4LFBM

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lfbM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lfbM02
2F5OA 3SASA 3TWLA 5BR8M 1FJGM 4X64M 2F5PA 4MB7A 2E5LM 4AQYM 1R2YA 5ITUA 4OX9M 1KFVA 3U6OA 1NNJA 1IBKM 3SBJA 4JI7M 3U6SA 2HKJA 1L2CA 3A42A 4DV3M 3VK7A 4LF8M 3T1HM 1J5EM 4G4QA 4JI3M 4NXNM 3DOAA 3SAWA 4K0KM 4DR6M 4NRWA 5IT9S 1XMQM 3GPYA 1HNZM 3SATA 2UUAM 4DV5M 3GPXA 4GKJM 1K82A 3U6EA 1N33M 2XZFA 1L2BA 2F5NA 1N34M 3OTOM 4PDIA 1Z59A 4DV1M 5IWAM 3GQ4A 2OQ4A 1MU5A 3SAUA 1IBMM 4PD2A 4DR3M 3U6PA 1PJIA 5ITRA 4DV7M 3J80S 1L1ZA 4KHPM 4B3SM 4PCZA 3SAVA 4DR4M 4B3RM 2UXBM 5FLXS 4ITQA 3GPUA 4DV0M 4LF6M 4DV6M 2EA0A 4JI2M 1N36M 4JI1M 1K3XA 4JYAM 1TDZA 1TDHA 2HHHM 5LMUM 4JV5M 1MX0A 4JI8M 4DV4M 4X65M 4G4NA 1N32M 1Q3BA 3W0FA 5ITQA 4DUYM 2F5QA 1XC8A 3U6DA 1XNQM 4LFCM 4NRVA 5ITYA 2XZUA 4DV2M 4LFBM 3TWKA 3JR4A 4JI4M 4G4OA 1I94M 3T1YM 4GKKM 2ZBKB 1XNRM 4G4RA 3SARA 5A2QS 4CISA 1Q39A 1Q3CA 4LF5M 4YY3M 3U6QA 1PJJA 2UU9M 2VQFM 3J81S 3GP1A 1L2DA 1L1TA 3U6CA 2Q2EB 2UUBM 3A46A 3GPPA 4LF4M 4DUZM 4JI0M 2UUCM 4DR2M 4LF9M 4DR7M 3TWMA 1R2ZA 4LF7M 2UXDM 1HNWM 3GO8A 4JI6M 1Z5CA 4LFAM 3VK8A 4NXMM 4PDGA 1HNXM 2ZM6M 3JAMS 4X66M 3U6MA 5ITXA 3GQ5A 2F4VM 1PM5A 3C58A 2VQEM 1IBLM 1Z5AA 5LMNM 1HR0M 2UXCM 4DR5M 4YHHM 1K3WA 4DR1M 4B3MM 2F5SA 4JI5M 2OPFA 4B3TM 3A45A 1Z5BA 5ITXE 1XMOM 1EE8A 3U6LA 3JR5A 4X62M 3J7AS 3GQ3A 5ITTA
chains in the Genus database with same CATH superfamily
2J5YA 1FJGM 4BLCA 1NJGA 1QUSA 3E4RA 1A5TA 2R18A 1BVSA 3KDSE 1D0LA 4FD2A 4MB7A 4NC6A 4L8RC 4AI6A 2V1UA 3LVVA 3FE3A 3FUVA 2JXNA 3LCVB 1W5TA 3CF2A 3HKPA 4AKGA 2R45A 2QBYB 3M6AA 1JB0F 1NHWC 4WURA 4P17A 4JI7M 2WSEF 4GEWA 2XF3A 2CE7A 1S3SA 4LZJA 1N77A 2ZTDA 2DWMA 2LHCA 3B7NA 5FTLA 5FTJA 5DYGA 2X8AA 2QNJA 3T1HM 3I51A 1NY5A 2D7GA 3V76A 1HNZM 2N35A 3HY5A 4R3DA 1GJSA 1N75A 1MJGM 2KNAA 3HZJA 4GKJM 3U6EA 1T43A 1OKSA 1L2BA 2BJWA 2DWZB 3J27B 2DHYA 2I7PA 1R4GA 3GQ4A 3SAUA 4DR3M 3U6PA 1D0MA 1IN5A 1YSYA 3KOWE 3FUTA 5ITRA 4FCTA 4DV7M 1IXSB 1WGLA 2Z4SA 1IY2A 1TH3A 2XH9A 1GJTA 3VFDA 2FNAA 2DWLA 4B3RM 2UXBM 5KO3A 2J7OA 2Y0TA 3GPUA 4DV6M 4CHTB 3AOGA 3K8ZA 4CGYB 3HJ8A 3RGPA 3F92A 3GLIB 3HX3A 1K3XA 1TDZA 4IBKA 1TF0B 4AW4A 1HQYE 5LMUM 2B3TA 4JI8M 4JV5M 3GLGB 3FUXA 2CV1A 2F5QA 1MN3A 1QQWA 1D0KA 4M9XA 3L26A 1XNQM 3L2AA 4NRVA 2L4FA 2R0IA 4DV2M 4LFBM 2DAEA 1DGHA 1T3TA 4JI4M 1IN7A 4G4OA 1QYRA 1V33A 3FYCA 2O01F 2CFOA 2LHGA 4IBJA 3HU1A 4XGIA 4G4RA 1G59A 4FW9A 4GKKM 5A2QS 1OJLA 1NO1A 2R6FA 1Q3CA 3KOYE 1JR3D 2JY7A 2ERCA 1DO0A 3KVWA 3U6QA 1IXZA 3GLFA 4II7A 3DZDA 3GRRA 1L2DA 3U6CA 2LVNC 2VF7A 3J7BA 1GLNA 3SHFA 4CJ6A 2LBCA 4L16A 4Z6YA 4LF4M 2KA6B 1ZMUA 2J7NA 4I81A 5FTKA 1QAQA 4DR7M 2BNKA 3TWMA 2V1CA 1R2ZA 1N78A 1Q02A 3AJIB 1Z5CA 4LFAM 3VK8A 4NXMM 1GL7A 1LTMA 1Z6TA 3SYLA 4D81A 1OAOC 1GVNA 2RGHA 3EIHA 3JAMS 3KP1E 3SC3A 4WP2A 5ITXA 2G3QA 4AG6A 3TL4X 3GQ5A 2F4VM 2VQEM 4Z8XA 2CRUA 2KNZA 2UXCM 4DR5M 1QZMA 2QSFX 3UK6A 4LJAA 2OOBA 1NY6A 4KT0F 2F5SA 4B3MM 1JQJC 2MJ5B 2OPFA 3D8LA 1QAOA 4GC5A 3JR5A 1HT2E 1DGGA 3SASA 3TWLA 3ILKA 5EP4A 3VLFB 1WJ7A 2FS1A 3CF0A 4FWHA 4LY6A 3I04M 2QZ4A 3U60A 3IG8A 5ITUA 1NJFA 1W5SA 2KDLA 1YUBA 1VQ1A 3FTDA 5EXTA 1DO2A 4BBAA 2M60A 5EXXA 4I5SA 2OOAA 5EP2A 1IBKM 4IJEA 1UM8A 2HCBA 3PNYA 1Y8GA 4RF1A 5EQTA 2EKFA 3U6SA 3AL0C 1L2CA 2QP9X 1HQCA 3HU3A 2KRUA 3AOEC 2CUZA 2L7HA 4DV3M 3VK7A 4FCWA 1F4IA 2XGNA 2JY6B 3TE6A 2JY5A 4ZPXA 4JN6A 4G4QA 2FFJA 3TPZA 3HHXA 1LV7A 4DR6M 4NRWA 5IT9S 1VDDA 2LH0A 2UUAM 3SMPA 1N33M 2EJSA 4GHAA 3QYBA 1JR3A 1N34M 4PDIA 2W82A 3K92A 2O25A 3M0EA 4QOSA 8CATA 1OTRA 4B7HA 1ORYB 5EXPA 1ZAEA 2DAKA 4GH9A 4AKIA 3B7ZA 1QVRA 3GRVA 3NBIA 4MGZE 3M7GA 3UMMA 4NOOB 3HJSA 4B3SM 2C9CA 3SAVA 1QZEA 4R7GA 5FLXS 4AZFA 1G4AE 7CATA 2QCUA 3FRIA 3CF6E 2XLJA 3K1JA 2MH8A 4DV0M 2CP8A 2EA0A 1ZMVA 1OIPA 2JWSA 4JI2M 4JI1M 3B74A 4MGIE 1TGUA 4L4UA 1NV9A 1HT1E 1TDHA 2Y0QA 2R4EA 4DV4M 1Q3BA 2HAKA 1PJSA 5ITQA 4REZA 3U6DA 3PXGA 3ZC7B 