4LFBQ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfbQ00
3CC4A 4R4TA 3A74A 4B3SL 1IL2A 1OXSC 4A76A 3VDYA 3M4PA 3T1HQ 3M3YH 2HQLA 3GTQH 2HIXA 1UE6A 2NVXH 2HT1A 3KDFA 3UDFA 2A8VA 3F1ZA 3MEFA 3CMEA 1VQ9A 5ELOA 2ALYB 2XGTA 2OWOA 3GTJH 4QL5A 4KI0A 1CUKA 1I94Q 1P16A 4L5RC 1D7QA 3HOWH 1I5FA 2QEXA 2LXKA 4PZ6A 2K50A 1IBML 5C4XG 4GS3A 5IYCG 1B7YB 1L2FA 1K3RA 1YNXA 3DLLA 1N9WA 4GOPA 4OX9Q 1Q7YC 3KDFB 2C35B 2CCZA 3PSIA 1V1QA 1SE8A 3Q8DA 3UE0A 1HR0W 4B3TL 2UU9Q 4JBWA 4R4CA 4OONA 1L0WA 4A3GH 2KENA 1X6OA 1VQ6A 3T1HL 4DV5L 4DV6L 1N34Q 3I55A 3PO2G 1YZ6A 4UPAA 2K5VA 4LWCA 3H0GG 5IWAL 4JG2A 1EFWA 1SFOH 4QQBX 3S1MH 4POGA 4PMWA 3OTOL 5C44G 4GKKL 1OTCA 3PO3G 3ULLA 1G6PA 2VUMH 2R7ZH 1T9HA 3ER0A 1CKMA 3CCJA 3KJPA 4JI0L 4HIKA 2ZTCA 3CCLA 2CKZB 4AIMA 2GVAA 1YHAA 1FL0A 1VCIA 4R1JA 2AKWB 1LM0A 1Q81C 4B3TQ 1YIJA 1MJEA 4YCWA 2NVYH 4Y7NH 3HOWG 5IE8A 5JJIA 1HR0Q 1CKOA 1U0LA 3J80i 2BA1A 4P73A 2WP8J 5GAEC 2VQEQ 3I4OA 3NEMA 2CWAA 5C4JH 1VQAA 1JMCA 2EIFA 3HOUG 4WJ3M 2UXBQ 1SN8A 4IFDG 1QVCA 2KHJA 2VZAA 5LMUL 3RZDH 5GQOA 2D62A 4GOPC 1VQNA 3RLFA 4LF5L 4Y52H 4IPGA 1SROA 5GAGC 2JEBI 5HGQA 2XTIA 3CXCA 2ZM6L 3HOUH 4PG3A 4JI5Q 2VW9A 1M1KC 2NZHA 1K9MC 3CCEA 3M4QA 3IRBA 2NN6G 2K5HA 1U5KA 1XNRL 1PYBA 3CPWA 1QUQB 4B3RL 4AQYQ 1XMQQ 5C44H 2MFIA 5IYCH 1AE2A 1VQFA 3MXNB 1GKHA 4L5QA 1JT8A 1JJGA 4A3KG 1HNXL 4NXML 1L1OA 1TWHH 2VQEL 4DV0Q 3PO2H 4DUYQ 3NELA 1MKHA 4LFBQ 2OQKA 3BZCA 4BBSH 2ZJPA 1K73C 3CD6A 4DV1Q 4LF7L 2Q2HA 4O2DA 1NTGA 1LYLA 2GVBA 4A3EG 1A63A 2K52A 3KF8B 4RG1A 3GTPH 4YWKA 2CFMA 4DV1L 4LF7Q 4OX9L 2I5LX 2VQFQ 1QVFA 3S16H 2JEAI 4PZ8A 1SLJA 4R4QA 2UUCQ 3PUWA 3G71A 2I5HA 3W1GA 4JV5Q 3K80C 3HOZG 2UXCQ 4DR7L 2NZOA 3HKZG 5M3FG 3E9HA 4DR3Q 4P74A 2JA6H 5C0XG 4AQYL 1XMQL 1PH3A 3HKZE 2IHEA 4JI1L 3M85A 3CCSA 1IBKL 1VQ8A 3UDIA 4X66L 4X62Q 5LMNW 4A3JG 4TVAB 4DAYB 4C3JH 4JI5L 2UUBQ 5GADC 2OTLA 4DV4Q 1KAWA 1DGSA 1YHBA 3U58A 1GM5A 2Z0SA 2BA0A 4DR4L 4B3MQ 2KHIA 1KIXA 1IYJB 1E3PA 3K0XA 2ATWA 2ID0A 4AH6A 2D0OA 4JI6Q 4LF4L 1TXYA 4A3IH 1VQHA 4R4IA 2HHHQ 2KCTA 2AWOA 3PIPA 2ZTDA 2NVQH 5BR8Q 2PI2E 1VQ4A 3CPFA 1JJCB 1EQRA 3RR5A 1EOVA 3F2DA 3J81c 1BBWA 4DK3C 1PA6A 2HHHL 4H02A 1PYSB 4JOIA 1VQ5A 1FVIA 1OXUA 4ALPA 1Q12A 4NXNL 4O0AA 3J81i 1ASYA 3GTOH 1GO3E 4BY7G 3GD7A 4JI7Q 2ES2A 4A3MH 1R9TH 2JE6I 4KHPQ 1YJWA 1FJGQ 2R7ZG 1QUQA 2K5NA 2R92H 2Z6KC 1NY4A 3HOXH 4UY8C 1WJJA 3GTMH 4JI1Q 3L2PA 3S2DH 4JCVE 3H0GH 3BJUA 2Y0SE 4LUOA 4JI2L 4BXXH 1X3FA 4GN4B 4KLKA 2VUMG 3D0FA 2BH2A 2VS1A 3AQQA 4BBRH 1L1OB 2MO1A 5C0XI 1JE5A 3KYHC 2YTXA 2QA4A 1Z9FA 5M3MH 1TWAH 2PMZE 4DR1L 2LXJA 2V1CC 1RIPA 4NPSA 4A75A 2JA5G 3I4MH 4IJLA 1Y1WG 5C0XJ 2NVTH 2UXBL 2Y0SG 1Q82C 1CSPA 4DR5Q 4A93H 3KF6A 3H3VH 1YJ9A 3HKSA 3KLWA 4IPDA 5M3MG 2RHQB 1K8GA 2UXDL 1C0AA 5IP7G 3DM3A 4JYAQ 1FGUA 3PGZA 3STBC 1PH2A 4A3FH 1H95A 4OXPA 5FLMH 2UUAL 3CCQA 2R93H 3G48A 3ULPA 1CKNB 1V43A 3A5ZB 2MNAA 4B3ML 1XNRQ 3M7NA 4A3BG 4GN5A 2MO0A 4FDBA 5C4XH 1MJCA 3CCUA 1KXLA 3JAMc 2VL6A 2ZM6Q 4A3KH 5J3BA 1KC8C 3KF6B 4R4OA 3U4ZA 4OWWB 2R92G 3HOVG 1Q8KA 4QJFA 3TRZA 2PQAA 1WI5A 3U50C 1IBKQ 1HNZL 4BBSG 3AFPA 1NMGA 4DV7L 4YCVA 3I56A 4GLVB 4DK6C 3WWVA 2A19A 1J6QA 2QGQA 4MTNA 4JV5L 4A3LG 4XIGS 4C3IH 1J5EQ 2ZTEA 1HR0L 1VQIA 2ZJQA 2R6GA 4BY1G 3U4VA 3NBHB 3L7ZC 4LFCQ 4JI8L 2RHSB 4L5SA 2IY5B 2RF4A 3CF5A 2PQAB 1VQJA 2E5LQ 1A0IA 1OXTA 1VQGA 3PCOB 3GDEA 2K14A 4HJ9A 4GNXC 1PH4A 4YY3Q 1OXXK 4DV2Q 3PUXA 4HIMA 4HJAA 3FKIG 4J15A 4LFBL 4DV3Q 2Q2UA 1HNWL 1QZGA 1VQMA 4A3DG 4DV0L 3TREA 1AE3A 5M3FH 5IT9c 3J80c 4GKKQ 3RLNA 1L1OC 4NB3A 5IWAQ 3RNUA 4AYBE 5DLQE 3E0EA 1K83H 3H15A 4YHHL 4DV4L 4UP7A 1QVGA 3CAMA 1X55A 1XTDA 4YWLA 1Q86C 2GN5A 2OQ0A 3A0JA 5IP9H 3FP9A 4LF5Q 4LUZA 3PV0A 2DUDA 4DR2L 4NXNQ 2AHOB 5JEAJ 2JA5H 1VQDA 2ASBA 4IOAA 4DNIA 3J7ZC 3G4SA 4DUZL 1YEZA 2OCEA 2RCNA 3HFZB 4IOCA 4A3IG 2JQOA 1SR3A 1S40A 3B6YA 1HZ9A 3KOJA 3TQYA 1Y1VH 1BVSA 2AMCB 1HZAA 2LSSA 5JJKA 3G6EA 2YV5A 3H3VI 1YHQA 1G51A 1Q46A 1SRUA 4DV3L 1PH9A 2UXDQ 1N33L 1CKNA 5C3EG 4DR5L 3M4OH 4P71A 2VNUD 2K4KA 1VQ7A 4X65L 4HJ7A 1VQCA 3KJOA 4LF8Q 1N32L 5AJ3L 1VQEA 1Y14B 5M5YH 2PNHA 3FKIH 3UE1A 4A3MG 1XNQL 2HIVA 1Q1EA 2DGYA 3TS2A 1PH6A 4DR6Q 2AWNA 2L15A 3ERSX 1KRTA 3TS0A 4BY7H 3K8AA 1D8LA 4LF9Q 2F4VL 3E9IA 4BXXG 1C9OA 4B3RQ 2H5XA 5M5XH 2CQOA 4DV6Q 1XJVA 5IYBG 1NJIC 2IX0A 1EUJA 3CC7A 5ELNA 4LFAQ 3SGIA 4DPGA 4QY7A 4YY3L 4DV2L 1XMOL 1N36Q 1AH9A 4EX5A 2UU9L 4GNXB 4TQUS 1KHIA 5IP7H 5AJ3Q 1GVPA 1LTLA 4LF8L 4MNOA 4X65Q 2CWPA 4LFCL 2YU9H 1EIFA 4LW1A 4A4IA 3M9BA 4IPHA 2PI2A 1HZCA 4LUVA 1TWFH 1KD1C 5FLXc 4HJ8A 1VQOA 1XPRA 4JBKA 4A3DH 1PH8A 4A3JH 1HNXQ 4NXMQ 2B63H 3S14H 1UEBA 1WCMH 3OW2A 2Q2TA 5JEAG 4MZ9A 1ASZA 2JA6G 2YTVA 4GLXA 2F52A 3CW2C 4PZ7A 1N36L 3S2HH 1A8VA 2R7DA 3I7FA 4OWTB 2UUBL 4JI0Q 3HOVH 5IY0A 1JJ2A 4LF6Q 3S1QH 3EN2A 1I3QH 4XTCS 3NENA 4JI3L 2WB1G 2YTYA 4JI4Q 4LNQA 4GN3B 1IBLL 1EWIA 1HJPA 4LF9L 1XPOA 3GTKH 4A3CH 3OYYA 3UDXA 3F8TA 3CMAA 4DR7Q 4OO1I 1NMFA 4IO9A 3BU2A 1IZ6A 1B8AA 1VS0A 3EBEA 4BBRG 1X9NA 2UUCL 3EIVA 1UE7A 4L5TA 1I6HH 2VQFL 5IYDG 1VQPA 2K75A 3W1BA 2B3GA 5LMNL 3I4MG 4JI8Q 1X3GA 1S3OA 3GTGH 3S17H 3TEHB 3RZOH 1E22A 1E24A 2WAQE 1BKBA 3D31A 4UP8A 5FJ8G 5FJ8H 1C7YA 1J5EL 3I4NG 3I4NH 4X64L 3HOZH 1RL2A 4BA2I 2JK8A 1PH5A 3AEVA 3HOYH 1WCMG 4JI2Q 2N3SA 4DUZQ 3RN5A 1P8LA 1WOCA 2Z6KA 3PF5A 1I94L 1IBLQ 4BA1I 4DR2Q 3PUYA 4JC0A 2WFWA 1PV4A 4K0KQ 2E2IH 3I2ZA 4APVA 4IFDI 4JBMA 4A3FG 1NE3A 3CP0A 2JJQA 2R93G 4B3SQ 5GROA 1KQSA 4K0KL 2IX1A 2VY3A 4A3CG 1TWCH 1HZBA 4IFDJ 1PFSA 5LMUQ 1XPUA 1KRSA 4IJHA 1S72A 3PIOA 4JYAL 4A3LH 3RLOA 4C3HH 4HJ5A 2MQHA 2F3IA 3T1YQ 1TWGH 2I5MX 4DAMA 5M5WH 1B70B 3S24A 4X6AH 3CCVA 1Z47A 4HIDA 1A62A 4BY1H 1XMOQ 2IHFA 2E8GA 3HOXG 2A1AA 2F4VQ 1MIUA 1EIYB 4JBJA 3OTOQ 3K7AH 4GLAC 1K0RA 5HY6A 4DR3L 3PO3H 1GD7A 1Q1BA 1QZHA 2JA7H 2EXDA 3W5OA 1VQLA 2EQSA 1W3SA 3F2BA 2ZJRA 4DV5Q 3UDGA 1HNWQ 1XNQQ 3ULJA 3HOYG 1E1OA 1FJGL 3J7A5 1JB7A 1M90C 1E1TA 4DKAC 2D0PA 1YJNA 2E5LL 5IYDH 2WB1E 2E2HH 4ME3A 2IT1A 1N8RC 4QIWE 3ICEA 2NN6I 4POFA 1PVOA 1N33Q 2JA8H 2JA8G 1SMXA 1NBWA 1G291 3L0OA 4EQ5A 1PH1A 1O7IA 5BR8L 1CSQA 5C3EH 4GOPB 1YITA 3S1RH 4UP9A 1Y1WH 4YCUA 1K8AC 3CCRA 1HH2P 3J81j 1V9PA 1VQBA 3LGJA 4DV7Q 4HIOA 4A93G 1X56A 3CC2A 1Y1VG 5IP9G 4JI6L 4JI3Q 4JI4L 4A3BH 2UUAQ 1HNZQ 3PUZA 5K36G 4DR4Q 4QGUA 1W2BA 3BZKA 2N78A 2WAQG 4LF6L 1IXRA 3PUVA 3S1NH 2JA9A 4YHHQ 4X62L 5E7NA 4X66Q 1PH7A 3S15H 1EYGA 4P72A 4P75A 1YI2A 1X3EA 4GKJQ 2YYZA 4A3GG 2Q2IA 3GO5A 1EQQA 4IPCA 2FXQA 2JA7G 3FHWA 3JAMi 3GTLH 5IYBH 4DR6L 4A3EH 2UXCL 1UE1A 1UE5A 3K81C 4OWXB 1N34L 4X64Q 3CQZH 3PF4A 4KHPL 3AFQA 4JI7L 5EAYA 4YWMA 1OXVA 2I0QA 4KHZA 1N32Q 1X65A 3STBD 3ZJYC 5H1SE 4GNXA 5LMNQ 4AYBG 4DR1Q 3KFUA 3CCMA 1PHJA 2N8NA 2E2JH 3T1YL 4RMFA 3RN2A 3A5UA 1X54A 1I50H 4LFAL 1UWVA 2R7FA 1E7ZA 2N49A 4C2MH 3F2CA 2KBNA 3AYHB 4DUYL 3K7UC 2BH8A 1IBMQ 2B63G 1LUZA 5GAHC 4WJ4A 5JJLA 3JC66 1KL9A 4OO1G 5FLMG 1YBYA 2B29A 1WFQA 1WYDA 4GKJL 4LF4Q 2OTJA 1VQKA 4JOIC 1YVCA 1BBUA 2KCMA
chains in the Genus database with same CATH superfamily
5DAUA 4B3SL 1IL2A 3VDYA 2B39A 4DFAA 2HT1A 2PO4A 5ELOA 2ALYB 3GTJH 4QL5A 5D3DA 1IKLA 5L37A 4L5RC 1D7QA 2Q8IB 4F88A 2NZ1D 1I5FA 3D4WA 4ZUJA 2K32A 5C4XG 1H9RA 1CHQD 3DLLA 1B7YB 1L2FA 3M7GA 1E2VA 4DAPA 1SYFA 1KTKA 4F7XA 2CCZA 3OIPA 4B3TL 2F0IA 2UU9Q 2CH4W 2J7ZA 2OXPA 3Q0AA 4DXFA 3H6MA 4JG2A 1SFOH 4POGA 4PMWA 5C44G 1OTCA 4DK0A 3SXHA 1T9HA 4KY5A 2Z9HA 4AIMA 1YHAA 4KJOA 5KRUA 1ZKOA 4YCWA 2HCCA 2K6AA 2VXWA 5FK9C 1OO9B 1CFMA 2WP8J 4DAVA 3I4OA 1HQMC 2G9HD 2EOTA 1VQAA 1JWUD 1JWSD 1S4ZA 2VB2X 4CJ1B 3RZDH 1DYQA 5GQOA 3PO2B 5CMDA 4GOPC 1VQNA 4ILWA 3ERQA 4IPGA 1Y1WB 4Y52H 4Y7NB 3OWEB 1S5DD 4RCOA 2VW9A 4JI5Q 3EA6A 1B3AA 3M4QA 3OSOA 5CV7A 3QG1A 4C3IB 3S1NB 2NB0A 2B2YC 3K0YA 5CBEE 1STEA 5ELBA 4DV0Q 1TWHH 1JC7A 3LX0A 3A56A 4LFBQ 5D3IB 4PMBA 2XN9C 3MVVA 4O1NA 1K73C 1Q3LA 3GTLB 1V1PB 2Q2HA 1ZYRD 4IZ8A 3CU7A 4FYDA 3G6JB 2CFMA 5M3FB 1D2BA 2I5LX 1EY5A 3NPPA 3SEBA 3K57A 4JV5Q 2RKSA 4DR7L 3HKZG 1GHJA 5M3FG 4DR3Q 4P74A 5A2QL 3HKZE 5EBCA 4JI1L 4X3TA 4X66L 4X62Q 3HKZB 4TVAB 1PFNA 4EQPA 1G6ZA 2F3WA 4C3JH 2Q8TA 5GADC 2OTLA 3U58A 1GM5A 1H9JA 1WTXA 1IYJB 4LF4L 1GUWA 1VF5C 1HTPA 1STNA 2N88A 4A3IH 3HZXA 2HHHQ 2AWOA 1YNNC 3PIPA 2PI2E 4ZUIA 1VQ4A 4H13C 5K36H 3RR5A 1EOVA 1HRJA 1PA6A 2HCIA 4JOIA 1PYSB 1VQ5A 5FLXE 2KCCA 3J81i 1XTCD 1A15A 1GO3E 5IODA 4A3MH 1R9TH 1EY9A 2K5NA 4DA2A 4UY8C 5C6AA 3S2DH 2L9HA 4LUOA 3D0FA 1O7LA 4BBRH 2AUKA 2MO1A 3KF8A 1Z9FA 2BCOA 1H9SA 2JA5G 1RIPA 1TT2A 1D5XC 4G7ZC 4X3SA 4C1NK 2NVTH 1CSPA 4A93H 3H3VH 1UEAB 4KY6A 2A5HA 1QCBD 4IPDA 1C0AA 5IP7G 1SMYD 3PGZA 2WAQB 1O7ZA 4OXPA 3CCQA 4ME5A 3A5ZB 2MNAA 4LK1C 1XNRQ 2NTTA 1STYA 2MO0A 2Z4HA 3GTKB 4K6LA 3MXGA 1HNZL 2IPKD 3AFPA 1QNKA 1AEXA 1NMGA 5EQ0A 1STGA 3D4RA 1QJOA 4RHSA 1H9MA 3U4VA 1UNSA 5EKLA 3L7ZC 2EXZA 4LFCQ 2FHTA 2FMCA 2IY5B 2E75C 2CW0D 4OO1H 1A0IA 4FXDA 4K14A 4HJ9A 3GDEA 1PH4A 4YY3Q 4DV2Q 3PUXA 4CKCA 2Q2UA 4P2CB 2EYLA 3RD4A 3NTIA 4E6IA 5M3FH 1F9PA 1RKNA 2TSSA 2EY6A 1EQTA 3RNUA 2PQEA 1K83H 1CM9A 3H15A 4UP7A 4RKLA 4DN4M 1X55A 2OF1A 3H94A 2OQ0A 1C8CA 4HSPA 1RD9D 4LUZA 2JA5H 3N52A 3NK9A 4DNIA 3J7ZC 3G4SA 2HQEA 4IOCA 3HFZB 2UUAQ 1YNJC 2JQOA 3B6YA 1HZAA 2H1EA 5JJKA 2NYZD 1G51A 1E0BA 5HGTA 4DV3L 3R93A 5CBAE 4BY7B 1CKNA 5C3EG 2JXMB 4P71A 4OGQC 2K4KA 3KBGA 1VQ7A 4X65L 4OL7A 1AW7A 5FO7B 4LF8Q 1GUSA 4HTHA 3FKIH 2Z6BA 4A3MG 1KNAA 