  4AYB E;  3T1Y L;  4K0K L;  4H02 A;  5IP9 G;  4YY3 Q;  4HID A;  2QEX A;  4APV A;  4B3S Q;  2VUM H;  1T5X D;  3NBI A;  2NVT B;  5JEA J;  4L5S A;  1JC7 A;  1J9O A;  2M9V A;  4C3J G;  1BF4 A;  4QQB X;  3CCU A;  1U9R A;  2Y0S B;  1JOR A;  1VQM A;  2EJM A;  2A6H D;  4C2M B;  4DR1 Q;  1PH9 A;  1VMC A;  1IZ6 A;  2AUK A;  1QWY A;  5C5M A;  4BBS B;  1Y8O B;  2A5H A;  4IO9 A;  2B2T A;  4A3E B;  1BOS A;  3DWP A;  5EQ0 A;  3RN2 A;  4IUV A;  5NUC A;  2RKS A;  3I90 A;  2B29 A;  1QG7 A;  4KD3 A;  1LV9 A;  2PI2 A;  1Q46 A;  2ZXP A;  1TWC H;  1HTL D;  1I4H A;  4NXN L;  1TR5 A;  3VYU A;  2GVB A;  3HOY B;  2ZXO A;  4C3H G;  4IJH A;  4F88 A;  1H9M A;  3JAM L;  5DM6 3;  1L0X B;  1OXS C;  2Y0S E;  4N9T A;  5C3E H;  4IOA A;  4RFB A;  1PFS A;  1D1K A;  4CJ2 C;  3W5O A;  5EPJ A;  1IBM L;  1B44 D;  4MHE A;  4NP5 A;  4FXD A;  2K5D A;  2P5Z X;  4GLV B;  3AU7 A;  1O7L A;  4DR3 Q;  3BZC A;  2IPK D;  5L37 A;  2LXJ A;  4JI8 L;  1IYU A;  3NEM A;  3PIP 3;  1LTG D;  4UDU C;  2BH8 A;  4Y7N B;  2C35 B;  1P8L A;  3EQL C;  4B3R L;  4U67 3;  2H5X A;  1F9P A;  3GTJ H;  2A68 C;  5FLX L;  4WJW A;  3H3V I;  3VR6 A;  1Z7T A;  2IX1 A;  1HNX Q;  1ROD A;  4IN3 A;  3H3V H;  5LMU Q;  1CHP D;  3KF6 A;  3K81 C;  4HJ7 A;  3HOX G;  4ZYS A;  3F2B A;  1IHZ A;  2UUA L;  2UU9 Q;  2LS0 1;  1Q12 A;  3TDQ A;  3JAM c;  2Z4I A;  1VQL A;  3GTO H;  4DNT B;  1MGS A;  1GUW A;  5M5X H;  1LAC A;  2MJ8 A;  4DUZ L;  5IT9 E;  2F0S A;  2X69 A;  3TBI B;  4IPC A;  1DOK A;  1X3G A;  3GTG B;  4HMI A;  2PNH A;  1ZYR D;  3D3R A;  5A2Q L;  3G6J B;  2D2C C;  1VQC A;  4JW0 A;  3RN5 A;  4JV5 Q;  1VQ5 A;  1WYD A;  3PUV A;  1NR2 A;  4B3T Q;  2ZJQ A;  2HUG A;  4GOP A;  1K8O A;  2SNM A;  1EUJ A;  1WTX A;  5J1Z A;  4C3I G;  1CI3 M;  1S40 A;  5JVG 3;  4TQU S;  4YWK A;  1ILQ A;  2NVQ H;  1N9W A;  3E6Z X;  3A55 A;  1KDC A;  4DV3 Q;  4A3B B;  3MVV A;  1DOL A;  5JJZ A;  4IUR A;  2B8G A;  4N8F A;  5JPM C;  3CF5 A;  5IGD A;  2VUM G;  