4QNMA 2G8LA 1IXSA 2CHGA 4B08A 2ZANA 2XFSA 1SXJE 1TTEA 3U61B 3JR4A 4BB9A 3FRHA 4Y28F 5IZ7D 1XB2B 2MR9A 3H4MA 3LW5F 1T6OA 3RFWA 1NV8A 2R62A 3BBZA 3SARA 4HEOA 4IBEA 3GLIA 1TR8A 4IJFA 1H6UA 2CHQA 1HJPA 2OO9A 3KSJA 4GC9A 4YY3M 5DNYA 2APLA 3B7QA 5IREB 3U5ZB 2V6ZM 3I01M 2UU9M 2VQFM 1E94E 5EXSA 2DAIA 4FCVA 1L1TA 3NBXX 3NWLA 5E26A 3CTWB 5DYIA 2JY8A 4DUZM 4JI0M 2UUCM 3HHWA 2RGOA 2C96A 2WSCF 2BJVA 3SYKA 2LVQD 1P3QQ 1DGFA 2EO2A 3GO8A 3K9PA 3GRYA 5E6JA 3BOSA 4IBIA 2ZM6M 2DKLA 3MMPA 5H37D 3GLFB 4G6ZA 2R46A 3W0LB 1E9SA 3VKHA 2DAGA 1IM2A 1GABA 2D7HA 4HLQA 2K47A 2DZLA 3LMMA 1YLAA 2A5YB 4LJ8A 4DR1M 4OU7A 2K0BX 3E9SA 3H4JA 4B3TM 2DXIA 3A45A 1IY1A 1WIVA 4QNRA 4OW0A 2O5RA 1XMOM 2KHHA 4I4LA 3HGIA 3KS8A 3C3EA 3GQ3A 5ITTA 2F5OA 1PJTA 4I8OA 1IQPA 3W67A 1VEGA 5BR8M 4X64M 3PNVA 1G71A 1SG9A 1VG5A 3FYDA 1ZV1A 3VDUA 1J09A 1R7RA 4EIWA 1DV0A 2JNHA 4HL4A 4B7GA 2YFQA 4F2LA 1KFVA 4IBBA 3U6OA 1NVMA 3U61A 2CEAA 2H1RA 2WZJA 3IHPA 1NNJA 3ZH9B 3D8BA 2HKJA 2YR0A 3UJNA 4P16A 2DENA 2KRKA 2XEPA 3FD9A 2L09A 3GLGE 2YQZA 3B9PA 4Q7JA 3HHYA 3SAWA 4K0KM 2C9OA 3KOXE 2H5XA 3GLHE 2GNOA 4DV5M 1QDRA 3QWLA 3LQRA 2Z3XA 4QHTA 1K82A 3AOEA 2F5NA 4MGKE 3OTOM 1VDLA 2C98A 4DV1M 1IBMM 2Y21A 1QANA 3U5ZA 3MJ5A 3GLHB 2LVPC 1CUKA 1D2NA 3GLIE 1L1ZA 3HWSA 4IIWA 4B7FA 1EIJA 4PCZA 2CWBA 5KPTA 5JI3E 2Z4RA 2LNHC 2AHMA 5KPRA 1E9RA 2DAMA 4L15A 1NSFA 1XXHA 5C1BA 3SFZA 2R4JA 5KQ8A 2HHHM 2ZAMA 1N32M 2KZSA 4G4NA 2KXEA 3W0FA 1I4WA 1XC8A 4LRSA 1UFZA 3R9XB 2XZUA 3LQQA 1NNUC 1G8PA 4GMQA 3TWKA 4S12A 3ZQJA 5KQDA 4M9SA 3HJQA 1R5LA 2ZBKB 1XNRM 3SHGB 1VEKA 3BXWA 4NSRA 4CISA 1Q39A 3VKGA 3U60B 1DGBA 2QQ8A 2RKOA 4FWGA 4UN2B 4DBGB 5F3WA 3IECA 3AFHA 4MGYE 1WXQA 3J81S 1QAMA 3GP1A 1KSFX 4LJ4A 4WW0A 5BPVA 2X49A 4IBFA 4RKUF 1SXJC 1OIZA 4AKHA 1IY0A 2DHRA 2M5ZA 2VIIA 4D80A 1IFYA 5GKNA 4TUWA 2L7IA 4FWDA 1XXHB 2KW0A 3W68A 1C1KA 4LF7M 1HNWM 1IN4A 2UXDM 5C18A 4NSOB 3EIEA 4GRIA 3SMSA 2QBYA 4PDGA 3HHZA 1HNXM 4X66M 2LXEA 1X37A 2YNMD 4MH0E 1XHBA 4W5WA 3C58A 4R71A 1VEJA 2QENA 1IBLM 1G41A 2I7NA 5LMNM 2JA2A 3FTEA 1IN6A 2EUCA 3QYEA 4F1IA 1K3WA 2FOIC 4M9ZA 2VDBB 1J7KA 3DFZA 4JI5M 1Z5BA 3C3DA 3GRUA 5ITXE 4XK8F 4AG5A 1EE8A 3U6LA 4X62M 2K6BA 1GKIA 3T15A 3ZCBB 4JI6M 3J7AS 2BWEA 4IBGA 2LVOC 2CV0A 1YE9A 1E32A 1OFIA 1WGNA 2QHOB 3FUUA 4GITA 2F5PA 4G3OA 1AIPC 4M0DA 4KODA 4A3VB 1GL6A 1XXHE 3KP0E 2X4AA 3K9OA 4AQYM 1R2YA 2E5LM 2LVAA 4OX9M 1V92A 3K2LA 2KNVA 2EKKA 4NL4H 3Q8GA 2CHVA 4M0WA 2DI0A 4MGHA 3SBJA 2ZTCA 2FE8A 3LVWA 3A42A 4JXJA 4LJ9A 4LGMA 3L28A 4RNAA 3T38A 3KFUG 3HU2A 3B89A 2XFTA 3L27A 3LCUA 4KO8A 3CGWA 4LF8M 2P5TA 3E46A 2ZAOA 1J5EM 5DFLA 4JI3M 4NXNM 3DOAA 1SXJD 2L6OA 3GPYA 3QAUA 2WSFF 3THGA 5FSWA 1XMQM 2JZ0A 3SATA 3RGSA 3GPXA 1SXJB 4LG2A 3A98B 1L8QA 3KSXA 5EJCA 3GLHA 2XZFA 1C7YA 1TH2A 1Z59A 3VDPA 2DNAA 5IWAM 3AV0A 2MROB 1MU5A 1NHGC 3GLGA 4PD2A 3FKEA 2OQ4A 1PJIA 3FTFA 1JR3E 1G3IA 1ZQ9A 3UZUA 1WHCA 3KW6A 3J80S 3RE8A 3Q8XA 2RRUA 4KHPM 1ZMWA 2FH0A 4DR4M 4QHSA 4ITQA 2G5GX 4LF6M 4KLNA 3I4YA 3MK6A 1FNNA 1V34A 1N36M 2HWJA 2Y20A 4JYAM 3C9PA 3L29A 2DZNB 4IBDA 4LGYA 5FTMA 1MX0A 4X65M 2R44A 3J2PB 4DUYM 1EFUB 1XWIA 3FTCA 3T6PA 5JI2E 4LFCM 2HL7A 5L8RF 2JZ1A 2LTUA 2LWXA 4LCBA 4LJ7A 5ITYA 3FUWA 1QDTA 1TH4A 1WR1B 3TQSA 2C99A 2DVWB 1PGYA 1I94M 3T1YM 1PJQA 3E21A 4L78A 3DA1A 1OAIA 5EP3A 3I4VA 4LJ6A 3KS4A 4RF0A 4LF5M 2BWBA 3R8FA 2CV2A 2Z8YM 4XBOA 1AUAA 3KXEC 5EP1A 1PJJA 2L2DA 2QPAA 5FTNA 4D82A 3PVSA 1KYIA 4LZZA 3PFIA 1PRBA 2Q2EB 2UUBM 4IBCA 3A46A 3IG5A 1QUTA 4ANRA 3GPPA 4CIZA 4LRTA 4MM3B 4DR2M 4LF9M 2Z7JA 4FVMA 3KOZE 4L6V6 1OQYA 2C5RA 4GIPA 2XSZA 3UGJA 2D7EA 1SXJA 3L25A 1GO5A 3WHKA 3WHLA 1IN8A 2K9DA 2DZOB 3U6MA 2VF8A 4PT5A 1PM5A 4GHLA 2L4EA 4OVZA 1DGHB 1Z5AA 1HR0M 1R6BX 4YHHM 2JUJA 3MHVC 2KEBA 4OVZB 3GLFE 4QOZC 3AKZA 2JP7A 5KPZA 2MGWA 2GQFA 4LJ5A 1OFHA 2XSZD 2DWNA 2R65A 2NQ8C 1IXRC 2KZUA 1RU3A
chains in the Genus database with same CATH topology