3QB3A 1Q1EA 1A3VA 4KD4A 4JW0A 2AWNA 4CBVA 3TS0A 4BY7H 4LF9Q 4BXXG 3HOXB 1ML0D 2CQOA 3MXPA 3MXNA 4DV6Q 2A73B 1TS2A 1M4VA 1EUJA 1K8MA 4H44C 3CC7A 4L6TB 1MD2D 5CV6A 4DPGA 1WCMB 5M5YB 3E6ZX 4GNXB 4OHJA 5IP7H 3DWQA 5AJ3Q 4IN3A 3S2HB 5ELFA 3ITPA 1U4PA 1ESFA 1TWFH 1J9OA 1VQOA 4A3BB 1XPRA 4FF3A 2NTSA 1PH8A 1LLRD 4N9TA 1IKMA 3K5MA 1ILPA 3EFXD 3VYTA 2JA6G 5KNBA 3CW2C 1KDAA 3S2HH 3I7FA 2R7DA 1B2TA 2F0DA 1NNXA 3TZDA 3HOVH 1JJ2A 2VB3X 1LT3D 4M1UB 5C4XB 1HHVA 4LNQA 1DZ1A 2IL8A 1H9KA 1IBLL 4LF9L 4A3CH 1PXUA 1XPOA 3OYYA 3CMAA 3F8TA 1NMFA 3I4NB 4IO9A 1IZ6A 1B8AA 3EBEA 1X9NA 1I6HH 1QWYA 5IYDG 2B3GA 2F0PA 5LMNL 2X6GA 1D1IA 3VR6A 2B2UA 1PFBA 4CJ0B 2CQAA 3C3LA 2EJGC 1BKBA 2WAQE 5FJ8G 5EKIA 2XWJB 1PMRA 3I4NH 4BA2I 1PH5A 4JVZA 3HOYH 1NSNS 2RDFA 4JI2Q 3L9AX 4IALA 1P8LA 3PF5A 1I94L 1IBLQ 1GXDC 2M00A 1TS5A 4K0KQ 2P5ZX 4A3FG 1NE3A 1II3A 4OELB 1GUTA 4K2LA 5CV4A 4IFDJ 5LMUQ 1XPUA 1DD2A 3IFTA 3JAML 1BCPC 4C3HH 4HJ5A 4DAMA 1TIID 3S24A 3Q6SA 4X6AH 3DHQA 3BDLA 1FNVA 5IGBA 3CCVA 1AP0A 3M4OB 4BY1H 2IHFA 5CYUA 1EU4A 2E2HB 2A1AA 1KDCA 4JBJA 2IW3A 2ZXOA 3NTKA 1K0RA 4CKBA 2K01A 2JA7H 2EQSA 2XRSD 3MHBA 4HCEA 4N8FA 1E1TA 2K03A 2D0PA 2E5LL 3TP7A 1N8RC 1F77A 2B8GA 2NN6I 1PVOA 2JA8H 2JA8G 1SMXA 1NBWA 1G291 1PH1A 4GOPB 3S1RH 2F0FA 4YCUA 5DNFA 3GV6A 2Q8RE 3J81j 1V1OA 1TWFB 4DV7Q 1Y1VG 2KHSA 5IP9G 4JI4L 4DR4Q 2F0EA 2N78A 5JVH3 1CZWA 3PUVA 4HN7A 5E7NA 3S15H 5I9PA 2F0NA 2EPBA 2E2JB 4P72A 5EBDA 2ENBA 2Q2IA 1I50B 2JA7G 1VF7A 2JN4A 4DR6L 4A3EH 4OWXB 4X64Q 2FFKB 1B4OA 3CQZH 3PF4A 2AUJD 3ND9A 3AFQA 5K5PA 4YWMA 1TS3A 4GNXA 2HD3A 5LMNQ 1AN8A 3M3YB 5NUCA 1B1ZA 4RMFA 2C9OA 1X3QA 1X3PA 3P75A 1DOMA 4WJ4A 5JJLA 2I46A 3JC66 5JPNC 1KL9A 1F2ZA 4LF4Q 4I7AA 1T5XD 3A74A 3VYSA 1ENCA 3GTQH 2PCFB 1UE6A 2A8VA 3UDFA 3WOEA 1C48A 3CMEA 1VQ9A 1EEID 4KI0A 1Y8NB 5FOBB 5IGEA 5LL6S 2QEXA 2EJFC 5F2DA 1PZKD 1LT5D 2B2VC 3ZYYX 1CA5A 3FMCA 1JOOA 1N9WA 2EZVA 3KDFB 2C35B 3PSIA 1BCPF 3UE0A 1JORA 1F9RA 1HUMA 4R4CA 1L0WA 1X6OA 2PYKA 2C5CA 1VQ6A 5C4ZA 3T1HL 1LV9A 4DV5L 4DV6L 3I55A 3PO2G 2Z1CA 4UPAA 2K5VA 2NVYB 2F0JA 3H0GG 5IWAL 2RVLA 4QQBX 4GKKL 2VUMH 4I7ZC 4XDXA 4FF2A 1CKMA 4JI0L 2ZTCA 4A93B 3CCLA 2JA7B 1VCIA 2F0OA 1LM0A 1JQYD 1YIJA 2IX3A 2ZT9C 2BE5D 2L4NA 3ND8A 4Y7NH 3HOUB 1RF2D 4KKTA 5IE8A 1HR0Q 1CKOA 3J80i 2JP1A 2LFNA 4P73A 3HOUG 1JMCA 2EIFA 4DNTB 4IFDG 2KHJA 3P1HA 2D62A 2A6HD 3K59A 3RLFA 4LF5L 1NCVA 3E5SA 3CXCA 2ZM6L 4PG3A 2NZHA 4ZKBB 4K6DA 1PYBA 2QCPX 4B3RL 1TQOA 5E4XA 2MFIA 1AE2A 1VQFA 3NHHA 4HSVA 1JJGA 4NXML 1L1OA 2Z8LA 2VQEL 3PO2H 1CK1A 3AMUA 1MKHA 2OQKA 4BBSH 1EIGA 2DNEA 4HAEA 1SSOA 1NTGA 1LYLA 2GVBA 4ZLTF 4A3EG 1HA6A 4YWKA 4M8AA 4V0BA 2L1BA 1WTQA 2VQFQ 1SLJA 4KY7A 3W1GA 2UXCQ 3HOZG 1ICWA 2ICEC 2B2WA 2NZOA 4NMZA 1FR3A 3E9HA 5EPLA 3FDTA 2KA7A 2F0MA 4C2MB 5C0XG 2JA6H 1SYBA 1PH3A 1PLFA 3M85A 5LMNW 1J8IA 2R61A 4DAYB 4JI5L 4PQXA 1QG7A 2L11A 5CORA 4DR4L 1LTID 4DK1A 1E3PA 3J81E 4AH6A 5IGDA 1TXYA 2QKIC 5JVG3 4R4IA 2ZTDA 2NVQH 5BR8Q 4HMIA 3DWPA 3FPUB 2EY5A 4H02A 4WORA 1WTOA 4NXNL 3H09A 3IKJA 4O0AA 4CGYB 4BY7G 3GD7A 2E74C 3WDNA 2JE6I 4KHPQ 1YJWA 3BG3A 3CHBD 2NVQB 1NY4A 2NVTB 3H0GH 3BYTB 5EPKA 3BJUA 5C5LA 2Y0SE 1ET9A 2VUMG 1SMYC 2G9DA 1JE5A 4A3MB 1R9TB 2VUMB 2PMZE 1SNMA 2LXJA 4NPSA 4A75A 3I4MH 4RGTA 1IL8A 3EROA 3A8KE 3S2DB 2UXBL 2Y0SG 4DR5Q 3KF6A 3CRKC 5M3MG 2RHQB 2X6LA 3SR1A 4JYAQ 3NUCA 1S5FD 4NW2A 1PH2A 4A3FH 5E1FA 3G48A 3ULPA 4RCNA 1V43A 1A6XA 1EOTA 4A3BG 4GN5A 1SYEA 3D6CA 1SYDA 3E3XA 1KXLA 4OEMB 2ZM6Q 1JB3A 3QR8A 1PZID 1KC8C 4OWWB 2R92G 4QJFA 1IBKQ 4Q5VA 3OPOA 3O13A 4FF1A 3AU7A 2F0HA 1QE6A 4GLVB 4DK6C 4A3LG 3I72A 5COYA 2ZTEA 1HR0L 1ET6A 4BY1G 5CC4A 3VR4A 4A3KB 2SNSA 3NTHA 4PNYA 4JI8L 4L5SA 3X3MA 1D5ZC 3CF5A 1VQJA 1OXTA 2K14A 5I4DA 1OXXK 4HJAA 3FKIG 4J15A 4LFBL 4DV3Q 3RUZA 1VQMA 4KN7C 4DV0L 3NE5B 2B2VA 4MTKA 3S16B 4G57A 5IT9c 1B50A 3J80c 4GKKQ 2RDHA 3RLNA 1IYVA 5IWAQ 4AYBE 5DLQE 1RTNA 1DOKA 1DXMA 1NAPA 1F2YA 1Q86C 2GN5A 3A0JA 5IP9H 4DR2L 4ABNA 5JEAJ 4CDCC 2ASBA 1YEZA 2OCEA 3SK6A 3V05A 1HZ9A 5M5WB 1Y1VH 1F2MA 3G6EA 2YV5A 1Q46A 2VNUD 2MUYA 3M4OH 3W2DA 1BCPB 1SE4A 3HG9A 1N32L 5AJ3L 5M5YH 2OEOA 3PO3B 2PZTA 5HURA 3TS2A 1PH6A 4K5XA 3TMEA 3ERSX 2PNRC 1D8LA 2EYMA 4B3RQ 2XNAC 3AB9A 3H3VC 3SK4A 5ELNA 1N36Q 2JA8B 2F0LA 4TQUS 4R8IA 1GVPA 2OT2A 4MNOA 3LWUA 1PTOD 5DM63 4A4IA 3S1RB 4JPBW 2PI2A 5LL6X 5DM73 5A2QE 5KIXA 4B9WA 3HS0C 4CHTB 1HNXQ 2B63H 1LABA 3S14H 1A2TA 3OIQA 2Q2TA 4MZ9A 4L8JA 4X3UA 1ASZA 2YTVA 2F52A 3I90A 1I6HB 1EY4A 2F0GA 2A69D 4OWTB 4X3KA 4JI0Q 1CQFA 2WKCA 4IUQA 3EN2A 4OIKA 1XYIA 4CDFC 4JI4Q 2WB1G 2YTYA 3NXWA 3GTGB 2EE1A 3VR3A 3UDXA 4QCLA 4OO1I 3BU2A 4BBRG 3PIO3 3BS1A 4TRDA 2UUCL 4HCSA 2VQFL 2F03A 3DUZA 3I4MG 3S1QB 3QOJA 4JI8Q 1S3OA 3S17H 2F0WA 3RZOH 5TSSA 1C7YA 1KNEA 2JK8A 3AEVA 3CKIB 1Y8PB 3RN5A 4DUZQ 2ZXRA 2KEDA 1MSHA 4BA1I 2QEJC 4C3HB 2E2IH 1B9NA 4CDDC 3FRPB 4IFDI 5CV8A 3BZDB 2R3ZA 5GROA 3SE0A 3TN2A 1ENFA 1PFSA 1I4RA 1S72A 3PIOA 4IFDH 4JYAL 1IW7D 3MC0B 4OIJA 2B8FA 5C4HA 1TWGH 2I5MX 5M5WH 1B70B 1ZEQX 3P20A 1KLGD 4HMJA 1LTRD 4HIDA 1A62A 1RJTA 1XMOQ 4WRDA 4QMGA 2D5DA 1MIUA 4EGVA 3OTOQ 1DJRD 1AZPA 1GD7A 1PTOB 1QZHA 3F2BA 1W3SA 1RTOA 4DV5Q 3UDGA 3A8JE 3Q22A 4FO2A 2B2YA 2IT1A 1U9RA 3KUPA 4QIWE 5JOBA 5C4JB 2WKDA 3RZDB 4EQ5A 5BR8L 1GUGA 5C3EH 1Y1WH 4C3JG 4KMUC 1A2UA 2QF7A 1HH2P 4A93G 4A3BH 4BS9A 4DAYA 4QGUA 1W2BA 2WAQG 3SVMA 4RHRA 4N9PA 1EYGA 1TWHB 3C1EA 4P75A 5C3EB 4GKJQ 3I73A 2YYZA 1EYDA 3FHWA 3GTLH 1PRTC 5KGUA 2UXCL 2XIWA 2QILA 5G3LF 3K58A 4IUUA 4KHZA 3ZJYC 2K5DA 4AYBG 1C4QA 3CCMA 1PHJA 2N8NA 2E2JH 3A5UA 4QIWB 4S3SA 3F2CA 2KBNA 4A3EB 3OWFA 3K7UC 1LUZA 1EL0A 5FLMG 2B29A 1WYDA 1WD0A 4GKJL 2KOLA 3A7AB 3EJIA 2DJFC 2RBMA 1OXSC 2SEBD 3M4PA 4KTAA 2HIXA 1GUOA 4XT3B 3F1ZA 3MEFA 1MI2A 2OWOA 2XGTA 1I94Q 1P16A 5FO8B 4PZ6A 2K50A 1IBML 3NBIA 5JPMC 1PRTF 1MSGA 2WACA 2F0SA 4GS3A 5IYCG 1YNXA 1K3RA 2RA4A 1CZGA 2LKVA 1Y8OB 5KYLA 4QUFA 1SE8A 1D6EC 1HR0W 1HXYD 3X3NA 4JBWA 4A3GH 4K5WA 3J80E 1YZ6A 5EGTA 1EFWA 3S1MH 2A6HC 3OTOL 1W6JA 1HUNA 3ULLA 1G6PA 1F9QA 1EZ8A 3ER0A 3NSWA 1SE3A 3CCJA 5BN4A 2AQ2B 3EQLC 2KCNA 5I9OA 2WIIB 1FL0A 1K3BC 4R1JA 4B3TQ 3BDCA 1K0SA 4C56C 5JJIA 1U0LA 5FO9B 2HUGA 3W3AA 5GAEC 2VQEQ 3E0JA 3FPPA 1SN8A 1QVCA 5LMUL 2VZAA 2FINB 2RQXA 3GV3A 1EFID 3QWNA 1SROA 5GAGC 2EYOA 2JEBI 5HGQA 2XTIA 3HOUH 1K9MC 2NN6G 3IAYA 3UI2A 4FF4A 1XNRL 3GTPB 1QUQB 1I6VC 4ZAIA 5C44H 5IYCH 4A3KG 2KJXA 4HR7B 4DUYQ 4DXGA 3LNNA 4XT1B 3K5NA 2ZJPA 3CD6A 4DV1Q 4LF7L 4RWSC 3H91A 4O2DA 3MXUA 1A63A 2K52A 4RG1A 3TBIB 4OX9L 3J7YW 3OMCA 4I65A 2JEAI 4PZ8A 1EYCA 2UUCQ 3Q24A 3A7LA 1SNCA 2I5HA 3K80C 3BVZA 4AQYL 1XMQL 4N8X1 1HCZA 3CCSA 1QNUA 1VQ8A 1IBKL 3UDIA 1BOSA 4A3JG 1NUCA 1G2SA 3D6WA 4J1MA 5EPJA 4RGNA 1YHBA 2F0UA 2Z0SA 2ATWA 1SXTA 3K0XA 1CA6A 4JI6Q 2D0OA 2FJ2A 2KCTA 1SNDA 2NN6H 3PMFA 3F2DA 1BBWA 2HHHL 4V190 2AQ3B 2F0TA 1FVIA 1OXUA 4ALPA 2F0KA 3DWAA 4JI7Q 5EJWA 2Z4IA 1SE2A 1H9SB 1TWAB 1QUQA 2IWHA 3DMUA 3R3OA 2Z6KC 3HOXH 4JI1Q 3M4YA 3L2PA 3C2PA 4IUPA 1BCPD 4XQNA 3D3RA 4BXXH 4KLKA 4NDXA 4C1NI 1XWEA 3MFYA 2AQ1B 3GTOB 3DEPA 1L1OB 4J8QA 2B2UC 3S1MB 1HPCA 3LWEA 3KYHC 2R7ZB 4IURA 1TS4A 5BN3A 1VMPA 2L55A 4IJLA 2SDFA 5C0XJ 2XVSA 4A3JB 5E4WC 3FVQA 1YJ9A 1B44D 3MZ5A 3KLWA 1K8GA 1FGUA 3STBC 2UUAL 5LHY1 2K1BA 3NWSA 2M2LA 2SOBA 3EVQA 4B3ML 1MJCA 3NWTA 4KKSA 1ZXTA 4A3KH 1CHPD 5J3BA 4R4OA 3TRZA 2PQAA 1WI5A 2B2TA 3U50C 3A8IE 4DV7L 1Q8IA 2QDLA 4A3FB 3WWVA 2K05A 4MTNA 4RAUC 5I2YA 3MAQA 4C3IH 1J5EQ 3SK5A 5J22A 1VQIA 2ZJQA 1XX8A 3KBXA 3NBHB 2QDBA 3J7AF 4R8NA 2RF4A 2E5LQ 4BBSB 1QILA 1NR2A 4HIMA 1QZGA 1D5MC 4A3DG 3TREA 2F3VA 1EEFD 5KNCA 1L1OC 1O80A 1BR9A 1T5EA 2NUCA 3E0EA 1ZYRC 1TWCB 3CAMA 4ZK9B 5IGGA 4YWLA 2M9VA 1I4PA 3FP9A 4LF5Q 3PV0A 1BUVT 2DUDA 2PW5A 3A55A 2AHOB 4FP5D 4C3JB 4IOAA 4KJNA 2RCNA 2DJGC 4A3IG 1TWGB 3NQIA 1BVSA 3H3VI 3MTSA 2HDMA 1Y69U 4B08A 3BVMA 3QO2A 4DR5L 1VQEA 5T1GA 4Z9CB 2PNHA 3UE1A 4UHVA 1Y1VB 1BDOA 2E76C 3K8AA 2F4VL 1C9OA 3I70A 2A69C 4IUNA 1SNOA 2EYHA 1XJVA 4A3DB 3H0GB 4LFAQ 4EQNA 4FXGC 4QY7A 1AH9A 2BOSA 4LF8L 1KHIA 1LTLA 4BBRB 4X65Q 1TVXA 2CWPA 2YU9H 2PZUA 2L12A 1AFPA 3M9BA 3GQBA 4IPHA 3I4MB 3KLSA 4XYQA 4A3DH 2FMMA 4KHVA 1O78A 1UEBA 1WCMH 1S5BD 2F4IA 5IIFA 3T16A 5JEAG 2XSCA 4GLXA 2F0VA 2V4DA 1A8VA 1I4GA 3WOFA 5IY0A 3S1QH 3IFDA 4XTCS 4MIUA 1EZ6A 4JI3L 1EWCA 3VYUA 4GN3B 4UDUC 2LMCB 1HJPA 3CQZB 3GTKH 3T13A 3CRLC 3SDZA 1SDFA 3OOCA 2MGSA 4PMCA 3EIVA 1UE7A 4L5TA 5I6WA 4CJ2C 1TY0A 2K75A 3BVGA 4ODGA 3W1BA 5CR3A 1YNJD 2E2IB 1X3GA 1IW7C 3TEHB 1E22A 1E24A 4KD3A 4TSSA 2XWBB 3DXJC 3D31A 1NR4A 5FJ8H 5FLXL 4X64L 3HOZH 3PQIA 1LTAD 2RSOA 1WCMG 3I8ZA 1WTVA 2N3SA 1WOCA 3PUYA 4JC0A 3T4AC 1CTMA 2F1MA 3K6OA 2PPBC 3I2ZA 4APVA 4JBMA 3CP0A 2CW0C 1I4QA 1LT6D 1EYAA 2X69A 1B9MA 4B3SQ 1KQSA 1UAPA 1K83B 4K2KA 1BO0A 3HOZB 1CQVA 4A3CG 1HZBA 4XQJA 2K5WA 1KRSA 4IJHA 2J0TD 4F8MA 4A3LH 3V96A 1FGBD 2JA5B 1JOKA 5J39A 1GOZA 1V1PA 1VDZA 3K7AB 3T1YQ 2BE5C 4DF7A 2K7VA 1Z47A 4NP5A 2E8GA 3K7AH 4GLAC 1F9SA 5HY6A 1Q1BA 1K28A 4RGOS 2EXDA 2ZJRA 1XNQQ 1PZJD 3URYA 3HOYG 1FJGL 1BXTA 1M90C 5IT9L 1YJNA 5IYDH 2WB1E 2E2HH 2MP1A 2PMZB 1HFNA 1N33Q 1LTSD 4WFN3 4MHEA 1O7IA 1CSQA 2O2LD 2Y0SB 4UP9A 2DN8A 5C3WA 1YITA 1K8AC 1V9PA 1VQBA 2PW7A 2WV6D 1Z6HA 1HNZQ 5K36G 1LTGD 3S14B 4LF6L 4KK7A 4K8IA 1EY8A 3S1NH 2JA9A 4YHHQ 2D9UA 4X62L 4X66Q 1G8ZD 1KDBA 3GO5A 1EQQA 4A3GG 4IPCA 2FXQA 3JAMi 1I3QB 5IYBH 1UE1A 3K81C 