4LFBQ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfbQ00
1XJVA 3RLOA 2K5HA 2AKWB 2FXQA 4LF6L 2JA8G 4R4OA 5FLMG 4L5TA 3LGJA 2KBNA 5E7NA 5GAHC 2JA6H 1W2BA 3HOUH 1PVOA 4GOPB 3CAMA 2VW9A 2E2IH 4DV6Q 1Y1VH 2AWOA 4R4TA 2JE6I 3BU2A 1I6HH 4O2DA 2IHFA 3H15A 1Q8KA 4C3IH 2R7FA 4AIMA 1G51A 2ALYB 3PO2G 3J81i 3CCJA 4B3SQ 2IHEA 2IX0A 4P72A 2OQ0A 2R6GA 2JK8A 2JJQA 3HKZG 4DK3C 2WAQE 1Y1WG 1J6QA 4DV2L 4BXXG 3S2HH 3CCRA 1D8LA 3TRZA 4JI1Q 4A3BH 2K14A 1TWFH 5IT9c 5M5WH 4AYBG 5C44H 1VQ7A 1VQEA 3MEFA 1GM5A 3E9HA 3GTMH 5C4XG 4GLXA 4DUYL 2Q2TA 4OWTB 1HNXL 2A8VA 2UU9Q 4JI3L 2N3SA 4DR5Q 1N8RC 4KHPL 1BBUA 2JA5G 4Y7NH 1WFQA 4A75A 2R93H 1Q86C 3Q8DA 3ERSX 4YWKA 1HH2P 2C35B 2NZOA 1N36L 1L2FA 1XPOA 4OWWB 3L0OA 5IYBH 2ZM6L 1K8GA 5HGQA 1YBYA 5C0XI 4IO9A 1AE2A 2EIFA 3H3VH 5C3EG 4DV4Q 1L1OA 1WYDA 3PUWA 4GN5A 1YJWA 4LF9L 3OTOL 5M3MG 3PSIA 4DR6L 2ZJQA 3U4VA 4LF5L 1FJGL 4HJ9A 1EYGA 2HIXA 4AQYQ 3J81j 2UUBQ 1PV4A 4B3RL 1CKNB 2PMZE 2PQAB 4DV0L 2VS1A 4B3ML 4P74A 4QY7A 4YHHQ 1UE7A 3HKZE 4KHZA 4YCVA 1XMQQ 1K73C 4JI4L 4JBJA 4IPHA 3OYYA 1YITA 1YVCA 3K80C 4EX5A 3CCUA 4A3EG 1M1KC 1XPUA 4DR4Q 1JJGA 2WP8J 4AYBE 2HHHL 1PFSA 4R4IA 4RMFA 1WJJA 2LSSA 5H1SE 4L5QA 2N8NA 4X66Q 1ASYA 4A3DG 2F4VQ 2ZTDA 3GTGH 5IYDH 4GOPC 3CCEA 2B63H 1YHAA 1EQQA 3M85A 4LFBQ 1KL9A 3UDIA 1JJCB 5AJ3L 3NENA 4JI7Q 4A3IG 1WI5A 4A3CG 2QGQA 2CWPA 1CSPA 3FP9A 4C3JH 5IP7G 3HOVH 3F2CA 2I0QA 1SROA 5JEAJ 3TREA 1OXXK 4LFAQ 1MIUA 4RG1A 5GROA 3CCLA 3PF5A 5JJIA 2E2HH 4IOAA 1NJIC 3A0JA 2NVYH 1PYSB 4LUVA 3W1BA 2VY3A 4LF4L 1PH1A 3HOWG 1LTLA 1S3OA 4GS3A 4BBRG 3J7ZC 3CCSA 3JAMc 3J80c 4BY7H 3HOYG 1G291 3B6YA 3ER0A 1J5EQ 4DV6L 1R9TH 5IWAQ 1H95A 4PG3A 2JA8H 1Q82C 5FLMH 2OTJA 2UUAQ 4IFDG 1NTGA 4L5RC 1PHJA 1XTDA 4PMWA 1WCMH 1I94Q 4QGUA 1T9HA 4J15A 4LNQA 3PO2H 1X3FA 3S16H 1JE5A 5IY0A 4JI1L 2Z0SA 2I5HA 1WOCA 2IX1A 2N78A 4DAYB 4LF7Q 2R92G 4PZ8A 4TQUS 4HIKA 3I4NH 1SRUA 4A93G 5ELOA 1Y1WH 2ZTCA 3G4SA 3S17H 4BXXH 2UU9L 4DR5L 1P16A 2Z6KC 4UP9A 1E1OA 2I5LX 1PH9A 4GKKQ 1TWAH 3F1ZA 4JV5Q 1K3RA 4DR7Q 4X62Q 3I2ZA 1L1OB 4P75A 1N34Q 1B8AA 1GVPA 1VQBA 1MKHA 3M3YH 4MNOA 1X3GA 4C3HH 3K81C 3CPWA 3ICEA 4YWMA 2NVTH 1YZ6A 5M5XH 3KFUA 4JBWA 3KDFA 4DV4L 1E24A 1K9MC 4LUZA 4DR3Q 2VL6A 3ULJA 1VQ6A 1NE3A 1UE6A 1VQDA 2HIVA 4A3KG 1VQ4A 3GTJH 1XNRL 1ASZA 2KHIA 3CF5A 2UXCQ 3TQYA 5C3EH 2UUBL 1YI2A 4GKJL 1LUZA 3TEHB 3PIPA 4YHHL 3CC4A 2ES2A 1XMQL 2UXDQ 3UDXA 3H3VI 2MO1A 1NY4A 2NZHA 4DV3Q 4A3GG 2ZJPA 4JI0Q 1N33L 3PUVA 1G6PA 3CMAA 4DR4L 1QVGA 4QJFA 5HY6A 1UE1A 3T1HQ 1SLJA 4WJ3M 3CCMA 4BBSG 3AFQA 5C0XG 4ALPA 1Q81C 4LW1A 3PUZA 4X66L 2RHQB 2VQEQ 2F4VL 4A3EH 3PO3G 3RLFA 3K7AH 2OQKA 5BR8L 4DR2Q 4NXML 3FKIG 4UPAA 4UP8A 4B3TL 4UP7A 2CWAA 1KRTA 3JC66 4JI7L 4HJ5A 4IJHA 3CC7A 1A8VA 1LYLA 1C0AA 3KF8B 4LFAL 3AQQA 1YNXA 1HNZL 1GD7A 5FLXc 2B29A 1YEZA 2NN6G 1A63A 4JI6Q 4YY3Q 3HFZB 4DKAC 5IYCH 3G6EA 2F3IA 4JI5Q 2NVXH 4P71A 3E9IA 3CPFA 4R4QA 2UXBQ 1I5FA 1CKMA 3RR5A 2DGYA 5M3FG 1J5EL 2E2JH 3EN2A 5IWAL 3HOWH 2Q2HA 5JJLA 3W5OA 4XIGS 2OWOA 1D7QA 4BBRH 2UUAL 3BZKA 1L1OC 2VZAA 4BY1G 2ID0A 3CQZH 2JA7G 2OCEA 2R7ZG 1I94L 1SR3A 4GLVB 1M90C 1OXTA 4OONA 3J80i 3JAMi 4HJ7A 1PH2A 1CUKA 3HOXG 4DV7Q 4AH6A 2LXJA 4O0AA 1SMXA 1VS0A 3U50C 4GLAC 1SN8A 3AEVA 1NBWA 1HR0W 1K0RA 4A3MG 4GNXC 1IBKQ 2YYZA 4QL5A 3U4ZA 3RNUA 2PNHA 4A3FG 2DUDA 1FGUA 4A3LG 3EIVA 2BH8A 4GKKL 2K52A 2R92H 4JYAQ 1E22A 4JV5L 4DR7L 4IFDJ 3PV0A 3M9BA 4LFCQ 3A74A 4DV5Q 1VQPA 3I56A 3G48A 3PF4A 3PUYA 4R1JA 3GTKH 3WWVA 1QVCA 1VQJA 3AYHB 4DR3L 3GTLH 3GD7A 4GN3B 5J3BA 2VUMG 2MO0A 4JBMA 5IE8A 3OW2A 4DPGA 5GAEC 1Y1VG 2UXCL 2KHJA 1X6OA 1YJ9A 3HKSA 5DLQE 4LF6Q 5GQOA 3D31A 3F2BA 1AE3A 1XPRA 4OX9L 1HZ9A 1RL2A 3BZCA 4WJ4A 4TVAB 3M4PA 2UXDL 2MNAA 1KHIA 1VCIA 4JC0A 1UEBA 4IPDA 4LF8Q 3EBEA 4DR1Q 1S72A 1C7YA 4C2MH 5LMUQ 1VQ9A 3VDYA 2VNUD 4QIWE 1IXRA 2OTLA 1HJPA 3T1YQ 4IPGA 5IP9G 2VQEL 1KD1C 3S1QH 2BA0A 4B3SL 3FHWA 3DLLA 1I50H 2CFMA 4DV1Q 1YHQA 2D0OA 4BBSH 1IBMQ 2R93G 1OXUA 4OO1G 2K5NA 1IYJB 1QZHA 4K0KQ 2E8GA 4DUYQ 3FKIH 3STBC 4OXPA 1TXYA 4KHPQ 4MTNA 1P8LA 1CKOA 1FL0A 3L7ZC 1JMCA 4YCUA 1FVIA 3D0FA 3NELA 3UE1A 4YY3L 4JI6L 4L5SA 2ZJRA 4LUOA 2H5XA 2YTXA 3CXCA 4JI8Q 1XMOQ 4JI5L 3J7A5 2UXBL 1EIYB 5C4XH 2AWNA 1YHBA 3HOZG 3M7NA 3OTOQ 3W1GA 2JA5H 3PUXA 4LF5Q 4HJAA 1PH4A 3DM3A 1VQFA 1KC8C 1VQLA 2EQSA 1U5KA 3KJOA 1IL2A 4PZ6A 4DV0Q 1HZAA 3GO5A 1JT8A 5C4JH 4DNIA 2D62A 4NB3A 5JEAG 1MJCA 5LMNQ 2JQOA 4AQYL 3S1RH 2EXDA 1CKNA 3CW2C 1KAWA 1VQKA 1TWGH 2HQLA 5M3MH 2ATWA 2Z6KA 1OTCA 2JA7H 3KOJA 3ULLA 2E5LQ 4A3JG 1K8AC 1A62A 5GAGC 5GADC 1IBKL 1BKBA 2AHOB 2JEAI 3HOXH 1W3SA 2QEXA 1OXSC 4JYAL 4JOIA 2AMCB 3KJPA 4NXNQ 2A1AA 3SGIA 4A3MH 3CCQA 4LFCL 1PH8A 4A3FH 4IFDI 4A3LH 4UY8C 1QVFA 3H0GG 3RZDH 2R7DA 4LFBL 1IZ6A 1VQ5A 1XNQQ 2I5MX 1PA6A 4A3DH 2Q2IA 4IJLA 1SFOH 3CC2A 2B3GA 3ZJYC 1CSQA 4LF4Q 3RLNA 4POGA 1V1QA 2K50A 3S1NH 4A3IH 1UWVA 3RN2A 4A3CH 1HNWQ 4DAMA 4DUZQ 2VUMH 5IP7H 3TS2A 2UUCQ 1WCMG 1B7YB 4X64Q 1VQ8A 4LF8L 1NMFA 2XTIA 4DR1L 1N32Q 1PH3A 3F8TA 5LMUL 4ME3A 1Q7YC 2HT1A 1A0IA 2D0PA 2KCTA 4JI2Q 4A93H 1X9NA 1IBLQ 1KIXA 2MFIA 3T1YL 4JCVE 2CQOA 3I4NG 3NBHB 4X65Q 3TS0A 3HOYH 3GDEA 1EWIA 1EOVA 1V43A 4DV1L 2QA4A 2CCZA 1Y14B 1LM0A 3UE0A 1YJNA 1IBML 2YTYA 4P73A 5ELNA 1UE5A 1VQGA 1GO3E 1VQIA 5IP9H 2RHSB 3CMEA 3I4OA 4K0KL 2VQFQ 2BH2A 5FJ8G 2GVAA 1HR0Q 3KF6A 3GTPH 4LF7L 3BJUA 1HZCA 1EUJA 2JA9A 3K7UC 1NMGA 3I4MG 2ASBA 3KLWA 3PGZA 3MXNB 2WB1G 2BA1A 3U58A 3S1MH 2N49A 2Y0SG 1GKHA 4JI8L 1XMOL 4A76A 3M4QA 4HIMA 4X62L 3KDFB 1EIFA 4XTCS 1N34L 1BBWA 3GTQH 1QUQA 1C9OA 1XNRQ 1U0LA 4YWLA 2F52A 4GKJQ 4Y52H 1JB7A 3M4OH 2JA6G 1TWHH 3J81c 1VQOA 3HOUG 3HOZH 1JJ2A 3CP0A 5LMNL 4GNXA 2Q2UA 1O7IA 2RCNA 1OXVA 1N33Q 2NN6I 4LWCA 1X3EA 2XGTA 1E3PA 4A3KH 1E7ZA 5M5YH 1K83H 2E5LL 4BA2I 2PI2E 4X6AH 3PCOB 1VQCA 4EQ5A 4DV3L 3S2DH 4JI0L 4HIDA 1KRSA 3A5ZB 3S15H 4R4CA 1PH7A 4GOPA 3T1HL 2K75A 1S40A 5BR8Q 4A3JH 4NXNL 1VQNA 4NXMQ 4A3BG 4MZ9A 1DGSA 4A3GH 2GN5A 4B3TQ 5C44G 2PI2A 2RF4A 2WB1E 2YU9H 2L15A 2Y0SE 3PIOA 4DR2L 4KI0A 4DV2Q 3NEMA 3UDGA 1EFWA 2WFWA 5IYCG 2YTVA 1KQSA 1XNQL 1HNZQ 4PZ7A 1X65A 2A19A 3PO3H 1VQMA 3H0GH 3STBD 3K0XA 4GN4B 4YCWA 1HNXQ 4JI3Q 1EQRA 5IYBG 1AH9A 1Q1EA 1V9PA 1Q12A 1RIPA 3KYHC 3RN5A 1N36Q 1Q46A 1HNWL 4DUZL 3IRBA 4IPCA 1X54A 1VQAA 4A4IA 4BA1I 1I3QH 4X64L 4HJ8A 2UUCL 5C0XJ 4OWXB 2ZM6Q 1Q1BA 3I7FA 1N32L 1MJEA 2K4KA 2JEBI 4H02A 4JI2L 4LF9Q 3GTOH 4DR6Q 1IBLL 2IY5B 4HIOA 2MQHA 3AFPA 5K36G 1YIJA 1FJGQ 4X65L 2KENA 2YV5A 1SE8A 5M3FH 4B3RQ 2KCMA 1KXLA 4KLKA 3KF6B 4B3MQ 4POFA 2LXKA 1PH5A 4JBKA 4JI4Q 4DV7L 5EAYA 2VQFL 4BY1H 1QZGA 2R7ZH 2PQAA 1HR0L 1E1TA 3UDFA 5IYDG 2GVBA 4QQBX 1TWCH 1N9WA 2B63G 2HHHQ 3L2PA 3E0EA 1X56A 2CKZB 5FJ8H 1QUQB 3RZOH 3K8AA 3HOVG 2WAQG 4NPSA 3F2DA 1VQHA 4JOIC 1BVSA 3G71A 5JJKA 1HZBA 3I4MH 1PYBA 5AJ3Q 3CCVA 4APVA 4OX9Q 4DV5L 4IOCA 4FDBA 2K5VA 4JG2A 2V1CC 1Z9FA 1L0WA 2ZTEA 3I55A 3S24A 3ULPA 1B70B 4DK6C 3A5UA 4GNXB 2NVQH 3CD6A 1Z47A 3S14H 4BY7G 2IT1A 4OO1I 1PH6A 1X55A 5LMNW
chains in the Genus database with same CATH superfamily
3S16B 3DMUA 3NHHA 5IT9E 2EYFA 3DM1A 5E7NA 1PVOA 1TVXA 1ENFA 2IHFA 1TWAB 2K28A 4AIMA 1G51A 2ALYB 3J81i 3GV6A 1ENCA 2IHEA 3W3AA 4P72A 2R6GA 3BZDB 2EVBA 4KTAA 4OIJA 4DK1A 4R9WA 4DK3C 5CGKA 5M5XB 1Y1WG 4FXDA 3QB3A 1J6QA 4DV2L 1B44D 1K8OA 4X3TA 2Y0SB 3HGBA 5E1FA 1GM5A 5C4XG 1U4MA 5C3EB 2F0LA 4DUYL 1HNXL 2A8VA 2UU9Q 4DR5Q 2N3SA 1BBUA 2NB0A 4RA8A 2R93H 3KLSA 1CTMA 4XQJA 1N36L 3TP6A 1L2FA 1A2UA 5BN3A 3L0OA 3DUZA 2ZM6L 3H3VH 4IO9A 1I6HB 4C1NI 3U4VA 3VYRA 2MHVA 4HJ9A 4K5XA 4NMZA 2UUBQ 3D8GA 3K6OA 1CKNB 4P74A 4YHHQ 1UE7A 2J4XA 2TMPA 3SK5A 1TWFB 1YVCA 1QWYA 5C44B 3CCUA 1XPUA 4AYBE 3LX0A 5I4DA 4X66Q 4FF3A 3DEOA 4RWSC 1KL9A 2IPKD 1JJCB 3NENA 4JI7Q 2B2TA 4A3CG 2CWPA 1JCKB 1X3PA 5LHY1 1BNZA 5IGCA 2E2HH 1NJIC 3W1BA 1PYSB 4GS3A 1S3OA 3CCSA 1O7ZA 4N9TA 4XYQA 1SNOA 2JA8H 4LMQD 1PZJD 3ITPA 5FLMH 2FFKB 1XTDA 4MN3A 3NSWA 4S3SA 1T9HA 4J15A 4KKTA 2F4IA 3GTLB 3T53B 1WOCA 4EVOA 4C3JB 3I4NH 3FPUB 5ELOA 3S9WA 2ZTCA 1UNSA 1PH9A 2NBFA 1WD1A 1K3RA 3CU7A 1PZID 4X62Q 3K58A 4P75A 1N34Q 1GVPA 1SYFA 3BVMA 3KFUA 3KBXA 1YZ6A 2L5TA 3EFXD 1CHPD 2PZTA 1E24A 3KDFA 4JBWA 4DV4L 3ULJA 1NE3A 4U68A 3GTJH 1GUGA 1XNRL 5IOCA 1VDZA 4NDXA 4GKJL 3T13A 1LUZA 3TEHB 1STBA 3K57A 1CA6A 4XDXA 1SXTA 3SVMA 1XMQL 2UXDQ 4G4KA 3H3VI 1N33L 4JI0Q 3PUVA 3CMAA 4ZKBB 4WJ3M 1SLJA 3AFQA 4ALPA 1Q81C 3PUZA 2F4VL 4HR7B 4RGNA 4DR2Q 3T16A 4UPAA 4UP8A 5I2XA 3QO2A 3MFYA 1IYUA 3CC7A 2O2LD 3A8JE 3BDOA 2NN6G 4FO2A 3Q22A 3ERQA 5M3MB 2F3IA 2NVXH 4R4QA 1AW7A 1I5FA 1PTOH 2DGYA 1IHZA 1YNNC 3J81L 2Q2HA 4XIGS 3BG3A 2UUAL 2RCFA 1GUWA 1L1OC 1F9RA 1EYDA 2VZAA 4BY1G 1I94L 5DNFA 2SNMA 3CHBD 1SYBA 2LFNA 1X32A 1M90C 1IYVA 4HJ7A 4IFDH 1PH2A 1CUKA 3P1HA 4O0AA 3J81E 1SMXA 5ISRA 2KUMA 1HR0W 1K0RA 4GNXC 4A3FG 2DUDA 1FGUA 4GKKL 2K52A 4JYAQ 4IFDJ 3M9BA 3URYA 3K5LA 4LFCQ 2F03A 3I56A 1FGBD 