1FJGM 4BLCA 1NJGA 3E4RA 2R18A 4MB7A 3KDSE 4FD2A 4AI6A 4L8RC 2V1UA 3LVVA 3FUVA 1W5TA 3CF2A 3HKPA 4AKGA 2R45A 3M6AA 1NHWC 4WURA 4JI7M 2XF3A 2CE7A 1S3SA 4LZJA 1N77A 2DWMA 5FTLA 5FTJA 5DYGA 2X8AA 3T1HM 3I51A 1NY5A 2D7GA 1HNZM 4R3DA 1N75A 4GKJM 3U6EA 1L2BA 2BJWA 2DWZB 3J27B 2I7PA 3GQ4A 3SAUA 4DR3M 3U6PA 1IN5A 1YSYA 3KOWE 3FUTA 5ITRA 4FCTA 4DV7M 1IXSB 2Z4SA 1IY2A 1TH3A 2XH9A 3VFDA 2FNAA 2DWLA 4B3RM 2UXBM 5KO3A 2J7OA 2Y0TA 3GPUA 4DV6M 4CHTB 3AOGA 3K8ZA 4CGYB 3HJ8A 3RGPA 3GLIB 1K3XA 1TDZA 4IBKA 4AW4A 1HQYE 5LMUM 4JV5M 4JI8M 3GLGB 3FUXA 2CV1A 2F5QA 1QQWA 4M9XA 3L26A 1XNQM 3L2AA 4NRVA 4DV2M 4LFBM 1DGHA 1T3TA 4JI4M 1IN7A 4G4OA 1QYRA 3FYCA 4IBJA 4GKKM 2CFOA 4XGIA 3HU1A 4G4RA 1G59A 4FW9A 5A2QS 1OJLA 1Q3CA 3KOYE 1JR3D 2ERCA 1DO0A 3KVWA 3U6QA 1IXZA 3GLFA 4II7A 3DZDA 3GRRA 1L2DA 3U6CA 3J7BA 3SHFA 1GLNA 4Z6YA 4L16A 4LF4M 2KA6B 2J7NA 4I81A 5FTKA 1QAQA 4DR7M 2BNKA 3TWMA 2V1CA 1R2ZA 1N78A 3AJIB 1Z5CA 4LFAM 3VK8A 4NXMM 1GL7A 1Z6TA 3SYLA 4D81A 2RGHA 1GVNA 3EIHA 3JAMS 3KP1E 3SC3A 5ITXA 4AG6A 3TL4X 3GQ5A 2F4VM 2VQEM 4Z8XA 2UXCM 4DR5M 1QZMA 3UK6A 4LJAA 1NY6A 4B3MM 2F5SA 1JQJC 2OPFA 3D8LA 1QAOA 4GC5A 3JR5A 1HT2E 1DGGA 3SASA 3TWLA 3ILKA 5EP4A 3VLFB 3CF0A 4FWHA 4LY6A 2QZ4A 3U60A 3IG8A 5ITUA 1NJFA 1W5SA 1YUBA 3FTDA 5EXTA 1DO2A 4BBAA 2M60A 5EXXA 4I5SA 5EP2A 1IBKM 4IJEA 1UM8A 2HCBA 3PNYA 4RF1A 5EQTA 3U6SA 3AL0C 1L2CA 2QP9X 1HQCA 3HU3A 2KRUA 3AOEC 2CUZA 2L7HA 4DV3M 3VK7A 4FCWA 2XGNA 3TE6A 4ZPXA 4JN6A 4G4QA 2FFJA 3TPZA 3HHXA 1LV7A 4DR6M 4NRWA 5IT9S 1VDDA 2LH0A 2UUAM 3SMPA 1N33M 4GHAA 1JR3A 1N34M 4PDIA 2W82A 3K92A 3M0EA 4QOSA 8CATA 4B7HA 1ORYB 5EXPA 1ZAEA 4GH9A 4AKIA 3NBIA 1QVRA 3GRVA 4MGZE 3UMMA 3M7GA 4NOOB 3HJSA 4B3SM 2C9CA 3SAVA 4R7GA 5FLXS 4AZFA 1G4AE 7CATA 2QCUA 2XLJA 3CF6E 4DV0M 3K1JA 2EA0A 4JI2M 4JI1M 4MGIE 1TGUA 4L4UA 1HT1E 1TDHA 2Y0QA 2R4EA 4DV4M 1Q3BA 5ITQA 4REZA 3U6DA 3PXGA 3ZC7B 4QNMA 2G8LA 2CHGA 4B08A 2ZANA 2XFSA 1SXJE 3U61B 3JR4A 4BB9A 5IZ7D 3H4MA 3RFWA 2R62A 3SARA 4IBEA 3GLIA 4IJFA 1H6UA 2CHQA 4YY3M 5DNYA 3KSJA 4GC9A 5IREB 3U5ZB 2V6ZM 2UU9M 2VQFM 1E94E 5EXSA 4FCVA 1L1TA 3NWLA 5E26A 3CTWB 5DYIA 4DUZM 4JI0M 2UUCM 3HHWA 2RGOA 2C96A 2BJVA 3SYKA 1DGFA 2EO2A 3GO8A 3GRYA 5E6JA 3BOSA 4IBIA 2ZM6M 5H37D 3GLFB 4G6ZA 2R46A 3W0LB 1E9SA 3VKHA 1IM2A 2D7HA 4HLQA 2K47A 3LMMA 2A5YB 4LJ8A 4DR1M 4OU7A 3E9SA 4B3TM 2DXIA 3A45A 1IY1A 4QNRA 4OW0A 2O5RA 1XMOM 4I4LA 3HGIA 3KS8A 3GQ3A 5ITTA 2F5OA 4I8OA 1IQPA 5BR8M 4X64M 3PNVA 3FYDA 3VDUA 1J09A 1R7RA 4EIWA 4HL4A 4B7GA 2YFQA 1KFVA 4IBBA 3U6OA 1NVMA 3U61A 2CEAA 2H1RA 1NNJA 3ZH9B 3D8BA 2HKJA 2YR0A 3UJNA 4P16A 2KRKA 2XEPA 3FD9A 2L09A 2YQZA 3B9PA 3HHYA 3SAWA 4K0KM 2C9OA 3KOXE 4DV5M 2Z3XA 3QWLA 3LQRA 1K82A 4QHTA 3AOEA 2F5NA 4MGKE 3OTOM 2C98A 4DV1M 1IBMM 2Y21A 1QANA 3U5ZA 3MJ5A 3GLHB 1D2NA 1L1ZA 3HWSA 4IIWA 4B7FA 4PCZA 5KPTA 5JI3E 2Z4RA 2LNHC 2AHMA 5KPRA 1E9RA 4L15A 1NSFA 1XXHA 5C1BA 3SFZA 2R4JA 5KQ8A 2HHHM 2ZAMA 1N32M 2KZSA 4G4NA 2KXEA 3W0FA 1I4WA 1XC8A 4LRSA 3R9XB 2XZUA 3LQQA 1NNUC 1G8PA 4GMQA 3TWKA 4S12A 5KQDA 4M9SA 3HJQA 2ZBKB 1XNRM 3SHGB 4NSRA 4CISA 1Q39A 3VKGA 3U60B 1DGBA 2RKOA 4FWGA 5F3WA 3AFHA 4MGYE 1WXQA 3J81S 1QAMA 3GP1A 1KSFX 4LJ4A 4WW0A 5BPVA 2X49A 4IBFA 1SXJC 4AKHA 1IY0A 2DHRA 2M5ZA 2VIIA 4D80A 5GKNA 4TUWA 2L7IA 4FWDA 1XXHB 2KW0A 1C1KA 4LF7M 1HNWM 1IN4A 2UXDM 5C18A 4NSOB 3EIEA 4GRIA 3SMSA 2QBYA 4PDGA 3HHZA 1HNXM 4X66M 2LXEA 1X37A 2YNMD 4MH0E 1XHBA 4W5WA 3C58A 2QENA 1IBLM 1G41A 2I7NA 5LMNM 2JA2A 3FTEA 1IN6A 2EUCA 1K3WA 2FOIC 4M9ZA 1J7KA 3DFZA 4JI5M 1Z5BA 3GRUA 5ITXE 4AG5A 1EE8A 3U6LA 4X62M 1GKIA 3T15A 3J7AS 3ZCBB 4JI6M 4IBGA 2CV0A 1YE9A 1E32A 1OFIA 3FUUA 4GITA 2F5PA 4M0DA 4KODA 4A3VB 1GL6A 3KP0E 2E5LM 2X4AA 4AQYM 1R2YA 4OX9M 3K2LA 4NL4H 2CHVA 4M0WA 4MGHA 3SBJA 2FE8A 3LVWA 3A42A 4JXJA 4LJ9A 4LGMA 3L28A 4RNAA 3T38A 3KFUG 3HU2A 2XFTA 3L27A 4KO8A 4LF8M 2P5TA 2ZAOA 1J5EM 4JI3M 4NXNM 3DOAA 1SXJD 2L6OA 3GPYA 3QAUA 3THGA 5FSWA 1XMQM 3SATA 4LG2A 3RGSA 3GPXA 1SXJB 3A98B 