1Q90A 2MHVA 5G3LD 1N34L 2NBFA 5CV9A 4JI7L 1DOLA 2I0QA 1N32Q 1X65A 5H1SE 5D65A 3KFUA 3RN2A 4C2MH 2N49A 2JA6B 1A3TA 2BH8A 3T53B 2B63G 3V2TA 4OO1G 1RCVD 1EWHA 5ELCA 2DNCA 1RDPD 4JOIC 5BN5A 4EQOA 1BBUA 2KCMA 1WVLA 3CC4A 1U4LA 4R4TA 2XRQD 5C5MA 4A76A 3T1HQ 3M3YH 2HQLA 4DNRB 2NVXH 1B53A 3KDFA 4ZRZA 2KQ3A 2PZWA 4ZYSA 4PV1C 3MEHA 1CUKA 2RDGA 3HOWH 1MHWC 4IUVA 2LXKA 4RKBA 1HFGA 2I07B 3PIP3 4U673 1SFOB 1WTRA 5I6YA 4RFBA 4OX9Q 4GOPA 2MPMA 4BWGB 3QOLA 1Q7YC 1V1QA 3Q8DA 2A6EC 2DY7A 4OONA 3HRZC 2KENA 1W6KA 5DEHA 3L3OC 1N34Q 2ICIA 4U68A 2WINB 4LWCA 1BBXC 2RCFA 2O5JC 3PO3G 5M3MB 2R7ZH 3J7AV 5ELDA 5M9OA 1ESRA 3KJPA 4HIKA 5JAVA 4A3GB 4CDEC 2CKZB 2GVAA 1Q81C 3HP3A 2AKWB 3VA7A 2JSOA 1MJEA 1JWMD 2NVYH 4GZYC 3HOWG 2HDLA 2CH4A 2BA1A 4EVOA 3BYYB 1BNZA 1LTTD 3NEMA 2CWAA 5C4JH 1R4PB 3FEWX 2UXBQ 4WJ3M 3JAME 1JCKB 2DY8A 1EU3A 2KVMA 1WTWA 2TMPA 1M1KC 4LMQD 3CCEA 3IRBA 2K5HA 1U5KA 2BDOA 3SHLA 3CPWA 4AQYQ 1XMQQ 1QB5D 3KK7A 1GKHA 2K28A 1ENAA 3MXNB 4L5QA 4XXEA 1JT8A 1HNXL 3NELA 2J4XA 3BZCA 1STBA 3SK8A 2CVRA 3KF8B 1LACA 1SAPA 3VA5A 3GTPH 3S16H 4DV1L 1PFMA 4LF7Q 1QVFA 4R4QA 4B9XA 3PUWA 2EYJA 3KLRA 3G71A 2F0QA 1YNND 2A74C 4QUCA 2B2TC 1STHA 1M8AA 2IHEA 3QIAA 2WB1B 4QB4A 3VR2A 2LS01 1G91A 2UUBQ 4Q0FA 1S5CD 1KAWA 4O42A 1DGSA 3J80L 4DV4Q 2BA0A 5KNDA 4B3MQ 2KHIA 1KIXA 2ID0A 2QW7A 1VQHA 2R92B 1VMCA 3CPFA 1B3QA 1EQRA 1JJCB 4C3HG 1LO5D 3J81c 2KECA 3OW7A 1HA5A 4DK3C 3HOWB 1PRTB 3A54A 1Q12A 1ASYA 3GTOH 2ES2A 2NWGA 5CV5A 2CHBD 4A3IB 1FJGQ 1SNQA 2R7ZG 1PTOC 4KV6A 1WD1A 5I2XA 5M5XB 2R92H 1WJJA 3GTMH 3NP8A 1KAAA 4JCVE 5FKAC 1E2ZA 4JI2L 1X3FA 4GN4B 4K8JA 4AYBB 2BH2A 2VS1A 3AQQA 4ULLA 3DEOA 5C0XI 1KABA 2YTXA 2QA4A 5E3FA 2R93B 5M3MH 3QJYA 1TWAH 1IHZA 4DR1L 2V1CC 3GTMB 4ZKCB 1LT4D 1FYCA 1Y1WG 1Q82C 4MN3A 5C0XH 3TP6A 3HKSA 2UXDL 3I3CA 3DM3A 4XQQA 1V8QA 1H95A 5CGKA 5FLMH 2R93H 1S5ED 5IOCA 1WTPA 3HOVB 1CKNB 3TP8A 3M7NA 3Q23A 4FDBA 5C4XH 1R4QB 3CCUA 3JAMc 2VL6A 3D8GA 1LTBD 3HOVG 3KF6B 1U4MA 3U4ZA 1Q8KA 4H7BA 5AFWA 4BBSG 1PTOF 4ID6A 1ONLA 4YCVA 3I56A 4H0LC 1TKWB 2A19A 1J6QA 4G7HC 2QGQA 4JV5L 4XIGS 4C3IG 3R2TA 2R6GA 3RMHA 3T56B 2A68C 2RHSB 4RH6A 2GA4B 2PQAB 2EDGA 1VQGA 1K8OA 3PCOB 4UAIA 4GNXC 2O4XA 4G4KA 4DU9A 1HNWL 1EIHA 1DCZA 1DM0B 2EY1A 1AE3A 1GUNA 2JYOA 4NB3A 2ZXPA 1L0XB 3G7LA 4YHHL 4DV4L 5C3XA 1E2WA 2L5TA 1QVGA 3TDQA 4IUTA 3OMGA 1XTDA 1CT1D 3R2IA 2A6ED 3BDOA 4NXNQ 2BDNA 1VQDA 1QOHA 4DUZL 1S40A 1SR3A 2R93G 3KOJA 3TQYA 2AMCB 1SNPA 2LSSA 1YHQA 1SRUA 1PH9A 2UXDQ 1N33L 3MA2B 1JOQA 4HEDA 4HJ7A 3VR5A 1VQCA 3KJOA 1A3UA 3C46A 1Y14B 3OHXC 2EY2A 2N55A 1ICFB 3KLSX 5A35A 1XNQL 2HIVA 2DGYA 4F87A 4DR6Q 4R9WA 2L15A 1KRTA 4L63B 3E9IA 2H5XA 1SYGA 1RODA 3P7JA 5M5XH 1L0YB 3T51B 5IYBG 3IL8A 1NJIC 2IX0A 3SGIA 4YY3L 4DV2L 3FKIB 4LAAA 1XMOL 4EX5A 2UU9L 1TU2B 5KYIA 1ILQA 3MFGA 1DONA 4LFCL 1EIFA 4LW1A 1HZCA 4LUVA 4XYOA 1KD1C 5FLXc 4HJ8A 1SBBB 4JBKA 1SJED 1O7YA 4A3JH 4NXMQ 2A68D 2H4OA 3OW2A 1SEBD 3S15B 1PYWD 4PZ7A 2L0CA 1SJHD 2KUMA 2YU9B 1N36L 4KKUA 2UUBL 4LF6Q 4ZCKA 5IGCA 1I3QH 3I4LA 1BQQT 3NENA 3VYRA 1EWIA 2K33A 4DR7Q 3TZUA 1VS0A 3TP5A 1U4RA 1SYCA 1VQPA 1GHKA 2RSNA 5T1IA 3F2UA 3GTGH 4QF4A 1JICA 3K5LA 4UP8A 1JE4A 1J5EL 3I4NG 1RL2A 5J1ZA 3N6RA 2K5QA 1UUPA 2Z6KA 3MWYW 3GTQB 3DM1A 3NQTA 2NVXB 4DR2Q 2WFWA 1PV4A 3K5OA 1PRTD 3S17B 2JJQA 4TKOB 5JEAH 4K0KL 2IX1A 2VY3A 1STAA 1XXGA 1TWCH 1IYUA 3HOYB 1JR0D 4BY1B 3R8BA 1FNUA 3ONAB 1EY0A 4ZQ3A 1RHPA 2KEEA 4FXKC 1AZQA 3RLOA 2MQHA 2F3IA 1EY6A 1PTOH 5JJZA 2EJMA 2EYFA 1FNWA 1HQRD 1I4XA 2B2WC 4YIJA 4KN4C 5EKKA 2EVBA 5ELEA 1G2TA 4RA8A 1HTLD 3HOXG 1FD7D 4LJZC 2K04A 3C1FA 2F4VQ 1EIYB 1F2LA 4DR3L 3PO3H 3U9OA 4WJWA 3W5OA 1VQLA 4RGMA 1Z7TA 2E2DC 1HNWQ 3ULJA 1E1OA 3J7A5 1JB7A 3NBHA 4DKAC 4DGZA 1TR5A 4ME3A 1CI3M 3ICEA 4CKEA 4POFA 1X32A 4FVMA 1WTHA 3L0OA 1EY7A 3U9SA 1MGSA 3J81L 3CCRA 3LGJA 4HIOA 1X56A 3CC2A 1MBYA 4JI6L 4JI3Q 4G7OC 4NKLA 3PUZA 2EYPA 2IJ0A 2B63B 5IGFA 3BZKA 1IXRA 4J6HA 5C44B 2LY7A 3S9WA 3HEJA 1PH7A 5IT9E 1D1KA 1YI2A 1X3EA 4JK1C 3I91A 2O5IC 1UE5A 1BF4A 2SNMA 4KHPL 4K5VA 5KEEA 5ISRA 5EAYA 1OXVA 1PDQA 1EQVA 3STBD 3D4DA 4FNFA 4DR1Q 3HGBA 3T1YL 1TY2A 1X54A 1I50H 2G5DA 5D14A 4LFAL 1UWVA 2R7FA 1E7ZA 3AYHB 4DUYL 3GTJB 1IBMQ 5GAHC 3GP7A 3RZOB 1YBYA 1WFQA 1KLUD 2D2CC 2OTJA 1I4HA 4IQZA 3TSSA 1VQKA 1GJXA 1YVCA 2MJ8A
chains in the Genus database with same CATH topology
3CC4A 4R4TA 3A74A 4B3SL 1IL2A 1OXSC 4A76A 3VDYA 3M4PA 3T1HQ 3M3YH 2HQLA 3GTQH 2HIXA 1UE6A 2NVXH 2HT1A 3KDFA 3UDFA 2A8VA 3F1ZA 3MEFA 3CMEA 1VQ9A 5ELOA 2ALYB 2XGTA 2OWOA 3GTJH 4QL5A 4KI0A 1CUKA 1I94Q 1P16A 4L5RC 1D7QA 3HOWH 1I5FA 2QEXA 2LXKA 4PZ6A 2K50A 1IBML 5C4XG 4GS3A 5IYCG 1B7YB 1L2FA 1K3RA 1YNXA 3DLLA 1N9WA 4GOPA 4OX9Q 1Q7YC 3KDFB 2C35B 2CCZA 3PSIA 1V1QA 1SE8A 3Q8DA 3UE0A 1HR0W 4B3TL 2UU9Q 4JBWA 4R4CA 4OONA 1L0WA 4A3GH 2KENA 1X6OA 1VQ6A 3T1HL 4DV5L 4DV6L 1N34Q 3I55A 3PO2G 1YZ6A 4UPAA 2K5VA 4LWCA 3H0GG 5IWAL 4JG2A 1EFWA 1SFOH 4QQBX 3S1MH 4POGA 4PMWA 3OTOL 5C44G 4GKKL 1OTCA 3PO3G 3ULLA 1G6PA 2VUMH 2R7ZH 1T9HA 3ER0A 1CKMA 3CCJA 3KJPA 4JI0L 4HIKA 2ZTCA 3CCLA 2CKZB 4AIMA 2GVAA 1YHAA 1FL0A 1VCIA 4R1JA 2AKWB 1LM0A 1Q81C 4B3TQ 1YIJA 1MJEA 4YCWA 2NVYH 4Y7NH 3HOWG 5IE8A 5JJIA 1HR0Q 1CKOA 1U0LA 3J80i 2BA1A 4P73A 2WP8J 5GAEC 2VQEQ 3I4OA 3NEMA 2CWAA 5C4JH 1VQAA 1JMCA 2EIFA 3HOUG 4WJ3M 2UXBQ 1SN8A 4IFDG 1QVCA 2KHJA 2VZAA 5LMUL 3RZDH 5GQOA 2D62A 4GOPC 1VQNA 3RLFA 4LF5L 4Y52H 4IPGA 1SROA 5GAGC 2JEBI 5HGQA 2XTIA 3CXCA 2ZM6L 3HOUH 4PG3A 4JI5Q 2VW9A 1M1KC 2NZHA 1K9MC 3CCEA 3M4QA 3IRBA 2NN6G 2K5HA 1U5KA 1XNRL 1PYBA 3CPWA 1QUQB 4B3RL 4AQYQ 1XMQQ 5C44H 2MFIA 5IYCH 1AE2A 1VQFA 3MXNB 1GKHA 4L5QA 1JT8A 1JJGA 4A3KG 1HNXL 4NXML 1L1OA 1TWHH 2VQEL 4DV0Q 3PO2H 4DUYQ 3NELA 1MKHA 4LFBQ 2OQKA 3BZCA 4BBSH 2ZJPA 1K73C 3CD6A 4DV1Q 4LF7L 2Q2HA 4O2DA 1NTGA 1LYLA 2GVBA 4A3EG 1A63A 2K52A 3KF8B 4RG1A 3GTPH 4YWKA 2CFMA 4DV1L 4LF7Q 4OX9L 2I5LX 2VQFQ 1QVFA 3S16H 2JEAI 4PZ8A 1SLJA 4R4QA 2UUCQ 3PUWA 3G71A 2I5HA 3W1GA 4JV5Q 3K80C 3HOZG 2UXCQ 4DR7L 2NZOA 3HKZG 5M3FG 3E9HA 4DR3Q 4P74A 2JA6H 5C0XG 4AQYL 1XMQL 1PH3A 3HKZE 2IHEA 4JI1L 3M85A 3CCSA 1IBKL 1VQ8A 3UDIA 4X66L 4X62Q 5LMNW 4A3JG 4TVAB 4DAYB 4C3JH 4JI5L 2UUBQ 5GADC 2OTLA 4DV4Q 1KAWA 1DGSA 1YHBA 3U58A 1GM5A 2Z0SA 2BA0A 4DR4L 4B3MQ 2KHIA 1KIXA 1IYJB 1E3PA 3K0XA 2ATWA 2ID0A 4AH6A 2D0OA 4JI6Q 4LF4L 1TXYA 4A3IH 1VQHA 4R4IA 2HHHQ 2KCTA 2AWOA 3PIPA 2ZTDA 2NVQH 5BR8Q 2PI2E 1VQ4A 3CPFA 1JJCB 1EQRA 3RR5A 1EOVA 3F2DA 3J81c 1BBWA 4DK3C 1PA6A 2HHHL 4H02A 1PYSB 4JOIA 1VQ5A 1FVIA 1OXUA 4ALPA 1Q12A 4NXNL 4O0AA 3J81i 1ASYA 3GTOH 1GO3E 4BY7G 3GD7A 4JI7Q 2ES2A 4A3MH 1R9TH 2JE6I 4KHPQ 1YJWA 1FJGQ 2R7ZG 1QUQA 2K5NA 2R92H 2Z6KC 1NY4A 3HOXH 4UY8C 1WJJA 3GTMH 4JI1Q 3L2PA 3S2DH 4JCVE 3H0GH 3BJUA 2Y0SE 4LUOA 4JI2L 4BXXH 1X3FA 4GN4B 4KLKA 2VUMG 3D0FA 2BH2A 2VS1A 3AQQA 4BBRH 1L1OB 2MO1A 5C0XI 1JE5A 3KYHC 2YTXA 2QA4A 1Z9FA 5M3MH 1TWAH 2PMZE 4DR1L 2LXJA 2V1CC 1RIPA 4NPSA 4A75A 2JA5G 3I4MH 4IJLA 1Y1WG 5C0XJ 2NVTH 2UXBL 2Y0SG 1Q82C 1CSPA 4DR5Q 4A93H 3KF6A 3H3VH 1YJ9A 3HKSA 3KLWA 4IPDA 5M3MG 2RHQB 1K8GA 2UXDL 1C0AA 5IP7G 3DM3A 4JYAQ 1FGUA 3PGZA 3STBC 1PH2A 4A3FH 1H95A 4OXPA 5FLMH 2UUAL 3CCQA 2R93H 3G48A 3ULPA 1CKNB 1V43A 3A5ZB 2MNAA 4B3ML 1XNRQ 3M7NA 4A3BG 4GN5A 2MO0A 4FDBA 5C4XH 1MJCA 3CCUA 1KXLA 3JAMc 2VL6A 2ZM6Q 4A3KH 5J3BA 1KC8C 3KF6B 4R4OA 3U4ZA 4OWWB 2R92G 3HOVG 1Q8KA 4QJFA 3TRZA 2PQAA 1WI5A 3U50C 1IBKQ 1HNZL 4BBSG 3AFPA 1NMGA 4DV7L 4YCVA 3I56A 4GLVB 4DK6C 3WWVA 2A19A 1J6QA 2QGQA 4MTNA 4JV5L 4A3LG 4XIGS 4C3IH 1J5EQ 2ZTEA 1HR0L 1VQIA 2ZJQA 2R6GA 4BY1G 3U4VA 3NBHB 3L7ZC 4LFCQ 4JI8L 2RHSB 4L5SA 2IY5B 2RF4A 3CF5A 2PQAB 1VQJA 2E5LQ 1A0IA 1OXTA 1VQGA 3PCOB 3GDEA 2K14A 4HJ9A 4GNXC 1PH4A 4YY3Q 1OXXK 4DV2Q 3PUXA 4HIMA 4HJAA 3FKIG 4J15A 4LFBL 4DV3Q 2Q2UA 1HNWL 1QZGA 1VQMA 4A3DG 4DV0L 3TREA 1AE3A 5M3FH 5IT9c 3J80c 4GKKQ 3RLNA 1L1OC 4NB3A 5IWAQ 3RNUA 4AYBE 5DLQE 3E0EA 1K83H 3H15A 4YHHL 4DV4L 4UP7A 1QVGA 3CAMA 1X55A 1XTDA 4YWLA 1Q86C 2GN5A 2OQ0A 3A0JA 5IP9H 3FP9A 4LF5Q 4LUZA 3PV0A 2DUDA 4DR2L 4NXNQ 2AHOB 5JEAJ 2JA5H 1VQDA 2ASBA 4IOAA 4DNIA 3J7ZC 3G4SA 4DUZL 1YEZA 2OCEA 2RCNA 3HFZB 4IOCA 4A3IG 2JQOA 1SR3A 1S40A 3B6YA 1HZ9A 3KOJA 3TQYA 1Y1VH 1BVSA 2AMCB 1HZAA 2LSSA 5JJKA 3G6EA 2YV5A 3H3VI 1YHQA 1G51A 1Q46A 1SRUA 4DV3L 1PH9A 2UXDQ 1N33L 1CKNA 5C3EG 4DR5L 3M4OH 4P71A 2VNUD 2K4KA 1VQ7A 4X65L 4HJ7A 1VQCA 3KJOA 4LF8Q 1N32L 5AJ3L 1VQEA 1Y14B 5M5YH 2PNHA 3FKIH 3UE1A 4A3MG 1XNQL 2HIVA 1Q1EA 2DGYA 3TS2A 1PH6A 4DR6Q 2AWNA 2L15A 3ERSX 1KRTA 3TS0A 4BY7H 3K8AA 1D8LA 4LF9Q 2F4VL 3E9IA 4BXXG 1C9OA 4B3RQ 2H5XA 5M5XH 2CQOA 4DV6Q 1XJVA 5IYBG 1NJIC 2IX0A 1EUJA 3CC7A 5ELNA 4LFAQ 3SGIA 4DPGA 4QY7A 4YY3L 4DV2L 1XMOL 1N36Q 1AH9A 4EX5A 2UU9L 4GNXB 4TQUS 1KHIA 5IP7H 5AJ3Q 1GVPA 1LTLA 4LF8L 4MNOA 4X65Q 2CWPA 4LFCL 2YU9H 1EIFA 4LW1A 4A4IA 3M9BA 4IPHA 2PI2A 1HZCA 4LUVA 1TWFH 1KD1C 5FLXc 4HJ8A 1VQOA 1XPRA 4JBKA 4A3DH 1PH8A 4A3JH 1HNXQ 4NXMQ 2B63H 3S14H 1UEBA 1WCMH 3OW2A 2Q2TA 5JEAG 4MZ9A 1ASZA 2JA6G 2YTVA 4GLXA 2F52A 3CW2C 4PZ7A 1N36L 3S2HH 1A8VA 2R7DA 3I7FA 4OWTB 2UUBL 4JI0Q 3HOVH 5IY0A 1JJ2A 4LF6Q 3S1QH 3EN2A 1I3QH 4XTCS 3NENA 4JI3L 2WB1G 2YTYA 4JI4Q 4LNQA 4GN3B 1IBLL 1EWIA 1HJPA 4LF9L 1XPOA 3GTKH 4A3CH 3OYYA 3UDXA 3F8TA 3CMAA 4DR7Q 4OO1I 1NMFA 4IO9A 3BU2A 1IZ6A 1B8AA 1VS0A 3EBEA 4BBRG 1X9NA 2UUCL 3EIVA 1UE7A 4L5TA 1I6HH 2VQFL 5IYDG 1VQPA 2K75A 3W1BA 2B3GA 5LMNL 