5FLX E;  1KHI A;  2IHF A;  2Z6B A;  2FMC A;  2CH4 A;  4DXF A;  1LTT D;  3HOW B;  4YHH Q;  2OQ0 A;  3J7Y W;  5IGG A;  1G51 A;  5G3L F;  4HCE A;  5BR8 Q;  3HEJ A;  4JI3 L;  3V05 A;  4HIK A;  2OTL A;  1EY0 A;  5I6Y A;  5DEH A;  1SYB A;  1SEB D;  2OF1 A;  3T13 A;  1HZC A;  5I2Y A;  2JA8 H;  4G7O C;  1YIT A;  3S1R H;  4IUQ A;  4AIM A;  2HHH Q;  3QR8 A;  4KHP L;  5LMN W;  3AFP A;  1O7Y A;  3LX0 A;  1HUM A;  2EYL A;  2N49 A;  5A2Q E;  1XPO A;  4K2K A;  3M3Y H;  1YI2 A;  1EQT A;  4ZAI A;  3FKI B;  5C3E G;  4JI0 L;  3U4Z A;  3H09 A;  4OIJ A;  3S2D H;  4P73 A;  1HZA A;  4RHS A;  3I4M B;  1ENC A;  2QEJ C;  4FO2 A;  3ONA B;  4CJ0 B;  4LW1 A;  5I4D A;  1K83 H;  1VQH A;  1LT3 D;  2PYK A;  2XRQ D;  4HR7 B;  1PRT D;  4JI5 Q;  4IOC A;  2EOT A;  1UE6 A;  4JI1 Q;  3NTK A;  1FJG Q;  3OTO Q;  2WAQ E;  4PMB A;  1VQ7 A;  3ERS X;  4DKA C;  4XT1 B;  4OGQ C;  1H9S A;  5FJ8 H;  1XMQ Q;  2OEO A;  1VQ9 A;  4R4Q A;  1LTR D;  2JQO A;  2K50 A;  2LSS A;  4ZLT F;  3CQZ B;  3QO2 A;  4LUZ A;  4PV1 C;  1KQS A;  1R9T B;  4UHV A;  4F87 A;  3G6E A;  4R4T A;  5E7N A;  5CGK A;  4ZQ3 A;  2ALY B;  1II3 A;  3T1Y Q;  2JA6 B;  3A7L A;  5IIF A;  1X54 A;  4XXE A;  1HXY D;  1FNW A;  2F0G A;  3BYT B;  2E2I B;  3U9O A;  3VA5 A;  4G57 A;  2JA9 A;  3D4R A;  3BS1 A;  2NTS A;  5ELN A;  4RCO A;  1CFM A;  1HQM C;  1TS5 A;  4IAL A;  3URY A;  4RAU C;  2BCO A;  3J81 i;  3X3N A;  1ZKO A;  1Q82 C;  3Q22 A;  3U4V A;  5M9O A;  1CTM A;  2F0J A;  4L63 B;  4H0L C;  2J4X A;  4DPG A;  2AKW B;  5C3W A;  3M4O B;  5M3F B;  1J6Q A;  1SNO A;  1A8V A;  1A6X A;  1GM5 A;  1L0Y B;  1EWI A;  4NXN Q;  1MKH A;  2FXQ A;  2ZJR A;  4R8I A;  3D4D A;  2ICI A;  2R7Z B;  1F2L A;  4O1N A;  4BY1 H;  4ILW A;  3SEB A;  2NZ1 D;  1DON A;  4OEM B;  1IBM Q;  4V19 0;  2HT1 A;  2N55 A;  3S1Q B;  1D5M C;  3BDO A;  4LJZ C;  3SXH A;  4YIJ A;  3S9W A;  1SNQ A;  3U50 C;  5C0X I;  2X6G A;  5AFW A;  1WTV A;  1JQY D;  3GTM B;  4IFD H;  2I07 B;  1LT4 