1L8QA 3KSXA 5EJCA 3GLHA 2XZFA 1TH2A 1Z59A 3VDPA 5IWAM 3AV0A 2OQ4A 1MU5A 1NHGC 3GLGA 4PD2A 3FKEA 3FTFA 1PJIA 1G3IA 1ZQ9A 3UZUA 3KW6A 3J80S 3RE8A 3Q8XA 4KHPM 4DR4M 4QHSA 4ITQA 2G5GX 4LF6M 4KLNA 3I4YA 3MK6A 1FNNA 1N36M 2Y20A 4JYAM 3L29A 2DZNB 4IBDA 4LGYA 5FTMA 1MX0A 4X65M 3J2PB 4DUYM 3FTCA 1XWIA 5JI2E 4LFCM 2HL7A 2LWXA 5ITYA 4LCBA 4LJ7A 3FUWA 1TH4A 3TQSA 2C99A 2DVWB 1I94M 3T1YM 4L78A 3DA1A 5EP3A 3I4VA 4LJ6A 3KS4A 4RF0A 4LF5M 3R8FA 2CV2A 4XBOA 3KXEC 1PJJA 5EP1A 2QPAA 5FTNA 4D82A 3PVSA 1KYIA 4LZZA 3PFIA 2Q2EB 2UUBM 4IBCA 3A46A 3IG5A 3GPPA 4LRTA 4MM3B 4DR2M 4LF9M 2Z7JA 4FVMA 3KOZE 2C5RA 4GIPA 2XSZA 3UGJA 2D7EA 1SXJA 3L25A 3WHKA 3WHLA 1IN8A 3U6MA 2DZOB 4PT5A 1PM5A 4GHLA 4OVZA 1DGHB 1Z5AA 1HR0M 1R6BX 4YHHM 3MHVC 2KEBA 4OVZB 4QOZC 3AKZA 5KPZA 4LJ5A 1OFHA 2XSZD 2DWNA 2R65A 2NQ8C 1IXRC 2KZUA 2QBYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5O A;  3SAS A;  3TWL A;  5BR8 M;  1FJG M;  4X64 M;  2F5P A;  4MB7 A;  2E5L M;  4AQY M;  1R2Y A;  5ITU A;  4OX9 M;  1KFV A;  3U6O A;  1NNJ A;  1IBK M;  3SBJ A;  4JI7 M;  3U6S A;  2HKJ A;  1L2C A;  3A42 A;  4DV3 M;  3VK7 A;  4LF8 M;  3T1H M;  1J5E M;  4G4Q A;  4JI3 M;  4NXN M;  3DOA A;  3SAW A;  4K0K M;  4DR6 M;  4NRW A;  5IT9 S;  1XMQ M;  3GPY A;  1HNZ M;  3SAT A;  2UUA M;  4DV5 M;  3GPX A;  4GKJ M;  1K82 A;  3U6E A;  1N33 M;  2XZF A;  1L2B A;  2F5N A;  1N34 M;  3OTO M;  4PDI A;  1Z59 A;  4DV1 M;  5IWA M;  3GQ4 A;  2OQ4 A;  1MU5 A;  3SAU A;  1IBM M;  4PD2 A;  4DR3 M;  3U6P A;  1PJI A;  5ITR A;  4DV7 M;  3J80 S;  1L1Z A;  4KHP M;  4B3S M;  4PCZ A;  3SAV A;  4DR4 M;  4B3R M;  2UXB M;  5FLX S;  4ITQ A;  3GPU A;  4DV0 M;  4LF6 M;  4DV6 M;  2EA0 A;  4JI2 M;  1N36 M;  4JI1 M;  1K3X A;  4JYA M;  1TDZ A;  1TDH A;  2HHH M;  5LMU M;  4JV5 M;  1MX0 A;  4JI8 M;  4DV4 M;  4X65 M;  4G4N A;  1N32 M;  1Q3B A;  3W0F A;  5ITQ A;  4DUY M;  2F5Q A;  1XC8 A;  3U6D A;  1XNQ M;  4LFC M;  4NRV A;  5ITY A;  2XZU A;  4DV2 M;  4LFB M;  3TWK A;  3JR4 A;  4JI4 M;  4G4O A;  1I94 M;  3T1Y M;  4GKK M;  2ZBK B;  1XNR M;  4G4R A;  3SAR A;  5A2Q S;  4CIS A;  1Q39 A;  1Q3C A;  4LF5 M;  4YY3 M;  3U6Q A;  1PJJ A;  2UU9 M;  2VQF M;  3J81 S;  3GP1 A;  1L2D A;  1L1T A;  3U6C A;  2Q2E B;  2UUB M;  3A46 A;  3GPP A;  4LF4 M;  4DUZ M;  4JI0 M;  2UUC M;  4DR2 M;  4LF9 M;  4DR7 M;  3TWM A;  1R2Z A;  4LF7 M;  2UXD M;  1HNW M;  3GO8 A;  4JI6 M;  1Z5C A;  4LFA M;  3VK8 A;  4NXM M;  4PDG A;  1HNX M;  2ZM6 M;  3JAM S;  4X66 M;  3U6M A;  5ITX A;  3GQ5 A;  2F4V M;  1PM5 A;  3C58 A;  2VQE M;  1IBL M;  1Z5A A;  5LMN M;  1HR0 M;  2UXC M;  4DR5 M;  4YHH M;  1K3W A;  4DR1 M;  4B3M M;  2F5S A;  4JI5 M;  2OPF A;  4B3T M;  3A45 A;  1Z5B A;  5ITX E;  1XMO M;  1EE8 A;  3U6L A;  3JR5 A;  4X62 M;  3J7A S;  3GQ3 A;  5ITT A; 
#chains in the Genus database with same CATH topology
 2J5Y A;  1FJG M;  4BLC A;  1NJG A;  1QUS A;  3E4R A;  1A5T A;  2R18 A;  1BVS A;  3KDS E;  1D0L A;  4FD2 A;  4MB7 A;  4NC6 A;  4L8R C;  4AI6 A;  2V1U A;  3LVV A;  3FE3 A;  3FUV A;  2JXN A;  3LCV B;  1W5T A;  3CF2 A;  3HKP A;  4AKG A;  2R45 A;  2QBY B;  3M6A A;  1JB0 F;  1NHW C;  4WUR A;  4P17 A;  4JI7 M;  2WSE F;  4GEW A;  2XF3 A;  2CE7 A;  1S3S A;  4LZJ A;  1N77 A;  2ZTD A;  2DWM A;  2LHC A;  3B7N A;  5FTL A;  5FTJ A;  5DYG A;  2X8A A;  2QNJ A;  3T1H M;  3I51 A;  1NY5 A;  2D7G A;  3V76 A;  1HNZ M;  2N35 A;  3HY5 A;  4R3D A;  1GJS A;  1N75 A;  1MJG M;  2KNA A;  3HZJ A;  4GKJ M;  3U6E A;  1T43 A;  1OKS A;  1L2B A;  2BJW A;  2DWZ B;  3J27 B;  2DHY A;  2I7P A;  1R4G A;  3GQ4 A;  3SAU A;  4DR3 M;  3U6P A;  1D0M A;  1IN5 A;  1YSY A;  3KOW E;  3FUT A;  5ITR A;  4FCT A;  4DV7 M;  1IXS B;  1WGL A;  2Z4S A;  1IY2 A;  1TH3 A;  2XH9 A;  1GJT A;  3VFD A;  2FNA A;  2DWL A;  4B3R M;  2UXB M;  5KO3 A;  2J7O A;  2Y0T A;  3GPU A;  4DV6 M;  4CHT B;  3AOG A;  3K8Z A;  4CGY B;  3HJ8 A;  3RGP A;  3F92 A;  3GLI B;  3HX3 A;  