4LFBM

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lfbM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lfbM02
4JI6M 1HNXM 5ITYA 5FLXS 3GP1A 4LF6M 1FJGM 5IT9S 3SARA 3SAVA 2HHHM 2E5LM 4G4QA 1HR0M 1XMOM 3T1HM 1XNRM 2UUCM 5ITXA 4DV3M 3OTOM 4ITQA 4NXMM 5ITUA 1IBMM 3GPUA 1XC8A 3C58A 4DR7M 2EA0A 4MB7A 4LFBM 4JI4M 1N32M 1Z5CA 1N36M 4B3SM 3A46A 4CISA 2Q2EB 3JR4A 3U6CA 2UXDM 3JR5A 3SAUA 3SAWA 1K3WA 1MX0A 3A42A 3DOAA 1NNJA 1Q3BA 3J80S 2F5QA 1TDHA 4LFAM 2OPFA 1J5EM 3TWLA 3U6QA 1XNQM 4B3MM 5ITXE 2ZBKB 4X62M 2UUAM 4DV0M 4JI3M 4G4OA 4LF5M 4JYAM 1K82A 2UUBM 4DV6M 2F5OA 4JI5M 4DV2M 1EE8A 1KFVA 3VK7A 2F5PA 3U6DA 1N33M 1Q3CA 4PCZA 4B3TM 4B3RM 4G4RA 5ITTA 1XMQM 4X64M 3GQ3A 1Z59A 1I94M 3J81S 4LF7M 4PDIA 1K3XA 4JI7M 2UU9M 4DR4M 4X65M 2VQEM 4PDGA 4DV4M 4DV7M 3U6EA 1L1ZA 4K0KM 2F5SA 2OQ4A 4DR3M 3TWMA 2VQFM 1MU5A 1TDZA 3JAMS 4OX9M 3U6MA 3VK8A 4NXNM 1L2DA 1L1TA 4GKKM 4JV5M 4JI8M 4PD2A 2HKJA 5BR8M 1PJIA 4KHPM 1PM5A 3T1YM 1N34M 4NRVA 1Z5BA 3A45A 3GQ5A 1L2CA 4DUZM 4NRWA 1PJJA 1IBKM 1R2ZA 4LF8M 4YHHM 2UXCM 1HNWM 2F5NA 2XZUA 4DUYM 3U6PA 3J7AS 3U6SA 2UXBM 3SATA 3U6LA 4DR2M 4AQYM 4LFCM 3GPXA 5LMNM 5ITRA 3W0FA 2XZFA 4YY3M 3SASA 5IWAM 3GQ4A 3GPYA 4LF4M 4LF9M 4JI2M 3GPPA 1Q39A 4G4NA 1HNZM 4GKJM 3TWKA 3GO8A 5A2QS 4JI0M 3U6OA 4JI1M 4DR5M 1Z5AA 4DV1M 2F4VM 5ITQA 2ZM6M 4DV5M 3SBJA 4DR1M 5LMUM 1R2YA 1L2BA 4DR6M 4X66M 1IBLM
chains in the Genus database with same CATH superfamily
1JR3D 3RE8A 1HNXM 3RGSA 3KDSE 4JXJA 5FTJA 2AHMA 2DWLA 3AJIB 3HU3A 3SAVA 2HHHM 1FJGM 4L8RC 5IT9S 4G4QA 4MGYE 1T3TA 3E21A 4II7A 2KZSA 2CUZA 4FW9A 4IBGA 3HU1A 2UUCM 4R7GA 1WJ7A 5EP3A 1QYRA 1YSYA 2DZLA 3B7NA 1NV9A 3KOZE 2K6BA 1SXJE 4MB7A 3SYLA 2LBCA 3LVVA 3TQSA 4B3SM 2DZOB 3FKEA 1ZAEA 2EO2A 2RRUA 3A46A 4AW4A 2G8LA 2JZ1A 2XLJA 2UXDM 5EXXA 1Q02A 1MX0A 2KW0A 3DOAA 4AZFA 5DNYA 8CATA 1TDHA 3FYDA 1VQ1A 2CE7A 3CF6E 4LJ7A 1WXQA 3U6QA 2V6ZM 1VEKA 4B3MM 5ITXE 4AKHA 1P3QQ 1WR1B 3HX3A 4G4OA 4LF5M 4JYAM 1K82A 1IY1A 2HAKA 2R65A 1IN8A 4MGKE 5EP4A 1YUBA 4HEOA 2J5YA 2MGWA 1NY6A 3VLFB 5C18A 3MJ5A 2W82A 3KXEC 2KNVA 1GLNA 1KSFX 1IN7A 1UM8A 2DENA 2ZANA 4B3RM 5F3WA 1VG5A 2BJVA 3FTEA 1WIVA 2X4AA 2C99A 2Y0TA 4PDIA 2OO9A 2R0IA 2D7GA 2Z8YM 4JI7M 4X65M 3EIHA 2VQEM 4PDGA 2R18A 4NSOB 3L28A 2C98A 4DV7M 1JQJC 1ZQ9A 2OOBA 4PT5A 5EXPA 1XXHB 4GMQA 1AUAA 3U60B 2DXIA 2F5SA 4DR3M 3DA1A 5IZ7D 4WP2A 3TL4X 3BOSA 2L09A 1TDZA 3LMMA 4GKKM 2KXEA 4JV5M 4Z6YA 3C3EA 4KHPM 3VKGA 1GL6A 4IBIA 3ZCBB 5BR8M 1PJIA 4FCWA 3T6PA 3LQQA 2ZAMA 3J27B 2JY5A 4A3VB 2L6OA 4CJ6A 2APLA 5FTKA 1GJTA 5FTLA 3WHKA 1R2ZA 2WSFF 4XK8F 1N78A 3GRRA 1E9SA 4QHSA 1S3SA 2XZUA 2MJ5B 1G3IA 1TGUA 1VEJA 3U6PA 4XBOA 3U6SA 2XSZD 2R46A 4IBDA 3L25A 3K2LA 4REZA 4F2LA 3K9PA 4XGIA 2DWNA 1IFYA 3IG5A 1OJLA 3W0FA 2KRUA 4YY3M 1LTMA 2HL7A 2LH0A 3LQRA 2X8AA 4I4LA 4CIZA 3GPYA 3FTCA 3AOGA 4QNMA 1PJQA 1R4GA 5GKNA 1DV0A 3CGWA 3RGPA 3T38A 2A5YB 4GKJM 1MJGM 4M9XA 2DVWB 5A2QS 3PXGA 3QWLA 2Y0QA 1TTEA 3I4YA 2JNHA 1PJSA 3SHGB 5ITQA 2BWEA 4LY6A 4QHTA 1Y8GA 1D0MA 3E4RA 2CHGA 2XEPA 3FTDA 4DR6M 3J7BA 3TPZA 2DWMA 3R8FA 4LF6M 1IXZA 2E5LM 3HGIA 4OW0A 2I7NA 3HKPA 3Q8GA 1NHGC 2VF8A 3T1HM 1XNRM 3GLFB 3FYCA 5KPZA 5DYIA 1H6UA 4ITQA 3GLHB 3KW6A 2I7PA 2JA2A 5ITUA 1PRBA 1XC8A 4DR7M 1IM2A 4GEWA 1N32M 1G41A 2L7IA 1V34A 3KS8A 3D8LA 4BLCA 2XFTA 2LVOC 3U6CA 3JR5A 2XSZA 1K3WA 3UMMA 3B7QA 1OAIA 2DAEA 2LNHC 1Q3BA 4LJ9A 3SMPA 1XWIA 4FD2A 4LG2A 1PJTA 1XHBA 1J5EM 4NOOB 5BPVA 3H4JA 3R9XB 2FFJA 4QNRA 3EIEA 2B3TA 2UUAM 4JI3M 4GHAA 1G8PA 3FRIA 5FTMA 3FRHA 1SXJB 1NSFA 2VIIA 3KOXE 1EE8A 3K92A 1KFVA 3LVWA 2YR0A 2F5PA 3NWLA 3IECA 3UGJA 3U6DA 1N33M 1Q3CA 2RGHA 3ILKA 4LJ4A 4G4RA 4NSRA 1QQWA 2LTUA 3MK6A 2QPAA 1XMQM 2FH0A 4LF7M 4FWGA 5DFLA 2CV2A 1GJSA 2CFOA 2UU9M 3K1JA 1AIPC 2QNJA 4L4UA 2GNOA 3I51A 4AI6A 3HWSA 2JY7A 1E9RA 2R4EA 3W0LB 4OVZB 5KQ8A 2OQ4A 1TH2A 4L15A 1MU5A 2FS1A 4LJ5A 1C1KA 4GC9A 5FTNA 3SYKA 3U6MA 1QZEA 4D80A 3VK8A 3K9OA 4QOZC 