D;  2Z9H A;  1S4Z A;  3PF5 A;  1K0S A;  3A56 A;  2CWA A;  4R4I A;  5HUR A;  2TSS A;  4BY7 H;  4WJ4 A;  3GTL H;  5E4X A;  2HDL A;  3FPP A;  4RH6 A;  1XX8 A;  4H13 C;  4ID6 A;  2OTJ A;  3GTK B;  4FXK C;  3E5S A;  3VR4 A;  2KUM A;  2B2W C;  4LF8 L;  3HOU B;  3MC0 B;  2UUB Q;  3PIO A;  2F1M A;  5CV7 A;  2Q2T A;  3U58 A;  4DUZ Q;  2YTV A;  3K5O A;  1VQN A;  1BCP F;  1SE2 A;  2K6A A;  2RCN A;  1HUN A;  3UE1 A;  3F1Z A;  3W1G A;  4QUF A;  1DJR D;  1L1O C;  2K14 A;  1LTI D;  3K7A B;  5I6W A;  5CYU A;  3KFU A;  1BXT A;  1JMC A;  5EGT A;  2DNE A;  3EFX D;  2R93 B;  3KLR A;  3DMU A;  2I46 A;  2F0V A;  2UXB L;  3H94 A;  1F2Z A;  1X3P A;  1HZ9 A;  2K05 A;  3D4W A;  2F0D A;  4CDE C;  1UAP A;  2XVS A;  2ZTE A;  5T1G A;  2KVM A;  4AH6 A;  1KXL A;  4A3M H;  3I4N H;  4Y52 H;  1BR9 A;  1SYG A;  1WTR A;  3BVG A;  3KUP A;  1SAP A;  1RKN A;  4KY6 A;  3KLW A;  5IE8 A;  1IW7 D;  2R61 A;  1V1P A;  2F4I A;  1XXG A;  3F2D A;  3T1H Q;  4G7H C;  4DV4 L;  2A6E D;  1I6H H;  3A8J E;  3I7F A;  3A0J A;  1LTL A;  2EY5 A;  1HR0 Q;  1QVC A;  3NBH B;  2PPB C;  4KHP Q;  2L4N A;  2F0I A;  4MIU A;  2A19 A;  1QVF A;  2EY6 A;  2R7F A;  4KMU C;  4YY3 L;  5IY0 A;  2NVY B;  2R92 B;  4B3S L;  1H95 A;  4BY1 G;  2F03 A;  2PW5 A;  4A93 B;  3CXC A;  2ICE C;  2K01 A;  2PI2 E;  1C0A A;  1QE6 A;  5CV4 A;  3OW7 A;  1QB5 D;  4IQZ A;  5KNC A;  4ZKC B;  4LF5 L;  2B2U A;  3KF6 B;  1E7Z A;  2O4X A;  1STA A;  3M7N A;  4IFD G;  2EYJ A;  4RG1 A;  2WB1 B;  1V1Q A;  5CV9 A;  5LMN L; 
#chains in the Genus database with same CATH homology
 3PO3 G;  3HOZ H;  4OWX B;  1SE8 A;  4BY7 G;  1HH2 P;  3S24 A;  4JI7 Q;  3CMA A;  4LF4 Q;  4KHZ A;  1I94 Q;  4DV1 L;  4QGU A;  1QUQ A;  2NZO A;  4IFD I;  3E9I A;  2KBN A;  1A62 A;  5FLX c;  3S2H H;  1TWA H;  2VZA A;  4KI0 A;  3J81 j;  1L0W A;  4LNQ A;  3FKI G;  4GNX C;  1QZH A;  4JCV E;  4HJ9 A;  1XJV A;  3HOU H;  3VDY A;  3ULL A;  2VW9 A;  4A3J H;  2Z6K A;  3I4M G;  1K8G