1K3X A;  1TDZ A;  4IBK A;  1TF0 B;  4AW4 A;  1HQY E;  5LMU M;  2B3T A;  4JI8 M;  4JV5 M;  3GLG B;  3FUX A;  2CV1 A;  2F5Q A;  1MN3 A;  1QQW A;  1D0K A;  4M9X A;  3L26 A;  1XNQ M;  3L2A A;  4NRV A;  2L4F A;  2R0I A;  4DV2 M;  4LFB M;  2DAE A;  1DGH A;  1T3T A;  4JI4 M;  1IN7 A;  4G4O A;  1QYR A;  1V33 A;  3FYC A;  2O01 F;  2CFO A;  2LHG A;  4IBJ A;  3HU1 A;  4XGI A;  4G4R A;  1G59 A;  4FW9 A;  4GKK M;  5A2Q S;  1OJL A;  1NO1 A;  2R6F A;  1Q3C A;  3KOY E;  1JR3 D;  2JY7 A;  2ERC A;  1DO0 A;  3KVW A;  3U6Q A;  1IXZ A;  3GLF A;  4II7 A;  3DZD A;  3GRR A;  1L2D A;  3U6C A;  2LVN C;  2VF7 A;  3J7B A;  1GLN A;  3SHF A;  4CJ6 A;  2LBC A;  4L16 A;  4Z6Y A;  4LF4 M;  2KA6 B;  1ZMU A;  2J7N A;  4I81 A;  5FTK A;  1QAQ A;  4DR7 M;  2BNK A;  3TWM A;  2V1C A;  1R2Z A;  1N78 A;  1Q02 A;  3AJI B;  1Z5C A;  4LFA M;  3VK8 A;  4NXM M;  1GL7 A;  1LTM A;  1Z6T A;  3SYL A;  4D81 A;  1OAO C;  1GVN A;  2RGH A;  3EIH A;  3JAM S;  3KP1 E;  3SC3 A;  4WP2 A;  5ITX A;  2G3Q A;  4AG6 A;  3TL4 X;  3GQ5 A;  2F4V M;  2VQE M;  4Z8X A;  2CRU A;  2KNZ A;  2UXC M;  4DR5 M;  1QZM A;  2QSF X;  3UK6 A;  4LJA A;  2OOB A;  1NY6 A;  4KT0 F;  2F5S A;  4B3M M;  1JQJ C;  2MJ5 B;  2OPF A;  3D8L A;  1QAO A;  4GC5 A;  3JR5 A;  1HT2 E;  1DGG A;  3SAS A;  3TWL A;  3ILK A;  5EP4 A;  3VLF B;  1WJ7 A;  2FS1 A;  3CF0 A;  4FWH A;  4LY6 A;  3I04 M;  2QZ4 A;  3U60 A;  3IG8 A;  5ITU A;  1NJF A;  1W5S A;  2KDL A;  1YUB A;  1VQ1 A;  3FTD A;  5EXT A;  1DO2 A;  4BBA A;  2M60 A;  5EXX A;  4I5S A;  2OOA A;  5EP2 A;  1IBK M;  4IJE A;  1UM8 A;  2HCB A;  3PNY A;  1Y8G A;  4RF1 A;  5EQT A;  2EKF A;  3U6S A;  3AL0 C;  1L2C A;  2QP9 X;  1HQC A;  3HU3 A;  2KRU A;  3AOE C;  2CUZ A;  2L7H A;  4DV3 M;  3VK7 A;  4FCW A;  1F4I A;  2XGN A;  2JY6 B;  3TE6 A;  2JY5 A;  4ZPX A;  4JN6 A;  4G4Q A;  2FFJ A;  3TPZ A;  3HHX A;  1LV7 A;  4DR6 M;  4NRW A;  5IT9 S;  1VDD A;  2LH0 A;  2UUA M;  3SMP A;  1N33 M;  2EJS A;  4GHA A;  3QYB A;  1JR3 A;  1N34 M;  4PDI A;  2W82 A;  3K92 A;  2O25 A;  3M0E A;  4QOS A;  8CAT A;  1OTR A;  4B7H A;  1ORY B;  5EXP A;  1ZAE A;  2DAK A;  4GH9 A;  4AKI A;  3B7Z A;  1QVR A;  3GRV A;  3NBI A;  4MGZ E;  3M7G A;  3UMM A;  4NOO B;  3HJS A;  4B3S M;  2C9C A;  3SAV A;  1QZE A;  4R7G A;  5FLX S;  4AZF A;  1G4A E;  7CAT A;  2QCU A;  3FRI A;  3CF6 E;  2XLJ A;  3K1J A;  2MH8 A;  4DV0 M;  2CP8 A;  2EA0 A;  1ZMV A;  1OIP A;  2JWS A;  4JI2 M;  4JI1 M;  3B74 A;  4MGI E;  1TGU A;  4L4U A;  1NV9 A;  1HT1 E;  1TDH A;  2Y0Q A;  2R4E A;  4DV4 M;  1Q3B A;  2HAK A;  1PJS A;  5ITQ A;  4REZ A;  3U6D A;  3PXG A;  3ZC7 B;  4QNM A;  2G8L A;  1IXS A;  2CHG A;  4B08 A;  2ZAN A;  2XFS A;  1SXJ E;  1TTE A;  3U61 B;  3JR4 A;  4BB9 A;  3FRH A;  4Y28 F;  5IZ7 D;  1XB2 B;  2MR9 A;  3H4M A;  3LW5 F;  1T6O A;  3RFW A;  1NV8 A;  2R62 A;  3BBZ A;  3SAR A;  4HEO A;  4IBE A;  3GLI A;  1TR8 A;  4IJF A;  1H6U A;  2CHQ A;  1HJP A;  2OO9 A;  3KSJ A;  4GC9 A;  4YY3 M;  5DNY A;  2APL A;  3B7Q A;  5IRE B;  3U5Z B;  2V6Z M;  3I01 M;  2UU9 M;  2VQF M;  1E94 E;  5EXS A;  2DAI A;  4FCV A;  1L1T A;  3NBX X;  3NWL A;  5E26 A;  3CTW B;  5DYI A;  2JY8 A;  4DUZ M;  4JI0 M;  2UUC M;  3HHW A;  2RGO A;  2C96 A;  2WSC F;  2BJV A;  3SYK A;  2LVQ D;  1P3Q Q;  1DGF A;  2EO2 A;  3GO8 A;  3K9P A;  3GRY A;  5E6J A;  3BOS A;  4IBI A;  2ZM6 M;  2DKL A;  3MMP A;  5H37 D;  3GLF B;  4G6Z A;  2R46 A;  3W0L B;  1E9S A;  3VKH A;  2DAG A;  1IM2 A;  1GAB A;  2D7H A;  4HLQ A;  2K47 A;  2DZL A;  3LMM A;  1YLA A;  2A5Y B;  4LJ8 A;  4DR1 M;  4OU7 A;  2K0B X;  3E9S A;  3H4J A;  4B3T M;  2DXI A;  3A45 A;  1IY1 A;  1WIV A;  4QNR A;  4OW0 A;  2O5R A;  1XMO M;  2KHH A;  4I4L A;  3HGI A;  3KS8 A;  3C3E A;  3GQ3 A;  5ITT A;  2F5O A;  1PJT A;  4I8O A;  1IQP A;  3W67 A;  1VEG A;  5BR8 M;  4X64 M;  3PNV A;  1G71 A;  1SG9 A;  1VG5 A;  3FYD A;  1ZV1 A;  3VDU A;  1J09 A;  1R7R A;  4EIW A;  