1TS5A 3PF4A 3PUYA 1AZQA 2E2JB 3WWVA 1EZ6A 4DR3L 1JORA 3ND8A 1NSNS 4K6DA 5J3BA 4K6LA 4CHTB 2VUMG 3SXHA 5IE8A 4DPGA 1U9RA 2KHJA 2XRSD 5DLQE 5GQOA 3G7LA 3GQBA 4WJ4A 2CVRA 2Z6BA 2MNAA 4IPDA 2C5CA 4C2MH 2C9OA 2P5ZX 3I91A 3T1YQ 2R92B 3MXPA 1KD1C 5DEHA 2BA0A 3BDLA 4BBSH 1IBMQ 4X3KA 4OO1G 3NBHA 1C48A 1IYJB 1DJRD 2D5DA 5TSSA 3FKIH 1SNDA 1CKOA 3U9SA 3IAYA 3CKIB 5C4ZA 2B2UA 1JMCA 2HDMA 3NELA 5HURA 4YY3L 4L5SA 4K8IA 4DGZA 2ZJRA 4ZK9B 3I90A 1XMOQ 4JI5L 1KDAA 3K5MA 5E3FA 3S2DB 1YHBA 5CR3A 3A7AB 4LF5Q 2L55A 1HQRD 1VQFA 1KC8C 3QOJA 4I65A 3VR4A 5CV8A 3S1QB 2L0CA 3SK6A 1HZAA 1HCZA 5EQ0A 5C4JH 2NVTH 1EY7A 3SK8A 2ATWA 4RFBA 2XRQD 3KOJA 5GAGC 1IBKL 4ZAIA 4FXGC 3AB9A 4F87A 3HOXH 2JXMB 1O7YA 1OO9B 2AMCB 4A3MH 3CCQA 2O4XA 1I6VC 1PH8A 4IFDI 4A3LH 3OIQA 5A2QL 1HFGA 1STHA 5A35A 3QG1A 1S4ZA 2I5MX 2B2WC 4IJLA 3CC2A 2K6AA 2B3GA 4POGA 2EYOA 1UWVA 5A2QE 4G7ZC 4DUZQ 1WCMG 1TWGB 4X64Q 2F0KA 4DR1L 1QILA 1N32Q 4HCEA 1YNND 4X3UA 2XIWA 5LMUL 1Q7YC 2HT1A 1A0IA 2FJ2A 2KCTA 1X9NA 3TN2A 1B9NA 2WACA 3NBHB 4PMCA 3HOYH 3I4MB 1V43A 1Y8PB 2CCZA 1I4GA 1LM0A 1YJNA 4P73A 3DHQA 4DN4M 1GO3E 4K0KL 1LTGD 1MSHA 3I70A 1NMGA 1XTCD 2QW7A 5C4HA 2Z1CA 3MXNB 2BA1A 2Y0SG 1GKHA 2K33A 4XTCS 3GTQH 5KYIA 1J9OA 1C9OA 1GXDC 1BO0A 2CHBD 4Y52H 3M4OH 1TWHH 3SDZA 3CP0A 4WJWA 5LMNL 1OXVA 2Z9HA 3TBIB 4CDEC 2XGTA 4A3KH 1E7ZA 1K83H 4UHVA 2E5LL 2PI2E 4CDFC 3I73A 3GTPB 5EPLA 1EY8A 2R93B 3A5ZB 4PMBA 2Q8TA 4GOPA 1BR9A 2K75A 5BR8Q 3BDCA 3F2UA 4FF4A 4B3TQ 5C44G 3OWEB 2YU9H 2L15A 4C1NK 4DNTB 5IYCG 2PPBC 4CBVA 3DWAA 3PO3H 2BE5D 3H0GH 4YCWA 2ZXRA 2Z8LA 4JI3Q 1EQRA 5IYBG 3T56B 3VYSA 3E5SA 1K0SA 3RN5A 1HNWL 1BCPB 4X3SA 4A4IA 3VYTA 2A5HA 3I7FA 1MJEA 3HRZC 3NWSA 4ME5A 4H02A 4JI2L 1FNUA 3EVQA 5KRUA 5CV4A 1BOSA 2YV5A 4QF4A 3TDQA 5HGTA 5M3FH 2Z4IA 3HZXA 4POFA 3GV3A 5EBCA 2E74C 4JPBW 5EAYA 2VQFL 3H94A 2PQAA 1S5FD 3UDFA 2E2HB 2K5DA 3A8IE 4H7BA 4HEDA 2J0TD 3RZOH 4C3JG 3F2DA 1LACA 4JOIC 1I3QB 4DXGA 1PXUA 3G71A 5BN4A 5EBDA 2QF7A 4APVA 1ESRA 1SYGA 3E0JA 2BDOA 3S24A 4DK6C 3S14H 2BOSA 5COYA 3J7AV 1JOKA 3M4YA 2AKWB 2F0PA 4R4OA 1I4PA 3LGJA 3I4NB 3HOUH 1CFMA 4GOPB 3CAMA 1Y1VH 4R4TA 1TIID 4O2DA 3H15A 1MSGA 1Q8KA 1T5EA 3KUPA 2IX0A 1LLRD 2JK8A 4IUNA 2EY2A 4F8MA 1Z7TA 4BXXG 2IW3A 4JI1Q 2K14A 2WB1B 5IT9c 1O80A 3GTJB 5M5WH 1G91A 1RHPA 5FK9C 1VQEA 3MEFA 4CJ2C 3E9HA 4GLXA 3DEPA 4OWTB 1N8RC 3OWFA 5CC4A 4KHPL 4Y7NH 4A75A 2PW7A 3ERSX 2C35B 1EFID 2A6HC 1XPOA 4V190 2JA6B 4OEMB 1WD0A 1K8GA 1ML0D 2EIFA 2B8FA 2D9UA 1BQQT 2E75C 4C3IB 1TS3A 1YJWA 5M3MG 1RD9D 3SK4A 1FJGL 3GP7A 2HIXA 4B3RL 3J80L 2PQAB 2QEJC 3HKZE 1LT3D 4QUCA 4JI4L 1D1IA 4KJNA 3C1EA 3GTMB 3BYTB 1SDFA 2HHHL 1PFSA 2F0GA 5JEAH 1WJJA 2LSSA 5H1SE 3PIO3 4L5QA 2N8NA 2NVXB 2ZTDA 3GTGH 3N6RA 5EKIA 2Z4HA 2HD3A 2B63H 4M8AA 4LFBQ 1SE4A 4N9PA 1WI5A 3HOVH 5IP7G 5JEAJ 1OXXK 4RG1A 5JJIA 1F9QA 3SHLA 2NVYH 5JJLA 2L4NA 3J7ZC 3JAMc 4J8QA 4BY7H 1B2TA 3ER0A 1J5EQ 5I9OA 1BUVT 2JYOA 5IWAQ 1QE6A 4PMWA 4HN7A 1ZXTA 4LNQA 2BCOA 3MFGA 4WRDA 5C3XA 2AQ3B 2PQEA 2KECA 4K14A 5IY0A 1FR3A 1B9MA 4DAYB 2R92G 2KJXA 4PZ8A 3AMUA 1QG7A 1Y1WH 3G4SA 3S17H 2UU9L 4DR5L 4DR7Q 1B8AA 2G5DA 4C2MB 4R8NA 1K9MC 1GHJA 4EGVA 2VL6A 1VQ6A 2HIVA 2PO4A 1G2SA 3M7GA 1ASZA 4OIKA 2F3WA 1UUPA 2LS01 2UUBL 4I7ZC 3D4DA 1YI2A 2QKIC 2WINB 4YHHL 3CC4A 3PO2B 1V1PA 4ZKCB 3UDXA 1AP0A 2F0WA 4RH6A 1R4QB 2L9HA 2ZJPA 2PNRC 2XWBB 1KNEA 4QJFA 3CCMA 4X66L 4AYBB 2RHQB 3OMCA 2VQEQ 3RLFA 3K7AH 4DK0A 1PFNA 2RDHA 4C3HB 2CWAA 1KRTA 3JC66 1GOZA 4JI7L 1LYLA 2IWHA 3KF8B 1YNXA 4KV6A 3TP7A 1HNZL 1GD7A 5FLXc 1PFBA 2B29A 5C4JB 4JI6Q 3HFZB 1DZ1A 3I72A 2A6HD 4PQXA 2EYMA 1CKMA 1BDOA 3CRKC 3ZYYX 1HUMA 2OWOA 1M4VA 1SJHD 1O7LA 2ID0A 3CQZH 4A3EB 1SR3A 5ELBA 4OONA 4Q0FA 4BS9A 4EQPA 2LXJA 4GLAC 1SN8A 5K36H 2V4DA 3MA2B 3RNUA 3EIVA 2R3ZA 2ENBA 4MIUA 4JK1C 5C5LA 1Q90A 3VA5A 5IIFA 1SMYD 3PV0A 4OHJA 3FVQA 4DFAA 3A74A 1VQPA 3BVGA 3GTKH 1QVCA 2HUGA 5KNDA 3HOWB 1VQJA 2RA4A 4G57A 4CKCA 1ILPA 4BBRB 4IQZA 3HOYB 2MO0A 4JBMA 1NR4A 2PYKA 2RVLA 4P2CB 1V1PB 4XXEA 1X3QA 3HKSA 2FMMA 3F2BA 3UI2A 3BZCA 1JB3A 2G9HD 1BF4A 3M4PA 2B2VC 2UXDL 2A69D 1CZWA 4JC0A 4LF8Q 2M9VA 1C7YA 1PDQA 1I4HA 2F0MA 1ICFB 5JVH3 4B3SL 3FHWA 2EY5A 1I50H 4OELB 1RTNA 1SJED 3NUCA 4DV1Q 2D0OA 5M9OA 1BCPF 5LL6S 2R93G 2EY6A 2K5NA 1QZHA 4DUYQ 2EYPA 4MTNA 1P8LA 3L7ZC 4YCUA 3UE1A 1PLFA 4LUOA 4A3KB 1AEXA 1B1ZA 3L3OC 4ID6A 3OHXC 1IKLA 2NN6H 4XT1B 4KKUA 2F0JA 2JA5H 3PUXA 1KLGD 4HJAA 4FP5D 3DM3A 3H6MA 3FPPA 1RJTA 3SE0A 1IL2A 5C3WA 4KN4C 1MD2D 3GO5A 1JT8A 4AQYL 4NB3A 4TKOB 2JQOA 2EXDA 5CV5A 3ULLA 3PO3B 3NK9A 2CH4W 5GADC 2JEAI 1OXSC 3A55A 4JYAL 3KJPA 1EEID 2D2CC 1F9SA 4NW2A 3SGIA 5G3LF 4NXNQ 1HUNA 4LFCL 1KDCA 4A3FH 1LT6D 4UY8C 1QVFA 1LTSD 3RZDH 1II3A 1SYCA 2B8GA 4U673 2LY7A 4BWGB 1XNQQ 4A3DH 2Q2IA 5M3FB 3RLNA 2K50A 3S1NH 4ZLTF 1QNKA 4A3IH 2CQAA 3RN2A 3RD4A 2VUMH 4ZRZA 3TS2A 2JA7B 3HEJA 1NMFA 2XTIA 2OF1A 4I7AA 4ME3A 3QIAA 4A93H 3RZOB 3T1YL 2CQOA 5CV7A 3I4NG 4X65Q 3GDEA 4V0BA 2FHTA 4RCNA 4DAVA 5ELEA 1IBML 2YTYA 5KNCA 3DXJC 1VQIA 2HCCA 1VF7A 1D5XC 3NXWA 3KF6A 4LF7L 1SFOB 2JA9A 3K7UC 4IURA 4OO1H 4HMIA 1STEA 5DM73 2A6EC 3PGZA 5ELDA 2WB1G 3HOUB 1XMOL 5DM63 4A76A 4HIMA 1JICA 1Y1VB 2DNCA 3G6JB 3KDFB 3TZDA 2RDGA 1TKWB 2PZWA 1XNRQ 2F52A 4GKJQ 1JB7A 2JA6G 4KD4A 4KY6A 3VR3A 1CI3M 1RODA 3K5OA 4GNXA 1O7IA 3C3LA 4C3IG 1B50A 5M5WB 1N33Q 2NN6I 1STAA 1E3PA 4BA2I 3I4LA 2Q8RE 4DV3L 2KEEA 4Y7NB 4HIDA 1KRSA 1Q3LA 1H9KA 3T1HL 4FF1A 4A3BG 3C1FA 3S1MB 1DGSA 4A3GH 2PI2A 2B2YC 4ILWA 5C0XH 1KQSA 3HG9A 4KY5A 2LKVA 2K5WA 3K0XA 5IODA 3HOZB 4RKLA 3NP8A 2EJFC 4K8JA 1Q12A 3KYHC 1YNJC 1HPCA 4DUZL 4BA1I 4X64L 5C0XJ 1O78A 5IGGA 1N32L 1HHVA 2MP1A 2SDFA 2JEBI 1Y8NB 2RQXA 3MXGA 2HQEA 4IUVA 4LF9Q 3GTOH 4DR6Q 3S15B 4HIOA 3AFPA 2KCNA 4MTKA 2QDLA 4A3JB 1KAAA 5CMDA 3D4RA 1SE8A 4KLKA 2I07B 3KF6B 4B3MQ 1STYA 4JBKA 4DXFA 5FKAC 4DV7L 2PCFB 2R7ZH 1H9SA 5EKKA 5IYDG 2GVBA 4ZYSA 3A7LA 2NVYB 3NTIA 2I46A 2CKZB 1XXGA 3ONAB 3R2TA 2FINB 5D14A 3K0YA 1HZBA 5AJ3Q 3CCVA 3V05A 4DV5L 4IOCA 2RBMA 1Z9FA 3I55A 2ZTEA 1B70B 1HQMC 3A5UA 4GNXB 2NVQH 3CD6A 4OO1I 2IT1A 4FVMA 1PH6A 1X55A 1U0LA 1XJVA 1MGSA 4LF6L 4KHVA 3IL8A 3NE5B 1WTVA 1EY9A 1W2BA 2VW9A 4DV6Q 1TS2A 2AWOA 3S17B 1R4PB 3BU2A 1I6HH 2R7FA 5EKLA 4HAEA 1LT5D 1CA5A 1BCPC 3PO2G 3I3CA 3WDNA 1DXMA 4C56C 1Q8IA 2B2WA 2WAQE 5EJWA 3TRZA 1A3UA 1TWFH 4AYBG 5C44H 1GUNA 1F2MA 2Q2TA 4JI3L 4C3HG 1WFQA 1MI2A 2A6ED 1SAPA 5IYBH 1ONLA 1LTBD 1YBYA 5HGQA 5C0XI 1AE2A 3LWEA 5C3EG 3KBGA 1WYDA 2DN8A 3OTOL 2ZJQA 3OSOA 4CJ0B 1EYGA 1E2VA 3J81j 1PV4A 1EQVA 2X6GA 5IGBA 2PMZE 1H9SB 4DV0L 2VS1A 4QY7A 1CQFA 1BXTA 4YCVA 1STGA 3OYYA 1YITA 3K80C 4EX5A 4A3EG 1M1KC 1JJGA 4DR4Q 2K1BA 4IUTA 4R4IA 4RMFA 1TS4A 5CV6A 1ASYA 4EQNA 3VR2A 2EYLA 4GOPC 5FO9B 3CCEA 1EQQA 2VB2X 1RKNA 3RMHA 4C3JH 1KDBA 1TY2A 3F2CA 3TREA 4LFAQ 4J6HA 3CCLA 1ILQA 3R2IA 1NCVA 2CH4A 3A0JA 4LUVA 2J7ZA 4LF4L 3HOWG 1YNJD 2VY3A 1LTLA 4BBRG 3J80c 3HOYG 1G291 3B6YA 1FNWA 2K7VA 2F0QA 3KK7A 1R9TH 2NTTA 5JPNC 1JOOA 1NTGA 4L5RC 4QGUA 4K2KA 2XWJB 4JI1L 2IX1A 2N78A 4TQUS 1SRUA 2TSSA 1CZGA 4BXXH 1P16A 2Z6KC 3F1ZA 1PRTB 4JV5Q 2F0OA 1B53A 1Y8OB 1EY6A 4HMJA 4IUPA 5F2DA 1LTRD 1MKHA 3M3YH 4MNOA 1X3GA 2DJFC 3CPWA 4YWMA 4LUZA 2JA8B 1UE6A 1VQDA 2JN4A 4A3KG 3V96A 1VQ4A 3QOLA 2KHIA 3CF5A 2F1MA 2UXCQ 3R93A 2ZXPA 3TQYA 3PIPA 3VYUA 3L9AX 2ES2A 1JWMD 1EIGA 2MO1A 1NY4A 2HDLA 3HKZB 3NWTA 4ZCKA 4ULLA 3X3NA 1B3AA 2IL8A 1QOHA 2ICEC 3OIPA 1BCPD 3AU7A 4LW1A 4DAPA 3PO3G 1QCBD 2OQKA 4NXML 3V2TA 1PZKD 2JA5B 2KVMA 2WKDA 3X3MA 4ABNA 2KOLA 3AQQA 1DONA 2O5JC 4XQNA 1A3VA 4IN3A 4O1NA 2M00A 1A63A 1A15A 1CM9A 4PV1C 3HS0C 4DKAC 2K01A 1EWHA 2UXBQ 3CPFA 5M3FG 1J5EL 4M1UB 2E2JH 3EN2A 5IWAL 3FMCA 3W5OA 1D7QA 2H1EA 1EZ8A 3NPPA 2JA7G 1OXTA 3JAMi 5JAVA 4AH6A 1GUSA 2MJ8A 4A3DB 1VS0A 3U50C 1NBWA 1F9PA 5C5MA 2L12A 2YYZA 4QL5A 3U4ZA 4LK1C 3SEBA 4A3IB 2N55A 2BH8A 5EGTA 2R92H 3BVZA 4F7XA 4DR7L 3T4AC 4L63B 2BDNA 5ELFA 1I4QA 2IJ0A 3C46A 3TMEA 1PTOB 4HSPA 4XYOA 3AYHB 4A93B 2ICIA 1JOQA 3C2PA 4DNRB 5GAEC 1Y1VG 1X6OA 1YJ9A 4OX9L 1AE3A 1RL2A 2EPBA 2AQ1B 2AUJD 4QCLA 1HXYD 1KHIA 1VCIA 2F0HA 3OMGA 1S72A 2SEBD 2VNUD 4QIWE 5JOBA 3QJYA 1HJPA 3D3RA 2VQEL 1TY0A 5IP9G 3S1QH 2CFMA 1GJXA 4LAAA 3MVVA 4OXPA 4KHPQ 2HCIA 5IGDA 4K5WA 3D0FA 4JI6L 1EWCA 3NTKA 4JI8Q 2MUYA 4ZUJA 3J7A5 3PQIA 1SBBB 5C4XH 2AWNA 3HOZG 1D2BA 1GUTA 3M7NA 1MHWC 2PZUA 3MHBA 1PH4A 1VQLA 2KEDA 4A3GB 3KJOA 4PZ6A 1F2ZA 5JEAG 1VQ8A 4BBSB 4FNFA 1VQKA 3S1RH 4RHRA 1CKNA 1RF2D 3CW2C 1TWGH 2HQLA 2K32A 3MZ5A 4F88A 1OTCA 4A3JG 3FKIB 1BKBA 2AHOB 4KJOA 4HTHA 1KTKA 5JVG3 1HA6A 1NAPA 2H4OA 1D6EC 4KMUC 3GTOB 1LABA 1SNQA 1WTQA 1VQ5A 1S5DD 1VMCA 4G7HC 4RGTA 1LT4D 1CSQA 1E0BA 4RGOS 2MPMA 1HFNA 1LTID 1WTWA 1I4RA 3N52A 2A68C 4A3CH 4JW0A 2UUCQ 2WV6D 2NVTB 2R7ZB 1D1KA 1CQVA 1KNAA 4LF8L 1JQYD 5I9PA 1PH3A 4ZUIA 3HOXB 1RCVD 1IBLQ 2MFIA 5I2YA 4JCVE 3TS0A 4A3MB 3VA7A 1EOVA 5KEEA 4DV1L 2QA4A 