4AKGA 4JI8M 4B7FA 2DKLA 4FCTA 4JN6A 1NV8A 5KQDA 1Z5BA 2JWSA 3A45A 1IY0A 1L2CA 4LGMA 4DUZM 4LGYA 3FUWA 4NRWA 3U5ZA 3AFHA 1IXSA 1GVNA 4HL4A 2CV1A 4IBFA 3RFWA 2H5XA 2HCBA 1JR3E 2BNKA 1D0LA 2C9CA 3VDPA 1JR3A 3GPXA 5LMNM 5ITRA 2DNAA 3SASA 4OU7A 4LRSA 3M6AA 3PFIA 1I4WA 1NJGA 4LF9M 2Z3XA 1JB0F 2VF7A 3FD9A 5EJCA 3H4MA 4KODA 3LW5F 5L8RF 4M0DA 3GO8A 3KP0E 4AG5A 2QP9X 3U61A 4EIWA 1QUTA 2QBYB 2MR9A 3B9PA 1ZMVA 4DR5M 4MGHA 5C1BA 2ZM6M 2CHVA 4RNAA 4BBAA 1PGYA 2JUJA 4LRTA 2EJSA 4NC6A 3SBJA 2FE8A 1A5TA 1Z6TA 4S12A 5EP1A 1R2YA 5H37D 3D8BA 2QHOB 4X66M 2ERCA 1IBLM 1IY2A 3GLIE 3GLGE 3FUVA 3M0EA 3L26A 3GP1A 3GLIA 3GLGA 4G3OA 1NJFA 2WZJA 1HR0M 1XXHE 1E94E 1XMOM 1HT2E 3HJQA 4UN2B 2KZUA 2C5RA 1R6BX 1QDTA 1XXHA 3OTOM 1QAOA 4NXMM 4IJEA 2QCUA 4P17A 1IBMM 3A98B 3GPUA 2K0BX 2EKFA 4LFBM 2DZNB 3MMPA 4JI4M 1QAQA 2Y20A 3AV0A 1N36M 2BJWA 3KOYE 3QYBA 4LJAA 1G71A 2Q2EB 3BXWA 3JR4A 3SAUA 2C96A 1OIZA 1NNJA 3QYEA 4CGYB 3J80S 3UJNA 4RF0A 1FNNA 3DZDA 3HHYA 1F4IA 3PNYA 2JXNA 4M0WA 3THGA 1DGHB 2WSCF 2WSEF 3E46A 2KNAA 3GRUA 1J09A 4X62M 3KFUG 3HHZA 5JI2E 4GRIA 2UUBM 2XH9A 1ORYB 1R5LA 1NY5A 4Y28F 2R45A 2O5RA 3KOWE 2R6FA 1EIJA 4R71A 3VK7A 4GHLA 3SFZA 1SXJD 2LWXA 2O25A 4MGZE 5JI3E 2XGNA 4B3TM 5E26A 4AKIA 2G3QA 3HU2A 2ZAOA 2P5TA 2Z4RA 1BVSA 1L8QA 3GQ3A 1Z59A 4M9ZA 1GL7A 1I94M 1K3XA 1QZMA 2CEAA 4Z8XA 4DBGB 4IIWA 1G4AE 1D2NA 2HWJA 3L2AA 2CP8A 2JY8A 1QANA 2EKKA 4Q7JA 3U6EA 1NVMA 1L1ZA 4IBKA 4K0KM 3I4VA 4WW0A 5EXTA 2ZTDA 3AOEC 3HZJA 3M7GA 1YLAA 3TWMA 3FTFA 4GC5A 4OX9M 2CV0A 4NXNM 3HJSA 1L2DA 1L1TA 2DWZB 1W5TA 2HKJA 4FWHA 2DI0A 4PD2A 2J7OA 1DO2A 3GLHE 4NRVA 3GLFA 1C7YA 2H1RA 1OIPA 1WHCA 3J2PB 3GLHA 4B7HA 3IG8A 4LF8M 4YHHM 2L7HA 3B89A 4IBBA 2ZTCA 3SMSA 2YNMD 4MH0E 4ZPXA 2Z4SA 2F5NA 1HNWM 4ANRA 1R7RA 2FOIC 2UXBM 1IN4A 1DGFA 4KLNA 4AG6A 3U6LA 3FUTA 3SATA 2OOAA 1VEGA 4LFCM 4MM3B 2XF3A 1E32A 4LJ6A 3I01M 5EP2A 4G6ZA 3C9PA 3VFDA 5IWAM 2CRUA 4LF4M 3GPPA 1Q39A 3U5ZB 4G4NA 1SXJC 1HNZM 1HJPA 3TWKA 1IXSB 2R62A 1ZMWA 3U6OA 3NBIA 1OAOC 2LVQD 1SXJA 3KSJA 3TE6A 1TH3A 4DV1M 2F4VM 3HY5A 3E9SA 4DR1M 3KP1E 2MH8A 2O01F 3NBXX 4FWDA 5LMUM 3W68A 4RF1A 1IQPA 4JI6M 4NL4H 5ITYA 5FSWA 3FUUA 4W5WA 2N35A 5FLXS 1VDLA 3SARA 2YQZA 2JY6B 4HLQA 2EUCA 3L29A 2M5ZA 2RKOA 4GH9A 3QAUA 5KPTA 1EFUB 1OQYA 3BBZA 3K8ZA 5ITXA 3DFZA 4GITA 4DV3M 1NNUC 2M60A 2G5GX 3U61B 2BWBA 1ZV1A 4OVZA 2V1UA 1GO5A 2KEBA 1OKSA 1GABA 4B7GA 2KDLA 3C58A 3FUXA 2VDBB 3UK6A 1DO0A 2EA0A 1Z5CA 1DGGA 1TH4A 1J7KA 2FNAA 3B7ZA 5KPRA 4QOSA 3KS4A 4D82A 1RU3A 3GLIB 4CISA 4CHTB 3GLGB 2K47A 2DHYA 3SAWA 3A42A 1W5SA 2LXEA 2F5QA 2KHHA 3HHWA 2L4EA 4LFAM 2K9DA 2KA6B 4B08A 3B74A 3IHPA 3MHVC 4I5SA 2OPFA 3TWLA 2V1CA 1XNQM 2CHQA 2C9OA 1QDRA 3W67A 2ZBKB 2QSFX 3LCVB 3PNVA 4IBEA 4L6V6 4DV0M 2LVNC 2DAMA 1T6OA 3U60A 1VDDA 7CATA 2J7NA 4KT0F 1XB2B 4DV6M 2F5OA 3CTWB 2MROB 3UZUA 4JI5M 4DV2M 3AL0C 1HQCA 4MGIE 4LJ8A 2Z7JA 1IXRC 4PCZA 1TF0B 2LHCA 4BB9A 4FVMA 4TUWA 5ITTA 2NQ8C 1OFIA 4X64M 2KRKA 2QBYA 5KO3A 3J81S 1NO1A 2R44A 4DR4M 1OFHA 2QZ4A 3VKHA 3VDUA 1NHWC 4DV4M 2JZ0A 1KYIA 1YE9A 4D81A 1DGBA 3CF2A 4KO8A 3ZC7B 4IBJA 2VQFM 4LZJA 2DHRA 5DYGA 3JAMS 3F92A 1V92A 2R4JA 2XFSA 5EXSA 4P16A 3V76A 2KNZA 3L27A 1HQYE 2DAGA 1PM5A 1N75A 3T1YM 1GKIA 2D7HA 4R3DA 1TR8A 2DAIA 2QENA 1N34M 1G59A 3GQ5A 3T15A 2JP7A 5E6JA 1PJJA 1IBKM 4F1IA 2UXCM 4I81A 1HT1E 1LV7A 2Y21A 3KSXA 4WURA 1T43A 4DUYM 3HHXA 2LVPC 3J7AS 3ZH9B 3GRVA 3I04M 2GQFA 1N77A 4L16A 4DR2M 4AQYM 1UFZA 4IBCA 2RGOA 4L78A 3AKZA 1V33A 2XZFA 2LHGA 2YFQA 3GQ4A 1X37A 3KVWA 4IJFA 2QQ8A 1IN5A 1MN3A 1OTRA 4LCBA 3SHFA 3SC3A 4JI2M 1QUSA 1SG9A 1D0KA 1WGNA 2L2DA 3HJ8A 5EQTA 1DGHA 3GLFE 3AOEA 3FE3A 4LZZA 1CUKA 2D7EA 4JI0M 1QAMA 4I8OA 4M9SA 1ZMUA 1WGLA 4GIPA 4JI1M 2L4FA 3GRYA 4FCVA 3WHLA 1Z5AA 3LCUA 1QVRA 3C3DA 3CF0A 3Q8XA 1IN6A 3ZQJA 2X49A 5IREB 4DV5M 4RKUF 2CWBA 2LVAA 1L2BA 3PVSA 2DAKA
chains in the Genus database with same CATH topology