A;  2ZM6 Q;  4AQY Q;  4A3G G;  4X6A H;  3M9B A;  4JI6 L;  4JI1 L;  4QY7 A;  5DLQ E;  4X66 L;  4A3C H;  1XPR A;  2XGT A;  1KAW A;  1A0I A;  2D62 A;  3UE0 A;  4A3F G;  5IYB G;  1PH6 A;  5M5W H;  1CKN B;  2VQE Q;  3CCE A;  4GS3 A;  2UXD Q;  3TRE A;  1Y1V G;  4C3I H;  4WJ3 M;  1SRU A;  2HIX A;  3A74 A;  4PG3 A;  4DV4 Q;  3KJO A;  1PH8 A;  3CC4 A;  4GKJ L;  3D31 A;  3RZD H;  4LFC L;  3CCQ A;  3I56 A;  1MJC A;  3K7A H;  4YCV A;  1OXU A;  4BBS H;  1O7I A;  4DR5 L;  4BA1 I;  4GKK L;  4AYB E;  4BBR H;  3T1Y L;  4K0K L;  1PVO A;  2OQK A;  2DUD A;  3HKZ G;  1NY4 A;  4H02 A;  4UPA A;  5IP9 G;  4APV A;  4YY3 Q;  2QEX A;  5LMU L;  4NB3 A;  4HIM A;  1N34 Q;  3W1B A;  3KDF B;  4B3S Q;  3TS0 A;  2UU9 L;  4HID A;  3K8A A;  5JEA J;  4L5S A;  4QQB X;  2MO0 A;  3CCU A;  4YWL A;  2VUM H;  1VQM A;  3L2P A;  1N33 Q;  3CCJ A;  1T9H A;  4OX9 L;  2IX0 A;  4DR1 Q;  1PH9 A;  2I0Q A;  1IZ6 A;  1M1K C;  1XPU A;  3CAM A;  1V9P A;  1K8A C;  1Q86 C;  4IO9 A;  2ZJP A;  2K5H A;  2F4V L;  2N8N A;  2D0O A;  3CCM A;  3KJP A;  3RN2 A;  1VQ6 A;  3CCR A;  5GRO A;  2B29 A;  4DK6 C;  1PA6 A;  1AH9 A;  3LGJ A;  1VQD A;  4A3M G;  4JBK A;  3I4N G;  4A3I H;  3H15 A;  4JV5 L;  4QJF A;  2PI2 A;  4MZ9 A;  5GAD C;  1Q46 A;  4J15 A;  4LFA L;  3UDF A;  1VQ4 A;  4DV1 Q;  1FGU A;  1TWC H;  3AQQ A;  3GO5 A;  4P74 A;  1P16 A;  3DLL A;  2NVX H;  2R92 G;  4NXN L;  4DV2 Q;  2GVB A;  1FL0 A;  1VQO A;  3I4O A;  4IJH A;  5ELO A;  5C0X J;  1K73 C;  4O0A A;  1X3F A;  4B3M Q;  4DR4 Q;  4A93 G;  1OXS C;  2Y0S E;  1X3E A;  5C3E H;  5IYD H;  4IOA A;  1CSP A;  2VY3 A;  1WJJ A;  1Y14 B;  1PFS A;  1YJW A;  3W5O A;  4X65 L;  2K75 A;  1IBM L;  2NVY H;  2R92 H;  1NTG A;  1J5E L;  1HR0 W;  2R7Z G;  4ME3 A;  2MNA A;  1E22 A;  4GLV B;  4A93 H;  3M85 A;  3BZC A;  4OXP A;  3ULJ A;  4DR3 Q;  2LXJ A;  4RG1 A;  4YCW A;  3J80 i;  4JI8 L;  3CC7 A;  3NEM A;  4LF8 Q;  4GKJ Q;  2BH8 A;  4GN3 B;  5C4J H;  2C35 B;  1P8L A;  4B3R L;  