1WVLA 3UE0A 1UE5A 4IZ8A 1HRJA 2ZT9C 2RHSB 4PNYA 3I4OA 2NVQB 2BH2A 5FJ8G 2KQ3A 1HR0Q 3GTPH 1WTOA 3I4MG 3FDTA 3U58A 2N49A 4NKLA 3M4QA 4X62L 1EIFA 1N34L 1G6ZA 3D4WA 1BBWA 4XT3B 1QUQA 1ET6A 3NQTA 4YWLA 1UEAB 2XNAC 4EQOA 2B2TC 3JAML 3J81c 1VQOA 1JJ2A 1SEBD 2WKCA 4DU9A 4DF7A 1MBYA 1T5XD 2RCNA 4H44C 5CBEE 1GUOA 3EROA 1QNUA 3TZUA 5M5YH 3PCOB 4JI0L 1K28A 3HP3A 3JAME 5C6AA 3TSSA 1PH7A 2WIIB 2SNSA 1S40A 2EJMA 4NXNL 1FNVA 1A3TA 4MZ9A 5LL6X 2Y0SE 4DR2L 1C4QA 1FD7D 4DV2Q 3UDGA 3QR8A 3GTQB 5J1ZA 2WFWA 1V8QA 4K5VA 1XNQL 1HNZQ 1AN8A 4J1MA 1X65A 2A19A 1VQMA 5CORA 2B2VA 1HNXQ 3M4OB 1TWHB 1V9PA 3A54A 1WTXA 1N36Q 1Q46A 3IRBA 4IPCA 3LWUA 1SYDA 1I3QH 1F2YA 4OWXB 2F0FA 4FXKC 5KGUA 2ZM6Q 1K83B 4CJ1B 1DM0B 2KA7A 1CHQD 2JP1A 4OGQC 3IKJA 2MQHA 4RAUC 5K36G 1YIJA 4X65L 2EZVA 1IL8A 1KXLA 1PRTF 2YU9B 2F0SA 1WTPA 1PH5A 1XX8A 4BY1H 1QZGA 1EEFD 1EY4A 4MHEA 3H0GB 1TWCH 1N9WA 3VR5A 2SOBA 3E0EA 4ZQ3A 2NZ1D 1X56A 1QUQB 3K8AA 4YIJA 1BVSA 1R9TB 5JJKA 1PYBA 3MTSA 4FDBA 5KIXA 5FLXL 2K5VA 4JG2A 1L0WA 3ULPA 3Q0AA 5IGFA 1ZEQX 1E2WA 2F0VA 2OT2A 2K5HA 3RLOA 4KKSA 2FXQA 2B39A 2JA8G 2A68D 5FLMG 1SE2A 4L5TA 5KNBA 5FLXE 2KBNA 5GAHC 2JA6H 1EY0A 4ODGA 2E2IH 2JE6I 4FYDA 3NQIA 4C3IH 1H9MA 3P7JA 3CCJA 4B3SQ 5FO7B 3NBIA 2OQ0A 4QB4A 3A8KE 3M3YB 2JJQA 2F0IA 2CW0C 3HKZG 1EU3A 4GZYC 5D3IB 3S2HH 1S5CD 3CCRA 1D8LA 4LJZC 4A3BH 3R8BA 2NUCA 2R61A 2K03A 2QDBA 1VQ7A 1E2ZA 3GTMH 3S14B 3SR1A 5CBAE 1FYCA 2F0UA 2JA5G 1Q86C 3Q8DA 5JPMC 4YWKA 1HH2P 2NZOA 4K2LA 1WTHA 1A6XA 4OWWB 4UAIA 4DV4Q 1L1OA 1W6KA 3PUWA 4GN5A 4LF9L 3PSIA 4DR6L 4LF5L 4AQYQ 2F3VA 1VMPA 4B3ML 4QMGA 3IFDA 1JR0D 3KLSX 4KHZA 1XMQQ 4JBJA 4IPHA 2IX3A 1WTRA 2K05A 1K73C 1C8CA 4RGMA 1XYIA 1PTOF 1LO5D 3MAQA 2WP8J 2EYJA 4CDCC 3Q6SA 1TQOA 4A3DG 2F4VQ 5IYDH 2E76C 3BYYB 1YHAA 2EJGC 3M85A 2VB3X 3W2DA 3UDIA 5AJ3L 4A3IG 2QGQA 1CSPA 3FP9A 2I0QA 1SROA 1MIUA 5GROA 3PF5A 1L0XB 4IOAA 4A93G 1PH1A 3TP8A 2B2UC 1NUCA 4DV6L 2E2DC 1I4XA 1H95A 4PG3A 1Q82C 2OTJA 3D6CA 2UUAQ 2NYZD 2B2YA 4IFDG 5L37A 1PHJA 1S5ED 1WCMH 1SNCA 1I94Q 3GTGB 1HTLD 1B4OA 2B63B 1BBXC 3PO2H 1X3FA 2GA4B 2EDGA 5T1IA 1JE5A 3S16H 1B3QA 2I5HA 2Z0SA 5KYLA 2BE5C 4LF7Q 3HOVB 2WAQB 4HIKA 2XSCA 1JC7A 1KLUD 2DJGC 4UP9A 1E1OA 2I5LX 4GKKQ 1HA5A 1TWAH 2F0DA 3I2ZA 1L1OB 3TP5A 4BY7B 3MXNA 5FO8B 1VQBA 3ICEA 4C3HH 3K81C 5M5XH 4DR3Q 3T51B 3R3OA 1LV9A 1KABA 2KCCA 1DD2A 5C3EH 2NTSA 3H3VC 3LNNA 5FOBB 3CRLC 2PMZB 2NZHA 4A3GG 4DV3Q 1H9RA 3FRPB 1EL0A 5E4WC 1G6PA 4DR4L 4KN7C 1QVGA 1Y1WB 5HY6A 1UE1A 2EY1A 3T1HQ 4BBSG 5C0XG 4A3EH 5C4XB 2FMCA 5BR8L 3FEWX 2CW0D 3FKIG 1DYQA 4B3TL 4UP7A 1NNXA 4HJ5A 4IJHA 1A8VA 5K5PA 3H91A 1C0AA 4KK7A 4LFAL 1F2LA 1AZPA 1YEZA 4WORA 3S1RB 4YY3Q 2AUKA 5IYCH 4KY7A 3G6EA 1DOMA 4JI5Q 4P71A 3E9IA 3RR5A 2LMCB 3HOWH 4TRDA 1H9JA 1PYWD 3VR6A 1PRTC 2M2LA 4BBRH 4H13C 3BZKA 1K3BC 2A74C 2EE1A 2R7ZG 3E6ZX 2OCEA 3K7AB 4GLVB 3P75A 3EQLC 3J80i 2L11A 3HOXG 4DV7Q 4RKBA 1LTAD 4DA2A 2RDFA 1PFMA 3AEVA 2L1BA 4A3MG 1IBKQ 2A73B 2PNHA 2RSNA 4A3LG 3I8ZA 1D5MC 3PMFA 4JV5L 1E22A 3OW7A 1M8AA 1SSOA 3KLRA 4DV5Q 3G48A 4R1JA 4N8X1 5E4XA 1TU2B 3OPOA 2XN9C 2F0EA 3IFTA 3GTLH 3GD7A 4GN3B 4CDDC 1PMRA 2O5IC 1VF5C 3OW2A 1RDPD 3CQZB 2UXCL 1SNMA 4LF6Q 3D31A 1J8IA 1XPRA 1HZ9A 1DOKA 4TVAB 2OEOA 1Z6HA 3EJIA 1UEBA 3EBEA 3OOCA 4DR1Q 3U9OA 1EYAA 3DWQA 4IUQA 5LMUQ 1VQ9A 3VDYA 1NR2A 2MGSA 5CYUA 1IXRA 2N88A 2OTLA 1QB5D 4IPGA 4KD3A 3DLLA 3MEHA 1YHQA 2Q8IB 1SYEA 1OXUA 1U4PA 3GTKB 2KHSA 2ZXOA 1XWEA 3BS1A 4K0KQ 2E8GA 3J7AF 3STBC 1TXYA 1A2TA 1FL0A 1FVIA 1K8MA 1ZYRC 5DAUA 2H5XA 5IGEA 1EY5A 2YTXA 3CXCA 5M5YB 4QUFA 1HTPA 1GHKA 2UXBL 5EPKA 1EIYB 5I6WA 2K04A 1L0YB 3OTOQ 4G7OC 3W1GA 3PIP3 2EQSA 1U5KA 4H0LC 4DV0Q 4FF2A 1PTOC 1I50B 1ENAA 4DNIA 2D62A 2RSOA 5LMNQ 1MJCA 1G8ZD 1IW7C 1STNA 1KAWA 5J39A 2JA7H 5M3MH 2Z6KA 1ZKOA 2E5LQ 3H09A 1K8AC 1QJOA 1A62A 1EYCA 1W3SA 2QEXA 1CK1A 4JOIA 3DWPA 5BN5A 2A1AA 2AQ2B 1F77A 4RCOA 1Y69U 3H0GG 4L8JA 2R7DA 4LFBL 1G2TA 3K5NA 1IZ6A 1U4LA 1ET9A 1PA6A 1SFOH 3WOFA 5I6YA 1S5BD 3ZJYC 4R8IA 4LF4Q 1V1QA 4IUUA 1HNWQ 4DAMA 1TR5A 4HSVA 4O42A 5IP7H 4BY1B 1AFPA 1B7YB 4N8FA 5AFWA 4JVZA 1EU4A 1TWCB 1V1OA 3K59A 3F8TA 1PRTD 3P20A 2G9DA 5CV9A 2D0PA 4JI2Q 1SNPA 3Q24A 1KIXA 4UDUC 4QIWB 1EWIA 4A3FB 1Y14B 2EXZA 3NTHA 3RZDB 4B9WA 5ELNA 1EOTA 3O13A 1VQGA 4WFN3 5IP9H 1EQTA 3Q23A 3CMEA 3ND9A 2VQFQ 2GVAA 4CKEA 3BJUA 4DAYA 1HZCA 4HCSA 1EUJA 5G3LD 2EOTA 4NP5A 2QCPX 2VXWA 3KLWA 2ASBA 3S1NB 3S1MH 1SE3A 1CT1D 4JI8L 2VUMB 2E2IB 1ICWA 1DCZA 4Z9CB 1U4RA 2NWGA 1EIHA 3J7YW 3E3XA 1IKMA 3QWNA 1JE4A 3HOUG 3HOZH 2DNEA 4XQQA 3S2HB 3EA6A 2Q2UA 3MC0B 4A3BB 2QILA 2JSOA 4LWCA 1X3EA 5JJZA 2XVSA 4X6AH 1VQCA 4TSSA 4EQ5A 3S2DH 5ELCA 3J80E 3S15H 4IALA 2X6LA 1SMYC 4R4CA 1DOLA 4A3JH 1VQNA 4NXMQ 1D5ZC 2GN5A 2RF4A 2WB1E 3PIOA 4KI0A 3A56A 3NEMA 1JWUD 2DY7A 1EFWA 4B08A 2YTVA 5NUCA 1TT2A 4PZ7A 1LTTD 3STBD 4GN4B 3KF8A 1RTOA 1AH9A 1Q1EA 4Q5VA 2PW5A 1RIPA 2A69C 1ZYRD 2EYHA 1X54A 1VQAA 2UUCL 4CKBA 1UAPA 4HJ8A 1JWSD 1Q1BA 2K4KA 5J22A 5D3DA 2OXPA 1IBLL 2IY5B 2F0TA 2DY8A 1FJGQ 2KENA 4L6TB 4E6IA 4B3RQ 1PTOD 2K5QA 2KCMA 1ESFA 3MWYW 2LXKA 1IW7D 4JI4Q 3D6WA 5D65A 1HR0L 1E1TA 3RUZA 3WOEA 4QQBX 2X69A 2B63G 2HHHQ 3L2PA 2RKSA 2F0NA 5FJ8H 5EPJA 3HOVG 2WAQG 4NPSA 1VQHA 5T1GA 4OL7A 5IT9L 3I4MH 3MXUA 4CGYB 1W6JA 2V1CC 1WCMB 4RHSA 1Z47A 4BY7G 4OX9Q 4B9XA 5LMNW
chains in the Genus database with same CATH topology
1XJVA 3RLOA 2K5HA 2AKWB 2FXQA 4LF6L 2JA8G 4R4OA 5FLMG 4L5TA 3LGJA 2KBNA 5E7NA 5GAHC 2JA6H 1W2BA 3HOUH 1PVOA 4GOPB 3CAMA 2VW9A 2E2IH 4DV6Q 1Y1VH 2AWOA 4R4TA 2JE6I 3BU2A 1I6HH 4O2DA 2IHFA 3H15A 1Q8KA 4C3IH 2R7FA 4AIMA 1G51A 2ALYB 3PO2G 3J81i 3CCJA 4B3SQ 2IHEA 2IX0A 4P72A 2OQ0A 2R6GA 2JK8A 2JJQA 3HKZG 4DK3C 2WAQE 1Y1WG 1J6QA 4DV2L 4BXXG 3S2HH 3CCRA 1D8LA 3TRZA 4JI1Q 4A3BH 2K14A 1TWFH 5IT9c 5M5WH 4AYBG 5C44H 1VQ7A 1VQEA 3MEFA 1GM5A 3E9HA 3GTMH 5C4XG 4GLXA 4DUYL 2Q2TA 4OWTB 1HNXL 2A8VA 2UU9Q 4JI3L 2N3SA 4DR5Q 1N8RC 4KHPL 1BBUA 2JA5G 4Y7NH 1WFQA 4A75A 2R93H 1Q86C 3Q8DA 3ERSX 4YWKA 1HH2P 2C35B 2NZOA 1N36L 1L2FA 1XPOA 4OWWB 3L0OA 5IYBH 2ZM6L 1K8GA 5HGQA 1YBYA 5C0XI 4IO9A 1AE2A 2EIFA 3H3VH 5C3EG 4DV4Q 1L1OA 1WYDA 3PUWA 4GN5A 1YJWA 4LF9L 3OTOL 5M3MG 3PSIA 4DR6L 2ZJQA 3U4VA 4LF5L 1FJGL 4HJ9A 1EYGA 2HIXA 4AQYQ 3J81j 2UUBQ 1PV4A 4B3RL 1CKNB 2PMZE 2PQAB 4DV0L 2VS1A 4B3ML 4P74A 4QY7A 4YHHQ 1UE7A 3HKZE 4KHZA 4YCVA 1XMQQ 1K73C 4JI4L 4JBJA 4IPHA 3OYYA 1YITA 1YVCA 3K80C 4EX5A 3CCUA 4A3EG 1M1KC 1XPUA 4DR4Q 1JJGA 2WP8J 4AYBE 2HHHL 1PFSA 4R4IA 4RMFA 1WJJA 2LSSA 5H1SE 4L5QA 2N8NA 4X66Q 1ASYA 4A3DG 2F4VQ 2ZTDA 3GTGH 5IYDH 4GOPC 3CCEA 2B63H 1YHAA 1EQQA 3M85A 4LFBQ 1KL9A 3UDIA 1JJCB 5AJ3L 3NENA 4JI7Q 4A3IG 1WI5A 4A3CG 2QGQA 2CWPA 1CSPA 3FP9A 4C3JH 5IP7G 3HOVH 3F2CA 2I0QA 1SROA 5JEAJ 3TREA 1OXXK 4LFAQ 1MIUA 4RG1A 5GROA 3CCLA 3PF5A 5JJIA 2E2HH 4IOAA 1NJIC 3A0JA 2NVYH 1PYSB 4LUVA 3W1BA 2VY3A 4LF4L 1PH1A 3HOWG 1LTLA 1S3OA 4GS3A 4BBRG 3J7ZC 3CCSA 3JAMc 3J80c 4BY7H 3HOYG 1G291 3B6YA 3ER0A 1J5EQ 4DV6L 1R9TH 5IWAQ 1H95A 4PG3A 2JA8H 1Q82C 5FLMH 2OTJA 2UUAQ 4IFDG 1NTGA 4L5RC 1PHJA 1XTDA 4PMWA 1WCMH 1I94Q 4QGUA 1T9HA 4J15A 4LNQA 3PO2H 1X3FA 3S16H 1JE5A 5IY0A 4JI1L 2Z0SA 2I5HA 1WOCA 2IX1A 2N78A 4DAYB 4LF7Q 2R92G 4PZ8A 4TQUS 4HIKA 3I4NH 1SRUA 4A93G 5ELOA 1Y1WH 2ZTCA 3G4SA 3S17H 4BXXH 2UU9L 4DR5L 1P16A 2Z6KC 4UP9A 1E1OA 2I5LX 1PH9A 4GKKQ 1TWAH 3F1ZA 4JV5Q 1K3RA 4DR7Q 4X62Q 3I2ZA 1L1OB 4P75A 1N34Q 1B8AA 1GVPA 1VQBA 1MKHA 3M3YH 4MNOA 1X3GA 4C3HH 3K81C 3CPWA 3ICEA 4YWMA 2NVTH 1YZ6A 5M5XH 3KFUA 4JBWA 3KDFA 4DV4L 1E24A 1K9MC 4LUZA 4DR3Q 2VL6A 3ULJA 1VQ6A 1NE3A 1UE6A 1VQDA 2HIVA 4A3KG 1VQ4A 3GTJH 1XNRL 1ASZA 2KHIA 3CF5A 2UXCQ 3TQYA 5C3EH 2UUBL 1YI2A 4GKJL 1LUZA 3TEHB 3PIPA 4YHHL 3CC4A 2ES2A 1XMQL 2UXDQ 3UDXA 3H3VI 2MO1A 1NY4A 2NZHA 4DV3Q 4A3GG 2ZJPA 4JI0Q 1N33L 3PUVA 1G6PA 3CMAA 4DR4L 1QVGA 4QJFA 5HY6A 1UE1A 3T1HQ 1SLJA 4WJ3M 3CCMA 4BBSG 3AFQA 5C0XG 4ALPA 1Q81C 4LW1A 3PUZA 4X66L 2RHQB 2VQEQ 2F4VL 4A3EH 3PO3G 3RLFA 3K7AH 2OQKA 5BR8L 4DR2Q 4NXML 3FKIG 4UPAA 4UP8A 4B3TL 4UP7A 2CWAA 1KRTA 3JC66 4JI7L 4HJ5A 4IJHA 3CC7A 1A8VA 1LYLA 1C0AA 3KF8B 4LFAL 3AQQA 1YNXA 1HNZL 1GD7A 5FLXc 2B29A 1YEZA 2NN6G 1A63A 4JI6Q 4YY3Q 3HFZB 4DKAC 5IYCH 3G6EA 2F3IA 4JI5Q 2NVXH 4P71A 3E9IA 3CPFA 4R4QA 2UXBQ 1I5FA 1CKMA 3RR5A 2DGYA 5M3FG 1J5EL 2E2JH 3EN2A 5IWAL 3HOWH 2Q2HA 5JJLA 3W5OA 4XIGS 2OWOA 1D7QA 4BBRH 2UUAL 3BZKA 1L1OC 2VZAA 4BY1G 2ID0A 3CQZH 2JA7G 2OCEA 2R7ZG 1I94L 1SR3A 4GLVB 1M90C 1OXTA 4OONA 3J80i 3JAMi 4HJ7A 1PH2A 1CUKA 3HOXG 4DV7Q 4AH6A 2LXJA 4O0AA 1SMXA 1VS0A 3U50C 4GLAC 1SN8A 3AEVA 1NBWA 1HR0W 1K0RA 4A3MG 4GNXC 1IBKQ 2YYZA 4QL5A 3U4ZA 3RNUA 2PNHA 4A3FG 2DUDA 1FGUA 4A3LG 3EIVA 2BH8A 4GKKL 2K52A 2R92H 4JYAQ 1E22A 4JV5L 4DR7L 4IFDJ 3PV0A 3M9BA 4LFCQ 3A74A 4DV5Q 1VQPA 3I56A 3G48A 3PF4A 3PUYA 4R1JA 3GTKH 3WWVA 1QVCA 1VQJA 3AYHB 4DR3L 3GTLH 3GD7A 4GN3B 5J3BA 2VUMG 2MO0A 4JBMA 5IE8A 