1DV0 A;  2JNH A;  4HL4 A;  4B7G A;  2YFQ A;  4F2L A;  1KFV A;  4IBB A;  3U6O A;  1NVM A;  3U61 A;  2CEA A;  2H1R A;  2WZJ A;  3IHP A;  1NNJ A;  3ZH9 B;  3D8B A;  2HKJ A;  2YR0 A;  3UJN A;  4P16 A;  2DEN A;  2KRK A;  2XEP A;  3FD9 A;  2L09 A;  3GLG E;  2YQZ A;  3B9P A;  4Q7J A;  3HHY A;  3SAW A;  4K0K M;  2C9O A;  3KOX E;  2H5X A;  3GLH E;  2GNO A;  4DV5 M;  1QDR A;  3QWL A;  3LQR A;  2Z3X A;  4QHT A;  1K82 A;  3AOE A;  2F5N A;  4MGK E;  3OTO M;  1VDL A;  2C98 A;  4DV1 M;  1IBM M;  2Y21 A;  1QAN A;  3U5Z A;  3MJ5 A;  3GLH B;  2LVP C;  1CUK A;  1D2N A;  3GLI E;  1L1Z A;  3HWS A;  4IIW A;  4B7F A;  1EIJ A;  4PCZ A;  2CWB A;  5KPT A;  5JI3 E;  2Z4R A;  2LNH C;  2AHM A;  5KPR A;  1E9R A;  2DAM A;  4L15 A;  1NSF A;  1XXH A;  5C1B A;  3SFZ A;  2R4J A;  5KQ8 A;  2HHH M;  2ZAM A;  1N32 M;  2KZS A;  4G4N A;  2KXE A;  3W0F A;  1I4W A;  1XC8 A;  4LRS A;  1UFZ A;  3R9X B;  2XZU A;  3LQQ A;  1NNU C;  1G8P A;  4GMQ A;  3TWK A;  4S12 A;  3ZQJ A;  5KQD A;  4M9S A;  3HJQ A;  1R5L A;  2ZBK B;  1XNR M;  3SHG B;  1VEK A;  3BXW A;  4NSR A;  4CIS A;  1Q39 A;  3VKG A;  3U60 B;  1DGB A;  2QQ8 A;  2RKO A;  4FWG A;  4UN2 B;  4DBG B;  5F3W A;  3IEC A;  3AFH A;  4MGY E;  1WXQ A;  3J81 S;  1QAM A;  3GP1 A;  1KSF X;  4LJ4 A;  4WW0 A;  5BPV A;  2X49 A;  4IBF A;  4RKU F;  1SXJ C;  1OIZ A;  4AKH A;  1IY0 A;  2DHR A;  2M5Z A;  2VII A;  4D80 A;  1IFY A;  5GKN A;  4TUW A;  2L7I A;  4FWD A;  1XXH B;  2KW0 A;  3W68 A;  1C1K A;  4LF7 M;  1HNW M;  1IN4 A;  2UXD M;  5C18 A;  4NSO B;  3EIE A;  4GRI A;  3SMS A;  2QBY A;  4PDG A;  3HHZ A;  1HNX M;  4X66 M;  2LXE A;  1X37 A;  2YNM D;  4MH0 E;  1XHB A;  4W5W A;  3C58 A;  4R71 A;  1VEJ A;  2QEN A;  1IBL M;  1G41 A;  2I7N A;  5LMN M;  2JA2 A;  3FTE A;  1IN6 A;  2EUC A;  3QYE A;  4F1I A;  1K3W A;  2FOI C;  4M9Z A;  2VDB B;  1J7K A;  3DFZ A;  4JI5 M;  1Z5B A;  3C3D A;  3GRU A;  5ITX E;  4XK8 F;  4AG5 A;  1EE8 A;  3U6L A;  4X62 M;  2K6B A;  1GKI A;  3T15 A;  3ZCB B;  4JI6 M;  3J7A S;  2BWE A;  4IBG A;  2LVO C;  2CV0 A;  1YE9 A;  1E32 A;  1OFI A;  1WGN A;  2QHO B;  3FUU A;  4GIT A;  2F5P A;  4G3O A;  1AIP C;  4M0D A;  4KOD A;  4A3V B;  1GL6 A;  1XXH E;  3KP0 E;  2X4A A;  3K9O A;  4AQY M;  1R2Y A;  2E5L M;  2LVA A;  4OX9 M;  1V92 A;  3K2L A;  2KNV A;  2EKK A;  4NL4 H;  3Q8G A;  2CHV A;  4M0W A;  2DI0 A;  4MGH A;  3SBJ A;  2ZTC A;  2FE8 A;  3LVW A;  3A42 A;  4JXJ A;  4LJ9 A;  4LGM A;  3L28 A;  4RNA A;  3T38 A;  3KFU G;  3HU2 A;  3B89 A;  2XFT A;  3L27 A;  3LCU A;  4KO8 A;  3CGW A;  4LF8 M;  2P5T A;  3E46 A;  2ZAO A;  1J5E M;  5DFL A;  4JI3 M;  4NXN M;  3DOA A;  1SXJ D;  2L6O A;  3GPY A;  3QAU A;  2WSF F;  3THG A;  5FSW A;  1XMQ M;  2JZ0 A;  3SAT A;  3RGS A;  3GPX A;  1SXJ B;  4LG2 A;  3A98 B;  1L8Q A;  3KSX A;  5EJC A;  3GLH A;  2XZF A;  1C7Y A;  1TH2 A;  1Z59 A;  3VDP A;  2DNA A;  5IWA M;  3AV0 A;  2MRO B;  1MU5 A;  1NHG C;  3GLG A;  4PD2 A;  3FKE A;  2OQ4 A;  1PJI A;  3FTF A;  1JR3 E;  1G3I A;  1ZQ9 A;  3UZU A;  1WHC A;  3KW6 A;  3J80 S;  3RE8 A;  3Q8X A;  2RRU A;  4KHP M;  1ZMW A;  2FH0 A;  4DR4 M;  4QHS A;  4ITQ A;  2G5G X;  4LF6 M;  4KLN A;  3I4Y A;  3MK6 A;  1FNN A;  1V34 A;  1N36 M;  2HWJ A;  2Y20 A;  4JYA M;  3C9P A;  3L29 A;  2DZN B;  4IBD A;  4LGY A;  5FTM A;  1MX0 A;  4X65 M;  2R44 A;  3J2P B;  4DUY M;  1EFU B;  1XWI A;  3FTC A;  3T6P A;  5JI2 E;  4LFC M;  2HL7 A;  5L8R F;  2JZ1 A;  2LTU A;  2LWX A;  4LCB A;  4LJ7 A;  5ITY A;  3FUW A;  1QDT A;  1TH4 A;  1WR1 B;  3TQS A;  2C99 A;  2DVW B;  1PGY A;  1I94 M;  3T1Y M;  1PJQ A;  3E21 A;  4L78 A;  3DA1 A;  1OAI A;  5EP3 A;  3I4V A;  4LJ6 A;  3KS4 A;  4RF0 A;  4LF5 M;  2BWB A;  3R8F A;  2CV2 A;  2Z8Y M;  4XBO A;  1AUA A;  3KXE C;  5EP1 A;  1PJJ A;  2L2D A;  2QPA A;  5FTN A;  4D82 A;  3PVS A;  1KYI A;  4LZZ A;  3PFI A;  1PRB A;  2Q2E B;  2UUB M;  4IBC A;  3A46 A;  3IG5 A;  1QUT A;  4ANR A;  3GPP A;  4CIZ A;  4LRT A;  4MM3 B;  4DR2 M;  4LF9 M;  2Z7J A;  4FVM A;  3KOZ E;  4L6V 6;  1OQY A;  2C5R A;  4GIP A;  2XSZ A;  3UGJ A;  2D7E A;  1SXJ A;  3L25 A;  1GO5 A;  3WHK A;  3WHL A;  1IN8 A;  2K9D A;  2DZO B;  3U6M A;  2VF8 A;  4PT5 A;  1PM5 A;  4GHL A;  2L4E A;  4OVZ A;  1DGH B;  1Z5A A;  1HR0 M;  1R6B X;  4YHH M;  2JUJ A;  3MHV C;  2KEB A;  4OVZ B;  3GLF E;  4QOZ C;  3AKZ A;  2JP7 A;  5KPZ A;  2MGW A;  2GQF A;  4LJ5 A;  1OFH A;  2XSZ D;  2DWN A;  2R65 A;  2NQ8 C;  1IXR C;  2KZU A;  1RU3 A; 