3I4MG 4JI8Q 1X3GA 1S3OA 3GTGH 3S17H 3TEHB 3RZOH 1E22A 1E24A 2WAQE 1BKBA 3D31A 4UP8A 5FJ8G 5FJ8H 1C7YA 1J5EL 3I4NG 3I4NH 4X64L 3HOZH 1RL2A 4BA2I 2JK8A 1PH5A 3AEVA 3HOYH 1WCMG 4JI2Q 2N3SA 4DUZQ 3RN5A 1P8LA 1WOCA 2Z6KA 3PF5A 1I94L 1IBLQ 4BA1I 4DR2Q 3PUYA 4JC0A 2WFWA 1PV4A 4K0KQ 2E2IH 3I2ZA 4APVA 4IFDI 4JBMA 4A3FG 1NE3A 3CP0A 2JJQA 2R93G 4B3SQ 5GROA 1KQSA 4K0KL 2IX1A 2VY3A 4A3CG 1TWCH 1HZBA 4IFDJ 1PFSA 5LMUQ 1XPUA 1KRSA 4IJHA 1S72A 3PIOA 4JYAL 4A3LH 3RLOA 4C3HH 4HJ5A 2MQHA 2F3IA 3T1YQ 1TWGH 2I5MX 4DAMA 5M5WH 1B70B 3S24A 4X6AH 3CCVA 1Z47A 4HIDA 1A62A 4BY1H 1XMOQ 2IHFA 2E8GA 3HOXG 2A1AA 2F4VQ 1MIUA 1EIYB 4JBJA 3OTOQ 3K7AH 4GLAC 1K0RA 5HY6A 4DR3L 3PO3H 1GD7A 1Q1BA 1QZHA 2JA7H 2EXDA 3W5OA 1VQLA 2EQSA 1W3SA 3F2BA 2ZJRA 4DV5Q 3UDGA 1HNWQ 1XNQQ 3ULJA 3HOYG 1E1OA 1FJGL 3J7A5 1JB7A 1M90C 1E1TA 4DKAC 2D0PA 1YJNA 2E5LL 5IYDH 2WB1E 2E2HH 4ME3A 2IT1A 1N8RC 4QIWE 3ICEA 2NN6I 4POFA 1PVOA 1N33Q 2JA8H 2JA8G 1SMXA 1NBWA 1G291 3L0OA 4EQ5A 1PH1A 1O7IA 5BR8L 1CSQA 5C3EH 4GOPB 1YITA 3S1RH 4UP9A 1Y1WH 4YCUA 1K8AC 3CCRA 1HH2P 3J81j 1V9PA 1VQBA 3LGJA 4DV7Q 4HIOA 4A93G 1X56A 3CC2A 1Y1VG 5IP9G 4JI6L 4JI3Q 4JI4L 4A3BH 2UUAQ 1HNZQ 3PUZA 5K36G 4DR4Q 4QGUA 1W2BA 3BZKA 2N78A 2WAQG 4LF6L 1IXRA 3PUVA 3S1NH 2JA9A 4YHHQ 4X62L 5E7NA 4X66Q 1PH7A 3S15H 1EYGA 4P72A 4P75A 1YI2A 1X3EA 4GKJQ 2YYZA 4A3GG 2Q2IA 3GO5A 1EQQA 4IPCA 2FXQA 2JA7G 3FHWA 3JAMi 3GTLH 5IYBH 4DR6L 4A3EH 2UXCL 1UE1A 1UE5A 3K81C 4OWXB 1N34L 4X64Q 3CQZH 3PF4A 4KHPL 3AFQA 4JI7L 5EAYA 4YWMA 1OXVA 2I0QA 4KHZA 1N32Q 1X65A 3STBD 3ZJYC 5H1SE 4GNXA 5LMNQ 4AYBG 4DR1Q 3KFUA 3CCMA 1PHJA 2N8NA 2E2JH 3T1YL 4RMFA 3RN2A 3A5UA 1X54A 1I50H 4LFAL 1UWVA 2R7FA 1E7ZA 2N49A 4C2MH 3F2CA 2KBNA 3AYHB 4DUYL 3K7UC 2BH8A 1IBMQ 2B63G 1LUZA 5GAHC 4WJ4A 5JJLA 3JC66 1KL9A 4OO1G 5FLMG 1YBYA 2B29A 1WFQA 1WYDA 4GKJL 4LF4Q 2OTJA 1VQKA 4JOIC 1YVCA 1BBUA 2KCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 A;  4R4T A;  3A74 A;  4B3S L;  1IL2 A;  1OXS C;  4A76 A;  3VDY A;  3M4P A;  3T1H Q;  3M3Y H;  2HQL A;  3GTQ H;  2HIX A;  1UE6 A;  2NVX H;  2HT1 A;  3KDF A;  3UDF A;  2A8V A;  3F1Z A;  3MEF A;  3CME A;  1VQ9 A;  5ELO A;  2ALY B;  2XGT A;  2OWO A;  3GTJ H;  4QL5 A;  4KI0 A;  1CUK A;  1I94 Q;  1P16 A;  4L5R C;  1D7Q A;  3HOW H;  1I5F A;  2QEX A;  2LXK A;  4PZ6 A;  2K50 A;  1IBM L;  5C4X G;  4GS3 A;  5IYC G;  1B7Y B;  1L2F A;  1K3R A;  1YNX A;  3DLL A;  1N9W A;  4GOP A;  4OX9 Q;  1Q7Y C;  3KDF B;  2C35 B;  2CCZ A;  3PSI A;  1V1Q A;  1SE8 A;  3Q8D A;  3UE0 A;  1HR0 W;  4B3T L;  2UU9 Q;  4JBW A;  4R4C A;  4OON A;  1L0W A;  4A3G H;  2KEN A;  1X6O A;  1VQ6 A;  3T1H L;  4DV5 L;  4DV6 L;  1N34 Q;  3I55 A;  3PO2 G;  1YZ6 A;  4UPA A;  2K5V A;  4LWC A;  3H0G G;  5IWA L;  4JG2 A;  1EFW A;  1SFO H;  4QQB X;  3S1M H;  4POG A;  4PMW A;  3OTO L;  5C44 G;  4GKK L;  1OTC A;  3PO3 G;  3ULL A;  1G6P A;  2VUM H;  2R7Z H;  1T9H A;  3ER0 A;  1CKM A;  3CCJ A;  3KJP A;  4JI0 L;  4HIK A;  2ZTC A;  3CCL A;  2CKZ B;  4AIM A;  2GVA A;  1YHA A;  1FL0 A;  1VCI A;  4R1J A;  2AKW B;  1LM0 A;  1Q81 C;  4B3T Q;  1YIJ A;  1MJE A;  4YCW A;  2NVY H;  4Y7N H;  3HOW G;  5IE8 A;  5JJI A;  1HR0 Q;  1CKO A;  1U0L A;  3J80 i;  2BA1 A;  4P73 A;  2WP8 J;  5GAE C;  2VQE Q;  3I4O A;  3NEM A;  2CWA A;  5C4J H;  1VQA A;  1JMC A;  2EIF A;  3HOU G;  4WJ3 M;  2UXB Q;  1SN8 A;  4IFD G;  1QVC A;  2KHJ A;  2VZA A;  5LMU L;  3RZD H;  5GQO A;  2D62 A;  4GOP C;  1VQN A;  3RLF A;  4LF5 L;  4Y52 H;  4IPG A;  1SRO A;  5GAG C;  2JEB I;  5HGQ A;  2XTI A;  3CXC A;  2ZM6 L;  3HOU H;  4PG3 A;  4JI5 Q;  2VW9 A;  1M1K C;  2NZH A;  1K9M C;  3CCE A;  3M4Q A;  3IRB A;  2NN6 G;  2K5H A;  1U5K A;  1XNR L;  1PYB A;  3CPW A;  1QUQ B;  4B3R L;  4AQY Q;  1XMQ Q;  5C44 H;  2MFI A;  5IYC H;  1AE2 A;  1VQF A;  3MXN B;  1GKH A;  4L5Q A;  1JT8 A;  1JJG A;  4A3K G;  1HNX L;  4NXM L;  1L1O A;  1TWH H;  2VQE L;  4DV0 Q;  3PO2 H;  4DUY Q;  3NEL A;  1MKH A;  4LFB Q;  2OQK A;  3BZC A;  4BBS H;  2ZJP A;  1K73 C;  3CD6 A;  4DV1 Q;  4LF7 L;  2Q2H A;  4O2D A;  1NTG A;  1LYL A;  2GVB A;  4A3E G;  1A63 A;  2K52 A;  3KF8 B;  4RG1 A;  3GTP H;  4YWK A;  2CFM A;  4DV1 L;  4LF7 Q;  4OX9 L;  2I5L X;  2VQF Q;  1QVF A;  3S16 H;  2JEA I;  4PZ8 A;  1SLJ A;  4R4Q A;  2UUC Q;  3PUW A;  3G71 A;  2I5H A;  3W1G A;  4JV5 Q;  3K80 C;  3HOZ G;  2UXC Q;  4DR7 L;  2NZO A;  3HKZ G;  5M3F G;  3E9H A;  4DR3 Q;  4P74 A;  2JA6 H;  5C0X G;  4AQY L;  1XMQ L;  1PH3 A;  3HKZ E;  2IHE A;  4JI1 L;  3M85 A;  3CCS A;  1IBK L;  1VQ8 A;  3UDI A;  4X66 L;  4X62 Q;  5LMN W;  4A3J G;  4TVA B;  4DAY B;  4C3J H;  4JI5 L;  2UUB Q;  5GAD C;  2OTL A;  4DV4 Q;  1KAW A;  1DGS A;  1YHB A;  3U58 A;  1GM5 A;  2Z0S A;  2BA0 A;  4DR4 L;  4B3M Q;  2KHI A;  1KIX A;  1IYJ B;  1E3P A;  3K0X A;  2ATW A;  2ID0 A;  4AH6 A;  2D0O A;  4JI6 Q;  4LF4 L;  1TXY A;  4A3I H;  1VQH A;  4R4I A;  2HHH Q;  2KCT A;  2AWO A;  3PIP A;  2ZTD A;  2NVQ H;  5BR8 Q;  2PI2 E;  1VQ4 A;  3CPF A;  1JJC B;  1EQR A;  3RR5 A;  1EOV A;  3F2D A;  3J81 c;  1BBW A;  4DK3 C;  1PA6 A;  2HHH L;  4H02 A;  1PYS B;  4JOI A;  1VQ5 A;  1FVI A;  1OXU A;  4ALP A;  1Q12 A;  4NXN L;  4O0A A;  3J81 i;  1ASY A;  3GTO H;  1GO3 E;  4BY7 G;  3GD7 A;  4JI7 Q;  2ES2 A;  4A3M H;  1R9T H;  2JE6 I;  4KHP Q;  1YJW A;  1FJG Q;  2R7Z G;  1QUQ A;  2K5N A;  2R92 H;  2Z6K C;  1NY4 A;  3HOX H;  4UY8 C;  1WJJ A;  3GTM H;  4JI1 Q;  3L2P A;  3S2D H;  4JCV E;  3H0G H;  3BJU A;  2Y0S E;  4LUO A;  4JI2 L;  4BXX H;  1X3F A;  4GN4 B;  4KLK A;  2VUM G;  3D0F A;  2BH2 A;  2VS1 A;  3AQQ A;  4BBR H;  1L1O B;  2MO1 A;  5C0X I;  1JE5 A;  3KYH C;  2YTX A;  2QA4 A;  1Z9F A;  5M3M H;  1TWA H;  2PMZ E;  4DR1 L;  2LXJ A;  2V1C C;  1RIP A;  4NPS A;  4A75 A;  2JA5 G;  3I4M H;  4IJL A;  1Y1W G;  5C0X J;  2NVT H;  2UXB L;  2Y0S G;  1Q82 C;  1CSP A;  4DR5 Q;  4A93 H;  3KF6 A;  3H3V H;  1YJ9 A;  3HKS A;  3KLW A;  4IPD A;  5M3M G;  2RHQ B;  1K8G A;  2UXD L;  1C0A A;  5IP7 G;  3DM3 A;  4JYA Q;  1FGU A;  3PGZ A;  3STB C;  1PH2 A;  4A3F H;  1H95 A;  4OXP A;  5FLM H;  2UUA L;  3CCQ A;  2R93 H;  3G48 A;  3ULP A;  1CKN B;  1V43 A;  3A5Z B;  2MNA A;  4B3M L;  1XNR Q;  3M7N A;  4A3B G;  4GN5 A;  2MO0 A;  4FDB A;  5C4X H;  1MJC A;  3CCU A;  1KXL A;  3JAM c;  2VL6 A;  2ZM6 Q;  4A3K H;  5J3B A;  1KC8 C;  3KF6 B;  4R4O A;  3U4Z A;  4OWW B;  2R92 G;  3HOV G;  1Q8K A;  4QJF A;  3TRZ A;  2PQA A;  1WI5 A;  3U50 C;  1IBK Q;  1HNZ L;  4BBS G;  3AFP A;  1NMG A;  4DV7 L;  4YCV A;  3I56 A;  4GLV B;  4DK6 C;  3WWV A;  2A19 A;  1J6Q A;  2QGQ A;  4MTN A;  4JV5 L;  4A3L G;  4XIG S;  4C3I H;  1J5E Q;  2ZTE A;  1HR0 L;  1VQI A;  2ZJQ A;  2R6G A;  4BY1 G;  3U4V A;  3NBH B;  3L7Z C;  4LFC Q;  4JI8 L;  2RHS B;  4L5S A;  2IY5 B;  2RF4 A;  3CF5 A;  2PQA B;  1VQJ A;  2E5L Q;  1A0I A;  1OXT A;  1VQG A;  3PCO B;  3GDE A;  2K14 A;  4HJ9 A;  4GNX C;  1PH4 A;  4YY3 Q;  1OXX K;  4DV2 Q;  3PUX A;  4HIM A;  4HJA A;  3FKI G;  4J15 A;  4LFB L;  4DV3 Q;  2Q2U A;  1HNW L;  1QZG A;  1VQM A;  4A3D G;  4DV0 L;  3TRE A;  1AE3 A;  5M3F H;  5IT9 c;  3J80 c;  4GKK Q;  3RLN A;  1L1O C;  4NB3 A;  5IWA Q;  3RNU A;  4AYB E;  5DLQ E;  3E0E A;  1K83 H;  3H15 A;  4YHH L;  4DV4 L;  4UP7 A;  1QVG A;  3CAM A;  1X55 A;  1XTD A;  4YWL A;  1Q86 C;  2GN5 A;  2OQ0 A;  3A0J A;  5IP9 H;  3FP9 A;  4LF5 Q;  4LUZ A;  3PV0 A;  2DUD A;  4DR2 L;  4NXN Q;  2AHO B;  5JEA J;  2JA5 H;  1VQD A;  2ASB A;  4IOA A;  4DNI A;  3J7Z C;  3G4S A;  4DUZ L;  1YEZ A;  2OCE A;  2RCN A;  3HFZ B;  4IOC A;  4A3I G;  2JQO A;  1SR3 A;  1S40 A;  3B6Y A;  1HZ9 A;  3KOJ A;  3TQY A;  1Y1V H;  1BVS A;  2AMC B;  1HZA A;  2LSS A;  5JJK A;  3G6E A;  2YV5 A;  3H3V I;  1YHQ A;  1G51 A;  1Q46 A;  1SRU A;  4DV3 L;  1PH9 A;  2UXD Q;  1N33 L;  1CKN A;  5C3E G;  4DR5 L;  3M4O H;  4P71 A;  2VNU D;  2K4K A;  1VQ7 A;  4X65 L;  4HJ7 A;  1VQC A;  3KJO A;  4LF8 Q;  1N32 L;  5AJ3 L;  1VQE A;  1Y14 B;  5M5Y H;  2PNH A;  3FKI H;  3UE1 A;  4A3M G;  1XNQ L;  2HIV A;  1Q1E A;  2DGY A;  3TS2 A;  1PH6 A;  4DR6 Q;  2AWN A;  2L15 A;  3ERS X;  1KRT A;  3TS0 A;  4BY7 H;  3K8A A;  1D8L A;  4LF9 Q;  2F4V L;  3E9I A;  4BXX G;  1C9O A;  4B3R Q;  2H5X A;  5M5X H;  2CQO A;  4DV6 Q;  1XJV A;  5IYB G;  1NJI C;  2IX0 A;  1EUJ A;  3CC7 A;  5ELN A;  4LFA Q;  3SGI A;  4DPG A;  4QY7 A;  4YY3 L;  4DV2 L;  1XMO L;  1N36 Q;  1AH9 A;  4EX5 A;  2UU9 L;  4GNX B;  4TQU S;  1KHI A;  5IP7 H;  5AJ3 Q;  1GVP A;  1LTL A;  4LF8 L;  4MNO A;  4X65 Q;  2CWP A;  4LFC L;  2YU9 H;  1EIF A;  4LW1 A;  4A4I A;  3M9B A;  4IPH A;  2PI2 A;  1HZC A;  4LUV A;  1TWF H;  1KD1 C;  5FLX c;  4HJ8 A;  1VQO A;  1XPR A;  4JBK A;  4A3D H;  1PH8 A;  4A3J H;  1HNX Q;  4NXM Q;  2B63 H;  3S14 H;  1UEB A;  1WCM H;  3OW2 A;  2Q2T A;  5JEA G;  4MZ9 A;  1ASZ A;  2JA6 G;  2YTV A;  4GLX A;  2F52 A;  3CW2 C;  4PZ7 A;  1N36 L;  3S2H H;  1A8V A;  2R7D A;  3I7F A;  4OWT B;  2UUB L;  4JI0 Q;  3HOV H;  5IY0 A;  1JJ2 A;  4LF6 Q;  3S1Q H;  3EN2 A;  1I3Q H;  4XTC S;  3NEN A;  4JI3 L;  2WB1 G;  2YTY A;  4JI4 Q;  4LNQ A;  4GN3 B;  1IBL L;  1EWI A;  1HJP A;  4LF9 L;  1XPO A;  3GTK H;  4A3C H;  3OYY A;  3UDX A;  3F8T A;  3CMA A;  4DR7 Q;  4OO1 I;  1NMF A;  4IO9 A;  3BU2 A;  1IZ6 A;  1B8A A;  1VS0 A;  3EBE A;  4BBR G;  1X9N A;  2UUC L;  3EIV A;  1UE7 A;  