3OW2A 4DPGA 5GAEC 1Y1VG 2UXCL 2KHJA 1X6OA 1YJ9A 3HKSA 5DLQE 4LF6Q 5GQOA 3D31A 3F2BA 1AE3A 1XPRA 4OX9L 1HZ9A 1RL2A 3BZCA 4WJ4A 4TVAB 3M4PA 2UXDL 2MNAA 1KHIA 1VCIA 4JC0A 1UEBA 4IPDA 4LF8Q 3EBEA 4DR1Q 1S72A 1C7YA 4C2MH 5LMUQ 1VQ9A 3VDYA 2VNUD 4QIWE 1IXRA 2OTLA 1HJPA 3T1YQ 4IPGA 5IP9G 2VQEL 1KD1C 3S1QH 2BA0A 4B3SL 3FHWA 3DLLA 1I50H 2CFMA 4DV1Q 1YHQA 2D0OA 4BBSH 1IBMQ 2R93G 1OXUA 4OO1G 2K5NA 1IYJB 1QZHA 4K0KQ 2E8GA 4DUYQ 3FKIH 3STBC 4OXPA 1TXYA 4KHPQ 4MTNA 1P8LA 1CKOA 1FL0A 3L7ZC 1JMCA 4YCUA 1FVIA 3D0FA 3NELA 3UE1A 4YY3L 4JI6L 4L5SA 2ZJRA 4LUOA 2H5XA 2YTXA 3CXCA 4JI8Q 1XMOQ 4JI5L 3J7A5 2UXBL 1EIYB 5C4XH 2AWNA 1YHBA 3HOZG 3M7NA 3OTOQ 3W1GA 2JA5H 3PUXA 4LF5Q 4HJAA 1PH4A 3DM3A 1VQFA 1KC8C 1VQLA 2EQSA 1U5KA 3KJOA 1IL2A 4PZ6A 4DV0Q 1HZAA 3GO5A 1JT8A 5C4JH 4DNIA 2D62A 4NB3A 5JEAG 1MJCA 5LMNQ 2JQOA 4AQYL 3S1RH 2EXDA 1CKNA 3CW2C 1KAWA 1VQKA 1TWGH 2HQLA 5M3MH 2ATWA 2Z6KA 1OTCA 2JA7H 3KOJA 3ULLA 2E5LQ 4A3JG 1K8AC 1A62A 5GAGC 5GADC 1IBKL 1BKBA 2AHOB 2JEAI 3HOXH 1W3SA 2QEXA 1OXSC 4JYAL 4JOIA 2AMCB 3KJPA 4NXNQ 2A1AA 3SGIA 4A3MH 3CCQA 4LFCL 1PH8A 4A3FH 4IFDI 4A3LH 4UY8C 1QVFA 3H0GG 3RZDH 2R7DA 4LFBL 1IZ6A 1VQ5A 1XNQQ 2I5MX 1PA6A 4A3DH 2Q2IA 4IJLA 1SFOH 3CC2A 2B3GA 3ZJYC 1CSQA 4LF4Q 3RLNA 4POGA 1V1QA 2K50A 3S1NH 4A3IH 1UWVA 3RN2A 4A3CH 1HNWQ 4DAMA 4DUZQ 2VUMH 5IP7H 3TS2A 2UUCQ 1WCMG 1B7YB 4X64Q 1VQ8A 4LF8L 1NMFA 2XTIA 4DR1L 1N32Q 1PH3A 3F8TA 5LMUL 4ME3A 1Q7YC 2HT1A 1A0IA 2D0PA 2KCTA 4JI2Q 4A93H 1X9NA 1IBLQ 1KIXA 2MFIA 3T1YL 4JCVE 2CQOA 3I4NG 3NBHB 4X65Q 3TS0A 3HOYH 3GDEA 1EWIA 1EOVA 1V43A 4DV1L 2QA4A 2CCZA 1Y14B 1LM0A 3UE0A 1YJNA 1IBML 2YTYA 4P73A 5ELNA 1UE5A 1VQGA 1GO3E 1VQIA 5IP9H 2RHSB 3CMEA 3I4OA 4K0KL 2VQFQ 2BH2A 5FJ8G 2GVAA 1HR0Q 3KF6A 3GTPH 4LF7L 3BJUA 1HZCA 1EUJA 2JA9A 3K7UC 1NMGA 3I4MG 2ASBA 3KLWA 3PGZA 3MXNB 2WB1G 2BA1A 3U58A 3S1MH 2N49A 2Y0SG 1GKHA 4JI8L 1XMOL 4A76A 3M4QA 4HIMA 4X62L 3KDFB 1EIFA 4XTCS 1N34L 1BBWA 3GTQH 1QUQA 1C9OA 1XNRQ 1U0LA 4YWLA 2F52A 4GKJQ 4Y52H 1JB7A 3M4OH 2JA6G 1TWHH 3J81c 1VQOA 3HOUG 3HOZH 1JJ2A 3CP0A 5LMNL 4GNXA 2Q2UA 1O7IA 2RCNA 1OXVA 1N33Q 2NN6I 4LWCA 1X3EA 2XGTA 1E3PA 4A3KH 1E7ZA 5M5YH 1K83H 2E5LL 4BA2I 2PI2E 4X6AH 3PCOB 1VQCA 4EQ5A 4DV3L 3S2DH 4JI0L 4HIDA 1KRSA 3A5ZB 3S15H 4R4CA 1PH7A 4GOPA 3T1HL 2K75A 1S40A 5BR8Q 4A3JH 4NXNL 1VQNA 4NXMQ 4A3BG 4MZ9A 1DGSA 4A3GH 2GN5A 4B3TQ 5C44G 2PI2A 2RF4A 2WB1E 2YU9H 2L15A 2Y0SE 3PIOA 4DR2L 4KI0A 4DV2Q 3NEMA 3UDGA 1EFWA 2WFWA 5IYCG 2YTVA 1KQSA 1XNQL 1HNZQ 4PZ7A 1X65A 2A19A 3PO3H 1VQMA 3H0GH 3STBD 3K0XA 4GN4B 4YCWA 1HNXQ 4JI3Q 1EQRA 5IYBG 1AH9A 1Q1EA 1V9PA 1Q12A 1RIPA 3KYHC 3RN5A 1N36Q 1Q46A 1HNWL 4DUZL 3IRBA 4IPCA 1X54A 1VQAA 4A4IA 4BA1I 1I3QH 4X64L 4HJ8A 2UUCL 5C0XJ 4OWXB 2ZM6Q 1Q1BA 3I7FA 1N32L 1MJEA 2K4KA 2JEBI 4H02A 4JI2L 4LF9Q 3GTOH 4DR6Q 1IBLL 2IY5B 4HIOA 2MQHA 3AFPA 5K36G 1YIJA 1FJGQ 4X65L 2KENA 2YV5A 1SE8A 5M3FH 4B3RQ 2KCMA 1KXLA 4KLKA 3KF6B 4B3MQ 4POFA 2LXKA 1PH5A 4JBKA 4JI4Q 4DV7L 5EAYA 2VQFL 4BY1H 1QZGA 2R7ZH 2PQAA 1HR0L 1E1TA 3UDFA 5IYDG 2GVBA 4QQBX 1TWCH 1N9WA 2B63G 2HHHQ 3L2PA 3E0EA 1X56A 2CKZB 5FJ8H 1QUQB 3RZOH 3K8AA 3HOVG 2WAQG 4NPSA 3F2DA 1VQHA 4JOIC 1BVSA 3G71A 5JJKA 1HZBA 3I4MH 1PYBA 5AJ3Q 3CCVA 4APVA 4OX9Q 4DV5L 4IOCA 4FDBA 2K5VA 4JG2A 2V1CC 1Z9FA 1L0WA 2ZTEA 3I55A 3S24A 3ULPA 1B70B 4DK6C 3A5UA 4GNXB 2NVQH 3CD6A 1Z47A 3S14H 4BY7G 2IT1A 4OO1I 1PH6A 1X55A 5LMNW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJV A;  3RLO A;  2K5H A;  2AKW B;  2FXQ A;  4LF6 L;  2JA8 G;  4R4O A;  5FLM G;  4L5T A;  3LGJ A;  2KBN A;  5E7N A;  5GAH C;  2JA6 H;  1W2B A;  3HOU H;  1PVO A;  4GOP B;  3CAM A;  2VW9 A;  2E2I H;  4DV6 Q;  1Y1V H;  2AWO A;  4R4T A;  2JE6 I;  3BU2 A;  1I6H H;  4O2D A;  2IHF A;  3H15 A;  1Q8K A;  4C3I H;  2R7F A;  4AIM A;  1G51 A;  2ALY B;  3PO2 G;  3J81 i;  3CCJ A;  4B3S Q;  2IHE A;  2IX0 A;  4P72 A;  2OQ0 A;  2R6G A;  2JK8 A;  2JJQ A;  3HKZ G;  4DK3 C;  2WAQ E;  1Y1W G;  1J6Q A;  4DV2 L;  4BXX G;  3S2H H;  3CCR A;  1D8L A;  3TRZ A;  4JI1 Q;  4A3B H;  2K14 A;  1TWF H;  5IT9 c;  5M5W H;  4AYB G;  5C44 H;  1VQ7 A;  1VQE A;  3MEF A;  1GM5 A;  3E9H A;  3GTM H;  5C4X G;  4GLX A;  4DUY L;  2Q2T A;  4OWT B;  1HNX L;  2A8V A;  2UU9 Q;  4JI3 L;  2N3S A;  4DR5 Q;  1N8R C;  4KHP L;  1BBU A;  2JA5 G;  4Y7N H;  1WFQ A;  4A75 A;  2R93 H;  1Q86 C;  3Q8D A;  3ERS X;  4YWK A;  1HH2 P;  2C35 B;  2NZO A;  1N36 L;  1L2F A;  1XPO A;  4OWW B;  3L0O A;  5IYB H;  2ZM6 L;  1K8G A;  5HGQ A;  1YBY A;  5C0X I;  4IO9 A;  1AE2 A;  2EIF A;  3H3V H;  5C3E G;  4DV4 Q;  1L1O A;  1WYD A;  3PUW A;  4GN5 A;  1YJW A;  4LF9 L;  3OTO L;  5M3M G;  3PSI A;  4DR6 L;  2ZJQ A;  3U4V A;  4LF5 L;  1FJG L;  4HJ9 A;  1EYG A;  2HIX A;  4AQY Q;  3J81 j;  2UUB Q;  1PV4 A;  4B3R L;  1CKN B;  2PMZ E;  2PQA B;  4DV0 L;  2VS1 A;  4B3M L;  4P74 A;  4QY7 A;  4YHH Q;  1UE7 A;  3HKZ E;  4KHZ A;  4YCV A;  1XMQ Q;  1K73 C;  4JI4 L;  4JBJ A;  4IPH A;  3OYY A;  1YIT A;  1YVC A;  3K80 C;  4EX5 A;  3CCU A;  4A3E G;  1M1K C;  1XPU A;  4DR4 Q;  1JJG A;  2WP8 J;  4AYB E;  2HHH L;  1PFS A;  4R4I A;  4RMF A;  1WJJ A;  2LSS A;  5H1S E;  4L5Q A;  2N8N A;  4X66 Q;  1ASY A;  4A3D G;  2F4V Q;  2ZTD A;  3GTG H;  5IYD H;  4GOP C;  3CCE A;  2B63 H;  1YHA A;  1EQQ A;  3M85 A;  4LFB Q;  1KL9 A;  3UDI A;  1JJC B;  5AJ3 L;  3NEN A;  4JI7 Q;  4A3I G;  1WI5 A;  4A3C G;  2QGQ A;  2CWP A;  1CSP A;  3FP9 A;  4C3J H;  5IP7 G;  3HOV H;  3F2C A;  2I0Q A;  1SRO A;  5JEA J;  3TRE A;  1OXX K;  4LFA Q;  1MIU A;  4RG1 A;  5GRO A;  3CCL A;  3PF5 A;  5JJI A;  2E2H H;  4IOA A;  1NJI C;  3A0J A;  2NVY H;  1PYS B;  4LUV A;  3W1B A;  2VY3 A;  4LF4 L;  1PH1 A;  3HOW G;  1LTL A;  1S3O A;  4GS3 A;  4BBR G;  3J7Z C;  3CCS A;  3JAM c;  3J80 c;  4BY7 H;  3HOY G;  1G29 1;  3B6Y A;  3ER0 A;  1J5E Q;  4DV6 L;  1R9T H;  5IWA Q;  1H95 A;  4PG3 A;  2JA8 H;  1Q82 C;  5FLM H;  2OTJ A;  2UUA Q;  4IFD G;  1NTG A;  4L5R C;  1PHJ A;  1XTD A;  4PMW A;  1WCM H;  1I94 Q;  4QGU A;  1T9H A;  4J15 A;  4LNQ A;  3PO2 H;  1X3F A;  3S16 H;  1JE5 A;  5IY0 A;  4JI1 L;  2Z0S A;  2I5H A;  1WOC A;  2IX1 A;  2N78 A;  4DAY B;  4LF7 Q;  2R92 G;  4PZ8 A;  4TQU S;  4HIK A;  3I4N H;  1SRU A;  4A93 G;  5ELO A;  1Y1W H;  2ZTC A;  3G4S A;  3S17 H;  4BXX H;  2UU9 L;  4DR5 L;  1P16 A;  2Z6K C;  4UP9 A;  1E1O A;  2I5L X;  1PH9 A;  4GKK Q;  1TWA H;  3F1Z A;  4JV5 Q;  1K3R A;  4DR7 Q;  4X62 Q;  3I2Z A;  1L1O B;  4P75 A;  1N34 Q;  1B8A A;  1GVP A;  1VQB A;  1MKH A;  3M3Y H;  4MNO A;  1X3G A;  4C3H H;  3K81 C;  3CPW A;  3ICE A;  4YWM A;  2NVT H;  1YZ6 A;  5M5X H;  3KFU A;  4JBW A;  3KDF A;  4DV4 L;  1E24 A;  1K9M C;  4LUZ A;  4DR3 Q;  2VL6 A;  3ULJ A;  1VQ6 A;  1NE3 A;  1UE6 A;  1VQD A;  2HIV A;  4A3K G;  1VQ4 A;  3GTJ H;  1XNR L;  1ASZ A;  2KHI A;  3CF5 A;  2UXC Q;  3TQY A;  5C3E H;  2UUB L;  1YI2 A;  4GKJ L;  1LUZ A;  3TEH B;  3PIP A;  4YHH L;  3CC4 A;  2ES2 A;  1XMQ L;  2UXD Q;  3UDX A;  3H3V I;  2MO1 A;  1NY4 A;  2NZH A;  4DV3 Q;  4A3G G;  2ZJP A;  4JI0 Q;  1N33 L;  3PUV A;  1G6P A;  3CMA A;  4DR4 L;  1QVG A;  4QJF A;  5HY6 A;  1UE1 A;  3T1H Q;  1SLJ A;  4WJ3 M;  3CCM A;  4BBS G;  3AFQ A;  5C0X G;  4ALP A;  1Q81 C;  4LW1 A;  3PUZ A;  4X66 L;  2RHQ B;  2VQE Q;  2F4V L;  4A3E H;  3PO3 G;  3RLF A;  3K7A H;  2OQK A;  5BR8 L;  4DR2 Q;  4NXM L;  3FKI G;  4UPA A;  4UP8 A;  4B3T L;  4UP7 A;  2CWA A;  1KRT A;  3JC6 6;  4JI7 L;  4HJ5 A;  4IJH A;  3CC7 A;  1A8V A;  1LYL A;  1C0A A;  3KF8 B;  4LFA L;  3AQQ A;  1YNX A;  1HNZ L;  1GD7 A;  5FLX c;  2B29 A;  1YEZ A;  2NN6 G;  1A63 A;  4JI6 Q;  4YY3 Q;  3HFZ B;  4DKA C;  5IYC H;  3G6E A;  2F3I A;  4JI5 Q;  2NVX H;  4P71 A;  3E9I A;  3CPF A;  4R4Q A;  2UXB Q;  1I5F A;  1CKM A;  3RR5 A;  2DGY A;  5M3F G;  1J5E L;  2E2J H;  3EN2 A;  5IWA L;  3HOW H;  2Q2H A;  5JJL A;  3W5O A;  4XIG S;  2OWO A;  1D7Q A;  4BBR H;  2UUA L;  3BZK A;  1L1O C;  2VZA A;  4BY1 G;  2ID0 A;  3CQZ H;  2JA7 G;  2OCE A;  2R7Z G;  1I94 L;  1SR3 A;  4GLV B;  1M90 C;  1OXT A;  4OON A;  3J80 i;  3JAM i;  4HJ7 A;  1PH2 A;  1CUK A;  3HOX G;  4DV7 Q;  4AH6 A;  2LXJ A;  4O0A A;  1SMX A;  1VS0 A;  3U50 C;  4GLA C;  1SN8 A;  3AEV A;  1NBW A;  1HR0 W;  1K0R A;  4A3M G;  4GNX C;  1IBK Q;  2YYZ A;  4QL5 A;  3U4Z A;  3RNU A;  2PNH A;  4A3F G;  2DUD A;  1FGU A;  4A3L G;  3EIV A;  2BH8 A;  4GKK L;  2K52 A;  2R92 H;  4JYA Q;  1E22 A;  4JV5 L;  4DR7 L;  4IFD J;  3PV0 A;  3M9B A;  4LFC Q;  3A74 A;  4DV5 Q;  1VQP A;  3I56 A;  3G48 A;  3PF4 A;  3PUY A;  4R1J A;  3GTK H;  3WWV A;  1QVC A;  1VQJ A;  3AYH B;  4DR3 L;  3GTL H;  3GD7 A;  4GN3 B;  5J3B A;  2VUM G;  2MO0 A;  4JBM A;  5IE8 A;  3OW2 A;  4DPG A;  5GAE C;  1Y1V G;  2UXC L;  2KHJ A;  1X6O A;  1YJ9 A;  3HKS A;  5DLQ E;  4LF6 Q;  5GQO A;  3D31 A;  3F2B A;  1AE3 A;  1XPR A;  4OX9 