1VS0 A;  2H5X A;  3AYH B;  3GTJ H;  2E5L L;  4GOP C;  4YCU A;  4LFC Q;  1VQA A;  1LM0 A;  3F8T A;  3H3V I;  2Z0S A;  1WOC A;  2IX1 A;  4X64 Q;  1BBW A;  5BR8 L;  1HNX Q;  3JC6 6;  3HKS A;  4GKK Q;  2MFI A;  4AYB G;  4K0K Q;  3H3V H;  2EXD A;  2CQO A;  5LMU Q;  4R4C A;  3KF6 A;  3K81 C;  4HJ7 A;  3HOX G;  1B70 B;  3F2B A;  3OW2 A;  1M90 C;  2AWO A;  2RHS B;  2UUA L;  2UUC L;  2UU9 Q;  3RLO A;  1HNZ Q;  3J81 c;  1Q12 A;  3JAM c;  1VQL A;  3HOZ G;  4DR6 L;  3S16 H;  3GTO H;  4R1J A;  2CKZ B;  1YZ6 A;  5M5X H;  2E8G A;  2E2J H;  4OX9 Q;  3HOV H;  4DAM A;  1I3Q H;  5J3B A;  4LFB L;  1RL2 A;  4DUZ L;  3PGZ A;  2KCT A;  4JYA L;  4IPC A;  2JA5 H;  1X3G A;  1PHJ A;  1L1O B;  3HOU G;  2PNH A;  4YWM A;  4UP7 A;  4PZ6 A;  4DV0 Q;  4DUY L;  4A3J G;  1TWF H;  3S1N H;  1VQJ A;  2UXB Q;  5AJ3 L;  1VQC A;  2OCE A;  3RN5 A;  4A3B H;  4JV5 Q;  4A3C G;  1VQ5 A;  1YJN A;  4NXM L;  1WYD A;  3PUV A;  1PV4 A;  4LFA Q;  4B3T Q;  1JT8 A;  4BXX H;  2HQL A;  4NPS A;  2ZJQ A;  4GOP A;  1X65 A;  1IBL L;  1KD1 C;  2I5M X;  3RR5 A;  2VNU D;  2MQH A;  1EUJ A;  2PQA B;  2BA1 A;  4DV7 Q;  4A3D H;  1S40 A;  4DNI A;  1Y1W H;  4JI5 L;  5FLM H;  2Y0S G;  4TQU S;  4LF7 Q;  1OXX K;  1PH1 A;  2AMC B;  4YWK A;  3TS2 A;  2NVQ H;  1FJG L;  2R6G A;  1N9W A;  1V1Q A;  3OTO L;  5C4X H;  3D0F A;  5LMN L;  4DV3 Q;  4KLK A;  4DV6 L;  4BBS G;  1J5E Q;  2NVT H;  4BBR G;  1N32 L;  3CF5 A;  1HNW L;  2WB1 E;  1I5F A;  4HIO A;  1NMG A;  2R93 G;  2JK8 A;  3KDF A;  4HJ5 A;  3GD7 A;  4L5T A;  1B8A A;  2VUM G;  1KHI A;  2IHF A;  1EOV A;  4JI8 Q;  1XMQ L;  1JB7 A;  2UXC L;  1E1O A;  2QA4 A;  4DR2 L;  2AHO B;  4A3L G;  4C2M H;  4YHH Q;  4B3R Q;  1GO3 E;  2OQ0 A;  4HJA A;  3BZK A;  2E5L Q;  3PCO B;  2JA8 G;  1FVI A;  5IP7 H;  3UDG A;  1G51 A;  3S14 H;  1N36 L;  4IJL A;  4A3E H;  5BR8 Q;  1EFW A;  4HIK A;  4JI3 L;  1IBK L;  4QIW E;  2ASB A;  1VQE A;  3PSI A;  2OTL A;  4DR7 L;  1QUQ B;  2VQF L;  1KIX A;  2UUA