4L5T A;  1I6H H;  2VQF L;  5IYD G;  1VQP A;  2K75 A;  3W1B A;  2B3G A;  5LMN L;  3I4M G;  4JI8 Q;  1X3G A;  1S3O A;  3GTG H;  3S17 H;  3TEH B;  3RZO H;  1E22 A;  1E24 A;  2WAQ E;  1BKB A;  3D31 A;  4UP8 A;  5FJ8 G;  5FJ8 H;  1C7Y A;  1J5E L;  3I4N G;  3I4N H;  4X64 L;  3HOZ H;  1RL2 A;  4BA2 I;  2JK8 A;  1PH5 A;  3AEV A;  3HOY H;  1WCM G;  4JI2 Q;  2N3S A;  4DUZ Q;  3RN5 A;  1P8L A;  1WOC A;  2Z6K A;  3PF5 A;  1I94 L;  1IBL Q;  4BA1 I;  4DR2 Q;  3PUY A;  4JC0 A;  2WFW A;  1PV4 A;  4K0K Q;  2E2I H;  3I2Z A;  4APV A;  4IFD I;  4JBM A;  4A3F G;  1NE3 A;  3CP0 A;  2JJQ A;  2R93 G;  4B3S Q;  5GRO A;  1KQS A;  4K0K L;  2IX1 A;  2VY3 A;  4A3C G;  1TWC H;  1HZB A;  4IFD J;  1PFS A;  5LMU Q;  1XPU A;  1KRS A;  4IJH A;  1S72 A;  3PIO A;  4JYA L;  4A3L H;  3RLO A;  4C3H H;  4HJ5 A;  2MQH A;  2F3I A;  3T1Y Q;  1TWG H;  2I5M X;  4DAM A;  5M5W H;  1B70 B;  3S24 A;  4X6A H;  3CCV A;  1Z47 A;  4HID A;  1A62 A;  4BY1 H;  1XMO Q;  2IHF A;  2E8G A;  3HOX G;  2A1A A;  2F4V Q;  1MIU A;  1EIY B;  4JBJ A;  3OTO Q;  3K7A H;  4GLA C;  1K0R A;  5HY6 A;  4DR3 L;  3PO3 H;  1GD7 A;  1Q1B A;  1QZH A;  2JA7 H;  2EXD A;  3W5O A;  1VQL A;  2EQS A;  1W3S A;  3F2B A;  2ZJR A;  4DV5 Q;  3UDG A;  1HNW Q;  1XNQ Q;  3ULJ A;  3HOY G;  1E1O A;  1FJG L;  3J7A 5;  1JB7 A;  1M90 C;  1E1T A;  4DKA C;  2D0P A;  1YJN A;  2E5L L;  5IYD H;  2WB1 E;  2E2H H;  4ME3 A;  2IT1 A;  1N8R C;  4QIW E;  3ICE A;  2NN6 I;  4POF A;  1PVO A;  1N33 Q;  2JA8 H;  2JA8 G;  1SMX A;  1NBW A;  1G29 1;  3L0O A;  4EQ5 A;  1PH1 A;  1O7I A;  5BR8 L;  1CSQ A;  5C3E H;  4GOP B;  1YIT A;  3S1R H;  4UP9 A;  1Y1W H;  4YCU A;  1K8A C;  3CCR A;  1HH2 P;  3J81 j;  1V9P A;  1VQB A;  3LGJ A;  4DV7 Q;  4HIO A;  4A93 G;  1X56 A;  3CC2 A;  1Y1V G;  5IP9 G;  4JI6 L;  4JI3 Q;  4JI4 L;  4A3B H;  2UUA Q;  1HNZ Q;  3PUZ A;  5K36 G;  4DR4 Q;  4QGU A;  1W2B A;  3BZK A;  2N78 A;  2WAQ G;  4LF6 L;  1IXR A;  3PUV A;  3S1N H;  2JA9 A;  4YHH Q;  4X62 L;  5E7N A;  4X66 Q;  1PH7 A;  3S15 H;  1EYG A;  4P72 A;  4P75 A;  1YI2 A;  1X3E A;  4GKJ Q;  2YYZ A;  4A3G G;  2Q2I A;  3GO5 A;  1EQQ A;  4IPC A;  2FXQ A;  2JA7 G;  3FHW A;  3JAM i;  3GTL H;  5IYB H;  4DR6 L;  4A3E H;  2UXC L;  1UE1 A;  1UE5 A;  3K81 C;  4OWX B;  1N34 L;  4X64 Q;  3CQZ H;  3PF4 A;  4KHP L;  3AFQ A;  4JI7 L;  5EAY A;  4YWM A;  1OXV A;  2I0Q A;  4KHZ A;  1N32 Q;  1X65 A;  3STB D;  3ZJY C;  5H1S E;  4GNX A;  5LMN Q;  4AYB G;  4DR1 Q;  3KFU A;  3CCM A;  1PHJ A;  2N8N A;  2E2J H;  3T1Y L;  4RMF A;  3RN2 A;  3A5U A;  1X54 A;  1I50 H;  4LFA L;  1UWV A;  2R7F A;  1E7Z A;  2N49 A;  4C2M H;  3F2C A;  2KBN A;  3AYH B;  4DUY L;  3K7U C;  2BH8 A;  1IBM Q;  2B63 G;  1LUZ A;  5GAH C;  4WJ4 A;  5JJL A;  3JC6 6;  1KL9 A;  4OO1 G;  5FLM G;  1YBY A;  2B29 A;  1WFQ A;  1WYD A;  4GKJ L;  4LF4 Q;  2OTJ A;  1VQK A;  4JOI C;  1YVC A;  1BBU A;  2KCM A; 
#chains in the Genus database with same CATH topology
 5DAU A;  4B3S L;  1IL2 A;  3VDY A;  2B39 A;  4DFA A;  2HT1 A;  2PO4 A;  5ELO A;  2ALY B;  3GTJ H;  4QL5 A;  5D3D A;  1IKL A;  5L37 A;  4L5R C;  1D7Q A;  2Q8I B;  4F88 A;  2NZ1 D;  1I5F A;  3D4W A;  4ZUJ A;  2K32 A;  5C4X G;  1H9R A;  1CHQ D;  3DLL A;  1B7Y B;  1L2F A;  3M7G A;  1E2V A;  4DAP A;  1SYF A;  1KTK A;  4F7X A;  2CCZ A;  3OIP A;  4B3T L;  2F0I A;  2UU9 Q;  2CH4 W;  2J7Z A;  2OXP A;  3Q0A A;  4DXF A;  3H6M A;  4JG2 A;  1SFO H;  4POG A;  4PMW A;  5C44 G;  1OTC A;  4DK0 A;  3SXH A;  1T9H A;  4KY5 A;  2Z9H A;  4AIM A;  1YHA A;  4KJO A;  5KRU A;  1ZKO A;  4YCW A;  2HCC A;  2K6A A;  2VXW A;  5FK9 C;  1OO9 B;  1CFM A;  2WP8 J;  4DAV A;  3I4O A;  1HQM C;  2G9H D;  2EOT A;  1VQA A;  1JWU D;  1JWS D;  1S4Z A;  2VB2 X;  4CJ1 B;  3RZD H;  1DYQ A;  5GQO A;  3PO2 B;  5CMD A;  4GOP C;  1VQN A;  4ILW A;  3ERQ A;  4IPG A;  1Y1W B;  4Y52 H;  4Y7N B;  3OWE B;  1S5D D;  4RCO A;  2VW9 A;  4JI5 Q;  3EA6 A;  1B3A A;  3M4Q A;  3OSO A;  5CV7 A;  3QG1 A;  4C3I B;  3S1N B;  2NB0 A;  2B2Y C;  3K0Y A;  5CBE E;  1STE A;  5ELB A;  4DV0 Q;  1TWH H;  1JC7 A;  3LX0 A;  3A56 A;  4LFB Q;  5D3I B;  4PMB A;  2XN9 C;  3MVV A;  4O1N A;  1K73 C;  1Q3L A;  3GTL B;  1V1P B;  2Q2H A;  1ZYR D;  4IZ8 A;  3CU7 A;  4FYD A;  3G6J B;  2CFM A;  5M3F B;  1D2B A;  2I5L X;  1EY5 A;  3NPP A;  3SEB A;  3K57 A;  4JV5 Q;  2RKS A;  4DR7 L;  3HKZ G;  1GHJ A;  5M3F G;  4DR3 Q;  4P74 A;  5A2Q L;  3HKZ E;  5EBC A;  4JI1 L;  4X3T A;  4X66 L;  4X62 Q;  3HKZ B;  4TVA B;  1PFN A;  4EQP A;  1G6Z A;  2F3W A;  4C3J H;  2Q8T A;  5GAD C;  2OTL A;  3U58 A;  1GM5 A;  1H9J A;  1WTX A;  1IYJ B;  4LF4 L;  1GUW A;  1VF5 C;  1HTP A;  1STN A;  2N88 A;  4A3I H;  3HZX A;  2HHH Q;  2AWO A;  1YNN C;  3PIP A;  2PI2 E;  4ZUI A;  1VQ4 A;  4H13 C;  5K36 H;  3RR5 A;  1EOV A;  1HRJ A;  1PA6 A;  2HCI A;  4JOI A;  1PYS B;  1VQ5 A;  5FLX E;  2KCC A;  3J81 i;  1XTC D;  1A15 A;  1GO3 E;  5IOD A;  4A3M H;  1R9T H;  1EY9 A;  2K5N A;  4DA2 A;  4UY8 C;  5C6A A;  3S2D H;  2L9H A;  4LUO A;  3D0F A;  1O7L A;  4BBR H;  2AUK A;  2MO1 A;  3KF8 A;  1Z9F A;  2BCO A;  1H9S A;  2JA5 G;  1RIP A;  1TT2 A;  1D5X C;  4G7Z C;  4X3S A;  4C1N K;  2NVT H;  1CSP A;  4A93 H;  3H3V H;  1UEA B;  4KY6 A;  2A5H A;  1QCB D;  4IPD A;  1C0A A;  5IP7 G;  1SMY D;  3PGZ A;  2WAQ B;  1O7Z A;  4OXP A;  3CCQ A;  4ME5 A;  3A5Z B;  2MNA A;  4LK1 C;  1XNR Q;  2NTT A;  1STY A;  2MO0 A;  2Z4H A;  3GTK B;  4K6L A;  3MXG A;  1HNZ L;  2IPK D;  3AFP A;  1QNK A;  1AEX A;  1NMG A;  5EQ0 A;  1STG A;  3D4R A;  1QJO A;  4RHS A;  1H9M A;  3U4V A;  1UNS A;  5EKL A;  3L7Z C;  2EXZ A;  4LFC Q;  2FHT A;  2FMC A;  2IY5 B;  2E75 C;  2CW0 D;  4OO1 H;  1A0I A;  4FXD A;  4K14 A;  4HJ9 A;  3GDE A;  1PH4 A;  4YY3 Q;  4DV2 Q;  3PUX A;  4CKC A;  2Q2U A;  4P2C B;  2EYL A;  3RD4 A;  3NTI A;  4E6I A;  5M3F H;  1F9P A;  1RKN A;  2TSS A;  2EY6 A;  1EQT A;  3RNU A;  2PQE A;  1K83 H;  1CM9 A;  3H15 A;  4UP7 A;  4RKL A;  4DN4 M;  1X55 A;  2OF1 A;  3H94 A;  2OQ0 A;  1C8C A;  4HSP A;  1RD9 D;  4LUZ A;  2JA5 H;  3N52 A;  3NK9 A;  4DNI A;  3J7Z C;  3G4S A;  2HQE A;  4IOC A;  3HFZ B;  2UUA Q;  1YNJ C;  2JQO A;  3B6Y A;  1HZA A;  2H1E A;  5JJK A;  2NYZ D;  1G51 A;  1E0B A;  5HGT A;  4DV3 L;  3R93 A;  5CBA E;  4BY7 B;  1CKN A;  5C3E G;  2JXM B;  4P71 A;  4OGQ C;  2K4K A;  3KBG A;  1VQ7 A;  4X65 L;  4OL7 A;  1AW7 A;  5FO7 B;  4LF8 Q;  1GUS A;  4HTH A;  3FKI H;  2Z6B A;  4A3M G;  1KNA A;  3QB3 A;  1Q1E A;  1A3V A;  4KD4 A;  4JW0 A;  2AWN A;  4CBV A;  3TS0 A;  4BY7 H;  4LF9 Q;  4BXX G;  3HOX B;  1ML0 D;  2CQO A;  3MXP A;  3MXN A;  4DV6 Q;  2A73 B;  1TS2 A;  1M4V A;  1EUJ A;  1K8M A;  4H44 C;  3CC7 A;  4L6T B;  1MD2 D;  5CV6 A;  4DPG A;  1WCM B;  5M5Y B;  3E6Z X;  4GNX B;  4OHJ A;  5IP7 H;  3DWQ A;  5AJ3 Q;  4IN3 A;  3S2H B;  5ELF A;  3ITP A;  1U4P A;  1ESF A;  1TWF H;  1J9O A;  1VQO A;  4A3B B;  1XPR A;  4FF3 A;  2NTS A;  1PH8 A;  1LLR D;  4N9T A;  1IKM A;  3K5M A;  1ILP A;  3EFX D;  3VYT A;  2JA6 G;  5KNB A;  3CW2 C;  1KDA A;  3S2H H;  3I7F A;  2R7D A;  1B2T A;  2F0D A;  1NNX A;  3TZD A;  3HOV H;  1JJ2 A;  2VB3 X;  1LT3 D;  4M1U B;  5C4X B;  1HHV A;  4LNQ A;  1DZ1 A;  2IL8 A;  1H9K A;  1IBL L;  4LF9 L;  4A3C H;  1PXU A;  1XPO A;  3OYY A;  3CMA A;  3F8T A;  1NMF A;  3I4N B;  4IO9 A;  1IZ6 A;  1B8A A;  3EBE A;  1X9N A;  1I6H H;  1QWY A;  5IYD G;  2B3G A;  2F0P A;  5LMN L;  2X6G A;  1D1I A;  3VR6 A;  2B2U A;  1PFB A;  4CJ0 B;  2CQA A;  3C3L A;  2EJG C;  1BKB A;  2WAQ E;  5FJ8 G;  5EKI A;  2XWJ B;  1PMR A;  3I4N H;  4BA2 I;  1PH5 A;  4JVZ A;  3HOY H;  1NSN S;  2RDF A;  4JI2 Q;  3L9A X;  4IAL A;  1P8L A;  3PF5 A;  1I94 L;  1IBL Q;  1GXD C;  2M00 A;  1TS5 A;  4K0K Q;  2P5Z X;  4A3F G;  1NE3 A;  1II3 A;  4OEL B;  1GUT A;  4K2L A;  5CV4 A;  4IFD J;  5LMU Q;  1XPU A;  1DD2 A;  3IFT A;  3JAM L;  1BCP C;  4C3H H;  4HJ5 A;  4DAM A;  1TII D;  3S24 A;  3Q6S A;  4X6A H;  3DHQ A;  3BDL A;  1FNV A;  5IGB A;  3CCV A;  1AP0 A;  3M4O B;  4BY1 H;  2IHF A;  5CYU A;  1EU4 A;  2E2H B;  2A1A A;  1KDC A;  4JBJ A;  2IW3 A;  2ZXO A;  3NTK A;  1K0R A;  4CKB A;  2K01 A;  2JA7 H;  2EQS A;  2XRS D;  3MHB A;  4HCE A;  4N8F A;  1E1T A;  2K03 A;  2D0P A;  2E5L L;  3TP7 A;  1N8R C;  1F77 A;  2B8G A;  2NN6 I;  1PVO A;  2JA8 H;  2JA8 G;  1SMX A;  1NBW A;  1G29 1;  1PH1 A;  4GOP B;  3S1R H;  2F0F A;  4YCU A;  5DNF A;  3GV6 A;  2Q8R E;  3J81 j;  1V1O A;  1TWF B;  4DV7 Q;  1Y1V G;  2KHS A;  5IP9 G;  4JI4 L;  4DR4 Q;  2F0E A;  2N78 A;  5JVH 3;  1CZW A;  3PUV A;  4HN7 A;  5E7N A;  3S15 H;  5I9P A;  2F0N A;  2EPB A;  2E2J B;  4P72 A;  5EBD A;  2ENB A;  2Q2I A;  1I50 B;  2JA7 G;  1VF7 A;  2JN4 A;  4DR6 L;  4A3E H;  4OWX B;  4X64 Q;  2FFK B;  1B4O A;  3CQZ H;  3PF4 A;  2AUJ D;  3ND9 A;  3AFQ A;  5K5P A;  4YWM A;  1TS3 A;  4GNX A;  2HD3 A;  5LMN Q;  1AN8 A;  3M3Y B;  5NUC A;  1B1Z A;  4RMF A;  2C9O A;  1X3Q A;  1X3P A;  3P75 A;  1DOM A;  4WJ4 A;  5JJL A;  2I46 A;  3JC6 6;  5JPN C;  1KL9 A;  1F2Z A;  4LF4 Q;  4I7A A;  1T5X D;  3A74 A;  3VYS A;  1ENC A;  3GTQ H;  2PCF B;  1UE6 A;  2A8V A;  3UDF A;  3WOE A;  1C48 A;  3CME A;  1VQ9 A;  1EEI D;  4KI0 A;  1Y8N B;  5FOB B;  5IGE A;  5LL6 S;  2QEX A;  2EJF C;  5F2D A;  1PZK D;  1LT5 D;  2B2V C;  3ZYY X;  1CA5 A;  3FMC A;  1JOO A;  