1JR3D 3RE8A 1HNXM 3RGSA 3KDSE 4JXJA 5FTJA 2AHMA 2DWLA 3AJIB 3HU3A 3SAVA 2HHHM 1FJGM 4L8RC 5IT9S 4G4QA 4MGYE 1T3TA 4II7A 2KZSA 2CUZA 4FW9A 4IBGA 3HU1A 2UUCM 4R7GA 5EP3A 1QYRA 1YSYA 3KOZE 1SXJE 4MB7A 3SYLA 3LVVA 3TQSA 4B3SM 2DZOB 3FKEA 1ZAEA 2EO2A 3A46A 4AW4A 2G8LA 2XLJA 2UXDM 5EXXA 1MX0A 2KW0A 3DOAA 4AZFA 5DNYA 8CATA 1TDHA 3FYDA 2CE7A 3U6QA 3CF6E 4LJ7A 1WXQA 2V6ZM 4AKHA 4B3MM 5ITXE 4G4OA 4LF5M 4JYAM 1K82A 1IY1A 2R65A 1IN8A 4MGKE 5EP4A 1YUBA 1NY6A 3VLFB 5C18A 3MJ5A 2W82A 3KXEC 1GLNA 1KSFX 1IN7A 1UM8A 2ZANA 4B3RM 5F3WA 2BJVA 3FTEA 2X4AA 2C99A 2Y0TA 4PDIA 4JI7M 2D7GA 4X65M 3EIHA 2VQEM 4PDGA 2R18A 4NSOB 3L28A 2C98A 4DV7M 1JQJC 1ZQ9A 4PT5A 5EXPA 3U60B 1XXHB 4GMQA 2DXIA 2F5SA 4DR3M 3DA1A 5IZ7D 3TL4X 3BOSA 2L09A 1TDZA 3LMMA 4GKKM 2KXEA 4JV5M 4Z6YA 4KHPM 3VKGA 1GL6A 4IBIA 3ZCBB 5BR8M 1PJIA 4FCWA 3LQQA 2ZAMA 3J27B 4A3VB 2L6OA 5FTKA 5FTLA 3WHKA 1R2ZA 1N78A 3GRRA 1E9SA 4QHSA 1S3SA 2XZUA 1G3IA 1TGUA 3U6PA 4XBOA 3U6SA 2XSZD 2R46A 4IBDA 3L25A 3K2LA 4REZA 4XGIA 2DWNA 3IG5A 1OJLA 3W0FA 2KRUA 4YY3M 2LH0A 2HL7A 3LQRA 2X8AA 4I4LA 3GPYA 3FTCA 3AOGA 4QNMA 5GKNA 3RGPA 3T38A 2A5YB 4GKJM 4M9XA 2DVWB 5A2QS 3PXGA 3QWLA 2Y0QA 3I4YA 3SHGB 5ITQA 4LY6A 4QHTA 3E4RA 2CHGA 3FTDA 2XEPA 4DR6M 3J7BA 3TPZA 2DWMA 3R8FA 4LF6M 1IXZA 2E5LM 3HGIA 4OW0A 2I7NA 3HKPA 3T1HM 1NHGC 1XNRM 3GLFB 3FYCA 5KPZA 5DYIA 1H6UA 4ITQA 3GLHB 3KW6A 2I7PA 2JA2A 5ITUA 1XC8A 4DR7M 1IM2A 1N32M 1G41A 2L7IA 3KS8A 3D8LA 4BLCA 2XFTA 3U6CA 3JR5A 2XSZA 1K3WA 3UMMA 2LNHC 1Q3BA 4LJ9A 3SMPA 1XWIA 4FD2A 4LG2A 1XHBA 1J5EM 4NOOB 5BPVA 3R9XB 2FFJA 4QNRA 3EIEA 2UUAM 4JI3M 4GHAA 1G8PA 5FTMA 1SXJB 1NSFA 2VIIA 3KOXE 1EE8A 3K92A 1KFVA 3LVWA 2YR0A 2F5PA 3NWLA 3UGJA 3U6DA 1N33M 1Q3CA 2RGHA 3ILKA 4LJ4A 4G4RA 4NSRA 1QQWA 1XMQM 3MK6A 2QPAA 4LF7M 4FWGA 2CV2A 2CFOA 2UU9M 3K1JA 4L4UA 3I51A 4AI6A 3HWSA 1E9RA 2R4EA 3W0LB 4OVZB 5KQ8A 2OQ4A 1TH2A 4L15A 1MU5A 4LJ5A 1C1KA 4GC9A 5FTNA 3SYKA 3U6MA 4D80A 3VK8A 4QOZC 4AKGA 4JI8M 4B7FA 4FCTA 4JN6A 5KQDA 1Z5BA 3A45A 1IY0A 1L2CA 4LGMA 4DUZM 4LGYA 3FUWA 4NRWA 3U5ZA 3AFHA 1GVNA 4HL4A 2CV1A 4IBFA 3RFWA 2HCBA 2BNKA 2C9CA 3VDPA 1JR3A 3GPXA 5LMNM 5ITRA 3SASA 4OU7A 4LRSA 3M6AA 3PFIA 1I4WA 1NJGA 4LF9M 2Z3XA 3FD9A 5EJCA 3H4MA 4KODA 4M0DA 3GO8A 3KP0E 4AG5A 2QP9X 3U61A 4EIWA 2QBYB 3B9PA 4DR5M 4MGHA 5C1BA 2ZM6M 2CHVA 4RNAA 4BBAA 4LRTA 3SBJA 2FE8A 1Z6TA 4S12A 5EP1A 1R2YA 5H37D 3D8BA 4X66M 2ERCA 1IBLM 1IY2A 3FUVA 3M0EA 3L26A 3GP1A 3GLIA 3GLGA 1NJFA 1HR0M 1E94E 1XMOM 1HT2E 3HJQA 2KZUA 2C5RA 1R6BX 1XXHA 3OTOM 1QAOA 4NXMM 4IJEA 2QCUA 1IBMM 3A98B 3GPUA 4LFBM 2DZNB 4JI4M 1QAQA 2Y20A 3AV0A 1N36M 2BJWA 3KOYE 4LJAA 2Q2EB 3JR4A 3SAUA 2C96A 1NNJA 4CGYB 3J80S 3UJNA 4RF0A 1FNNA 3DZDA 3HHYA 3PNYA 4M0WA 3THGA 1DGHB 3KFUG 3GRUA 1J09A 4X62M 3HHZA 5JI2E 4GRIA 2UUBM 2XH9A 1ORYB 1NY5A 2R45A 2O5RA 3KOWE 3VK7A 4GHLA 3SFZA 1SXJD 2LWXA 4MGZE 5JI3E 2XGNA 4B3TM 5E26A 4AKIA 3HU2A 2ZAOA 2P5TA 2Z4RA 1L8QA 3GQ3A 1Z59A 4M9ZA 1GL7A 1I94M 1K3XA 1QZMA 2CEAA 4Z8XA 4IIWA 1G4AE 1D2NA 3L2AA 1QANA 3U6EA 1NVMA 1L1ZA 4IBKA 4K0KM 3I4VA 4WW0A 5EXTA 3M7GA 3AOEC 3TWMA 3FTFA 4GC5A 4OX9M 2CV0A 4NXNM 3HJSA 1L2DA 1L1TA 2DWZB 1W5TA 2HKJA 4FWHA 4PD2A 2J7OA 1DO2A 3GLFA 4NRVA 2H1RA 3J2PB 3GLHA 4B7HA 3IG8A 4LF8M 4YHHM 2L7HA 4IBBA 3SMSA 2YNMD 4MH0E 4ZPXA 2Z4SA 2F5NA 1HNWM 1R7RA 2FOIC 2UXBM 1IN4A 1DGFA 4KLNA 4AG6A 3U6LA 3FUTA 3SATA 4LFCM 4MM3B 2XF3A 1E32A 4LJ6A 5EP2A 4G6ZA 3VFDA 5IWAM 4LF4M 3GPPA 1Q39A 3U5ZB 4G4NA 1SXJC 1HNZM 3TWKA 1IXSB 2R62A 3U6OA 3NBIA 1SXJA 3KSJA 3TE6A 1TH3A 4DV1M 2F4VM 3E9SA 4DR1M 3KP1E 5LMUM 4FWDA 4RF1A 1IQPA 4JI6M 4NL4H 5ITYA 5FSWA 3FUUA 4W5WA 5FLXS 3SARA 2YQZA 4HLQA 2EUCA 3L29A 2M5ZA 2RKOA 4GH9A 3QAUA 5KPTA 3K8ZA 5ITXA 3DFZA 4GITA 4DV3M 1NNUC 2M60A 2G5GX 3U61B 2V1UA 4OVZA 2KEBA 4B7GA 3C58A 3FUXA 3UK6A 1DO0A 2EA0A 1Z5CA 1DGGA 1TH4A 1J7KA 2FNAA 5KPRA 4QOSA 3KS4A 4D82A 3GLIB 4CISA 4CHTB 3GLGB 2K47A 3SAWA 3A42A 1W5SA 2LXEA 2F5QA 3HHWA 4LFAM 2KA6B 2OPFA 4B08A 4I5SA 3MHVC 