Q;  2UUC Q;  5GAH C;  4A3L H;  1HZC A;  3CPF A;  5JJK A;  1B7Y B;  2JA8 H;  4LF6 L;  1CKO A;  4GLA C;  3PIP A;  4A76 A;  1YJ9 A;  1YIT A;  1XNQ L;  3S1R H;  2VS1 A;  4AIM A;  4A3I G;  2YYZ A;  3HOY H;  2HHH Q;  2IY5 B;  4KHP L;  1U5K A;  3UDX A;  5LMN W;  3AFP A;  3FP9 A;  1WFQ A;  2R93 H;  4LFB Q;  2VL6 A;  5HY6 A;  4JC0 A;  4LF5 Q;  2N49 A;  1UE1 A;  4XTC S;  3CCL A;  1XPO A;  3Q8D A;  3M3Y H;  1YI2 A;  2XTI A;  5GAE C;  5LMN Q;  5C3E G;  1XMO L;  4MNO A;  4EX5 A;  3U4Z A;  4DAY B;  5IYD G;  1MJE A;  4JI0 L;  1TWG H;  4JI4 L;  1BBU A;  5C44 H;  3S2D H;  4P73 A;  1HZA A;  3CC2 A;  1KC8 C;  3K0X A;  3RZO H;  3ZJY C;  3B6Y A;  2ZTC A;  1WI5 A;  1YBY A;  1PYS B;  4IPG A;  1X9N A;  4IFD J;  4Y7N H;  4LW1 A;  1X56 A;  1ASZ A;  2BH2 A;  1K83 H;  1PYB A;  1VQH A;  4OON A;  3I2Z A;  3KOJ A;  1QVG A;  1S72 A;  3CQZ H;  5FJ8 G;  4JI5 Q;  1OXV A;  4IOC A;  4L5R C;  3EBE A;  2WFW A;  3CCS A;  4JI6 Q;  1UE6 A;  2KHI A;  4JI1 Q;  4P75 A;  4X66 Q;  3BJU A;  3K80 C;  1FJG Q;  1X6O A;  3OTO Q;  1N8R C;  2JA6 H;  2WAQ E;  4PZ8 A;  4GNX B;  4DV5 L;  4HJ8 A;  1VQ7 A;  2JEA I;  3ERS X;  1YIJ A;  5IWA L;  3G48 A;  1VQI A;  4DKA C;  2WB1 G;  1Z47 A;  5FJ8 H;  1LYL A;  2BA0 A;  3ULP A;  1XMQ Q;  2UXC Q;  3K7U C;  1G29 1;  3HFZ B;  1VQ9 A;  3CD6 A;  4R4Q A;  2JQO A;  2LSS A;  2K50 A;  4JI2 L;  1WCM H;  1SFO H;  4LUZ A;  1NJI C;  3TEH B;  2ZM6 L;  4AQY L;  1KQS A;  3G6E A;  3PF4 A;  4R4T A;  5E7N A;  1IL2 A;  4POF A;  1A63 A;  4R4O A;  4DR5 Q;  2ALY B;  2R7D A;  5HGQ A;  4OWW B;  3GTG H;  1HZB A;  2A8V A;  3T1Y Q;  3EIV A;  3AFQ A;  1VQP A;  4JBJ A;  4JI3 Q;  4LUO A;  1X54 A;  2HIV A;  2ID0 A;  2YTY A;  1E3P A;  2VQE L;  1C7Y A;  3E0E A;  1PH7 A;  2JA5 G;  1Q7Y C;  1NMF A;  5M5Y H;  2LXK A;  1CSQ A;  2F3I A;  2JA9 A;  3G4S A;  3E9H A;  5ELN A;  1PH4 A;  1RIP A;  1GVP A;  2CCZ A;  4A3B G;  2UUB L;  1ASY A;  2L15 A;  3DM3 A;  2EIF A;  1OXT A;  5IT9 c;  2KCM A;  4POG A;  