1N9W A;  2EZV A;  3KDF B;  2C35 B;  3PSI A;  1BCP F;  3UE0 A;  1JOR A;  1F9R A;  1HUM A;  4R4C A;  1L0W A;  1X6O A;  2PYK A;  2C5C A;  1VQ6 A;  5C4Z A;  3T1H L;  1LV9 A;  4DV5 L;  4DV6 L;  3I55 A;  3PO2 G;  2Z1C A;  4UPA A;  2K5V A;  2NVY B;  2F0J A;  3H0G G;  5IWA L;  2RVL A;  4QQB X;  4GKK L;  2VUM H;  4I7Z C;  4XDX A;  4FF2 A;  1CKM A;  4JI0 L;  2ZTC A;  4A93 B;  3CCL A;  2JA7 B;  1VCI A;  2F0O A;  1LM0 A;  1JQY D;  1YIJ A;  2IX3 A;  2ZT9 C;  2BE5 D;  2L4N A;  3ND8 A;  4Y7N H;  3HOU B;  1RF2 D;  4KKT A;  5IE8 A;  1HR0 Q;  1CKO A;  3J80 i;  2JP1 A;  2LFN A;  4P73 A;  3HOU G;  1JMC A;  2EIF A;  4DNT B;  4IFD G;  2KHJ A;  3P1H A;  2D62 A;  2A6H D;  3K59 A;  3RLF A;  4LF5 L;  1NCV A;  3E5S A;  3CXC A;  2ZM6 L;  4PG3 A;  2NZH A;  4ZKB B;  4K6D A;  1PYB A;  2QCP X;  4B3R L;  1TQO A;  5E4X A;  2MFI A;  1AE2 A;  1VQF A;  3NHH A;  4HSV A;  1JJG A;  4NXM L;  1L1O A;  2Z8L A;  2VQE L;  3PO2 H;  1CK1 A;  3AMU A;  1MKH A;  2OQK A;  4BBS H;  1EIG A;  2DNE A;  4HAE A;  1SSO A;  1NTG A;  1LYL A;  2GVB A;  4ZLT F;  4A3E G;  1HA6 A;  4YWK A;  4M8A A;  4V0B A;  2L1B A;  1WTQ A;  2VQF Q;  1SLJ A;  4KY7 A;  3W1G A;  2UXC Q;  3HOZ G;  1ICW A;  2ICE C;  2B2W A;  2NZO A;  4NMZ A;  1FR3 A;  3E9H A;  5EPL A;  3FDT A;  2KA7 A;  2F0M A;  4C2M B;  5C0X G;  2JA6 H;  1SYB A;  1PH3 A;  1PLF A;  3M85 A;  5LMN W;  1J8I A;  2R61 A;  4DAY B;  4JI5 L;  4PQX A;  1QG7 A;  2L11 A;  5COR A;  4DR4 L;  1LTI D;  4DK1 A;  1E3P A;  3J81 E;  4AH6 A;  5IGD A;  1TXY A;  2QKI C;  5JVG 3;  4R4I A;  2ZTD A;  2NVQ H;  5BR8 Q;  4HMI A;  3DWP A;  3FPU B;  2EY5 A;  4H02 A;  4WOR A;  1WTO A;  4NXN L;  3H09 A;  3IKJ A;  4O0A A;  4CGY B;  4BY7 G;  3GD7 A;  2E74 C;  3WDN A;  2JE6 I;  4KHP Q;  1YJW A;  3BG3 A;  3CHB D;  2NVQ B;  1NY4 A;  2NVT B;  3H0G H;  3BYT B;  5EPK A;  3BJU A;  5C5L A;  2Y0S E;  1ET9 A;  2VUM G;  1SMY C;  2G9D A;  1JE5 A;  4A3M B;  1R9T B;  2VUM B;  2PMZ E;  1SNM A;  2LXJ A;  4NPS A;  4A75 A;  3I4M H;  4RGT A;  1IL8 A;  3ERO A;  3A8K E;  3S2D B;  2UXB L;  2Y0S G;  4DR5 Q;  3KF6 A;  3CRK C;  5M3M G;  2RHQ B;  2X6L A;  3SR1 A;  4JYA Q;  3NUC A;  1S5F D;  4NW2 A;  1PH2 A;  4A3F H;  5E1F A;  3G48 A;  3ULP A;  4RCN A;  1V43 A;  1A6X A;  1EOT A;  4A3B G;  4GN5 A;  1SYE A;  3D6C A;  1SYD A;  3E3X A;  1KXL A;  4OEM B;  2ZM6 Q;  1JB3 A;  3QR8 A;  1PZI D;  1KC8 C;  4OWW B;  2R92 G;  4QJF A;  1IBK Q;  4Q5V A;  3OPO A;  3O13 A;  4FF1 A;  3AU7 A;  2F0H A;  1QE6 A;  4GLV B;  4DK6 C;  4A3L G;  3I72 A;  5COY A;  2ZTE A;  1HR0 L;  1ET6 A;  4BY1 G;  5CC4 A;  3VR4 A;  4A3K B;  2SNS A;  3NTH A;  4PNY A;  4JI8 L;  4L5S A;  3X3M A;  1D5Z C;  3CF5 A;  1VQJ A;  1OXT A;  2K14 A;  5I4D A;  1OXX K;  4HJA A;  3FKI G;  4J15 A;  4LFB L;  4DV3 Q;  3RUZ A;  1VQM A;  4KN7 C;  4DV0 L;  3NE5 B;  2B2V A;  4MTK A;  3S16 B;  4G57 A;  5IT9 c;  1B50 A;  3J80 c;  4GKK Q;  2RDH A;  3RLN A;  1IYV A;  5IWA Q;  4AYB E;  5DLQ E;  1RTN A;  1DOK A;  1DXM A;  1NAP A;  1F2Y A;  1Q86 C;  2GN5 A;  3A0J A;  5IP9 H;  4DR2 L;  4ABN A;  5JEA J;  4CDC C;  2ASB A;  1YEZ A;  2OCE A;  3SK6 A;  3V05 A;  1HZ9 A;  5M5W B;  1Y1V H;  1F2M A;  3G6E A;  2YV5 A;  1Q46 A;  2VNU D;  2MUY A;  3M4O H;  3W2D A;  1BCP B;  1SE4 A;  3HG9 A;  1N32 L;  5AJ3 L;  5M5Y H;  2OEO A;  3PO3 B;  2PZT A;  5HUR A;  3TS2 A;  1PH6 A;  4K5X A;  3TME A;  3ERS X;  2PNR C;  1D8L A;  2EYM A;  4B3R Q;  2XNA C;  3AB9 A;  3H3V C;  3SK4 A;  5ELN A;  1N36 Q;  2JA8 B;  2F0L A;  4TQU S;  4R8I A;  1GVP A;  2OT2 A;  4MNO A;  3LWU A;  1PTO D;  5DM6 3;  4A4I A;  3S1R B;  4JPB W;  2PI2 A;  5LL6 X;  5DM7 3;  5A2Q E;  5KIX A;  4B9W A;  3HS0 C;  4CHT B;  1HNX Q;  2B63 H;  1LAB A;  3S14 H;  1A2T A;  3OIQ A;  2Q2T A;  4MZ9 A;  4L8J A;  4X3U A;  1ASZ A;  2YTV A;  2F52 A;  3I90 A;  1I6H B;  1EY4 A;  2F0G A;  2A69 D;  4OWT B;  4X3K A;  4JI0 Q;  1CQF A;  2WKC A;  4IUQ A;  3EN2 A;  4OIK A;  1XYI A;  4CDF C;  4JI4 Q;  2WB1 G;  2YTY A;  3NXW A;  3GTG B;  2EE1 A;  3VR3 A;  3UDX A;  4QCL A;  4OO1 I;  3BU2 A;  4BBR G;  3PIO 3;  3BS1 A;  4TRD A;  2UUC L;  4HCS A;  2VQF L;  2F03 A;  3DUZ A;  3I4M G;  3S1Q B;  3QOJ A;  4JI8 Q;  1S3O A;  3S17 H;  2F0W A;  3RZO H;  5TSS A;  1C7Y A;  1KNE A;  2JK8 A;  3AEV A;  3CKI B;  1Y8P B;  3RN5 A;  4DUZ Q;  2ZXR A;  2KED A;  1MSH A;  4BA1 I;  2QEJ C;  4C3H B;  2E2I H;  1B9N A;  4CDD C;  3FRP B;  4IFD I;  5CV8 A;  3BZD B;  2R3Z A;  5GRO A;  3SE0 A;  3TN2 A;  1ENF A;  1PFS A;  1I4R A;  1S72 A;  3PIO A;  4IFD H;  4JYA L;  1IW7 D;  3MC0 B;  4OIJ A;  2B8F A;  5C4H A;  1TWG H;  2I5M X;  5M5W H;  1B70 B;  1ZEQ X;  3P20 A;  1KLG D;  4HMJ A;  1LTR D;  4HID A;  1A62 A;  1RJT A;  1XMO Q;  4WRD A;  4QMG A;  2D5D A;  1MIU A;  4EGV A;  3OTO Q;  1DJR D;  1AZP A;  1GD7 A;  1PTO B;  1QZH A;  3F2B A;  1W3S A;  1RTO A;  4DV5 Q;  3UDG A;  3A8J E;  3Q22 A;  4FO2 A;  2B2Y A;  2IT1 A;  1U9R A;  3KUP A;  4QIW E;  5JOB A;  5C4J B;  2WKD A;  3RZD B;  4EQ5 A;  5BR8 L;  1GUG A;  5C3E H;  1Y1W H;  4C3J G;  4KMU C;  1A2U A;  2QF7 A;  1HH2 P;  4A93 G;  4A3B H;  4BS9 A;  4DAY A;  4QGU A;  1W2B A;  2WAQ G;  3SVM A;  4RHR A;  4N9P A;  1EYG A;  1TWH B;  3C1E A;  4P75 A;  5C3E B;  4GKJ Q;  3I73 A;  2YYZ A;  1EYD A;  3FHW A;  3GTL H;  1PRT C;  5KGU A;  2UXC L;  2XIW A;  2QIL A;  5G3L F;  3K58 A;  4IUU A;  4KHZ A;  3ZJY C;  2K5D A;  4AYB G;  1C4Q A;  3CCM A;  1PHJ A;  2N8N A;  2E2J H;  3A5U A;  4QIW B;  4S3S A;  3F2C A;  2KBN A;  4A3E B;  3OWF A;  3K7U C;  1LUZ A;  1EL0 A;  5FLM G;  2B29 A;  1WYD A;  1WD0 A;  4GKJ L;  2KOL A;  3A7A B;  3EJI A;  2DJF C;  2RBM A;  1OXS C;  2SEB D;  3M4P A;  4KTA A;  2HIX A;  1GUO A;  4XT3 B;  3F1Z A;  3MEF A;  1MI2 A;  2OWO A;  2XGT A;  1I94 Q;  1P16 A;  5FO8 B;  4PZ6 A;  2K50 A;  1IBM L;  3NBI A;  5JPM C;  1PRT F;  1MSG A;  2WAC A;  2F0S A;  4GS3 A;  5IYC G;  1YNX A;  1K3R A;  2RA4 A;  1CZG A;  2LKV A;  1Y8O B;  5KYL A;  4QUF A;  1SE8 A;  1D6E C;  1HR0 W;  1HXY D;  3X3N A;  4JBW A;  4A3G H;  4K5W A;  3J80 E;  1YZ6 A;  5EGT A;  1EFW A;  3S1M H;  2A6H C;  3OTO L;  1W6J A;  1HUN A;  3ULL A;  1G6P A;  1F9Q A;  1EZ8 A;  3ER0 A;  3NSW A;  1SE3 A;  3CCJ A;  5BN4 A;  2AQ2 B;  3EQL C;  2KCN A;  5I9O A;  2WII B;  1FL0 A;  1K3B C;  4R1J A;  4B3T Q;  3BDC A;  1K0S A;  4C56 C;  5JJI A;  1U0L A;  5FO9 B;  2HUG A;  3W3A A;  5GAE C;  2VQE Q;  3E0J A;  3FPP A;  1SN8 A;  1QVC A;  5LMU L;  2VZA A;  2FIN B;  2RQX A;  3GV3 A;  1EFI D;  3QWN A;  1SRO A;  5GAG C;  2EYO A;  2JEB I;  5HGQ A;  2XTI A;  3HOU H;  1K9M C;  2NN6 G;  3IAY A;  3UI2 A;  4FF4 A;  1XNR L;  3GTP B;  1QUQ B;  1I6V C;  4ZAI A;  5C44 H;  5IYC H;  4A3K G;  2KJX A;  4HR7 B;  4DUY Q;  4DXG A;  3LNN A;  4XT1 B;  3K5N A;  2ZJP A;  3CD6 A;  4DV1 Q;  4LF7 L;  4RWS C;  3H91 A;  4O2D A;  3MXU A;  1A63 A;  2K52 A;  4RG1 A;  3TBI B;  4OX9 L;  3J7Y W;  3OMC A;  4I65 A;  2JEA I;  4PZ8 A;  1EYC A;  2UUC Q;  3Q24 A;  3A7L A;  1SNC A;  2I5H A;  3K80 C;  3BVZ A;  4AQY L;  1XMQ L;  4N8X 1;  1HCZ A;  3CCS A;  1QNU A;  1VQ8 A;  1IBK L;  3UDI A;  1BOS A;  4A3J G;  1NUC A;  1G2S A;  3D6W A;  4J1M A;  5EPJ A;  4RGN A;  1YHB A;  2F0U A;  2Z0S A;  2ATW A;  1SXT A;  3K0X A;  1CA6 A;  4JI6 Q;  2D0O A;  2FJ2 A;  2KCT A;  1SND A;  2NN6 H;  3PMF A;  3F2D A;  1BBW A;  2HHH L;  4V19 0;  2AQ3 B;  2F0T A;  1FVI A;  1OXU A;  4ALP A;  2F0K A;  3DWA A;  4JI7 Q;  5EJW A;  2Z4I A;  1SE2 A;  1H9S B;  1TWA B;  1QUQ A;  2IWH A;  3DMU A;  3R3O A;  2Z6K C;  3HOX H;  4JI1 Q;  3M4Y A;  3L2P A;  3C2P A;  4IUP A;  1BCP D;  4XQN A;  3D3R A;  4BXX H;  4KLK A;  4NDX A;  4C1N I;  1XWE A;  3MFY A;  2AQ1 B;  3GTO B;  3DEP A;  1L1O B;  4J8Q A;  2B2U C;  3S1M B;  1HPC A;  3LWE A;  3KYH C;  2R7Z B;  4IUR A;  1TS4 A;  5BN3 A;  1VMP A;  2L55 A;  4IJL A;  2SDF A;  5C0X J;  2XVS A;  4A3J B;  5E4W C;  3FVQ A;  1YJ9 A;  1B44 D;  3MZ5 A;  3KLW A;  1K8G A;  1FGU A;  3STB C;  2UUA L;  5LHY 1;  2K1B A;  3NWS A;  2M2L A;  2SOB A;  3EVQ A;  4B3M L;  1MJC A;  3NWT A;  4KKS A;  1ZXT A;  4A3K H;  1CHP D;  5J3B A;  4R4O A;  3TRZ A;  2PQA A;  1WI5 A;  2B2T A;  3U50 C;  3A8I E;  4DV7 L;  1Q8I A;  2QDL A;  4A3F B;  3WWV A;  2K05 A;  4MTN A;  4RAU C;  5I2Y A;  3MAQ A;  4C3I H;  1J5E Q;  3SK5 A;  5J22 A;  1VQI A;  2ZJQ A;  1XX8 A;  3KBX A;  3NBH B;  2QDB A;  3J7A F;  4R8N A;  2RF4 A;  2E5L Q;  4BBS B;  1QIL A;  1NR2 A;  4HIM A;  1QZG A;  1D5M C;  4A3D G;  3TRE A;  2F3V A;  1EEF D;  5KNC A;  1L1O C;  1O80 A;  1BR9 A;  1T5E A;  2NUC A;  3E0E A;  1ZYR C;  1TWC B;  3CAM A;  4ZK9 B;  5IGG A;  4YWL A;  2M9V A;  1I4P A;  3FP9 A;  4LF5 Q;  3PV0 A;  1BUV T;  2DUD A;  2PW5 A;  3A55 A;  2AHO B;  4FP5 D;  4C3J B;  4IOA A;  4KJN A;  2RCN A;  2DJG C;  4A3I G;  1TWG B;  3NQI A;  1BVS A;  3H3V I;  3MTS A;  2HDM A;  1Y69 U;  4B08 A;  3BVM A;  3QO2 A;  4DR5 L;  1VQE A;  5T1G A;  4Z9C B;  2PNH A;  3UE1 A;  4UHV A;  1Y1V B;  1BDO A;  2E76 C;  3K8A A;  2F4V L;  1C9O A;  3I70 A;  2A69 C;  4IUN A;  1SNO A;  2EYH A;  1XJV A;  4A3D B;  3H0G B;  4LFA Q;  4EQN A;  4FXG C;  4QY7 A;  1AH9 A;  2BOS A;  4LF8 L;  1KHI A;  1LTL A;  4BBR B;  4X65 Q;  1TVX A;  2CWP A;  2YU9 H;  2PZU A;  2L12 A;  1AFP A;  3M9B A;  3GQB A;  4IPH A;  3I4M B;  3KLS A;  4XYQ A;  4A3D H;  2FMM A;  4KHV A;  1O78 A;  1UEB A;  1WCM