L;  1HZ9 A;  1RL2 A;  3BZC A;  4WJ4 A;  4TVA B;  3M4P A;  2UXD L;  2MNA A;  1KHI A;  1VCI A;  4JC0 A;  1UEB A;  4IPD A;  4LF8 Q;  3EBE A;  4DR1 Q;  1S72 A;  1C7Y A;  4C2M H;  5LMU Q;  1VQ9 A;  3VDY A;  2VNU D;  4QIW E;  1IXR A;  2OTL A;  1HJP A;  3T1Y Q;  4IPG A;  5IP9 G;  2VQE L;  1KD1 C;  3S1Q H;  2BA0 A;  4B3S L;  3FHW A;  3DLL A;  1I50 H;  2CFM A;  4DV1 Q;  1YHQ A;  2D0O A;  4BBS H;  1IBM Q;  2R93 G;  1OXU A;  4OO1 G;  2K5N A;  1IYJ B;  1QZH A;  4K0K Q;  2E8G A;  4DUY Q;  3FKI H;  3STB C;  4OXP A;  1TXY A;  4KHP Q;  4MTN A;  1P8L A;  1CKO A;  1FL0 A;  3L7Z C;  1JMC A;  4YCU A;  1FVI A;  3D0F A;  3NEL A;  3UE1 A;  4YY3 L;  4JI6 L;  4L5S A;  2ZJR A;  4LUO A;  2H5X A;  2YTX A;  3CXC A;  4JI8 Q;  1XMO Q;  4JI5 L;  3J7A 5;  2UXB L;  1EIY B;  5C4X H;  2AWN A;  1YHB A;  3HOZ G;  3M7N A;  3OTO Q;  3W1G A;  2JA5 H;  3PUX A;  4LF5 Q;  4HJA A;  1PH4 A;  3DM3 A;  1VQF A;  1KC8 C;  1VQL A;  2EQS A;  1U5K A;  3KJO A;  1IL2 A;  4PZ6 A;  4DV0 Q;  1HZA A;  3GO5 A;  1JT8 A;  5C4J H;  4DNI A;  2D62 A;  4NB3 A;  5JEA G;  1MJC A;  5LMN Q;  2JQO A;  4AQY L;  3S1R H;  2EXD A;  1CKN A;  3CW2 C;  1KAW A;  1VQK A;  1TWG H;  2HQL A;  5M3M H;  2ATW A;  2Z6K A;  1OTC A;  2JA7 H;  3KOJ A;  3ULL A;  2E5L Q;  4A3J G;  1K8A C;  1A62 A;  5GAG C;  5GAD C;  1IBK L;  1BKB A;  2AHO B;  2JEA I;  3HOX H;  1W3S A;  2QEX A;  1OXS C;  4JYA L;  4JOI A;  2AMC B;  3KJP A;  4NXN Q;  2A1A A;  3SGI A;  4A3M H;  3CCQ A;  4LFC L;  1PH8 A;  4A3F H;  4IFD I;  4A3L H;  4UY8 C;  1QVF A;  3H0G G;  3RZD H;  2R7D A;  4LFB L;  1IZ6 A;  1VQ5 A;  1XNQ Q;  2I5M X;  1PA6 A;  4A3D H;  2Q2I A;  4IJL A;  1SFO H;  3CC2 A;  2B3G A;  3ZJY C;  1CSQ A;  4LF4 Q;  3RLN A;  4POG A;  1V1Q A;  2K50 A;  3S1N H;  4A3I H;  1UWV A;  3RN2 A;  4A3C H;  1HNW Q;  4DAM A;  4DUZ Q;  2VUM H;  5IP7 H;  3TS2 A;  2UUC Q;  1WCM G;  1B7Y B;  4X64 Q;  1VQ8 A;  4LF8 L;  1NMF A;  2XTI A;  4DR1 L;  1N32 Q;  1PH3 A;  3F8T A;  5LMU L;  4ME3 A;  1Q7Y C;  2HT1 A;  1A0I A;  2D0P A;  2KCT A;  4JI2 Q;  4A93 H;  1X9N A;  1IBL Q;  1KIX A;  2MFI A;  3T1Y L;  4JCV E;  2CQO A;  3I4N G;  3NBH B;  4X65 Q;  3TS0 A;  3HOY H;  3GDE A;  1EWI A;  1EOV A;  1V43 A;  4DV1 L;  2QA4 A;  2CCZ A;  1Y14 B;  1LM0 A;  3UE0 A;  1YJN A;  1IBM L;  2YTY A;  4P73 A;  5ELN A;  1UE5 A;  1VQG A;  1GO3 E;  1VQI A;  5IP9 H;  2RHS B;  3CME A;  3I4O A;  4K0K L;  2VQF Q;  2BH2 A;  5FJ8 G;  2GVA A;  1HR0 Q;  3KF6 A;  3GTP H;  4LF7 L;  3BJU A;  1HZC A;  1EUJ A;  2JA9 A;  3K7U C;  1NMG A;  3I4M G;  2ASB A;  3KLW A;  3PGZ A;  3MXN B;  2WB1 G;  2BA1 A;  3U58 A;  3S1M H;  2N49 A;  2Y0S G;  1GKH A;  4JI8 L;  1XMO L;  4A76 A;  3M4Q A;  4HIM A;  4X62 L;  3KDF B;  1EIF A;  4XTC S;  1N34 L;  1BBW A;  3GTQ H;  1QUQ A;  1C9O A;  1XNR Q;  1U0L A;  4YWL A;  2F52 A;  4GKJ Q;  4Y52 H;  1JB7 A;  3M4O H;  2JA6 G;  1TWH H;  3J81 c;  1VQO A;  3HOU G;  3HOZ H;  1JJ2 A;  3CP0 A;  5LMN L;  4GNX A;  2Q2U A;  1O7I A;  2RCN A;  1OXV A;  1N33 Q;  2NN6 I;  4LWC A;  1X3E A;  2XGT A;  1E3P A;  4A3K H;  1E7Z A;  5M5Y H;  1K83 H;  2E5L L;  4BA2 I;  2PI2 E;  4X6A H;  3PCO B;  1VQC A;  4EQ5 A;  4DV3 L;  3S2D H;  4JI0 L;  4HID A;  1KRS A;  3A5Z B;  3S15 H;  4R4C A;  1PH7 A;  4GOP A;  3T1H L;  2K75 A;  1S40 A;  5BR8 Q;  4A3J H;  4NXN L;  1VQN A;  4NXM Q;  4A3B G;  4MZ9 A;  1DGS A;  4A3G H;  2GN5 A;  4B3T Q;  5C44 G;  2PI2 A;  2RF4 A;  2WB1 E;  2YU9 H;  2L15 A;  2Y0S E;  3PIO A;  4DR2 L;  4KI0 A;  4DV2 Q;  3NEM A;  3UDG A;  1EFW A;  2WFW A;  5IYC G;  2YTV A;  1KQS A;  1XNQ L;  1HNZ Q;  4PZ7 A;  1X65 A;  2A19 A;  3PO3 H;  1VQM A;  3H0G H;  3STB D;  3K0X A;  4GN4 B;  4YCW A;  1HNX Q;  4JI3 Q;  1EQR A;  5IYB G;  1AH9 A;  1Q1E A;  1V9P A;  1Q12 A;  1RIP A;  3KYH C;  3RN5 A;  1N36 Q;  1Q46 A;  1HNW L;  4DUZ L;  3IRB A;  4IPC A;  1X54 A;  1VQA A;  4A4I A;  4BA1 I;  1I3Q H;  4X64 L;  4HJ8 A;  2UUC L;  5C0X J;  4OWX B;  2ZM6 Q;  1Q1B A;  3I7F A;  1N32 L;  1MJE A;  2K4K A;  2JEB I;  4H02 A;  4JI2 L;  4LF9 Q;  3GTO H;  4DR6 Q;  1IBL L;  2IY5 B;  4HIO A;  2MQH A;  3AFP A;  5K36 G;  1YIJ A;  1FJG Q;  4X65 L;  2KEN A;  2YV5 A;  1SE8 A;  5M3F H;  4B3R Q;  2KCM A;  1KXL A;  4KLK A;  3KF6 B;  4B3M Q;  4POF A;  2LXK A;  1PH5 A;  4JBK A;  4JI4 Q;  4DV7 L;  5EAY A;  2VQF L;  4BY1 H;  1QZG A;  2R7Z H;  2PQA A;  1HR0 L;  1E1T A;  3UDF A;  5IYD G;  2GVB A;  4QQB X;  1TWC H;  1N9W A;  2B63 G;  2HHH Q;  3L2P A;  3E0E A;  1X56 A;  2CKZ B;  5FJ8 H;  1QUQ B;  3RZO H;  3K8A A;  3HOV G;  2WAQ G;  4NPS A;  3F2D A;  1VQH A;  4JOI C;  1BVS A;  3G71 A;  5JJK A;  1HZB A;  3I4M H;  1PYB A;  5AJ3 Q;  3CCV A;  4APV A;  4OX9 Q;  4DV5 L;  4IOC A;  4FDB A;  2K5V A;  4JG2 A;  2V1C C;  1Z9F A;  1L0W A;  2ZTE A;  3I55 A;  3S24 A;  3ULP A;  1B70 B;  4DK6 C;  3A5U A;  4GNX B;  2NVQ H;  3CD6 A;  1Z47 A;  3S14 H;  4BY7 G;  2IT1 A;  4OO1 I;  1PH6 A;  1X55 A;  5LMN W; 
#chains in the Genus database with same CATH topology
 3S16 B;  3DMU A;  3NHH A;  5IT9 E;  2EYF A;  3DM1 A;  5E7N A;  1PVO A;  1TVX A;  1ENF A;  2IHF A;  1TWA B;  2K28 A;  4AIM A;  1G51 A;  2ALY B;  3J81 i;  3GV6 A;  1ENC A;  2IHE A;  3W3A A;  4P72 A;  2R6G A;  3BZD B;  2EVB A;  4KTA A;  4OIJ A;  4DK1 A;  4R9W A;  4DK3 C;  5CGK A;  5M5X B;  1Y1W G;  4FXD A;  3QB3 A;  1J6Q A;  4DV2 L;  1B44 D;  1K8O A;  4X3T A;  2Y0S B;  3HGB A;  5E1F A;  1GM5 A;  5C4X G;  1U4M A;  5C3E B;  2F0L A;  4DUY L;  1HNX L;  2A8V A;  2UU9 Q;  4DR5 Q;  2N3S A;  1BBU A;  2NB0 A;  4RA8 A;  2R93 H;  3KLS A;  1CTM A;  4XQJ A;  1N36 L;  3TP6 A;  1L2F A;  1A2U A;  5BN3 A;  3L0O A;  3DUZ A;  2ZM6 L;  3H3V H;  4IO9 A;  1I6H B;  4C1N I;  3U4V A;  3VYR A;  2MHV A;  4HJ9 A;  4K5X A;  4NMZ A;  2UUB Q;  3D8G A;  3K6O A;  1CKN B;  4P74 A;  4YHH Q;  1UE7 A;  2J4X A;  2TMP A;  3SK5 A;  1TWF B;  1YVC A;  1QWY A;  5C44 B;  3CCU A;  1XPU A;  4AYB E;  3LX0 A;  5I4D A;  4X66 Q;  4FF3 A;  3DEO A;  4RWS C;  1KL9 A;  2IPK D;  1JJC B;  3NEN A;  4JI7 Q;  2B2T A;  4A3C G;  2CWP A;  1JCK B;  1X3P A;  5LHY 1;  1BNZ A;  5IGC A;  2E2H H;  1NJI C;  3W1B A;  1PYS B;  4GS3 A;  1S3O A;  3CCS A;  1O7Z A;  4N9T A;  4XYQ A;  1SNO A;  2JA8 H;  4LMQ D;  1PZJ D;  3ITP A;  5FLM H;  2FFK B;  1XTD A;  4MN3 A;  3NSW A;  4S3S A;  1T9H A;  4J15 A;  4KKT A;  2F4I A;  3GTL B;  3T53 B;  1WOC A;  4EVO A;  4C3J B;  3I4N H;  3FPU B;  5ELO A;  3S9W A;  2ZTC A;  1UNS A;  1PH9 A;  2NBF A;  1WD1 A;  1K3R A;  3CU7 A;  1PZI D;  4X62 Q;  3K58 A;  4P75 A;  1N34 Q;  1GVP A;  1SYF A;  3BVM A;  3KFU A;  3KBX A;  1YZ6 A;  2L5T A;  3EFX D;  1CHP D;  2PZT A;  1E24 A;  3KDF A;  4JBW A;  4DV4 L;  3ULJ A;  1NE3 A;  4U68 A;  3GTJ H;  1GUG A;  1XNR L;  5IOC A;  1VDZ A;  4NDX A;  4GKJ L;  3T13 A;  1LUZ A;  3TEH B;  1STB A;  3K57 A;  1CA6 A;  4XDX A;  1SXT A;  3SVM A;  1XMQ L;  2UXD Q;  4G4K A;  3H3V I;  1N33 L;  4JI0 Q;  3PUV A;  3CMA A;  4ZKB B;  4WJ3 M;  1SLJ A;  3AFQ A;  4ALP A;  1Q81 C;  3PUZ A;  2F4V L;  4HR7 B;  4RGN A;  4DR2 Q;  3T16 A;  4UPA A;  4UP8 A;  5I2X A;  3QO2 A;  3MFY A;  1IYU A;  3CC7 A;  2O2L D;  3A8J E;  3BDO A;  2NN6 G;  4FO2 A;  3Q22 A;  3ERQ A;  5M3M B;  2F3I A;  2NVX H;  4R4Q A;  1AW7 A;  1I5F A;  1PTO H;  2DGY A;  1IHZ A;  1YNN C;  3J81 L;  2Q2H A;  4XIG S;  3BG3 A;  2UUA L;  2RCF A;  1GUW A;  1L1O C;  1F9R A;  1EYD A;  2VZA A;  4BY1 G;  1I94 L;  5DNF A;  2SNM A;  3CHB D;  1SYB A;  2LFN A;  1X32 A;  1M90 C;  1IYV A;  4HJ7 A;  4IFD H;  1PH2 A;  1CUK A;  3P1H A;  4O0A A;  3J81 E;  1SMX A;  5ISR A;  2KUM A;  1HR0 W;  1K0R A;  4GNX C;  4A3F G;  2DUD A;  1FGU A;  4GKK L;  2K52 A;  4JYA Q;  4IFD J;  3M9B A;  3URY A;  3K5L A;  4LFC Q;  2F03 A;  3I56 A;  1FGB D;  1TS5 A;  3PF4 A;  3PUY A;  1AZQ A;  2E2J B;  3WWV A;  1EZ6 A;  4DR3 L;  1JOR A;  3ND8 A;  1NSN S;  4K6D A;  5J3B A;  4K6L A;  4CHT B;  2VUM G;  3SXH A;  5IE8 A;  4DPG A;  1U9R A;  2KHJ A;  2XRS D;  5DLQ E;  5GQO A;  3G7L A;  3GQB A;  4WJ4 A;  2CVR A;  2Z6B A;  2MNA A;  4IPD A;  2C5C A;  4C2M H;  2C9O A;  2P5Z X;  3I91 A;  3T1Y Q;  2R92 B;  3MXP A;  1KD1 C;  5DEH A;  2BA0 A;  3BDL A;  4BBS H;  1IBM Q;  4X3K A;  4OO1 G;  3NBH A;  1C48 A;  1IYJ B;  1DJR D;  2D5D A;  5TSS A;  3FKI H;  1SND A;  1CKO A;  3U9S A;  3IAY A;  3CKI B;  5C4Z A;  2B2U A;  1JMC A;  2HDM A;  3NEL A;  5HUR A;  4YY3 L;  4L5S A;  4K8I A;  4DGZ A;  2ZJR A;  4ZK9 B;  3I90 A;  1XMO Q;  4JI5 L;  1KDA A;  3K5M A;  5E3F A;  3S2D B;  1YHB A;  5CR3 A;  3A7A B;  4LF5 Q;  2L55 A;  1HQR D;  1VQF A;  1KC8 C;  3QOJ A;  4I65 A;  3VR4 A;  5CV8 A;  3S1Q B;  2L0C A;  3SK6 A;  1HZA A;  1HCZ A;  5EQ0 A;  5C4J H;  2NVT H;  1EY7 A;  3SK8 A;  2ATW A;  4RFB A;  2XRQ D;  3KOJ A;  5GAG C;  1IBK L;  4ZAI A;  4FXG C;  3AB9 A;  4F87 A;  3HOX H;  2JXM B;  1O7Y A;  1OO9 B;  2AMC B;  4A3M