3TWLA 2V1CA 1XNQM 2CHQA 2C9OA 2ZBKB 3PNVA 4IBEA 4DV0M 3U60A 1VDDA 7CATA 2J7NA 4DV6M 2F5OA 3CTWB 3UZUA 4JI5M 3AL0C 4DV2M 1HQCA 4MGIE 4LJ8A 2Z7JA 1IXRC 4PCZA 4BB9A 4FVMA 4TUWA 5ITTA 2NQ8C 1OFIA 4X64M 2KRKA 2QBYA 5KO3A 3J81S 4DR4M 1OFHA 2QZ4A 3VKHA 3VDUA 1NHWC 4DV4M 1KYIA 1YE9A 4D81A 1DGBA 3CF2A 4KO8A 3ZC7B 4IBJA 2VQFM 4LZJA 2DHRA 5DYGA 3JAMS 2R4JA 2XFSA 5EXSA 4P16A 3L27A 1HQYE 1PM5A 1N75A 3T1YM 1GKIA 2D7HA 4R3DA 2QENA 1N34M 1G59A 3GQ5A 3T15A 5E6JA 1PJJA 1IBKM 2UXCM 4I81A 1HT1E 1LV7A 2Y21A 3KSXA 4WURA 4DUYM 3HHXA 3J7AS 3ZH9B 3GRVA 1N77A 4L16A 4DR2M 4AQYM 4IBCA 2RGOA 4L78A 3AKZA 2XZFA 2YFQA 3GQ4A 1X37A 3KVWA 4IJFA 1IN5A 4LCBA 3SHFA 3SC3A 4JI2M 3HJ8A 5EQTA 1DGHA 3AOEA 4LZZA 2D7EA 4JI0M 1QAMA 4I8OA 4M9SA 4GIPA 4JI1M 3GRYA 4FCVA 3WHLA 1Z5AA 1QVRA 3Q8XA 3CF0A 1IN6A 2X49A 5IREB 4DV5M 1L2BA 3PVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 M;  1HNX M;  5ITY A;  5FLX S;  3GP1 A;  4LF6 M;  1FJG M;  5IT9 S;  3SAR A;  3SAV A;  2HHH M;  2E5L M;  4G4Q A;  1HR0 M;  1XMO M;  3T1H M;  1XNR M;  2UUC M;  5ITX A;  4DV3 M;  3OTO M;  4ITQ A;  4NXM M;  5ITU A;  1IBM M;  3GPU A;  1XC8 A;  3C58 A;  4DR7 M;  2EA0 A;  4MB7 A;  4LFB M;  4JI4 M;  1N32 M;  1Z5C A;  1N36 M;  4B3S M;  3A46 A;  4CIS A;  2Q2E B;  3JR4 A;  3U6C A;  2UXD M;  3JR5 A;  3SAU A;  3SAW A;  1K3W A;  1MX0 A;  3A42 A;  3DOA A;  1NNJ A;  1Q3B A;  3J80 S;  2F5Q A;  1TDH A;  4LFA M;  2OPF A;  1J5E M;  3TWL A;  3U6Q A;  1XNQ M;  4B3M M;  5ITX E;  2ZBK B;  4X62 M;  2UUA M;  4DV0 M;  4JI3 M;  4G4O A;  4LF5 M;  4JYA M;  1K82 A;  2UUB M;  4DV6 M;  2F5O A;  4JI5 M;  4DV2 M;  1EE8 A;  1KFV A;  3VK7 A;  2F5P A;  3U6D A;  1N33 M;  1Q3C A;  4PCZ A;  4B3T M;  4B3R M;  4G4R A;  5ITT A;  1XMQ M;  4X64 M;  3GQ3 A;  1Z59 A;  1I94 M;  3J81 S;  4LF7 M;  4PDI A;  1K3X A;  4JI7 M;  2UU9 M;  4DR4 M;  4X65 M;  2VQE M;  4PDG A;  4DV4 M;  4DV7 M;  3U6E A;  1L1Z A;  4K0K M;  2F5S A;  2OQ4 A;  4DR3 M;  3TWM A;  2VQF M;  1MU5 A;  1TDZ A;  3JAM S;  4OX9 M;  3U6M A;  3VK8 A;  4NXN M;  1L2D A;  1L1T A;  4GKK M;  4JV5 M;  4JI8 M;  4PD2 A;  2HKJ A;  5BR8 M;  1PJI A;  4KHP M;  1PM5 A;  3T1Y M;  1N34 M;  4NRV A;  1Z5B A;  3A45 A;  3GQ5 A;  1L2C A;  4DUZ M;  4NRW A;  1PJJ A;  1IBK M;  1R2Z A;  4LF8 M;  4YHH M;  2UXC M;  1HNW M;  2F5N A;  2XZU A;  4DUY M;  3U6P A;  3J7A S;  3U6S A;  2UXB M;  3SAT A;  3U6L A;  4DR2 M;  4AQY M;  4LFC M;  3GPX A;  5LMN M;  5ITR A;  3W0F A;  2XZF A;  4YY3 M;  3SAS A;  5IWA M;  3GQ4 A;  3GPY A;  4LF4 M;  4LF9 M;  4JI2 M;  3GPP A;  1Q39 A;  4G4N A;  1HNZ M;  4GKJ M;  3TWK A;  3GO8 A;  5A2Q S;  4JI0 M;  3U6O A;  4JI1 M;  4DR5 M;  1Z5A A;  4DV1 M;  2F4V M;  5ITQ A;  2ZM6 M;  4DV5 M;  3SBJ A;  4DR1 M;  5LMU M;  1R2Y A;  1L2B A;  4DR6 M;  4X66 M;  1IBL M; 
#chains in the Genus database with same CATH topology
 1JR3 D;  3RE8 A;  1HNX M;  3RGS A;  3KDS E;  4JXJ A;  5FTJ A;  2AHM A;  2DWL A;  3AJI B;  3HU3 A;  3SAV A;  2HHH M;  1FJG M;  4L8R C;  5IT9 S;  4G4Q A;  4MGY E;  1T3T A;  3E21 A;  4II7 A;  2KZS A;  2CUZ A;  4FW9 A;  4IBG A;  3HU1 A;  2UUC M;  4R7G A;  1WJ7 A;  5EP3 A;  1QYR A;  1YSY A;  2DZL A;  3B7N A;  1NV9 A;  3KOZ E;  2K6B A;  1SXJ E;  4MB7 A;  3SYL A;  2LBC A;  3LVV A;  3TQS A;  4B3S M;  2DZO B;  3FKE A;  1ZAE A;  2EO2 A;  2RRU A;  3A46 A;  4AW4 A;  2G8L A;  2JZ1 A;  2XLJ A;  2UXD M;  5EXX A;  1Q02 A;  1MX0 A;  2KW0 A;  3DOA A;  4AZF A;  5DNY A;  8CAT A;  1TDH A;  3FYD A;  1VQ1 A;  2CE7 A;  3CF6 E;  4LJ7 A;  1WXQ A;  3U6Q A;  2V6Z M;  1VEK A;  4B3M M;  5ITX E;  4AKH A;  1P3Q Q;  1WR1 B;  3HX3 A;  4G4O A;  4LF5 M;  4JYA M;  1K82 A;  1IY1 A;  2HAK A;  2R65 A;  1IN8 A;  4MGK E;  5EP4 A;  1YUB A;  4HEO A;  2J5Y A;  2MGW A;  1NY6 A;  3VLF B;  5C18 A;  3MJ5 A;  2W82 A;  3KXE C;  2KNV A;  1GLN A;  1KSF X;  1IN7 A;  1UM8 A;  2DEN A;  2ZAN A;  4B3R M;  5F3W A;  1VG5 A;  2BJV A;  3FTE A;  1WIV A;  2X4A A;  