2N78 A;  4BXX G;  2B63 H;  1VQG A;  3J81 i;  3JAM i;  1VCI A;  2PQA A;  3M4Q A;  2F4V Q;  4IPD A;  4X62 L;  1Q82 C;  1YNX A;  3SGI A;  3U4V A;  1VQ8 A;  3CPW A;  1Y1W G;  5FLM G;  4A3D G;  1G6P A;  3RLN A;  3PUZ A;  2DGY A;  4DPG A;  4JI0 Q;  2AKW B;  1XMO Q;  4JI4 Q;  3L0O A;  1YVC A;  1J6Q A;  3S1Q H;  1VQK A;  2ES2 A;  1SN8 A;  4TVA B;  1A8V A;  3PUY A;  2K5N A;  1GM5 A;  5C4X G;  1EWI A;  1CKN A;  2I5L X;  3PV0 A;  1MKH A;  4DR1 L;  2FXQ A;  4DK3 C;  4NXN Q;  2ZJR A;  3GTP H;  1PH5 A;  4LWC A;  2IHE A;  1XNR L;  3IRB A;  3HOW H;  3PO2 H;  4O2D A;  4BY1 H;  5M3M H;  4LF9 L;  3ICE A;  5IYC H;  4JBM A;  3H0G H;  5C0X G;  2E2H H;  3F2C A;  2MO1 A;  4X65 Q;  3J7A 5;  4UP9 A;  1V43 A;  1IBM Q;  4UP8 A;  2HT1 A;  1UWV A;  2WAQ G;  3RLF A;  4MTN A;  5IP7 G;  4DV5 Q;  3KF8 B;  3GTK H;  5IWA Q;  4EQ5 A;  1VQB A;  4A3E G;  3CP0 A;  4A3K H;  1D8L A;  2CWP A;  1UE7 A;  3U50 C;  1TWH H;  3CW2 C;  5C0X I;  1QZG A;  2NZH A;  4DV2 L;  2ZTD A;  2K5V A;  1YEZ A;  4RMF A;  4B3M L;  4DR4 L;  2KHJ A;  2Q2I A;  3PUX A;  1AE3 A;  5GAG C;  4JI2 Q;  3PO3 H;  1U0L A;  3AEV A;  1K9M C;  3PF5 A;  2CWA A;  4R4I A;  3KYH C;  3TRZ A;  4BY7 H;  4WJ4 A;  3GTL H;  3HOY G;  4L5Q A;  4GN5 A;  4JOI A;  1K0R A;  1K3R A;  2GVA A;  2OTJ A;  2V1C C;  1C9O A;  1Q1E A;  3FKI H;  4QL5 A;  5K36 G;  5JJL A;  4GOP B;  1JJC B;  3T1H L;  4DR3 L;  4A75 A;  1HJP A;  2AWN A;  2NN6 G;  3I4M H;  4LF8 L;  1Z9F A;  2K52 A;  2JA7 G;  4DR6 Q;  4A3G H;  1HR0 L;  4GN4 B;  1W2B A;  5C44 G;  3PIO A;  2UUB Q;  1E24 A;  2YTX A;  3U58 A;  2Q2T A;  4DUZ Q;  2YTV A;  1VQF A;  1L2F A;  4A3F H;  5IYB H;  1W3S A;  2NN6 I;  3A5Z B;  4X64 L;  1HNX L;  1VQN A;  4JYA Q;  3NEL A;  1SR3 A;  1Y1V H;  4LUV A;  1S3O A;  4X62 Q;  1OTC A;  2RCN A;  2EQS A;  1BVS A;  4DUY Q;  3UE1 A;  3F1Z A;  1SLJ A;  3W1G A;  1HNZ L;  5AJ3 Q;  4BA2 I;  2I5H A;  1IYJ B;  1MIU A;  1KL9 A;  4NXM Q;  3BU2 A;  4GNX A;  1NE3 A;  1L1O C;  