H;  3CCQ A;  2O4X A;  1I6V C;  1PH8 A;  4IFD I;  4A3L H;  3OIQ A;  5A2Q L;  1HFG A;  1STH A;  5A35 A;  3QG1 A;  1S4Z A;  2I5M X;  2B2W C;  4IJL A;  3CC2 A;  2K6A A;  2B3G A;  4POG A;  2EYO A;  1UWV A;  5A2Q E;  4G7Z C;  4DUZ Q;  1WCM G;  1TWG B;  4X64 Q;  2F0K A;  4DR1 L;  1QIL A;  1N32 Q;  4HCE A;  1YNN D;  4X3U A;  2XIW A;  5LMU L;  1Q7Y C;  2HT1 A;  1A0I A;  2FJ2 A;  2KCT A;  1X9N A;  3TN2 A;  1B9N A;  2WAC A;  3NBH B;  4PMC A;  3HOY H;  3I4M B;  1V43 A;  1Y8P B;  2CCZ A;  1I4G A;  1LM0 A;  1YJN A;  4P73 A;  3DHQ A;  4DN4 M;  1GO3 E;  4K0K L;  1LTG D;  1MSH A;  3I70 A;  1NMG A;  1XTC D;  2QW7 A;  5C4H A;  2Z1C A;  3MXN B;  2BA1 A;  2Y0S G;  1GKH A;  2K33 A;  4XTC S;  3GTQ H;  5KYI A;  1J9O A;  1C9O A;  1GXD C;  1BO0 A;  2CHB D;  4Y52 H;  3M4O H;  1TWH H;  3SDZ A;  3CP0 A;  4WJW A;  5LMN L;  1OXV A;  2Z9H A;  3TBI B;  4CDE C;  2XGT A;  4A3K H;  1E7Z A;  1K83 H;  4UHV A;  2E5L L;  2PI2 E;  4CDF C;  3I73 A;  3GTP B;  5EPL A;  1EY8 A;  2R93 B;  3A5Z B;  4PMB A;  2Q8T A;  4GOP A;  1BR9 A;  2K75 A;  5BR8 Q;  3BDC A;  3F2U A;  4FF4 A;  4B3T Q;  5C44 G;  3OWE B;  2YU9 H;  2L15 A;  4C1N K;  4DNT B;  5IYC G;  2PPB C;  4CBV A;  3DWA A;  3PO3 H;  2BE5 D;  3H0G H;  4YCW A;  2ZXR A;  2Z8L A;  4JI3 Q;  1EQR A;  5IYB G;  3T56 B;  3VYS A;  3E5S A;  1K0S A;  3RN5 A;  1HNW L;  1BCP B;  4X3S A;  4A4I A;  3VYT A;  2A5H A;  3I7F A;  1MJE A;  3HRZ C;  3NWS A;  4ME5 A;  4H02 A;  4JI2 L;  1FNU A;  3EVQ A;  5KRU A;  5CV4 A;  1BOS A;  2YV5 A;  4QF4 A;  3TDQ A;  5HGT A;  5M3F H;  2Z4I A;  3HZX A;  4POF A;  3GV3 A;  5EBC A;  2E74 C;  4JPB W;  5EAY A;  2VQF L;  3H94 A;  2PQA A;  1S5F D;  3UDF A;  2E2H B;  2K5D A;  3A8I E;  4H7B A;  4HED A;  2J0T D;  3RZO H;  4C3J G;  3F2D A;  1LAC A;  4JOI C;  1I3Q B;  4DXG A;  1PXU A;  3G71 A;  5BN4 A;  5EBD A;  2QF7 A;  4APV A;  1ESR A;  1SYG A;  3E0J A;  2BDO A;  3S24 A;  4DK6 C;  3S14 H;  2BOS A;  5COY A;  3J7A V;  1JOK A;  3M4Y A;  2AKW B;  2F0P A;  4R4O A;  1I4P A;  3LGJ A;  3I4N B;  3HOU H;  1CFM A;  4GOP B;  3CAM A;  1Y1V H;  4R4T A;  1TII D;  4O2D A;  3H15 A;  1MSG A;  1Q8K A;  1T5E A;  3KUP A;  2IX0 A;  1LLR D;  2JK8 A;  4IUN A;  2EY2 A;  4F8M A;  1Z7T A;  4BXX G;  2IW3 A;  4JI1 Q;  2K14 A;  2WB1 B;  5IT9 c;  1O80 A;  3GTJ B;  5M5W H;  1G91 A;  1RHP A;  5FK9 C;  1VQE A;  3MEF A;  4CJ2 C;  3E9H A;  4GLX A;  3DEP A;  4OWT B;  1N8R C;  3OWF A;  5CC4 A;  4KHP L;  4Y7N H;  4A75 A;  2PW7 A;  3ERS X;  2C35 B;  1EFI D;  2A6H C;  1XPO A;  4V19 0;  2JA6 B;  4OEM B;  1WD0 A;  1K8G A;  1ML0 D;  2EIF A;  2B8F A;  2D9U A;  1BQQ T;  2E75 C;  4C3I B;  1TS3 A;  1YJW A;  5M3M G;  1RD9 D;  3SK4 A;  1FJG L;  3GP7 A;  2HIX A;  4B3R L;  3J80 L;  2PQA B;  2QEJ C;  3HKZ E;  1LT3 D;  4QUC A;  4JI4 L;  1D1I A;  4KJN A;  3C1E A;  3GTM B;  3BYT B;  1SDF A;  2HHH L;  1PFS A;  2F0G A;  5JEA H;  1WJJ A;  2LSS A;  5H1S E;  3PIO 3;  4L5Q A;  2N8N A;  2NVX B;  2ZTD A;  3GTG H;  3N6R A;  5EKI A;  2Z4H A;  2HD3 A;  2B63 H;  4M8A A;  4LFB Q;  1SE4 A;  4N9P A;  1WI5 A;  3HOV H;  5IP7 G;  5JEA J;  1OXX K;  4RG1 A;  5JJI A;  1F9Q A;  3SHL A;  2NVY H;  5JJL A;  2L4N A;  3J7Z C;  3JAM c;  4J8Q A;  4BY7 H;  1B2T A;  3ER0 A;  1J5E Q;  5I9O A;  1BUV T;  2JYO A;  5IWA Q;  1QE6 A;  4PMW A;  4HN7 A;  1ZXT A;  4LNQ A;  2BCO A;  3MFG A;  4WRD A;  5C3X A;  2AQ3 B;  2PQE A;  2KEC A;  4K14 A;  5IY0 A;  1FR3 A;  1B9M A;  4DAY B;  2R92 G;  2KJX A;  4PZ8 A;  3AMU A;  1QG7 A;  1Y1W H;  3G4S A;  3S17 H;  2UU9 L;  4DR5 L;  4DR7 Q;  1B8A A;  2G5D A;  4C2M B;  4R8N A;  1K9M C;  1GHJ A;  4EGV A;  2VL6 A;  1VQ6 A;  2HIV A;  2PO4 A;  1G2S A;  3M7G A;  1ASZ A;  4OIK A;  2F3W A;  1UUP A;  2LS0 1;  2UUB L;  4I7Z C;  3D4D A;  1YI2 A;  2QKI C;  2WIN B;  4YHH L;  3CC4 A;  3PO2 B;  1V1P A;  4ZKC B;  3UDX A;  1AP0 A;  2F0W A;  4RH6 A;  1R4Q B;  2L9H A;  2ZJP A;  2PNR C;  2XWB B;  1KNE A;  4QJF A;  3CCM A;  4X66 L;  4AYB B;  2RHQ B;  3OMC A;  2VQE Q;  3RLF A;  3K7A H;  4DK0 A;  1PFN A;  2RDH A;  4C3H B;  2CWA A;  1KRT A;  3JC6 6;  1GOZ A;  4JI7 L;  1LYL A;  2IWH A;  3KF8 B;  1YNX A;  4KV6 A;  3TP7 A;  1HNZ L;  1GD7 A;  5FLX c;  1PFB A;  2B29 A;  5C4J B;  4JI6 Q;  3HFZ B;  1DZ1 A;  3I72 A;  2A6H D;  4PQX A;  2EYM A;  1CKM A;  1BDO A;  3CRK C;  3ZYY X;  1HUM A;  2OWO A;  1M4V A;  1SJH D;  1O7L A;  2ID0 A;  3CQZ H;  4A3E B;  1SR3 A;  5ELB A;  4OON A;  4Q0F A;  4BS9 A;  4EQP A;  2LXJ A;  4GLA C;  1SN8 A;  5K36 H;  2V4D A;  3MA2 B;  3RNU A;  3EIV A;  2R3Z A;  2ENB A;  4MIU A;  4JK1 C;  5C5L A;  1Q90 A;  3VA5 A;  5IIF A;  1SMY D;  3PV0 A;  4OHJ A;  3FVQ A;  4DFA A;  3A74 A;  1VQP A;  3BVG A;  3GTK H;  1QVC A;  2HUG A;  5KND A;  3HOW B;  1VQJ A;  2RA4 A;  4G57 A;  4CKC A;  1ILP A;  4BBR B;  4IQZ A;  3HOY B;  2MO0 A;  4JBM A;  1NR4 A;  2PYK A;  2RVL A;  4P2C B;  1V1P B;  4XXE A;  1X3Q A;  3HKS A;  2FMM A;  3F2B A;  3UI2 A;  3BZC A;  1JB3 A;  2G9H D;  1BF4 A;  3M4P A;  2B2V C;  2UXD L;  2A69 D;  1CZW A;  4JC0 A;  4LF8 Q;  2M9V A;  1C7Y A;  1PDQ A;  1I4H A;  2F0M A;  1ICF B;  5JVH 3;  4B3S L;  3FHW A;  2EY5 A;  1I50 H;  4OEL B;  1RTN A;  1SJE D;  3NUC A;  4DV1 Q;  2D0O A;  5M9O A;  1BCP F;  5LL6 S;  2R93 G;  2EY6 A;  2K5N A;  1QZH A;  4DUY Q;  2EYP A;  4MTN A;  1P8L A;  3L7Z C;  4YCU A;  3UE1 A;  1PLF A;  4LUO A;  4A3K B;  1AEX A;  1B1Z A;  3L3O C;  4ID6 A;  3OHX C;  1IKL A;  2NN6 H;  4XT1 B;  4KKU A;  2F0J A;  2JA5 H;  3PUX A;  1KLG D;  4HJA A;  4FP5 D;  3DM3 A;  3H6M A;  3FPP A;  1RJT A;  3SE0 A;  1IL2 A;  5C3W A;  4KN4 C;  1MD2 D;  3GO5 A;  1JT8 A;  4AQY L;  4NB3 A;  4TKO B;  2JQO A;  2EXD A;  5CV5 A;  3ULL A;  3PO3 B;  3NK9 A;  2CH4 W;  5GAD C;  2JEA I;  1OXS C;  3A55 A;  4JYA L;  3KJP A;  1EEI D;  2D2C C;  1F9S A;  4NW2 A;  3SGI A;  5G3L F;  4NXN Q;  1HUN A;  4LFC L;  1KDC A;  4A3F H;  1LT6 D;  4UY8 C;  1QVF A;  1LTS D;  3RZD H;  1II3 A;  1SYC A;  2B8G A;  4U67 3;  2LY7 A;  4BWG B;  1XNQ Q;  4A3D H;  2Q2I A;  5M3F B;  3RLN A;  2K50 A;  3S1N H;  4ZLT F;  1QNK A;  4A3I H;  2CQA A;  3RN2 A;  3RD4 A;  2VUM H;  4ZRZ A;  3TS2 A;  2JA7 B;  3HEJ A;  1NMF A;  2XTI A;  2OF1 A;  4I7A A;  4ME3 A;  3QIA A;  4A93 H;  3RZO B;  3T1Y L;  2CQO A;  5CV7 A;  3I4N G;  4X65 Q;  3GDE A;  4V0B A;  2FHT A;  4RCN A;  4DAV A;  5ELE A;  1IBM L;  2YTY A;  5KNC A;  3DXJ C;  1VQI A;  2HCC A;  1VF7 A;  1D5X C;  3NXW A;  3KF6 A;  4LF7 L;  1SFO B;  2JA9 A;  3K7U C;  4IUR A;  4OO1 H;  4HMI A;  1STE A;  5DM7 3;  2A6E C;  3PGZ A;  5ELD A;  2WB1 G;  3HOU B;  1XMO L;  5DM6 3;  4A76 A;  4HIM A;  1JIC A;  1Y1V B;  2DNC A;  3G6J B;  3KDF B;  3TZD A;  2RDG A;  1TKW B;  2PZW A;  1XNR Q;  2F52 A;  4GKJ Q;  1JB7 A;  2JA6 G;  4KD4 A;  4KY6 A;  3VR3 A;  1CI3 M;  1ROD A;  3K5O A;  4GNX A;  1O7I A;  3C3L A;  4C3I G;  1B50 A;  5M5W B;  1N33 Q;  2NN6 I;  1STA A;  1E3P A;  4BA2 I;  3I4L A;  2Q8R E;  4DV3 L;  2KEE A;  4Y7N B;  4HID A;  1KRS A;  1Q3L A;  1H9K A;  3T1H L;  4FF1 A;  4A3B G;  3C1F A;  3S1M B;  1DGS A;  4A3G H;  2PI2 A;  2B2Y C;  4ILW A;  5C0X H;  1KQS A;  3HG9 A;  4KY5 A;  2LKV A;  2K5W A;  3K0X A;  5IOD A;  3HOZ B;  4RKL A;  3NP8 A;  2EJF C;  4K8J A;  1Q12 A;  3KYH C;  1YNJ C;  1HPC A;  4DUZ L;  4BA1 I;  4X64 L;  5C0X J;  1O78 A;  5IGG A;  1N32 L;  1HHV A;  2MP1 A;  2SDF A;  2JEB I;  1Y8N B;  2RQX A;  3MXG A;  2HQE A;  4IUV A;  4LF9 Q;  3GTO H;  4DR6 Q;  3S15 B;  4HIO A;  3AFP A;  2KCN A;  4MTK A;  2QDL A;  4A3J B;  1KAA A;  5CMD A;  3D4R A;  1SE8 A;  4KLK A;  2I07 B;  3KF6 B;  4B3M Q;  1STY A;  4JBK A;  4DXF A;  5FKA C;  4DV7 L;  2PCF B;  2R7Z H;  1H9S A;  5EKK A;  5IYD G;  2GVB A;  4ZYS A;  3A7L A;  2NVY B;  3NTI A;  2I46 A;  2CKZ B;  1XXG A;  3ONA B;  3R2T A;  2FIN B;  5D14 A;  3K0Y A;  1HZB A;  5AJ3 Q;  3CCV A;  3V05 A;  4DV5 L;  4IOC A;  2RBM A;  1Z9F A;  3I55 A;  2ZTE A;  1B70 B;  1HQM C;  3A5U A;  4GNX B;  2NVQ H;  3CD6 A;  4OO1 I;  2IT1 A;  4FVM A;  1PH6 A;  1X55 A;  1U0L A;  1XJV A;  1MGS A;  4LF6 L;  4KHV A;  3IL8 A;  3NE5 B;  1WTV A;  1EY9 A;  1W2B A;  2VW9 A;  4DV6 Q;  1TS2 A;  2AWO A;  3S17 B;  1R4P B;  3BU2 A;  1I6H H;  2R7F A;  5EKL A;  4HAE A;  1LT5 D;  1CA5 A;  1BCP C;  3PO2 G;  3I3C A;  3WDN A;  1DXM A;  4C56 C;  1Q8I A;  2B2W A;  2WAQ E;  5EJW A;  3TRZ A;  1A3U A;  1TWF H;  4AYB G;  5C44 H;  1GUN A;  1F2M A;  2Q2T A;  4JI3 L;  4C3H G;  1WFQ A;  1MI2 A;  2A6E D;  1SAP A;  5IYB H;  1ONL A;  1LTB D;  1YBY A;  5HGQ A;  5C0X I;  1AE2 A;  3LWE A;  5C3E G;  3KBG A;  1WYD A;  2DN8 A;  3OTO L;  2ZJQ A;  3OSO A;  4CJ0 B;  1EYG A;  1E2V A;  3J81 j;  1PV4 A;  1EQV A;  2X6G A;  5IGB A;  2PMZ E;  1H9S B;  4DV0 L;  2VS1 A;  4QY7 A;  1CQF A;  1BXT A;  4YCV A;  1STG A;  3OYY A;  1YIT A;  3K80 C;  4EX5 A;  4A3E G;  1M1K C;  1JJG A;  4DR4 Q;  2K1B