H;  1S5B D;  2F4I A;  5IIF A;  3T16 A;  5JEA G;  2XSC A;  4GLX A;  2F0V A;  2V4D A;  1A8V A;  1I4G A;  3WOF A;  5IY0 A;  3S1Q H;  3IFD A;  4XTC S;  4MIU A;  1EZ6 A;  4JI3 L;  1EWC A;  3VYU A;  4GN3 B;  4UDU C;  2LMC B;  1HJP A;  3CQZ B;  3GTK H;  3T13 A;  3CRL C;  3SDZ A;  1SDF A;  3OOC A;  2MGS A;  4PMC A;  3EIV A;  1UE7 A;  4L5T A;  5I6W A;  4CJ2 C;  1TY0 A;  2K75 A;  3BVG A;  4ODG A;  3W1B A;  5CR3 A;  1YNJ D;  2E2I B;  1X3G A;  1IW7 C;  3TEH B;  1E22 A;  1E24 A;  4KD3 A;  4TSS A;  2XWB B;  3DXJ C;  3D31 A;  1NR4 A;  5FJ8 H;  5FLX L;  4X64 L;  3HOZ H;  3PQI A;  1LTA D;  2RSO A;  1WCM G;  3I8Z A;  1WTV A;  2N3S A;  1WOC A;  3PUY A;  4JC0 A;  3T4A C;  1CTM A;  2F1M A;  3K6O A;  2PPB C;  3I2Z A;  4APV A;  4JBM A;  3CP0 A;  2CW0 C;  1I4Q A;  1LT6 D;  1EYA A;  2X69 A;  1B9M A;  4B3S Q;  1KQS A;  1UAP A;  1K83 B;  4K2K A;  1BO0 A;  3HOZ B;  1CQV A;  4A3C G;  1HZB A;  4XQJ A;  2K5W A;  1KRS A;  4IJH A;  2J0T D;  4F8M A;  4A3L H;  3V96 A;  1FGB D;  2JA5 B;  1JOK A;  5J39 A;  1GOZ A;  1V1P A;  1VDZ A;  3K7A B;  3T1Y Q;  2BE5 C;  4DF7 A;  2K7V A;  1Z47 A;  4NP5 A;  2E8G A;  3K7A H;  4GLA C;  1F9S A;  5HY6 A;  1Q1B A;  1K28 A;  4RGO S;  2EXD A;  2ZJR A;  1XNQ Q;  1PZJ D;  3URY A;  3HOY G;  1FJG L;  1BXT A;  1M90 C;  5IT9 L;  1YJN A;  5IYD H;  2WB1 E;  2E2H H;  2MP1 A;  2PMZ B;  1HFN A;  1N33 Q;  1LTS D;  4WFN 3;  4MHE A;  1O7I A;  1CSQ A;  2O2L D;  2Y0S B;  4UP9 A;  2DN8 A;  5C3W A;  1YIT A;  1K8A C;  1V9P A;  1VQB A;  2PW7 A;  2WV6 D;  1Z6H A;  1HNZ Q;  5K36 G;  1LTG D;  3S14 B;  4LF6 L;  4KK7 A;  4K8I A;  1EY8 A;  3S1N H;  2JA9 A;  4YHH Q;  2D9U A;  4X62 L;  4X66 Q;  1G8Z D;  1KDB A;  3GO5 A;  1EQQ A;  4A3G G;  4IPC A;  2FXQ A;  3JAM i;  1I3Q B;  5IYB H;  1UE1 A;  3K81 C;  1Q90 A;  2MHV A;  5G3L D;  1N34 L;  2NBF A;  5CV9 A;  4JI7 L;  1DOL A;  2I0Q A;  1N32 Q;  1X65 A;  5H1S E;  5D65 A;  3KFU A;  3RN2 A;  4C2M H;  2N49 A;  2JA6 B;  1A3T A;  2BH8 A;  3T53 B;  2B63 G;  3V2T A;  4OO1 G;  1RCV D;  1EWH A;  5ELC A;  2DNC A;  1RDP D;  4JOI C;  5BN5 A;  4EQO A;  1BBU A;  2KCM A;  1WVL A;  3CC4 A;  1U4L A;  4R4T A;  2XRQ D;  5C5M A;  4A76 A;  3T1H Q;  3M3Y H;  2HQL A;  4DNR B;  2NVX H;  1B53 A;  3KDF A;  4ZRZ A;  2KQ3 A;  2PZW A;  4ZYS A;  4PV1 C;  3MEH A;  1CUK A;  2RDG A;  3HOW H;  1MHW C;  4IUV A;  2LXK A;  4RKB A;  1HFG A;  2I07 B;  3PIP 3;  4U67 3;  1SFO B;  1WTR A;  5I6Y A;  4RFB A;  4OX9 Q;  4GOP A;  2MPM A;  4BWG B;  3QOL A;  1Q7Y C;  1V1Q A;  3Q8D A;  2A6E C;  2DY7 A;  4OON A;  3HRZ C;  2KEN A;  1W6K A;  5DEH A;  3L3O C;  1N34 Q;  2ICI A;  4U68 A;  2WIN B;  4LWC A;  1BBX C;  2RCF A;  2O5J C;  3PO3 G;  5M3M B;  2R7Z H;  3J7A V;  5ELD A;  5M9O A;  1ESR A;  3KJP A;  4HIK A;  5JAV A;  4A3G B;  4CDE C;  2CKZ B;  2GVA A;  1Q81 C;  3HP3 A;  2AKW B;  3VA7 A;  2JSO A;  1MJE A;  1JWM D;  2NVY H;  4GZY C;  3HOW G;  2HDL A;  2CH4 A;  2BA1 A;  4EVO A;  3BYY B;  1BNZ A;  1LTT D;  3NEM A;  2CWA A;  5C4J H;  1R4P B;  3FEW X;  2UXB Q;  4WJ3 M;  3JAM E;  1JCK B;  2DY8 A;  1EU3 A;  2KVM A;  1WTW A;  2TMP A;  1M1K C;  4LMQ D;  3CCE A;  3IRB A;  2K5H A;  1U5K A;  2BDO A;  3SHL A;  3CPW A;  4AQY Q;  1XMQ Q;  1QB5 D;  3KK7 A;  1GKH A;  2K28 A;  1ENA A;  3MXN B;  4L5Q A;  4XXE A;  1JT8 A;  1HNX L;  3NEL A;  2J4X A;  3BZC A;  1STB A;  3SK8 A;  2CVR A;  3KF8 B;  1LAC A;  1SAP A;  3VA5 A;  3GTP H;  3S16 H;  4DV1 L;  1PFM A;  4LF7 Q;  1QVF A;  4R4Q A;  4B9X A;  3PUW A;  2EYJ A;  3KLR A;  3G71 A;  2F0Q A;  1YNN D;  2A74 C;  4QUC A;  2B2T C;  1STH A;  1M8A A;  2IHE A;  3QIA A;  2WB1 B;  4QB4 A;  3VR2 A;  2LS0 1;  1G91 A;  2UUB Q;  4Q0F A;  1S5C D;  1KAW A;  4O42 A;  1DGS A;  3J80 L;  4DV4 Q;  2BA0 A;  5KND A;  4B3M Q;  2KHI A;  1KIX A;  2ID0 A;  2QW7 A;  1VQH A;  2R92 B;  1VMC A;  3CPF A;  1B3Q A;  1EQR A;  1JJC B;  4C3H G;  1LO5 D;  3J81 c;  2KEC A;  3OW7 A;  1HA5 A;  4DK3 C;  3HOW B;  1PRT B;  3A54 A;  1Q12 A;  1ASY A;  3GTO H;  2ES2 A;  2NWG A;  5CV5 A;  2CHB D;  4A3I B;  1FJG Q;  1SNQ A;  2R7Z G;  1PTO C;  4KV6 A;  1WD1 A;  5I2X A;  5M5X B;  2R92 H;  1WJJ A;  3GTM H;  3NP8 A;  1KAA A;  4JCV E;  5FKA C;  1E2Z A;  4JI2 L;  1X3F A;  4GN4 B;  4K8J A;  4AYB B;  2BH2 A;  2VS1 A;  3AQQ A;  4ULL A;  3DEO A;  5C0X I;  1KAB A;  2YTX A;  2QA4 A;  5E3F A;  2R93 B;  5M3M H;  3QJY A;  1TWA H;  1IHZ A;  4DR1 L;  2V1C C;  3GTM B;  4ZKC B;  1LT4 D;  1FYC A;  1Y1W G;  1Q82 C;  4MN3 A;  5C0X H;  3TP6 A;  3HKS A;  2UXD L;  3I3C A;  3DM3 A;  4XQQ A;  1V8Q A;  1H95 A;  5CGK A;  5FLM H;  2R93 H;  1S5E D;  5IOC A;  1WTP A;  3HOV B;  1CKN B;  3TP8 A;  3M7N A;  3Q23 A;  4FDB A;  5C4X H;  1R4Q B;  3CCU A;  3JAM c;  2VL6 A;  3D8G A;  1LTB D;  3HOV G;  3KF6 B;  1U4M A;  3U4Z A;  1Q8K A;  4H7B A;  5AFW A;  4BBS G;  1PTO F;  4ID6 A;  1ONL A;  4YCV A;  3I56 A;  4H0L C;  1TKW B;  2A19 A;  1J6Q A;  4G7H C;  2QGQ A;  4JV5 L;  4XIG S;  4C3I G;  3R2T A;  2R6G A;  3RMH A;  3T56 B;  2A68 C;  2RHS B;  4RH6 A;  2GA4 B;  2PQA B;  2EDG A;  1VQG A;  1K8O A;  3PCO B;  4UAI A;  4GNX C;  2O4X A;  4G4K A;  4DU9 A;  1HNW L;  1EIH A;  1DCZ A;  1DM0 B;  2EY1 A;  1AE3 A;  1GUN A;  2JYO A;  4NB3 A;  2ZXP A;  1L0X B;  3G7L A;  4YHH L;  4DV4 L;  5C3X A;  1E2W A;  2L5T A;  1QVG A;  3TDQ A;  4IUT A;  3OMG A;  1XTD A;  1CT1 D;  3R2I A;  2A6E D;  3BDO A;  4NXN Q;  2BDN A;  1VQD A;  1QOH A;  4DUZ L;  1S40 A;  1SR3 A;  2R93 G;  3KOJ A;  3TQY A;  2AMC B;  1SNP A;  2LSS A;  1YHQ A;  1SRU A;  1PH9 A;  2UXD Q;  1N33 L;  3MA2 B;  1JOQ A;  4HED A;  4HJ7 A;  3VR5 A;  1VQC A;  3KJO A;  1A3U A;  3C46 A;  1Y14 B;  3OHX C;  2EY2 A;  2N55 A;  1ICF B;  3KLS X;  5A35 A;  1XNQ L;  2HIV A;  2DGY A;  4F87 A;  4DR6 Q;  4R9W A;  2L15 A;  1KRT A;  4L63 B;  3E9I A;  2H5X A;  1SYG A;  1ROD A;  3P7J A;  5M5X H;  1L0Y B;  3T51 B;  5IYB G;  3IL8 A;  1NJI C;  2IX0 A;  3SGI A;  4YY3 L;  4DV2 L;  3FKI B;  4LAA A;  1XMO L;  4EX5 A;  2UU9 L;  1TU2 B;  5KYI A;  1ILQ A;  3MFG A;  1DON A;  4LFC L;  1EIF A;  4LW1 A;  1HZC A;  4LUV A;  4XYO A;  1KD1 C;  5FLX c;  4HJ8 A;  1SBB B;  4JBK A;  1SJE D;  1O7Y A;  4A3J H;  4NXM Q;  2A68 D;  2H4O A;  3OW2 A;  1SEB D;  3S15 B;  1PYW D;  4PZ7 A;  2L0C A;  1SJH D;  2KUM A;  2YU9 B;  1N36 L;  4KKU A;  2UUB L;  4LF6 Q;  4ZCK A;  5IGC A;  1I3Q H;  3I4L A;  1BQQ T;  3NEN A;  3VYR A;  1EWI A;  2K33 A;  4DR7 Q;  3TZU A;  1VS0 A;  3TP5 A;  1U4R A;  1SYC A;  1VQP A;  1GHK A;  2RSN A;  5T1I A;  3F2U A;  3GTG H;  4QF4 A;  1JIC A;  3K5L A;  4UP8 A;  1JE4 A;  1J5E L;  3I4N G;  1RL2 A;  5J1Z A;  3N6R A;  2K5Q A;  1UUP A;  2Z6K A;  3MWY W;  3GTQ B;  3DM1 A;  3NQT A;  2NVX B;  4DR2 Q;  2WFW A;  1PV4 A;  3K5O A;  1PRT D;  3S17 B;  2JJQ A;  4TKO B;  5JEA H;  4K0K L;  2IX1 A;  2VY3 A;  1STA A;  1XXG A;  1TWC H;  1IYU A;  3HOY B;  1JR0 D;  4BY1 B;  3R8B A;  1FNU A;  3ONA B;  1EY0 A;  4ZQ3 A;  1RHP A;  2KEE A;  4FXK C;  1AZQ A;  3RLO A;  2MQH A;  2F3I A;  1EY6 A;  1PTO H;  5JJZ A;  2EJM A;  2EYF A;  1FNW A;  1HQR D;  1I4X A;  2B2W C;  4YIJ A;  4KN4 C;  5EKK A;  2EVB A;  5ELE A;  1G2T A;  4RA8 A;  1HTL D;  3HOX G;  1FD7 D;  4LJZ C;  2K04 A;  3C1F A;  2F4V Q;  1EIY B;  1F2L A;  4DR3 L;  3PO3 H;  3U9O A;  4WJW A;  3W5O A;  1VQL A;  4RGM A;  1Z7T A;  2E2D C;  1HNW Q;  3ULJ A;  1E1O A;  3J7A 5;  1JB7 A;  3NBH A;  4DKA C;  4DGZ A;  1TR5 A;  4ME3 A;  1CI3 M;  3ICE A;  4CKE A;  4POF A;  1X32 A;  4FVM A;  1WTH A;  3L0O A;  1EY7 A;  3U9S A;  1MGS A;  3J81 L;  3CCR A;  3LGJ A;  4HIO A;  1X56 A;  3CC2 A;  1MBY A;  4JI6 L;  4JI3 Q;  4G7O C;  4NKL A;  3PUZ A;  2EYP A;  2IJ0 A;  2B63 B;  5IGF A;  3BZK A;  1IXR A;  4J6H A;  5C44 B;  2LY7 A;  3S9W A;  3HEJ A;  1PH7 A;  5IT9 E;  1D1K A;  1YI2 A;  1X3E A;  4JK1 C;  3I91 A;  2O5I C;  1UE5 A;  1BF4 A;  2SNM A;  4KHP L;  4K5V A;  5KEE A;  5ISR A;  5EAY A;  1OXV A;  1PDQ A;  1EQV A;  3STB D;  3D4D A;  4FNF A;  4DR1 Q;  3HGB A;  3T1Y L;  1TY2 A;  1X54 A;  1I50 H;  2G5D A;  5D14 A;  4LFA L;  1UWV A;  2R7F A;  1E7Z A;  3AYH B;  4DUY L;  3GTJ B;  1IBM Q;  5GAH C;  3GP7 A;  3RZO B;  1YBY A;  1WFQ A;  1KLU D;  2D2C C;  2OTJ A;  1I4H A;  4IQZ A;  3TSS A;  1VQK A;  1GJX A;  1YVC A;  2MJ8 A; 
#chains in the Genus database with same CATH homology