2JA6 G;  1YHQ A;  2PMZ E;  2K14 A;  1IBL Q;  2Q2H A;  5GQO A;  5IP9 H;  1XNR Q;  3GDE A;  3KFU A;  1DGS A;  2RF4 A;  1R9T H;  1JMC A;  4LF9 Q;  1KRT A;  4OO1 G;  4XIG S;  3J7Z C;  4C3J H;  1D7Q A;  4DV0 L;  1WCM G;  4IPH A;  2UXB L;  3RNU A;  3I55 A;  4DV6 Q;  2YV5 A;  1PH2 A;  1HZ9 A;  2E2I H;  4JI7 L;  4LF4 L;  1I94 L;  4OO1 I;  4B3T L;  1N32 Q;  1HNW Q;  4PZ7 A;  1Q1B A;  1PH3 A;  4UY8 C;  3M4P A;  5H1S E;  3WWV A;  1YHB A;  4DV7 L;  2D0P A;  2ZTE A;  4DR2 Q;  5M3F G;  1SMX A;  1GKH A;  3FHW A;  4AH6 A;  1KXL A;  4LF7 L;  4A3M H;  3MXN B;  3I4N H;  1JJ2 A;  4Y52 H;  3J80 c;  1LUZ A;  2F52 A;  1N36 Q;  3L7Z C;  2JE6 I;  4P71 A;  4PMW A;  4DR7 Q;  1IBK Q;  4DV3 L;  2B63 G;  3KLW A;  5IE8 A;  3MEF A;  3GTQ H;  1L1O A;  4C3H H;  2VQF Q;  2UXD L;  2IT1 A;  3ER0 A;  3PUW A;  3M4O H;  3T1H Q;  3F2D A;  5M3F H;  1EQQ A;  2WP8 J;  2B3G A;  1KRS A;  4DV4 L;  1EQR A;  4LF6 Q;  1I6H H;  1UE5 A;  3I7F A;  1XNQ Q;  3A0J A;  1LTL A;  1JE5 A;  2QGQ A;  4YHH L;  5JEA G;  1HR0 Q;  1QVC A;  3NBH B;  2YU9 H;  3CCV A;  4KHP Q;  2GN5 A;  5JJI A;  3UDI A;  1SRO A;  1CKM A;  1Q81 C;  4FDB A;  2R7Z H;  3S15 H;  2A19 A;  3HOV G;  1UEB A;  2Z6K C;  1QVF A;  4A4I A;  2R7F A;  3HKZ E;  4YY3 L;  1IXR A;  2N3S A;  3EN2 A;  2K4K A;  5IY0 A;  3CME A;  1N34 L;  2OWO A;  4B3S L;  4JBW A;  3HOW G;  3S1M H;  3PO2 G;  1H95 A;  2JEB I;  4BY1 G;  5M3M G;  4JOI C;  1Q8K A;  3STB C;  3G71 A;  5IYC G;  4OWT B;  3CXC A;  1CUK A;  3H0G G;  1EYG A;  2PI2 E;  1N33 L;  3STB D;  1EIY B;  1C0A A;  2JA7 H;  4ALP A;  1AE2 A;  3NEN A;  1BKB A;  2A1A A;  3OYY A;  1TXY A;  2ATW A;  2CFM A;  2HHH L;  3TQY A;  4P72 A;  3GTM H;  4A3K G;  1JJG A;  1I50 H;  1GD7 A;  1X55 A;  1XTD A;  3HOX H;  2Q2U A;  1NBW A;  4JG2 A;  4GLX A;  3KF6 B;  4LF5 L;  3S17 H;  3A5U A;  1E7Z A;  2RHQ B;  1EIF A;  3M7N A;  2KEN A;  4IFD G;  1YHA A;  2JJQ A;  1E1T A;  5EAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...