#chains in the Genus database with same CATH homology
 1FJG M;  4BLC A;  1NJG A;  3E4R A;  2R18 A;  4MB7 A;  3KDS E;  4FD2 A;  4AI6 A;  4L8R C;  2V1U A;  3LVV A;  3FUV A;  1W5T A;  3CF2 A;  3HKP A;  4AKG A;  2R45 A;  3M6A A;  1NHW C;  4WUR A;  4JI7 M;  2XF3 A;  2CE7 A;  1S3S A;  4LZJ A;  1N77 A;  2DWM A;  5FTL A;  5FTJ A;  5DYG A;  2X8A A;  3T1H M;  3I51 A;  1NY5 A;  2D7G A;  1HNZ M;  4R3D A;  1N75 A;  4GKJ M;  3U6E A;  1L2B A;  2BJW A;  2DWZ B;  3J27 B;  2I7P A;  3GQ4 A;  3SAU A;  4DR3 M;  3U6P A;  1IN5 A;  1YSY A;  3KOW E;  3FUT A;  5ITR A;  4FCT A;  4DV7 M;  1IXS B;  2Z4S A;  1IY2 A;  1TH3 A;  2XH9 A;  3VFD A;  2FNA A;  2DWL A;  4B3R M;  2UXB M;  5KO3 A;  2J7O A;  2Y0T A;  3GPU A;  4DV6 M;  4CHT B;  3AOG A;  3K8Z A;  4CGY B;  3HJ8 A;  3RGP A;  3GLI B;  1K3X A;  1TDZ A;  4IBK A;  4AW4 A;  1HQY E;  5LMU M;  4JV5 M;  4JI8 M;  3GLG B;  3FUX A;  2CV1 A;  2F5Q A;  1QQW A;  4M9X A;  3L26 A;  1XNQ M;  3L2A A;  4NRV A;  4DV2 M;  4LFB M;  1DGH A;  1T3T A;  4JI4 M;  1IN7 A;  4G4O A;  1QYR A;  3FYC A;  4IBJ A;  4GKK M;  2CFO A;  4XGI A;  3HU1 A;  4G4R A;  1G59 A;  4FW9 A;  5A2Q S;  1OJL A;  1Q3C A;  3KOY E;  1JR3 D;  2ERC A;  1DO0 A;  3KVW A;  3U6Q A;  1IXZ A;  3GLF A;  4II7 A;  3DZD A;  3GRR A;  1L2D A;  3U6C A;  3J7B A;  3SHF A;  1GLN A;  4Z6Y A;  4L16 A;  4LF4 M;  2KA6 B;  2J7N A;  4I81 A;  5FTK A;  1QAQ A;  4DR7 M;  2BNK A;  3TWM A;  2V1C A;  1R2Z A;  1N78 A;  3AJI B;  1Z5C A;  4LFA M;  3VK8 A;  4NXM M;  1GL7 A;  1Z6T A;  3SYL A;  4D81 A;  2RGH A;  1GVN A;  3EIH A;  3JAM S;  3KP1 E;  3SC3 A;  5ITX A;  4AG6 A;  3TL4 X;  3GQ5 A;  2F4V M;  2VQE M;  4Z8X A;  2UXC M;  4DR5 M;  1QZM A;  3UK6 A;  4LJA A;  1NY6 A;  4B3M M;  2F5S A;  1JQJ C;  2OPF A;  3D8L A;  1QAO A;  4GC5 A;  3JR5 A;  1HT2 E;  1DGG A;  3SAS A;  3TWL A;  3ILK A;  5EP4 A;  3VLF B;  3CF0 A;  4FWH A;  4LY6 A;  2QZ4 A;  3U60 A;  3IG8 A;  5ITU A;  1NJF A;  1W5S A;  1YUB A;  3FTD A;  5EXT A;  1DO2 A;  4BBA A;  2M60 A;  5EXX A;  4I5S A;  5EP2 A;  1IBK M;  4IJE A;  1UM8 A;  2HCB A;  3PNY A;  4RF1 A;  5EQT A;  3U6S A;  3AL0 C;  1L2C A;  2QP9 X;  1HQC A;  3HU3 A;  2KRU A;  3AOE C;  2CUZ A;  2L7H A;  4DV3 M;  3VK7 A;  4FCW A;  2XGN A;  3TE6 A;  4ZPX A;  4JN6 A;  4G4Q A;  2FFJ A;  3TPZ A;  3HHX A;  1LV7 A;  4DR6 M;  4NRW A;  5IT9 S;  1VDD A;  2LH0 A;  2UUA M;  3SMP A;  1N33 M;  4GHA A;  1JR3 A;  1N34 M;  4PDI A;  2W82 A;  3K92 A;  3M0E A;  4QOS A;  8CAT A;  4B7H A;  1ORY B;  5EXP A;  1ZAE A;  4GH9 A;  4AKI A;  3NBI A;  1QVR A;  3GRV A;  4MGZ E;  3UMM A;  3M7G A;  4NOO B;  3HJS A;  4B3S M;  2C9C A;  3SAV A;  4R7G A;  5FLX S;  4AZF A;  1G4A E;  7CAT A;  2QCU A;  2XLJ A;  3CF6 E;  4DV0 M;  3K1J A;  2EA0 A;  4JI2 M;  4JI1 M;  4MGI E;  1TGU A;  4L4U A;  1HT1 E;  1TDH A;  2Y0Q A;  2R4E A;  4DV4 M;  1Q3B A;  5ITQ A;  4REZ A;  3U6D A;  3PXG A;  3ZC7 B;  4QNM A;  2G8L A;  2CHG A;  4B08 A;  2ZAN A;  2XFS A;  1SXJ E;  3U61 B;  3JR4 A;  4BB9 A;  5IZ7 D;  3H4M A;  3RFW A;  2R62 A;  3SAR A;  4IBE A;  3GLI A;  4IJF A;  1H6U A;  2CHQ A;  4YY3 M;  5DNY A;  3KSJ A;  4GC9 A;  5IRE B;  3U5Z B;  2V6Z M;  2UU9 M;  2VQF M;  1E94 E;  5EXS A;  4FCV A;  1L1T A;  3NWL A;  5E26 A;  3CTW B;  5DYI A;  4DUZ M;  4JI0 M;  2UUC M;  3HHW A;  2RGO A;  2C96 A;  2BJV A;  3SYK A;  1DGF A;  2EO2 A;  3GO8 A;  3GRY A;  5E6J A;  3BOS A;  4IBI