A;  4IUT A;  4R4I A;  4RMF A;  1TS4 A;  5CV6 A;  1ASY A;  4EQN A;  3VR2 A;  2EYL A;  4GOP C;  5FO9 B;  3CCE A;  1EQQ A;  2VB2 X;  1RKN A;  3RMH A;  4C3J H;  1KDB A;  1TY2 A;  3F2C A;  3TRE A;  4LFA Q;  4J6H A;  3CCL A;  1ILQ A;  3R2I A;  1NCV A;  2CH4 A;  3A0J A;  4LUV A;  2J7Z A;  4LF4 L;  3HOW G;  1YNJ D;  2VY3 A;  1LTL A;  4BBR G;  3J80 c;  3HOY G;  1G29 1;  3B6Y A;  1FNW A;  2K7V A;  2F0Q A;  3KK7 A;  1R9T H;  2NTT A;  5JPN C;  1JOO A;  1NTG A;  4L5R C;  4QGU A;  4K2K A;  2XWJ B;  4JI1 L;  2IX1 A;  2N78 A;  4TQU S;  1SRU A;  2TSS A;  1CZG A;  4BXX H;  1P16 A;  2Z6K C;  3F1Z A;  1PRT B;  4JV5 Q;  2F0O A;  1B53 A;  1Y8O B;  1EY6 A;  4HMJ A;  4IUP A;  5F2D A;  1LTR D;  1MKH A;  3M3Y H;  4MNO A;  1X3G A;  2DJF C;  3CPW A;  4YWM A;  4LUZ A;  2JA8 B;  1UE6 A;  1VQD A;  2JN4 A;  4A3K G;  3V96 A;  1VQ4 A;  3QOL A;  2KHI A;  3CF5 A;  2F1M A;  2UXC Q;  3R93 A;  2ZXP A;  3TQY A;  3PIP A;  3VYU A;  3L9A X;  2ES2 A;  1JWM D;  1EIG A;  2MO1 A;  1NY4 A;  2HDL A;  3HKZ B;  3NWT A;  4ZCK A;  4ULL A;  3X3N A;  1B3A A;  2IL8 A;  1QOH A;  2ICE C;  3OIP A;  1BCP D;  3AU7 A;  4LW1 A;  4DAP A;  3PO3 G;  1QCB D;  2OQK A;  4NXM L;  3V2T A;  1PZK D;  2JA5 B;  2KVM A;  2WKD A;  3X3M A;  4ABN A;  2KOL A;  3AQQ A;  1DON A;  2O5J C;  4XQN A;  1A3V A;  4IN3 A;  4O1N A;  2M00 A;  1A63 A;  1A15 A;  1CM9 A;  4PV1 C;  3HS0 C;  4DKA C;  2K01 A;  1EWH A;  2UXB Q;  3CPF A;  5M3F G;  1J5E L;  4M1U B;  2E2J H;  3EN2 A;  5IWA L;  3FMC A;  3W5O A;  1D7Q A;  2H1E A;  1EZ8 A;  3NPP A;  2JA7 G;  1OXT A;  3JAM i;  5JAV A;  4AH6 A;  1GUS A;  2MJ8 A;  4A3D B;  1VS0 A;  3U50 C;  1NBW A;  1F9P A;  5C5M A;  2L12 A;  2YYZ A;  4QL5 A;  3U4Z A;  4LK1 C;  3SEB A;  4A3I B;  2N55 A;  2BH8 A;  5EGT A;  2R92 H;  3BVZ A;  4F7X A;  4DR7 L;  3T4A C;  4L63 B;  2BDN A;  5ELF A;  1I4Q A;  2IJ0 A;  3C46 A;  3TME A;  1PTO B;  4HSP A;  4XYO A;  3AYH B;  4A93 B;  2ICI A;  1JOQ A;  3C2P A;  4DNR B;  5GAE C;  1Y1V G;  1X6O A;  1YJ9 A;  4OX9 L;  1AE3 A;  1RL2 A;  2EPB A;  2AQ1 B;  2AUJ D;  4QCL A;  1HXY D;  1KHI A;  1VCI A;  2F0H A;  3OMG A;  1S72 A;  2SEB D;  2VNU D;  4QIW E;  5JOB A;  3QJY A;  1HJP A;  3D3R A;  2VQE L;  1TY0 A;  5IP9 G;  3S1Q H;  2CFM A;  1GJX A;  4LAA A;  3MVV A;  4OXP A;  4KHP Q;  2HCI A;  5IGD A;  4K5W A;  3D0F A;  4JI6 L;  1EWC A;  3NTK A;  4JI8 Q;  2MUY A;  4ZUJ A;  3J7A 5;  3PQI A;  1SBB B;  5C4X H;  2AWN A;  3HOZ G;  1D2B A;  1GUT A;  3M7N A;  1MHW C;  2PZU A;  3MHB A;  1PH4 A;  1VQL A;  2KED A;  4A3G B;  3KJO A;  4PZ6 A;  1F2Z A;  5JEA G;  1VQ8 A;  4BBS B;  4FNF A;  1VQK A;  3S1R H;  4RHR A;  1CKN A;  1RF2 D;  3CW2 C;  1TWG H;  2HQL A;  2K32 A;  3MZ5 A;  4F88 A;  1OTC A;  4A3J G;  3FKI B;  1BKB A;  2AHO B;  4KJO A;  4HTH A;  1KTK A;  5JVG 3;  1HA6 A;  1NAP A;  2H4O A;  1D6E C;  4KMU C;  3GTO B;  1LAB A;  1SNQ A;  1WTQ A;  1VQ5 A;  1S5D D;  1VMC A;  4G7H C;  4RGT A;  1LT4 D;  1CSQ A;  1E0B A;  4RGO S;  2MPM A;  1HFN A;  1LTI D;  1WTW A;  1I4R A;  3N52 A;  2A68 C;  4A3C H;  4JW0 A;  2UUC Q;  2WV6 D;  2NVT B;  2R7Z B;  1D1K A;  1CQV A;  1KNA A;  4LF8 L;  1JQY D;  5I9P A;  1PH3 A;  4ZUI A;  3HOX B;  1RCV D;  1IBL Q;  2MFI A;  5I2Y A;  4JCV E;  3TS0 A;  4A3M B;  3VA7 A;  1EOV A;  5KEE A;  4DV1 L;  2QA4 A;  1WVL A;  3UE0 A;  1UE5 A;  4IZ8 A;  1HRJ A;  2ZT9 C;  2RHS B;  4PNY A;  3I4O A;  2NVQ B;  2BH2 A;  5FJ8 G;  2KQ3 A;  1HR0 Q;  3GTP H;  1WTO A;  3I4M G;  3FDT A;  3U58 A;  2N49 A;  4NKL A;  3M4Q A;  4X62 L;  1EIF A;  1N34 L;  1G6Z A;  3D4W A;  1BBW A;  4XT3 B;  1QUQ A;  1ET6 A;  3NQT A;  4YWL A;  1UEA B;  2XNA C;  4EQO A;  2B2T C;  3JAM L;  3J81 c;  1VQO A;  1JJ2 A;  1SEB D;  2WKC A;  4DU9 A;  4DF7 A;  1MBY A;  1T5X D;  2RCN A;  4H44 C;  5CBE E;  1GUO A;  3ERO A;  1QNU A;  3TZU A;  5M5Y H;  3PCO B;  4JI0 L;  1K28 A;  3HP3 A;  3JAM E;  5C6A A;  3TSS A;  1PH7 A;  2WII B;  2SNS A;  1S40 A;  2EJM A;  4NXN L;  1FNV A;  1A3T A;  4MZ9 A;  5LL6 X;  2Y0S E;  4DR2 L;  1C4Q A;  1FD7 D;  4DV2 Q;  3UDG A;  3QR8 A;  3GTQ B;  5J1Z A;  2WFW A;  1V8Q A;  4K5V A;  1XNQ L;  1HNZ Q;  1AN8 A;  4J1M A;  1X65 A;  2A19 A;  1VQM A;  5COR A;  2B2V A;  1HNX Q;  3M4O B;  1TWH B;  1V9P A;  3A54 A;  1WTX A;  1N36 Q;  1Q46 A;  3IRB A;  4IPC A;  3LWU A;  1SYD A;  1I3Q H;  1F2Y A;  4OWX B;  2F0F A;  4FXK C;  5KGU A;  2ZM6 Q;  1K83 B;  4CJ1 B;  1DM0 B;  2KA7 A;  1CHQ D;  2JP1 A;  4OGQ C;  3IKJ A;  2MQH A;  4RAU C;  5K36 G;  1YIJ A;  4X65 L;  2EZV A;  1IL8 A;  1KXL A;  1PRT F;  2YU9 B;  2F0S A;  1WTP A;  1PH5 A;  1XX8 A;  4BY1 H;  1QZG A;  1EEF D;  1EY4 A;  4MHE A;  3H0G B;  1TWC H;  1N9W A;  3VR5 A;  2SOB A;  3E0E A;  4ZQ3 A;  2NZ1 D;  1X56 A;  1QUQ B;  3K8A A;  4YIJ A;  1BVS A;  1R9T B;  5JJK A;  1PYB A;  3MTS A;  4FDB A;  5KIX A;  5FLX L;  2K5V A;  4JG2 A;  1L0W A;  3ULP A;  3Q0A A;  5IGF A;  1ZEQ X;  1E2W A;  2F0V A;  2OT2 A;  2K5H A;  3RLO A;  4KKS A;  2FXQ A;  2B39 A;  2JA8 G;  2A68 D;  5FLM G;  1SE2 A;  4L5T A;  5KNB A;  5FLX E;  2KBN A;  5GAH C;  2JA6 H;  1EY0 A;  4ODG A;  2E2I H;  2JE6 I;  4FYD A;  3NQI A;  4C3I H;  1H9M A;  3P7J A;  3CCJ A;  4B3S Q;  5FO7 B;  3NBI A;  2OQ0 A;  4QB4 A;  3A8K E;  3M3Y B;  2JJQ A;  2F0I A;  2CW0 C;  3HKZ G;  1EU3 A;  4GZY C;  5D3I B;  3S2H H;  1S5C D;  3CCR A;  1D8L A;  4LJZ C;  4A3B H;  3R8B A;  2NUC A;  2R61 A;  2K03 A;  2QDB A;  1VQ7 A;  1E2Z A;  3GTM H;  3S14 B;  3SR1 A;  5CBA E;  1FYC A;  2F0U A;  2JA5 G;  1Q86 C;  3Q8D A;  5JPM C;  4YWK A;  1HH2 P;  2NZO A;  4K2L A;  1WTH A;  1A6X A;  4OWW B;  4UAI A;  4DV4 Q;  1L1O A;  1W6K A;  3PUW A;  4GN5 A;  4LF9 L;  3PSI A;  4DR6 L;  4LF5 L;  4AQY Q;  2F3V A;  1VMP A;  4B3M L;  4QMG A;  3IFD A;  1JR0 D;  3KLS X;  4KHZ A;  1XMQ Q;  4JBJ A;  4IPH A;  2IX3 A;  1WTR A;  2K05 A;  1K73 C;  1C8C A;  4RGM A;  1XYI A;  1PTO F;  1LO5 D;  3MAQ A;  2WP8 J;  2EYJ A;  4CDC C;  3Q6S A;  1TQO A;  4A3D G;  2F4V Q;  5IYD H;  2E76 C;  3BYY B;  1YHA A;  2EJG C;  3M85 A;  2VB3 X;  3W2D A;  3UDI A;  5AJ3 L;  4A3I G;  2QGQ A;  1CSP A;  3FP9 A;  2I0Q A;  1SRO A;  1MIU A;  5GRO A;  3PF5 A;  1L0X B;  4IOA A;  4A93 G;  1PH1 A;  3TP8 A;  2B2U C;  1NUC A;  4DV6 L;  2E2D C;  1I4X A;  1H95 A;  4PG3 A;  1Q82 C;  2OTJ A;  3D6C A;  2UUA Q;  2NYZ D;  2B2Y A;  4IFD G;  5L37 A;  1PHJ A;  1S5E D;  1WCM H;  1SNC A;  1I94 Q;  3GTG B;  1HTL D;  1B4O A;  2B63 B;  1BBX C;  3PO2 H;  1X3F A;  2GA4 B;  2EDG A;  5T1I A;  1JE5 A;  3S16 H;  1B3Q A;  2I5H A;  2Z0S A;  5KYL A;  2BE5 C;  4LF7 Q;  3HOV B;  2WAQ B;  4HIK A;  2XSC A;  1JC7 A;  1KLU D;  2DJG C;  4UP9 A;  1E1O A;  2I5L X;  4GKK Q;  1HA5 A;  1TWA H;  2F0D A;  3I2Z A;  1L1O B;  3TP5 A;  4BY7 B;  3MXN A;  5FO8 B;  1VQB A;  3ICE A;  4C3H H;  3K81 C;  5M5X H;  4DR3 Q;  3T51 B;  3R3O A;  1LV9 A;  1KAB A;  2KCC A;  1DD2 A;  5C3E H;  2NTS A;  3H3V C;  3LNN A;  5FOB B;  3CRL C;  2PMZ B;  2NZH A;  4A3G G;  4DV3 Q;  1H9R A;  3FRP B;  1EL0 A;  5E4W C;  1G6P A;  4DR4 L;  4KN7 C;  1QVG A;  1Y1W B;  5HY6 A;  1UE1 A;  2EY1 A;  3T1H Q;  4BBS G;  5C0X G;  4A3E H;  5C4X B;  2FMC A;  5BR8 L;  3FEW X;  2CW0 D;  3FKI G;  1DYQ A;  4B3T L;  4UP7 A;  1NNX A;  4HJ5 A;  4IJH A;  1A8V A;  5K5P A;  3H91 A;  1C0A A;  4KK7 A;  4LFA L;  1F2L A;  1AZP A;  1YEZ A;  4WOR A;  3S1R B;  4YY3 Q;  2AUK A;  5IYC H;  4KY7 A;  3G6E A;  1DOM A;  4JI5 Q;  4P71 A;  3E9I A;  3RR5 A;  2LMC B;  3HOW H;  4TRD A;  1H9J A;  1PYW D;  3VR6 A;  1PRT C;  2M2L A;  4BBR H;  4H13 C;  3BZK A;  1K3B C;  2A74 C;  2EE1 A;  2R7Z G;  3E6Z X;  2OCE A;  3K7A B;  4GLV B;  3P75 A;  3EQL C;  3J80 i;  2L11 A;  3HOX G;  4DV7 Q;  4RKB A;  1LTA D;  4DA2 A;  2RDF A;  1PFM A;  3AEV A;  2L1B A;  4A3M G;  1IBK Q;  2A73 B;  2PNH A;  2RSN A;  4A3L G;  3I8Z A;  1D5M C;  3PMF A;  4JV5 L;  1E22 A;  3OW7 A;  1M8A A;  1SSO A;  3KLR A;  4DV5 Q;  3G48 A;  4R1J A;  4N8X 1;  5E4X A;  1TU2 B;  3OPO A;  2XN9 C;  2F0E A;  3IFT A;  3GTL H;  3GD7 A;  4GN3 B;  4CDD C;  1PMR A;  2O5I C;  1VF5 C;  3OW2 A;  1RDP D;  3CQZ B;  2UXC L;  1SNM A;  4LF6 Q;  3D31 A;  1J8I A;  1XPR A;  1HZ9 A;  1DOK A;  4TVA B;  2OEO A;  1Z6H A;  3EJI A;  1UEB A;  3EBE A;  3OOC A;  4DR1 Q;  3U9O A;  1EYA A;  3DWQ A;  4IUQ A;  5LMU Q;  1VQ9 A;  3VDY A;  1NR2 A;  2MGS A;  5CYU A;  1IXR A;  2N88 A;  2OTL A;  1QB5 D;  4IPG A;  4KD3 A;  3DLL A;  3MEH A;  1YHQ A;  2Q8I B;  1SYE A;  1OXU A;  1U4P A;  3GTK B;  2KHS A;  2ZXO A;  1XWE A;  3BS1 A;  4K0K Q;  2E8G A;  3J7A F;  3STB C;  1TXY A;  1A2T A;  1FL0 A;  1FVI A;  1K8M A;  1ZYR C;  5DAU A;  2H5X A;  5IGE A;  1EY5 A;  2YTX A;  3CXC A;  5M5Y B;  4QUF A;  1HTP A;  1GHK A;  2UXB L;  5EPK A;  1EIY B;  5I6W A;  2K04 A;  1L0Y B;  3OTO Q;  4G7O C;  3W1G A;  3PIP 3;  2EQS A;  1U5K A;  4H0L C;  4DV0 Q;  4FF2 A;  1PTO