2C99 A;  2Y0T A;  4PDI A;  2OO9 A;  2R0I A;  2D7G A;  2Z8Y M;  4JI7 M;  4X65 M;  3EIH A;  2VQE M;  4PDG A;  2R18 A;  4NSO B;  3L28 A;  2C98 A;  4DV7 M;  1JQJ C;  1ZQ9 A;  2OOB A;  4PT5 A;  5EXP A;  1XXH B;  4GMQ A;  1AUA A;  3U60 B;  2DXI A;  2F5S A;  4DR3 M;  3DA1 A;  5IZ7 D;  4WP2 A;  3TL4 X;  3BOS A;  2L09 A;  1TDZ A;  3LMM A;  4GKK M;  2KXE A;  4JV5 M;  4Z6Y A;  3C3E A;  4KHP M;  3VKG A;  1GL6 A;  4IBI A;  3ZCB B;  5BR8 M;  1PJI A;  4FCW A;  3T6P A;  3LQQ A;  2ZAM A;  3J27 B;  2JY5 A;  4A3V B;  2L6O A;  4CJ6 A;  2APL A;  5FTK A;  1GJT A;  5FTL A;  3WHK A;  1R2Z A;  2WSF F;  4XK8 F;  1N78 A;  3GRR A;  1E9S A;  4QHS A;  1S3S A;  2XZU A;  2MJ5 B;  1G3I A;  1TGU A;  1VEJ A;  3U6P A;  4XBO A;  3U6S A;  2XSZ D;  2R46 A;  4IBD A;  3L25 A;  3K2L A;  4REZ A;  4F2L A;  3K9P A;  4XGI A;  2DWN A;  1IFY A;  3IG5 A;  1OJL A;  3W0F A;  2KRU A;  4YY3 M;  1LTM A;  2HL7 A;  2LH0 A;  3LQR A;  2X8A A;  4I4L A;  4CIZ A;  3GPY A;  3FTC A;  3AOG A;  4QNM A;  1PJQ A;  1R4G A;  5GKN A;  1DV0 A;  3CGW A;  3RGP A;  3T38 A;  2A5Y B;  4GKJ M;  1MJG M;  4M9X A;  2DVW B;  5A2Q S;  3PXG A;  3QWL A;  2Y0Q A;  1TTE A;  3I4Y A;  2JNH A;  1PJS A;  3SHG B;  5ITQ A;  2BWE A;  4LY6 A;  4QHT A;  1Y8G A;  1D0M A;  3E4R A;  2CHG A;  2XEP A;  3FTD A;  4DR6 M;  3J7B A;  3TPZ A;  2DWM A;  3R8F A;  4LF6 M;  1IXZ A;  2E5L M;  3HGI A;  4OW0 A;  2I7N A;  3HKP A;  3Q8G A;  1NHG C;  2VF8 A;  3T1H M;  1XNR M;  3GLF B;  3FYC A;  5KPZ A;  5DYI A;  1H6U A;  4ITQ A;  3GLH B;  3KW6 A;  2I7P A;  2JA2 A;  5ITU A;  1PRB A;  1XC8 A;  4DR7 M;  1IM2 A;  4GEW A;  1N32 M;  1G41 A;  2L7I A;  1V34 A;  3KS8 A;  3D8L A;  4BLC A;  2XFT A;  2LVO C;  3U6C A;  3JR5 A;  2XSZ A;  1K3W A;  3UMM A;  3B7Q A;  1OAI A;  2DAE A;  2LNH C;  1Q3B A;  4LJ9 A;  3SMP A;  1XWI A;  4FD2 A;  4LG2 A;  1PJT A;  1XHB A;  1J5E M;  4NOO B;  5BPV A;  3H4J A;  3R9X B;  2FFJ A;  4QNR A;  3EIE A;  2B3T A;  2UUA M;  4JI3 M;  4GHA A;  1G8P A;  3FRI A;  5FTM A;  3FRH A;  1SXJ B;  1NSF A;  2VII A;  3KOX E;  1EE8 A;  3K92 A;  1KFV A;  3LVW A;  2YR0 A;  2F5P A;  3NWL A;  3IEC A;  3UGJ A;  3U6D A;  1N33 M;  1Q3C A;  2RGH A;  3ILK A;  4LJ4 A;  4G4R A;  4NSR A;  1QQW A;  2LTU A;  3MK6 A;  2QPA A;  1XMQ M;  2FH0 A;  4LF7 M;  4FWG A;  5DFL A;  2CV2 A;  1GJS A;  2CFO A;  2UU9 M;  3K1J A;  1AIP C;  2QNJ A;  4L4U A;  2GNO A;  3I51 A;  4AI6 A;  3HWS A;  2JY7 A;  1E9R A;  2R4E A;  3W0L B;  4OVZ B;  5KQ8 A;  2OQ4 A;  1TH2 A;  4L15 A;  1MU5 A;  2FS1 A;  4LJ5 A;  1C1K A;  4GC9 A;  5FTN A;  3SYK A;  3U6M A;  1QZE A;  4D80 A;  3VK8 A;  3K9O A;  4QOZ C;  4AKG A;  4JI8 M;  4B7F A;  2DKL A;  4FCT A;  4JN6 A;  1NV8 A;  5KQD A;  1Z5B A;  2JWS A;  3A45 A;  1IY0 A;  1L2C A;  4LGM A;  4DUZ M;  4LGY A;  3FUW A;  4NRW A;  3U5Z A;  3AFH A;  1IXS A;  1GVN A;  4HL4 A;  2CV1 A;  4IBF A;  3RFW A;  2H5X A;  2HCB A;  1JR3 E;  2BNK A;  1D0L A;  2C9C A;  3VDP A;  1JR3 A;  3GPX A;  5LMN M;  5ITR A;  2DNA A;  3SAS A;  4OU7 A;  4LRS A;  3M6A A;  3PFI A;  1I4W A;  1NJG A;  4LF9 M;  2Z3X A;  1JB0 F;  2VF7 A;  3FD9 A;  5EJC A;  3H4M A;  4KOD A;  3LW5 F;  5L8R F;  4M0D A;  3GO8 A;  3KP0 E;  4AG5 A;  2QP9 X;  3U61 A;  4EIW A;  1QUT A;  2QBY B;  2MR9 A;  3B9P A;  1ZMV A;  4DR5 M;  4MGH A;  5C1B A;  2ZM6 M;  2CHV A;  4RNA A;  4BBA A;  1PGY A;  2JUJ A;  4LRT A;  2EJS A;  4NC6 A;  3SBJ A;  2FE8 A;  1A5T A;  1Z6T A;  4S12 A;  5EP1 A;  1R2Y A;  5H37 D;  3D8B A;  2QHO B;  4X66 M;  2ERC A;  1IBL M;  1IY2 A;  3GLI E;  3GLG E;  3FUV A;  3M0E A;  3L26 A;  3GP1 A;  3GLI A;  3GLG A;  4G3O A;  1NJF A;  2WZJ A;  1HR0 M;  1XXH E;  1E94 E;  1XMO M;  1HT2 E;  3HJQ A;  4UN2 B;  2KZU A;  2C5R A;  1R6B X;  1QDT A;  1XXH A;  3OTO M;  1QAO A;  4NXM M;  4IJE A;  2QCU A;  4P17 A;  1IBM M;  3A98 B;  3GPU A;  2K0B X;  2EKF A;  4LFB M;  2DZN B;  3MMP A;  4JI4 M;  1QAQ A;  2Y20 A;  3AV0 A;  1N36 M;  2BJW A;  