 3CC4 A;  4R4T A;  3A74 A;  4B3S L;  1IL2 A;  1OXS C;  4A76 A;  3VDY A;  3M4P A;  3T1H Q;  3M3Y H;  2HQL A;  3GTQ H;  2HIX A;  1UE6 A;  2NVX H;  2HT1 A;  3KDF A;  3UDF A;  2A8V A;  3F1Z A;  3MEF A;  3CME A;  1VQ9 A;  5ELO A;  2ALY B;  2XGT A;  2OWO A;  3GTJ H;  4QL5 A;  4KI0 A;  1CUK A;  1I94 Q;  1P16 A;  4L5R C;  1D7Q A;  3HOW H;  1I5F A;  2QEX A;  2LXK A;  4PZ6 A;  2K50 A;  1IBM L;  5C4X G;  4GS3 A;  5IYC G;  1B7Y B;  1L2F A;  1K3R A;  1YNX A;  3DLL A;  1N9W A;  4GOP A;  4OX9 Q;  1Q7Y C;  3KDF B;  2C35 B;  2CCZ A;  3PSI A;  1V1Q A;  1SE8 A;  3Q8D A;  3UE0 A;  1HR0 W;  4B3T L;  2UU9 Q;  4JBW A;  4R4C A;  4OON A;  1L0W A;  4A3G H;  2KEN A;  1X6O A;  1VQ6 A;  3T1H L;  4DV5 L;  4DV6 L;  1N34 Q;  3I55 A;  3PO2 G;  1YZ6 A;  4UPA A;  2K5V A;  4LWC A;  3H0G G;  5IWA L;  4JG2 A;  1EFW A;  1SFO H;  4QQB X;  3S1M H;  4POG A;  4PMW A;  3OTO L;  5C44 G;  4GKK L;  1OTC A;  3PO3 G;  3ULL A;  1G6P A;  2VUM H;  2R7Z H;  1T9H A;  3ER0 A;  1CKM A;  3CCJ A;  3KJP A;  4JI0 L;  4HIK A;  2ZTC A;  3CCL A;  2CKZ B;  4AIM A;  2GVA A;  1YHA A;  1FL0 A;  1VCI A;  4R1J A;  2AKW B;  1LM0 A;  1Q81 C;  4B3T Q;  1YIJ A;  1MJE A;  4YCW A;  2NVY H;  4Y7N H;  3HOW G;  5IE8 A;  5JJI A;  1HR0 Q;  1CKO A;  1U0L A;  3J80 i;  2BA1 A;  4P73 A;  2WP8 J;  5GAE C;  2VQE Q;  3I4O A;  3NEM A;  2CWA A;  5C4J H;  1VQA A;  1JMC A;  2EIF A;  3HOU G;  4WJ3 M;  2UXB Q;  1SN8 A;  4IFD G;  1QVC A;  2KHJ A;  2VZA A;  5LMU L;  3RZD H;  5GQO A;  2D62 A;  4GOP C;  1VQN A;  3RLF A;  4LF5 L;  4Y52 H;  4IPG A;  1SRO A;  5GAG C;  2JEB I;  5HGQ A;  2XTI A;  3CXC A;  2ZM6 L;  3HOU H;  4PG3 A;  4JI5 Q;  2VW9 A;  1M1K C;  2NZH A;  1K9M C;  3CCE A;  3M4Q A;  3IRB A;  2NN6 G;  2K5H A;  1U5K A;  1XNR L;  1PYB A;  3CPW A;  1QUQ B;  4B3R L;  4AQY Q;  1XMQ Q;  5C44 H;  2MFI A;  5IYC H;  1AE2 A;  1VQF A;  3MXN B;  1GKH A;  4L5Q A;  1JT8 A;  1JJG A;  4A3K G;  1HNX L;  4NXM L;  1L1O A;  1TWH H;  2VQE L;  4DV0 Q;  3PO2 H;  4DUY Q;  3NEL A;  1MKH A;  4LFB Q;  2OQK A;  3BZC A;  4BBS H;  2ZJP A;  1K73 C;  3CD6 A;  4DV1 Q;  4LF7 L;  2Q2H A;  4O2D A;  1NTG A;  1LYL A;  2GVB A;  4A3E G;  1A63 A;  2K52 A;  3KF8 B;  4RG1 A;  3GTP H;  4YWK A;  2CFM A;  4DV1 L;  4LF7 Q;  4OX9 L;  2I5L X;  2VQF Q;  1QVF A;  3S16 H;  2JEA I;  4PZ8 A;  1SLJ A;  4R4Q A;  2UUC Q;  3PUW A;  3G71 A;  2I5H A;  3W1G A;  4JV5 Q;  3K80 C;  3HOZ G;  2UXC Q;  4DR7 L;  2NZO A;  3HKZ G;  5M3F G;  3E9H A;  4DR3 Q;  4P74 A;  2JA6 H;  5C0X G;  4AQY L;  1XMQ L;  1PH3 A;  3HKZ E;  2IHE A;  4JI1 L;  3M85 A;  3CCS A;  1IBK L;  1VQ8 A;  3UDI A;  4X66 L;  4X62 Q;  5LMN W;  4A3J G;  4TVA B;  4DAY B;  4C3J H;  4JI5 L;  2UUB Q;  5GAD C;  2OTL A;  4DV4 Q;  1KAW A;  1DGS A;  1YHB A;  3U58 A;  1GM5 A;  2Z0S A;  2BA0 A;  4DR4 L;  4B3M Q;  2KHI A;  1KIX A;  1IYJ B;  1E3P A;  3K0X A;  2ATW A;  2ID0 A;  4AH6 A;  2D0O A;  4JI6 Q;  4LF4 L;  1TXY A;  4A3I H;  1VQH A;  4R4I A;  2HHH Q;  2KCT A;  2AWO A;  3PIP A;  2ZTD A;  2NVQ H;  5BR8 Q;  2PI2 E;  1VQ4 A;  3CPF A;  1JJC B;  1EQR A;  3RR5 A;  1EOV A;  3F2D A;  3J81 c;  1BBW A;  4DK3 C;  1PA6 A;  2HHH L;  4H02 A;  1PYS B;  4JOI A;  1VQ5 A;  1FVI A;  1OXU A;  4ALP A;  1Q12 A;  4NXN L;  4O0A A;  3J81 i;  1ASY A;  3GTO H;  1GO3 E;  4BY7 G;  3GD7 A;  4JI7 Q;  2ES2 A;  4A3M H;  1R9T H;  2JE6 I;  4KHP Q;  1YJW A;  1FJG Q;  2R7Z G;  1QUQ A;  2K5N A;  2R92 H;  2Z6K C;  1NY4 A;  3HOX H;  4UY8 C;  1WJJ A;  3GTM H;  4JI1 Q;  3L2P A;  3S2D H;  4JCV E;  3H0G H;  3BJU A;  2Y0S E;  4LUO A;  4JI2 L;  4BXX H;  1X3F A;  4GN4 B;  4KLK A;  2VUM G;  3D0F A;  2BH2 A;  2VS1 A;  3AQQ A;  4BBR H;  1L1O B;  2MO1 A;  5C0X I;  1JE5 A;  3KYH C;  2YTX A;  2QA4 A;  1Z9F A;  5M3M H;  1TWA H;  2PMZ E;  4DR1 L;  2LXJ A;  2V1C C;  1RIP A;  4NPS A;  4A75 A;  2JA5 G;  3I4M H;  4IJL A;  1Y1W G;  5C0X J;  2NVT H;  2UXB L;  2Y0S G;  1Q82 C;  1CSP A;  4DR5 Q;  4A93 H;  3KF6 A;  3H3V H;  1YJ9 A;  3HKS A;  3KLW A;  4IPD A;  5M3M G;  2RHQ B;  1K8G A;  2UXD L;  1C0A A;  5IP7 G;  3DM3 A;  4JYA Q;  1FGU A;  3PGZ A;  3STB C;  1PH2 A;  4A3F H;  1H95 A;  4OXP A;  5FLM H;  2UUA L;  3CCQ A;  2R93 H;  3G48 A;  3ULP A;  1CKN B;  1V43 A;  3A5Z B;  2MNA A;  4B3M L;  1XNR Q;  3M7N A;  4A3B G;  4GN5 A;  2MO0 A;  4FDB A;  5C4X H;  1MJC A;  3CCU A;  1KXL A;  3JAM c;  2VL6 A;  2ZM6 Q;  4A3K H;  5J3B A;  1KC8 C;  3KF6 B;  4R4O A;  3U4Z A;  4OWW B;  2R92 G;  3HOV G;  1Q8K A;  4QJF A;  3TRZ A;  2PQA A;  1WI5 A;  3U50 C;  1IBK Q;  1HNZ L;  4BBS G;  3AFP A;  1NMG A;  4DV7 L;  4YCV A;  3I56 A;  4GLV B;  4DK6 C;  3WWV A;  2A19 A;  1J6Q A;  2QGQ A;  4MTN A;  4JV5 L;  4A3L G;  4XIG S;  4C3I H;  1J5E Q;  2ZTE A;  1HR0 L;  1VQI A;  2ZJQ A;  2R6G A;  4BY1 G;  3U4V A;  3NBH B;  3L7Z C;  4LFC Q;  4JI8 L;  2RHS B;  4L5S A;  2IY5 B;  2RF4 A;  3CF5 A;  2PQA B;  1VQJ A;  2E5L Q;  1A0I A;  1OXT A;  1VQG A;  3PCO B;  3GDE A;  2K14 A;  4HJ9 A;  4GNX C;  1PH4 A;  4YY3 Q;  1OXX K;  4DV2 Q;  3PUX A;  4HIM A;  4HJA A;  3FKI G;  4J15 A;  4LFB L;  4DV3 Q;  2Q2U A;  1HNW L;  1QZG A;  1VQM A;  4A3D G;  4DV0 L;  3TRE A;  1AE3 A;  5M3F H;  5IT9 c;  3J80 c;  4GKK Q;  3RLN A;  1L1O C;  4NB3 A;  5IWA Q;  3RNU A;  4AYB E;  5DLQ E;  3E0E A;  1K83 H;  3H15 A;  4YHH L;  4DV4 L;  4UP7 A;  1QVG A;  3CAM A;  1X55 A;  1XTD A;  4YWL A;  1Q86 C;  2GN5 A;  2OQ0 A;  3A0J A;  5IP9 H;  3FP9 A;  4LF5 Q;  4LUZ A;  3PV0 A;  2DUD A;  4DR2 L;  4NXN Q;  2AHO B;  5JEA J;  2JA5 H;  1VQD A;  2ASB A;  4IOA A;  4DNI A;  3J7Z C;  3G4S A;  4DUZ L;  1YEZ A;  2OCE A;  2RCN A;  3HFZ B;  4IOC A;  4A3I G;  2JQO A;  1SR3 A;  1S40 A;  3B6Y A;  1HZ9 A;  3KOJ A;  3TQY A;  1Y1V H;  1BVS A;  2AMC B;  1HZA A;  2LSS A;  5JJK A;  3G6E A;  2YV5 A;  3H3V I;  1YHQ A;  1G51 A;  1Q46 A;  1SRU A;  4DV3 L;  1PH9 A;  2UXD Q;  1N33 L;  1CKN A;  5C3E G;  4DR5 L;  3M4O H;  4P71 A;  2VNU D;  2K4K A;  1VQ7 A;  4X65 L;  4HJ7 A;  1VQC A;  3KJO A;  4LF8 Q;  1N32 L;  5AJ3 L;  1VQE A;  1Y14 B;  5M5Y H;  2PNH A;  3FKI H;  3UE1 A;  4A3M G;  1XNQ L;  2HIV A;  1Q1E A;  2DGY A;  3TS2 A;  1PH6 A;  4DR6 Q;  2AWN A;  2L15 A;  3ERS X;  1KRT A;  3TS0 A;  4BY7 H;  3K8A A;  1D8L A;  4LF9 Q;  2F4V L;  3E9I A;  4BXX G;  1C9O A;  4B3R Q;  2H5X A;  5M5X H;  2CQO A;  4DV6 Q;  1XJV A;  5IYB G;  1NJI C;  2IX0 A;  1EUJ A;  3CC7 A;  5ELN A;  4LFA Q;  3SGI A;  4DPG A;  4QY7 A;  4YY3 L;  4DV2 L;  1XMO L;  1N36 Q;  1AH9 A;  4EX5 A;  2UU9 L;  4GNX B;  4TQU S;  1KHI A;  5IP7 H;  5AJ3 Q;  1GVP A;  1LTL A;  4LF8 L;  4MNO A;  4X65 Q;  2CWP A;  4LFC L;  2YU9 H;  1EIF A;  4LW1 A;  4A4I A;  3M9B A;  4IPH A;  2PI2 A;  1HZC A;  4LUV A;  1TWF H;  1KD1 C;  5FLX c;  4HJ8 A;  1VQO A;  1XPR A;  4JBK A;  4A3D H;  1PH8 A;  4A3J H;  1HNX Q;  4NXM Q;  2B63 H;  3S14 H;  1UEB A;  1WCM H;  3OW2 A;  2Q2T A;  5JEA G;  4MZ9 A;  1ASZ A;  2JA6 G;  2YTV A;  4GLX A;  2F52 A;  3CW2 C;  4PZ7 A;  1N36 L;  3S2H H;  1A8V A;  2R7D A;  3I7F A;  4OWT B;  2UUB L;  4JI0 Q;  3HOV H;  5IY0 A;  1JJ2 A;  4LF6 Q;  3S1Q H;  3EN2 A;  1I3Q H;  4XTC S;  3NEN A;  4JI3 L;  2WB1 G;  2YTY A;  4JI4 Q;  4LNQ A;  4GN3 B;  1IBL L;  1EWI A;  1HJP A;  4LF9 L;  1XPO A;  3GTK H;  4A3C H;  3OYY A;  3UDX A;  3F8T A;  3CMA A;  4DR7 Q;  4OO1 I;  1NMF A;  4IO9 A;  3BU2 A;  1IZ6 A;  1B8A A;  1VS0 A;  3EBE A;  4BBR G;  1X9N A;  2UUC L;  3EIV A;  1UE7 A;  4L5T A;  1I6H H;  2VQF L;  5IYD G;  1VQP A;  2K75 A;  3W1B A;  2B3G A;  5LMN L;  3I4M G;  4JI8 Q;  1X3G A;  1S3O A;  3GTG H;  3S17 H;  3TEH B;  3RZO H;  1E22 A;  1E24 A;  2WAQ E;  1BKB A;  3D31 A;  4UP8 A;  5FJ8 G;  5FJ8 H;  1C7Y A;  1J5E L;  3I4N G;  3I4N H;  4X64 L;  3HOZ H;  1RL2 A;  4BA2 I;  2JK8 A;  1PH5 A;  3AEV A;  3HOY H;  1WCM G;  4JI2 Q;  2N3S A;  4DUZ Q;  3RN5 A;  1P8L A;  1WOC A;  2Z6K A;  3PF5 A;  1I94 L;  1IBL Q;  4BA1 I;  4DR2 Q;  3PUY A;  4JC0 A;  2WFW A;  1PV4 A;  4K0K Q;  2E2I H;  3I2Z A;  4APV A;  4IFD I;  4JBM A;  4A3F G;  1NE3 A;  3CP0 A;  2JJQ A;  2R93 G;  4B3S Q;  5GRO A;  1KQS A;  4K0K L;  2IX1 A;  2VY3 A;  4A3C G;  1TWC H;  1HZB A;  4IFD J;  1PFS A;  5LMU Q;  1XPU A;  1KRS A;  4IJH A;  1S72 A;  3PIO A;  4JYA L;  4A3L H;  3RLO A;  4C3H H;  4HJ5 A;  2MQH A;  2F3I A;  3T1Y Q;  1TWG H;  2I5M X;  4DAM A;  5M5W H;  1B70 B;  3S24 A;  4X6A H;  3CCV A;  1Z47 A;  4HID A;  1A62 A;  4BY1 H;  1XMO Q;  2IHF A;  2E8G A;  3HOX G;  2A1A A;  2F4V Q;  1MIU A;  1EIY B;  4JBJ A;  3OTO Q;  3K7A H;  4GLA C;  1K0R A;  5HY6 A;  4DR3 L;  3PO3 H;  1GD7 A;  1Q1B A;  1QZH A;  2JA7 H;  2EXD A;  3W5O A;  1VQL A;  2EQS A;  1W3S A;  3F2B A;  2ZJR A;  4DV5 Q;  3UDG A;  1HNW Q;  1XNQ Q;  3ULJ A;  3HOY G;  1E1O A;  1FJG L;  3J7A 5;  1JB7 A;  1M90 C;  1E1T A;  4DKA C;  2D0P A;  1YJN A;  2E5L L;  5IYD H;  2WB1 E;  2E2H H;  4ME3 A;  2IT1 A;  1N8R C;  4QIW E;  3ICE A;  2NN6 I;  4POF A;  1PVO A;  1N33 Q;  2JA8 H;  2JA8 G;  1SMX A;  1NBW A;  1G29 1;  3L0O A;  4EQ5 A;  1PH1 A;  1O7I A;  5BR8 L;  1CSQ A;  5C3E H;  4GOP B;  1YIT A;  3S1R H;  4UP9 A;  1Y1W H;  4YCU A;  1K8A C;  3CCR A;  1HH2 P;  3J81 j;  1V9P A;  1VQB A;  3LGJ A;  4DV7 Q;  4HIO A;  4A93 G;  1X56 A;  3CC2 A;  1Y1V G;  5IP9 G;  4JI6 L;  4JI3 Q;  4JI4 L;  4A3B H;  2UUA Q;  1HNZ Q;  3PUZ A;  5K36 G;  4DR4 Q;  4QGU A;  1W2B A;  3BZK A;  2N78 A;  2WAQ G;  4LF6 L;  1IXR A;  3PUV A;  3S1N H;  2JA9 A;  4YHH Q;  4X62 L;  5E7N A;  4X66 Q;  1PH7 A;  3S15 H;  1EYG A;  4P72 A;  4P75 A;  1YI2 A;  1X3E A;  4GKJ Q;  2YYZ A;  4A3G G;  2Q2I A;  3GO5 A;  1EQQ A;  4IPC A;  2FXQ A;  2JA7 G;  3FHW A;  3JAM i;  3GTL H;  5IYB H;  4DR6 L;  4A3E H;  2UXC L;  1UE1 A;  1UE5 A;  3K81 C;  4OWX B;  1N34 L;  4X64 Q;  3CQZ H;  3PF4 A;  4KHP L;  3AFQ A;  4JI7 L;  5EAY A;  4YWM A;  1OXV A;  2I0Q A;  4KHZ A;  1N32 Q;  1X65 A;  3STB D;  3ZJY C;  5H1S E;  4GNX A;  5LMN Q;  4AYB G;  4DR1 Q;  3KFU A;  3CCM A;  1PHJ A;  2N8N A;  2E2J H;  3T1Y L;  4RMF A;  3RN2 A;  3A5U A;  1X54 A;  1I50 H;  4LFA L;  1UWV A;  2R7F A;  1E7Z A;  2N49 A;  4C2M H;  3F2C A;  2KBN A;  3AYH B;  4DUY L;  3K7U C;  2BH8 A;  1IBM Q;  2B63 G;  1LUZ A;  5GAH C;  4WJ4 A;  5JJL A;  3JC6 6;  1KL9 A;  4OO1 G;  5FLM G;  1YBY A;  2B29 A;  1WFQ A;  1WYD A;  4GKJ L;  4LF4 Q;  2OTJ A;  1VQK A;  4JOI C;  1YVC A;  1BBU A;  2KCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...