A;  2ZM6 M;  5H37 D;  3GLF B;  4G6Z A;  2R46 A;  3W0L B;  1E9S A;  3VKH A;  1IM2 A;  2D7H A;  4HLQ A;  2K47 A;  3LMM A;  2A5Y B;  4LJ8 A;  4DR1 M;  4OU7 A;  3E9S A;  4B3T M;  2DXI A;  3A45 A;  1IY1 A;  4QNR A;  4OW0 A;  2O5R A;  1XMO M;  4I4L A;  3HGI A;  3KS8 A;  3GQ3 A;  5ITT A;  2F5O A;  4I8O A;  1IQP A;  5BR8 M;  4X64 M;  3PNV A;  3FYD A;  3VDU A;  1J09 A;  1R7R A;  4EIW A;  4HL4 A;  4B7G A;  2YFQ A;  1KFV A;  4IBB A;  3U6O A;  1NVM A;  3U61 A;  2CEA A;  2H1R A;  1NNJ A;  3ZH9 B;  3D8B A;  2HKJ A;  2YR0 A;  3UJN A;  4P16 A;  2KRK A;  2XEP A;  3FD9 A;  2L09 A;  2YQZ A;  3B9P A;  3HHY A;  3SAW A;  4K0K M;  2C9O A;  3KOX E;  4DV5 M;  2Z3X A;  3QWL A;  3LQR A;  1K82 A;  4QHT A;  3AOE A;  2F5N A;  4MGK E;  3OTO M;  2C98 A;  4DV1 M;  1IBM M;  2Y21 A;  1QAN A;  3U5Z A;  3MJ5 A;  3GLH B;  1D2N A;  1L1Z A;  3HWS A;  4IIW A;  4B7F A;  4PCZ A;  5KPT A;  5JI3 E;  2Z4R A;  2LNH C;  2AHM A;  5KPR A;  1E9R A;  4L15 A;  1NSF A;  1XXH A;  5C1B A;  3SFZ A;  2R4J A;  5KQ8 A;  2HHH M;  2ZAM A;  1N32 M;  2KZS A;  4G4N A;  2KXE A;  3W0F A;  1I4W A;  1XC8 A;  4LRS A;  3R9X B;  2XZU A;  3LQQ A;  1NNU C;  1G8P A;  4GMQ A;  3TWK A;  4S12 A;  5KQD A;  4M9S A;  3HJQ A;  2ZBK B;  1XNR M;  3SHG B;  4NSR A;  4CIS A;  1Q39 A;  3VKG A;  3U60 B;  1DGB A;  2RKO A;  4FWG A;  5F3W A;  3AFH A;  4MGY E;  1WXQ A;  3J81 S;  1QAM A;  3GP1 A;  1KSF X;  4LJ4 A;  4WW0 A;  5BPV A;  2X49 A;  4IBF A;  1SXJ C;  4AKH A;  1IY0 A;  2DHR A;  2M5Z A;  2VII A;  4D80 A;  5GKN A;  4TUW A;  2L7I A;  4FWD A;  1XXH B;  2KW0 A;  1C1K A;  4LF7 M;  1HNW M;  1IN4 A;  2UXD M;  5C18 A;  4NSO B;  3EIE A;  4GRI A;  3SMS A;  2QBY A;  4PDG A;  3HHZ A;  1HNX M;  4X66 M;  2LXE A;  1X37 A;  2YNM D;  4MH0 E;  1XHB A;  4W5W A;  3C58 A;  2QEN A;  1IBL M;  1G41 A;  2I7N A;  5LMN M;  2JA2 A;  3FTE A;  1IN6 A;  2EUC A;  1K3W A;  2FOI C;  4M9Z A;  1J7K A;  3DFZ A;  4JI5 M;  1Z5B A;  3GRU A;  5ITX E;  4AG5 A;  1EE8 A;  3U6L A;  4X62 M;  1GKI A;  3T15 A;  3J7A S;  3ZCB B;  4JI6 M;  4IBG A;  2CV0 A;  1YE9 A;  1E32 A;  1OFI A;  3FUU A;  4GIT A;  2F5P A;  4M0D A;  4KOD A;  4A3V B;  1GL6 A;  3KP0 E;  2E5L M;  2X4A A;  4AQY M;  1R2Y A;  4OX9 M;  3K2L A;  4NL4 H;  2CHV A;  4M0W A;  4MGH A;  3SBJ A;  2FE8 A;  3LVW A;  3A42 A;  4JXJ A;  4LJ9 A;  4LGM A;  3L28 A;  4RNA A;  3T38 A;  3KFU G;  3HU2 A;  2XFT A;  3L27 A;  4KO8 A;  4LF8 M;  2P5T A;  2ZAO A;  1J5E M;  4JI3 M;  4NXN M;  3DOA A;  1SXJ D;  2L6O A;  3GPY A;  3QAU A;  3THG A;  5FSW A;  1XMQ M;  3SAT A;  4LG2 A;  3RGS A;  3GPX A;  1SXJ B;  3A98 B;  1L8Q A;  3KSX A;  5EJC A;  3GLH A;  2XZF A;  1TH2 A;  1Z59 A;  3VDP A;  5IWA M;  3AV0 A;  2OQ4 A;  1MU5 A;  1NHG C;  3GLG A;  4PD2 A;  3FKE A;  3FTF A;  1PJI A;  1G3I A;  1ZQ9 A;  3UZU A;  3KW6 A;  3J80 S;  3RE8 A;  3Q8X A;  4KHP M;  4DR4 M;  4QHS A;  4ITQ A;  2G5G X;  4LF6 M;  4KLN A;  3I4Y A;  3MK6 A;  1FNN A;  1N36 M;  2Y20 A;  4JYA M;  3L29 A;  2DZN B;  4IBD A;  4LGY A;  5FTM A;  1MX0 A;  4X65 M;  3J2P B;  4DUY M;  3FTC A;  1XWI A;  5JI2 E;  4LFC M;  2HL7 A;  2LWX A;  5ITY A;  4LCB A;  4LJ7 A;  3FUW A;  1TH4 A;  3TQS A;  2C99 A;  2DVW B;  1I94 M;  3T1Y M;  4L78 A;  3DA1 A;  5EP3 A;  3I4V A;  4LJ6 A;  3KS4 A;  4RF0 A;  4LF5 M;  3R8F A;  2CV2 A;  4XBO A;  3KXE C;  1PJJ A;  5EP1 A;  2QPA A;  5FTN A;  4D82 A;  3PVS A;  1KYI A;  4LZZ A;  3PFI A;  2Q2E B;  2UUB M;  4IBC A;  3A46 A;  3IG5 A;  3GPP A;  4LRT A;  4MM3 B;  4DR2 M;  4LF9 M;  2Z7J A;  4FVM A;  3KOZ E;  2C5R A;  4GIP A;  2XSZ A;  3UGJ A;  2D7E A;  1SXJ A;  3L25 A;  3WHK A;  3WHL A;  1IN8 A;  3U6M A;  2DZO B;  4PT5 A;  1PM5 A;  4GHL A;  4OVZ A;  1DGH B;  1Z5A A;  1HR0 M;  1R6B X;  4YHH M;  3MHV C;  2KEB A;  4OVZ B;  4QOZ C;  3AKZ A;  5KPZ A;  4LJ5 A;  1OFH A;  2XSZ D;  2DWN A;  2R65 A;  2NQ8 C;  1IXR C;  2KZU A;  2QBY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...