3KOY E;  3QYB A;  4LJA A;  1G71 A;  2Q2E B;  3BXW A;  3JR4 A;  3SAU A;  2C96 A;  1OIZ A;  1NNJ A;  3QYE A;  4CGY B;  3J80 S;  3UJN A;  4RF0 A;  1FNN A;  3DZD A;  3HHY A;  1F4I A;  3PNY A;  2JXN A;  4M0W A;  3THG A;  1DGH B;  2WSC F;  2WSE F;  3E46 A;  2KNA A;  3GRU A;  1J09 A;  4X62 M;  3KFU G;  3HHZ A;  5JI2 E;  4GRI A;  2UUB M;  2XH9 A;  1ORY B;  1R5L A;  1NY5 A;  4Y28 F;  2R45 A;  2O5R A;  3KOW E;  2R6F A;  1EIJ A;  4R71 A;  3VK7 A;  4GHL A;  3SFZ A;  1SXJ D;  2LWX A;  2O25 A;  4MGZ E;  5JI3 E;  2XGN A;  4B3T M;  5E26 A;  4AKI A;  2G3Q A;  3HU2 A;  2ZAO A;  2P5T A;  2Z4R A;  1BVS A;  1L8Q A;  3GQ3 A;  1Z59 A;  4M9Z A;  1GL7 A;  1I94 M;  1K3X A;  1QZM A;  2CEA A;  4Z8X A;  4DBG B;  4IIW A;  1G4A E;  1D2N A;  2HWJ A;  3L2A A;  2CP8 A;  2JY8 A;  1QAN A;  2EKK A;  4Q7J A;  3U6E A;  1NVM A;  1L1Z A;  4IBK A;  4K0K M;  3I4V A;  4WW0 A;  5EXT A;  2ZTD A;  3AOE C;  3HZJ A;  3M7G A;  1YLA A;  3TWM A;  3FTF A;  4GC5 A;  4OX9 M;  2CV0 A;  4NXN M;  3HJS A;  1L2D A;  1L1T A;  2DWZ B;  1W5T A;  2HKJ A;  4FWH A;  2DI0 A;  4PD2 A;  2J7O A;  1DO2 A;  3GLH E;  4NRV A;  3GLF A;  1C7Y A;  2H1R A;  1OIP A;  1WHC A;  3J2P B;  3GLH A;  4B7H A;  3IG8 A;  4LF8 M;  4YHH M;  2L7H A;  3B89 A;  4IBB A;  2ZTC A;  3SMS A;  2YNM D;  4MH0 E;  4ZPX A;  2Z4S A;  2F5N A;  1HNW M;  4ANR A;  1R7R A;  2FOI C;  2UXB M;  1IN4 A;  1DGF A;  4KLN A;  4AG6 A;  3U6L A;  3FUT A;  3SAT A;  2OOA A;  1VEG A;  4LFC M;  4MM3 B;  2XF3 A;  1E32 A;  4LJ6 A;  3I01 M;  5EP2 A;  4G6Z A;  3C9P A;  3VFD A;  5IWA M;  2CRU A;  4LF4 M;  3GPP A;  1Q39 A;  3U5Z B;  4G4N A;  1SXJ C;  1HNZ M;  1HJP A;  3TWK A;  1IXS B;  2R62 A;  1ZMW A;  3U6O A;  3NBI A;  1OAO C;  2LVQ D;  1SXJ A;  3KSJ A;  3TE6 A;  1TH3 A;  4DV1 M;  2F4V M;  3HY5 A;  3E9S A;  4DR1 M;  3KP1 E;  2MH8 A;  2O01 F;  3NBX X;  4FWD A;  5LMU M;  3W68 A;  4RF1 A;  1IQP A;  4JI6 M;  4NL4 H;  5ITY A;  5FSW A;  3FUU A;  4W5W A;  2N35 A;  5FLX S;  1VDL A;  3SAR A;  2YQZ A;  2JY6 B;  4HLQ A;  2EUC A;  3L29 A;  2M5Z A;  2RKO A;  4GH9 A;  3QAU A;  5KPT A;  1EFU B;  1OQY A;  3BBZ A;  3K8Z A;  5ITX A;  3DFZ A;  4GIT A;  4DV3 M;  1NNU C;  2M60 A;  2G5G X;  3U61 B;  2BWB A;  1ZV1 A;  4OVZ A;  2V1U A;  1GO5 A;  2KEB A;  1OKS A;  1GAB A;  4B7G A;  2KDL A;  3C58 A;  3FUX A;  2VDB B;  3UK6 A;  1DO0 A;  2EA0 A;  1Z5C A;  1DGG A;  1TH4 A;  1J7K A;  2FNA A;  3B7Z A;  5KPR A;  4QOS A;  3KS4 A;  4D82 A;  1RU3 A;  3GLI B;  4CIS A;  4CHT B;  3GLG B;  2K47 A;  2DHY A;  3SAW A;  3A42 A;  1W5S A;  2LXE A;  2F5Q A;  2KHH A;  3HHW A;  2L4E A;  4LFA M;  2K9D A;  2KA6 B;  4B08 A;  3B74 A;  3IHP A;  3MHV C;  4I5S A;  2OPF A;  3TWL A;  2V1C A;  1XNQ M;  2CHQ A;  2C9O A;  1QDR A;  3W67 A;  2ZBK B;  2QSF X;  3LCV B;  3PNV A;  4IBE A;  4L6V 6;  4DV0 M;  2LVN C;  2DAM A;  1T6O A;  3U60 A;  1VDD A;  7CAT A;  2J7N A;  4KT0 F;  1XB2 B;  4DV6 M;  2F5O A;  3CTW B;  2MRO B;  3UZU A;  4JI5 M;  4DV2 M;  3AL0 C;  1HQC A;  4MGI E;  4LJ8 A;  2Z7J A;  1IXR C;  4PCZ A;  1TF0 B;  2LHC A;  4BB9 A;  4FVM A;  4TUW A;  5ITT A;  2NQ8 C;  1OFI A;  4X64 M;  2KRK A;  2QBY A;  5KO3 A;  3J81 S;  1NO1 A;  2R44 A;  4DR4 M;  1OFH A;  2QZ4 A;  3VKH A;  3VDU A;  1NHW C;  4DV4 M;  2JZ0 A;  1KYI A;  1YE9 A;  4D81 A;  1DGB A;  3CF2 A;  4KO8 A;  3ZC7 B;  4IBJ A;  2VQF M;  4LZJ A;  2DHR A;  5DYG A;  3JAM S;  3F92 A;  1V92 A;  2R4J A;  2XFS A;  5EXS A;  4P16 A;  3V76 A;  2KNZ A;  3L27 A;  1HQY E;  2DAG A;  1PM5 A;  1N75 A;  3T1Y M;  1GKI A;  2D7H A;  4R3D A;  1TR8 A;  2DAI A;  2QEN A;  1N34 M;  1G59 A;  3GQ5 A;  3T15 A;  2JP7 A;  5E6J A;  1PJJ A;  1IBK M;  4F1I A;  2UXC M;  4I81 A;  1HT1 E;  1LV7 A;  2Y21 A;  3KSX A;  4WUR A;  1T43 A;  4DUY M;  3HHX A;  2LVP C;  3J7A S;  3ZH9 B;  3GRV A;  3I04 M;  2GQF A;  1N77 A;  4L16 A;  4DR2 M;  4AQY M;  1UFZ A;  4IBC A;  2RGO A;  4L78 A;  3AKZ A;  1V33 A;  2XZF A;  2LHG A;  2YFQ A;  3GQ4 A;  1X37 A;  3KVW A;  4IJF A;  2QQ8 A;  1IN5 A;  1MN3 A;  1OTR A;  4LCB A;  3SHF A;  3SC3 A;  4JI2 M;  1QUS A;  1SG9 A;  1D0K A;  1WGN A;  2L2D A;  3HJ8 A;  5EQT A;  1DGH A;  3GLF E;  3AOE A;  3FE3 A;  4LZZ A;  1CUK A;  2D7E A;  4JI0 M;  1QAM A;  4I8O A;  4M9S A;  1ZMU A;  1WGL A;  4GIP A;  4JI1 M;  2L4F A;  3GRY A;  4FCV A;  3WHL A;  1Z5A A;  3LCU A;  1QVR A;  3C3D A;  3CF0 A;  3Q8X A;  1IN6 A;  3ZQJ A;  2X49 A;  5IRE B;  4DV5 M;  4RKU F;  2CWB A;  2LVA A;  1L2B A;  3PVS A;  2DAK A; 
#chains in the Genus database with same CATH homology
 1JR3 D;  3RE8 A;  1HNX M;  3RGS A;  3KDS E;  4JXJ A;  5FTJ A;  2AHM A;  2DWL A;  3AJI B;  3HU3 A;  3SAV A;  2HHH M;  1FJG M;  4L8R C;  5IT9 S;  4G4Q A;  4MGY E;  1T3T A;  4II7 A;  2KZS A;  2CUZ A;  4FW9 A;  4IBG A;  3HU1 A;  2UUC M;  4R7G A;  5EP3 A;  1QYR A;  1YSY A;  3KOZ E;  1SXJ E;  4MB7 A;  3SYL A;  3LVV A;  3TQS A;  4B3S M;  2DZO B;  3FKE A;  1ZAE A;  2EO2 A;  3A46 A;  4AW4 A;  2G8L A;  2XLJ A;  2UXD M;  5EXX A;  1MX0 A;  2KW0 A;  3DOA A;  4AZF A;  5DNY A;  8CAT A;  1TDH A;  3FYD A;  2CE7 A;  3U6Q A;  3CF6 E;  4LJ7 A;  1WXQ A;  2V6Z M;  4AKH A;  4B3M M;  5ITX E;  4G4O A;  4LF5 M;  4JYA M;  1K82 A;  1IY1 A;  2R65 A;  1IN8 A;  4MGK E;  5EP4 A;  1YUB A;  1NY6 A;  3VLF B;  5C18 A;  3MJ5 A;  2W82 A;  3KXE C;  1GLN A;  1KSF X;  1IN7 A;  1UM8 A;  2ZAN A;  4B3R M;  5F3W A;  2BJV A;  3FTE A;  2X4A A;  2C99 A;  2Y0T A;  4PDI A;  4JI7 M;  2D7G A;  4X65 M;  3EIH A;  2VQE M;  4PDG A;  2R18 A;  4NSO B;  3L28 A;  2C98 A;  4DV7 M;  1JQJ C;  1ZQ9 A;  4PT5 A;  5EXP A;  3U60 B;  1XXH B;  4GMQ A;  2DXI A;  2F5S A;  4DR3 M;  3DA1 A;  5IZ7 D;  3TL4 X;  3BOS A;  2L09 A;  1TDZ A;  3LMM A;  4GKK M;  2KXE A;  4JV5 M;  4Z6Y A;  4KHP M;  3VKG A;  1GL6 A;  4IBI A;  3ZCB B;  5BR8 M;  1PJI A;  4FCW A;  3LQQ A;  2ZAM A;  3J27 B;  4A3V B;  2L6O A;  5FTK A;  5FTL A;  3WHK A;  1R2Z A;  1N78 A;  3GRR A;  1E9S A;  4QHS A;  1S3S A;  2XZU A;  1G3I A;  1TGU A;  3U6P A;  4XBO A;  3U6S A;  2XSZ D;  2R46 A;  4IBD A;  3L25 A;  3K2L A;  4REZ A;  4XGI A;  2DWN A;  3IG5 A;  1OJL A;  3W0F A;  2KRU A;  4YY3 M;  2LH0 A;  2HL7 A;  3LQR A;  2X8A A;  4I4L A;  3GPY A;  3FTC A;  3AOG A;  4QNM A;  5GKN A;  3RGP A;  3T38 A;  2A5Y B;  4GKJ M;  4M9X A;  2DVW B;  5A2Q S;  3PXG A;  3QWL A;  2Y0Q A;  3I4Y A;  3SHG B;  5ITQ A;  4LY6 A;  4QHT A;  3E4R A;  2CHG A;  3FTD A;  2XEP A;  4DR6 M;  3J7B A;  3TPZ A;  2DWM A;  3R8F A;  4LF6 M;  1IXZ A;  2E5L M;  3HGI A;  4OW0 A;  2I7N A;  3HKP A;  3T1H M;  1NHG C;  1XNR M;  3GLF B;  3FYC A;  5KPZ A;  5DYI A;  1H6U A;  4ITQ A;  3GLH B;  3KW6 A;  2I7P A;  2JA2 A;  5ITU A;  1XC8 A;  4DR7 M;  1IM2 A;  1N32 M;  1G41 A;  2L7I A;  3KS8 A;  3D8L A;  4BLC A;  2XFT A;  3U6C A;  3JR5 A;  2XSZ A;  1K3W A;  3UMM A;  2LNH C;  1Q3B A;  4LJ9 A;  3SMP A;  1XWI A;  4FD2 A;  4LG2 A;  1XHB A;  1J5E M;  4NOO B;  5BPV A;  3R9X B;  2FFJ A;  4QNR A;  3EIE A;  2UUA M;  4JI3 M;  4GHA A;  1G8P A;  5FTM A;  1SXJ B;  1NSF A;  2VII A;  3KOX E;  1EE8 A;  3K92 A;  1KFV A;  3LVW A;  2YR0 A;  2F5P A;  3NWL A;  3UGJ A;  3U6D A;  1N33 M;  1Q3C A;  2RGH A;  3ILK A;  4LJ4 A;  4G4R A;  4NSR A;  1QQW A;  1XMQ M;  3MK6 A;  2QPA A;  4LF7 M;  4FWG A;  2CV2 A;  2CFO A;  2UU9 M;  3K1J A;  4L4U A;  3I51 A;  4AI6 A;  3HWS A;  1E9R A;  2R4E A;  3W0L B;  4OVZ B;  5KQ8 A;  2OQ4 A;  1TH2 A;  4L15 A;  1MU5 A;  4LJ5 A;  1C1K A;  4GC9 A;  5FTN A;  3SYK A;  3U6M A;  4D80 A;  3VK8 A;  4QOZ C;  4AKG A;  4JI8 M;  4B7F A;  4FCT A;  4JN6 A;  5KQD A;  1Z5B A;  3A45 A;  1IY0 A;  1L2C A;  4LGM A;  4DUZ M;  4LGY A;  3FUW A;  4NRW A;  3U5Z A;  3AFH A;  1GVN A;  4HL4 A;  2CV1 A;  4IBF A;  3RFW A;  2HCB A;  2BNK A;  2C9C A;  3VDP A;  1JR3 A;  3GPX A;  5LMN M;  5ITR A;  3SAS A;  4OU7 A;  4LRS A;  3M6A A;  3PFI A;  1I4W A;  1NJG A;  4LF9 M;  2Z3X A;  3FD9 A;  5EJC A;  3H4M A;  4KOD A;  4M0D A;  3GO8 A;  3KP0 E;  4AG5 A;  2QP9 X;  3U61 A;  4EIW A;  2QBY B;  3B9P A;  4DR5 M;  4MGH A;  5C1B A;  2ZM6 M;  2CHV A;  4RNA A;  4BBA A;  4LRT A;  3SBJ A;  2FE8 A;  1Z6T A;  4S12 A;  5EP1 A;  1R2Y A;  5H37 D;  3D8B A;  4X66 M;  2ERC A;  1IBL M;  1IY2 A;  3FUV A;  3M0E A;  3L26 A;  3GP1 A;  3GLI A;  3GLG A;  1NJF A;  1HR0 M;  1E94 E;  1XMO M;  1HT2 E;  3HJQ A;  2KZU A;  2C5R A;  1R6B X;  1XXH A;  3OTO M;  1QAO A;  4NXM M;  4IJE A;  2QCU A;  1IBM M;  3A98 B;  3GPU A;  4LFB M;  2DZN B;  4JI4 M;  1QAQ A;  2Y20 A;  3AV0 A;  1N36 M;  2BJW A;  3KOY E;  4LJA A;  2Q2E B;  3JR4 A;  3SAU A;  2C96 A;  1NNJ A;  4CGY B;  3J80 S;  3UJN A;  4RF0 A;  1FNN A;  3DZD A;  3HHY A;  3PNY A;  4M0W A;  3THG A;  1DGH B;  3KFU G;  3GRU A;  1J09 A;  4X62 M;  3HHZ A;  5JI2 E;  4GRI A;  2UUB M;  2XH9 A;  1ORY B;  1NY5 A;  2R45 A;  2O5R A;  3KOW E;  3VK7 A;  4GHL A;  3SFZ A;  1SXJ D;  2LWX A;  4MGZ E;  5JI3 E;  2XGN A;  4B3T M;  5E26 A;  4AKI A;  3HU2 A;  2ZAO A;  2P5T A;  2Z4R A;  1L8Q A;  3GQ3 A;  1Z59 A;  4M9Z A;  1GL7 A;  1I94 M;  1K3X A;  1QZM A;  2CEA A;  4Z8X A;  4IIW A;  1G4A E;  1D2N A;  3L2A A;  1QAN A;  3U6E A;  1NVM A;  1L1Z A;  4IBK A;  4K0K M;  3I4V A;  4WW0 A;  5EXT A;  3M7G A;  3AOE C;  3TWM A;  3FTF A;  4GC5 A;  4OX9 M;  2CV0 A;  4NXN M;  3HJS A;  1L2D A;  1L1T A;  2DWZ B;  1W5T A;  2HKJ A;  4FWH A;  4PD2 A;  2J7O A;  1DO2 A;  3GLF A;  4NRV A;  2H1R A;  3J2P B;  3GLH A;  4B7H A;  3IG8 A;  4LF8 M;  4YHH M;  2L7H A;  4IBB A;  3SMS A;  2YNM D;  4MH0 E;  4ZPX A;  2Z4S A;  2F5N A;  1HNW M;  1R7R A;  2FOI C;  2UXB M;  1IN4 A;  1DGF A;  4KLN A;  4AG6 A;  3U6L A;  3FUT A;  3SAT A;  4LFC M;  4MM3 B;  2XF3 A;  1E32 A;  4LJ6 A;  5EP2 A;  4G6Z A;  3VFD A;  5IWA M;  4LF4 M;  3GPP A;  1Q39 A;  3U5Z B;  4G4N A;  1SXJ C;  1HNZ M;  3TWK A;  1IXS B;  2R62 A;  3U6O A;  3NBI A;  1SXJ A;  3KSJ A;  3TE6 A;  1TH3 A;  4DV1 M;  2F4V M;  3E9S A;  4DR1 M;  3KP1 E;  5LMU M;  4FWD A;  4RF1 A;  1IQP A;  4JI6 M;  4NL4 H;  5ITY A;  5FSW A;  3FUU A;  4W5W A;  5FLX S;  3SAR A;  2YQZ A;  4HLQ A;  2EUC A;  3L29 A;  2M5Z A;  2RKO A;  4GH9 A;  3QAU A;  5KPT A;  3K8Z A;  5ITX A;  3DFZ A;  4GIT A;  4DV3 M;  1NNU C;  2M60 A;  2G5G X;  3U61 B;  2V1U A;  4OVZ A;  2KEB A;  4B7G A;  3C58 A;  3FUX A;  3UK6 A;  1DO0 A;  2EA0 A;  1Z5C A;  1DGG A;  1TH4 A;  1J7K A;  2FNA A;  5KPR A;  4QOS A;  3KS4 A;  4D82 A;  3GLI B;  4CIS A;  4CHT B;  3GLG B;  2K47 A;  3SAW A;  3A42 A;  1W5S A;  2LXE A;  2F5Q A;  3HHW A;  4LFA M;  2KA6 B;  2OPF A;  4B08 A;  4I5S A;  3MHV C;  3TWL A;  2V1C A;  1XNQ M;  2CHQ A;  2C9O A;  2ZBK B;  3PNV A;  4IBE A;  4DV0 M;  3U60 A;  1VDD A;  7CAT A;  2J7N A;  4DV6 M;  2F5O A;  3CTW B;  3UZU A;  4JI5 M;  3AL0 C;  4DV2 M;  1HQC A;  4MGI E;  4LJ8 A;  2Z7J A;  1IXR C;  4PCZ A;  4BB9 A;  4FVM A;  4TUW A;  5ITT A;  2NQ8 C;  1OFI A;  4X64 M;  2KRK A;  2QBY A;  5KO3 A;  3J81 S;  4DR4 M;  1OFH A;  2QZ4 A;  3VKH A;  3VDU A;  1NHW C;  4DV4 M;  1KYI A;  1YE9 A;  4D81 A;  1DGB A;  3CF2 A;  4KO8 A;  3ZC7 B;  4IBJ A;  2VQF M;  4LZJ A;  2DHR A;  5DYG A;  3JAM S;  2R4J A;  2XFS A;  5EXS A;  4P16 A;  3L27 A;  1HQY E;  1PM5 A;  1N75 A;  3T1Y M;  1GKI A;  2D7H A;  4R3D A;  2QEN A;  1N34 M;  1G59 A;  3GQ5 A;  3T15 A;  5E6J A;  1PJJ A;  1IBK M;  2UXC M;  4I81 A;  1HT1 E;  1LV7 A;  2Y21 A;  3KSX A;  4WUR A;  4DUY M;  3HHX A;  3J7A S;  3ZH9 B;  3GRV A;  1N77 A;  4L16 A;  4DR2 M;  4AQY M;  4IBC A;  2RGO A;  4L78 A;  3AKZ A;  2XZF A;  2YFQ A;  3GQ4 A;  1X37 A;  3KVW A;  4IJF A;  1IN5 A;  4LCB A;  3SHF A;  3SC3 A;  4JI2 M;  3HJ8 A;  5EQT A;  1DGH A;  3AOE A;  4LZZ A;  2D7E A;  4JI0 M;  1QAM A;  4I8O A;  4M9S A;  4GIP A;  4JI1 M;  3GRY A;  4FCV A;  3WHL A;  1Z5A A;  1QVR A;  3Q8X A;  3CF0 A;  1IN6 A;  2X49 A;  5IRE B;  4DV5 M;  1L2B A;  3PVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...