C;  1I50 B;  1ENA A;  4DNI A;  2D62 A;  2RSO A;  5LMN Q;  1MJC A;  1G8Z D;  1IW7 C;  1STN A;  1KAW A;  5J39 A;  2JA7 H;  5M3M H;  2Z6K A;  1ZKO A;  2E5L Q;  3H09 A;  1K8A C;  1QJO A;  1A62 A;  1EYC A;  1W3S A;  2QEX A;  1CK1 A;  4JOI A;  3DWP A;  5BN5 A;  2A1A A;  2AQ2 B;  1F77 A;  4RCO A;  1Y69 U;  3H0G G;  4L8J A;  2R7D A;  4LFB L;  1G2T A;  3K5N A;  1IZ6 A;  1U4L A;  1ET9 A;  1PA6 A;  1SFO H;  3WOF A;  5I6Y A;  1S5B D;  3ZJY C;  4R8I A;  4LF4 Q;  1V1Q A;  4IUU A;  1HNW Q;  4DAM A;  1TR5 A;  4HSV A;  4O42 A;  5IP7 H;  4BY1 B;  1AFP A;  1B7Y B;  4N8F A;  5AFW A;  4JVZ A;  1EU4 A;  1TWC B;  1V1O A;  3K59 A;  3F8T A;  1PRT D;  3P20 A;  2G9D A;  5CV9 A;  2D0P A;  4JI2 Q;  1SNP A;  3Q24 A;  1KIX A;  4UDU C;  4QIW B;  1EWI A;  4A3F B;  1Y14 B;  2EXZ A;  3NTH A;  3RZD B;  4B9W A;  5ELN A;  1EOT A;  3O13 A;  1VQG A;  4WFN 3;  5IP9 H;  1EQT A;  3Q23 A;  3CME A;  3ND9 A;  2VQF Q;  2GVA A;  4CKE A;  3BJU A;  4DAY A;  1HZC A;  4HCS A;  1EUJ A;  5G3L D;  2EOT A;  4NP5 A;  2QCP X;  2VXW A;  3KLW A;  2ASB A;  3S1N B;  3S1M H;  1SE3 A;  1CT1 D;  4JI8 L;  2VUM B;  2E2I B;  1ICW A;  1DCZ A;  4Z9C B;  1U4R A;  2NWG A;  1EIH A;  3J7Y W;  3E3X A;  1IKM A;  3QWN A;  1JE4 A;  3HOU G;  3HOZ H;  2DNE A;  4XQQ A;  3S2H B;  3EA6 A;  2Q2U A;  3MC0 B;  4A3B B;  2QIL A;  2JSO A;  4LWC A;  1X3E A;  5JJZ A;  2XVS A;  4X6A H;  1VQC A;  4TSS A;  4EQ5 A;  3S2D H;  5ELC A;  3J80 E;  3S15 H;  4IAL A;  2X6L A;  1SMY C;  4R4C A;  1DOL A;  4A3J H;  1VQN A;  4NXM Q;  1D5Z C;  2GN5 A;  2RF4 A;  2WB1 E;  3PIO A;  4KI0 A;  3A56 A;  3NEM A;  1JWU D;  2DY7 A;  1EFW A;  4B08 A;  2YTV A;  5NUC A;  1TT2 A;  4PZ7 A;  1LTT D;  3STB D;  4GN4 B;  3KF8 A;  1RTO A;  1AH9 A;  1Q1E A;  4Q5V A;  2PW5 A;  1RIP A;  2A69 C;  1ZYR D;  2EYH A;  1X54 A;  1VQA A;  2UUC L;  4CKB A;  1UAP A;  4HJ8 A;  1JWS D;  1Q1B A;  2K4K A;  5J22 A;  5D3D A;  2OXP A;  1IBL L;  2IY5 B;  2F0T A;  2DY8 A;  1FJG Q;  2KEN A;  4L6T B;  4E6I A;  4B3R Q;  1PTO D;  2K5Q A;  2KCM A;  1ESF A;  3MWY W;  2LXK A;  1IW7 D;  4JI4 Q;  3D6W A;  5D65 A;  1HR0 L;  1E1T A;  3RUZ A;  3WOE A;  4QQB X;  2X69 A;  2B63 G;  2HHH Q;  3L2P A;  2RKS A;  2F0N A;  5FJ8 H;  5EPJ A;  3HOV G;  2WAQ G;  4NPS A;  1VQH A;  5T1G A;  4OL7 A;  5IT9 L;  3I4M H;  3MXU A;  4CGY B;  1W6J A;  2V1C C;  1WCM B;  4RHS A;  1Z47 A;  4BY7 G;  4OX9 Q;  4B9X A;  5LMN W; 
#chains in the Genus database with same CATH homology
 1XJV A;  3RLO A;  2K5H A;  2AKW B;  2FXQ A;  4LF6 L;  2JA8 G;  4R4O A;  5FLM G;  4L5T A;  3LGJ A;  2KBN A;  5E7N A;  5GAH C;  2JA6 H;  1W2B A;  3HOU H;  1PVO A;  4GOP B;  3CAM A;  2VW9 A;  2E2I H;  4DV6 Q;  1Y1V H;  2AWO A;  4R4T A;  2JE6 I;  3BU2 A;  1I6H H;  4O2D A;  2IHF A;  3H15 A;  1Q8K A;  4C3I H;  2R7F A;  4AIM A;  1G51 A;  2ALY B;  3PO2 G;  3J81 i;  3CCJ A;  4B3S Q;  2IHE A;  2IX0 A;  4P72 A;  2OQ0 A;  2R6G A;  2JK8 A;  2JJQ A;  3HKZ G;  4DK3 C;  2WAQ E;  1Y1W G;  1J6Q A;  4DV2 L;  4BXX G;  3S2H H;  3CCR A;  1D8L A;  3TRZ A;  4JI1 Q;  4A3B H;  2K14 A;  1TWF H;  5IT9 c;  5M5W H;  4AYB G;  5C44 H;  1VQ7 A;  1VQE A;  3MEF A;  1GM5 A;  3E9H A;  3GTM H;  5C4X G;  4GLX A;  4DUY L;  2Q2T A;  4OWT B;  1HNX L;  2A8V A;  2UU9 Q;  4JI3 L;  2N3S A;  4DR5 Q;  1N8R C;  4KHP L;  1BBU A;  2JA5 G;  4Y7N H;  1WFQ A;  4A75 A;  2R93 H;  1Q86 C;  3Q8D A;  3ERS X;  4YWK A;  1HH2 P;  2C35 B;  2NZO A;  1N36 L;  1L2F A;  1XPO A;  4OWW B;  3L0O A;  5IYB H;  2ZM6 L;  1K8G A;  5HGQ A;  1YBY A;  5C0X I;  4IO9 A;  1AE2 A;  2EIF A;  3H3V H;  5C3E G;  4DV4 Q;  1L1O A;  1WYD A;  3PUW A;  4GN5 A;  1YJW A;  4LF9 L;  3OTO L;  5M3M G;  3PSI A;  4DR6 L;  2ZJQ A;  3U4V A;  4LF5 L;  1FJG L;  4HJ9 A;  1EYG A;  2HIX A;  4AQY Q;  3J81 j;  2UUB Q;  1PV4 A;  4B3R L;  1CKN B;  2PMZ E;  2PQA B;  4DV0 L;  2VS1 A;  4B3M L;  4P74 A;  4QY7 A;  4YHH Q;  1UE7 A;  3HKZ E;  4KHZ A;  4YCV A;  1XMQ Q;  1K73 C;  4JI4 L;  4JBJ A;  4IPH A;  3OYY A;  1YIT A;  1YVC A;  3K80 C;  4EX5 A;  3CCU A;  4A3E G;  1M1K C;  1XPU A;  4DR4 Q;  1JJG A;  2WP8 J;  4AYB E;  2HHH L;  1PFS A;  4R4I A;  4RMF A;  1WJJ A;  2LSS A;  5H1S E;  4L5Q A;  2N8N A;  4X66 Q;  1ASY A;  4A3D G;  2F4V Q;  2ZTD A;  3GTG H;  5IYD H;  4GOP C;  3CCE A;  2B63 H;  1YHA A;  1EQQ A;  3M85 A;  4LFB Q;  1KL9 A;  3UDI A;  1JJC B;  5AJ3 L;  3NEN A;  4JI7 Q;  4A3I G;  1WI5 A;  4A3C G;  2QGQ A;  2CWP A;  1CSP A;  3FP9 A;  4C3J H;  5IP7 G;  3HOV H;  3F2C A;  2I0Q A;  1SRO A;  5JEA J;  3TRE A;  1OXX K;  4LFA Q;  1MIU A;  4RG1 A;  5GRO A;  3CCL A;  3PF5 A;  5JJI A;  2E2H H;  4IOA A;  1NJI C;  3A0J A;  2NVY H;  1PYS B;  4LUV A;  3W1B A;  2VY3 A;  4LF4 L;  1PH1 A;  3HOW G;  1LTL A;  1S3O A;  4GS3 A;  4BBR G;  3J7Z C;  3CCS A;  3JAM c;  3J80 c;  4BY7 H;  3HOY G;  1G29 1;  3B6Y A;  3ER0 A;  1J5E Q;  4DV6 L;  1R9T H;  5IWA Q;  1H95 A;  4PG3 A;  2JA8 H;  1Q82 C;  5FLM H;  2OTJ A;  2UUA Q;  4IFD G;  1NTG A;  4L5R C;  1PHJ A;  1XTD A;  4PMW A;  1WCM H;  1I94 Q;  4QGU A;  1T9H A;  4J15 A;  4LNQ A;  3PO2 H;  1X3F A;  3S16 H;  1JE5 A;  5IY0 A;  4JI1 L;  2Z0S A;  2I5H A;  1WOC A;  2IX1 A;  2N78 A;  4DAY B;  4LF7 Q;  2R92 G;  4PZ8 A;  4TQU S;  4HIK A;  3I4N H;  1SRU A;  4A93 G;  5ELO A;  1Y1W H;  2ZTC A;  3G4S A;  3S17 H;  4BXX H;  2UU9 L;  4DR5 L;  1P16 A;  2Z6K C;  4UP9 A;  1E1O A;  2I5L X;  1PH9 A;  4GKK Q;  1TWA H;  3F1Z A;  4JV5 Q;  1K3R A;  4DR7 Q;  4X62 Q;  3I2Z A;  1L1O B;  4P75 A;  1N34 Q;  1B8A A;  1GVP A;  1VQB A;  1MKH A;  3M3Y H;  4MNO A;  1X3G A;  4C3H H;  3K81 C;  3CPW A;  3ICE A;  4YWM A;  2NVT H;  1YZ6 A;  5M5X H;  3KFU A;  4JBW A;  3KDF A;  4DV4 L;  1E24 A;  1K9M C;  4LUZ A;  4DR3 Q;  2VL6 A;  3ULJ A;  1VQ6 A;  1NE3 A;  1UE6 A;  1VQD A;  2HIV A;  4A3K G;  1VQ4 A;  3GTJ H;  1XNR L;  1ASZ A;  2KHI A;  3CF5 A;  2UXC Q;  3TQY A;  5C3E H;  2UUB L;  1YI2 A;  4GKJ L;  1LUZ A;  3TEH B;  3PIP A;  4YHH L;  3CC4 A;  2ES2 A;  1XMQ L;  2UXD Q;  3UDX A;  3H3V I;  2MO1 A;  1NY4 A;  2NZH A;  4DV3 Q;  4A3G G;  2ZJP A;  4JI0 Q;  1N33 L;  3PUV A;  1G6P A;  3CMA A;  4DR4 L;  1QVG A;  4QJF A;  5HY6 A;  1UE1 A;  3T1H Q;  1SLJ A;  4WJ3 M;  3CCM A;  4BBS G;  3AFQ A;  5C0X G;  4ALP A;  1Q81 C;  4LW1 A;  3PUZ A;  4X66 L;  2RHQ B;  2VQE Q;  2F4V L;  4A3E H;  3PO3 G;  3RLF A;  3K7A H;  2OQK A;  5BR8 L;  4DR2 Q;  4NXM L;  3FKI G;  4UPA A;  4UP8 A;  4B3T L;  4UP7 A;  2CWA A;  1KRT A;  3JC6 6;  4JI7 L;  4HJ5 A;  4IJH A;  3CC7 A;  1A8V A;  1LYL A;  1C0A A;  3KF8 B;  4LFA L;  3AQQ A;  1YNX A;  1HNZ L;  1GD7 A;  5FLX c;  2B29 A;  1YEZ A;  2NN6 G;  1A63 A;  4JI6 Q;  4YY3 Q;  3HFZ B;  4DKA C;  5IYC H;  3G6E A;  2F3I A;  4JI5 Q;  2NVX H;  4P71 A;  3E9I A;  3CPF A;  4R4Q A;  2UXB Q;  1I5F A;  1CKM A;  3RR5 A;  2DGY A;  5M3F G;  1J5E L;  2E2J H;  3EN2 A;  5IWA L;  3HOW H;  2Q2H A;  5JJL A;  3W5O A;  4XIG S;  2OWO A;  1D7Q A;  4BBR H;  2UUA L;  3BZK A;  1L1O C;  2VZA A;  4BY1 G;  2ID0 A;  3CQZ H;  2JA7 G;  2OCE A;  2R7Z G;  1I94 L;  1SR3 A;  4GLV B;  1M90 C;  1OXT A;  4OON A;  3J80 i;  3JAM i;  4HJ7 A;  1PH2 A;  1CUK A;  3HOX G;  4DV7 Q;  4AH6 A;  2LXJ A;  4O0A A;  1SMX A;  1VS0 A;  3U50 C;  4GLA C;  1SN8 A;  3AEV A;  1NBW A;  1HR0 W;  1K0R A;  4A3M G;  4GNX C;  1IBK Q;  2YYZ A;  4QL5 A;  3U4Z A;  3RNU A;  2PNH A;  4A3F G;  2DUD A;  1FGU A;  4A3L G;  3EIV A;  2BH8 A;  4GKK L;  2K52 A;  2R92 H;  4JYA Q;  1E22 A;  4JV5 L;  4DR7 L;  4IFD J;  3PV0 A;  3M9B A;  4LFC Q;  3A74 A;  4DV5 Q;  1VQP A;  3I56 A;  3G48 A;  3PF4 A;  3PUY A;  4R1J A;  3GTK H;  3WWV A;  1QVC A;  1VQJ A;  3AYH B;  4DR3 L;  3GTL H;  3GD7 A;  4GN3 B;  5J3B A;  2VUM G;  2MO0 A;  4JBM A;  5IE8 A;  3OW2 A;  4DPG A;  5GAE C;  1Y1V G;  2UXC L;  2KHJ A;  1X6O A;  1YJ9 A;  3HKS A;  5DLQ E;  4LF6 Q;  5GQO A;  3D31 A;  3F2B A;  1AE3 A;  1XPR A;  4OX9 L;  1HZ9 A;  1RL2 A;  3BZC A;  4WJ4 A;  4TVA B;  3M4P A;  2UXD L;  2MNA A;  1KHI A;  1VCI A;  4JC0 A;  1UEB A;  4IPD A;  4LF8 Q;  3EBE A;  4DR1 Q;  1S72 A;  1C7Y A;  4C2M H;  5LMU Q;  1VQ9 A;  3VDY A;  2VNU D;  4QIW E;  1IXR A;  2OTL A;  1HJP A;  3T1Y Q;  4IPG A;  5IP9 G;  2VQE L;  1KD1 C;  3S1Q H;  2BA0 A;  4B3S L;  3FHW A;  3DLL A;  1I50 H;  2CFM A;  4DV1 Q;  1YHQ A;  2D0O A;  4BBS H;  1IBM Q;  2R93 G;  1OXU A;  4OO1 G;  2K5N A;  1IYJ B;  1QZH A;  4K0K Q;  2E8G A;  4DUY Q;  3FKI H;  3STB C;  4OXP A;  1TXY A;  4KHP Q;  4MTN A;  1P8L A;  1CKO A;  1FL0 A;  3L7Z C;  1JMC A;  4YCU A;  1FVI A;  3D0F A;  3NEL A;  3UE1 A;  4YY3 L;  4JI6 L;  4L5S A;  2ZJR A;  4LUO A;  2H5X A;  2YTX A;  3CXC A;  4JI8 Q;  1XMO Q;  4JI5 L;  3J7A 5;  2UXB L;  1EIY B;  5C4X H;  2AWN A;  1YHB A;  3HOZ G;  3M7N A;  3OTO Q;  3W1G A;  2JA5 H;  3PUX A;  4LF5 Q;  4HJA A;  1PH4 A;  3DM3 A;  1VQF A;  1KC8 C;  1VQL A;  2EQS A;  1U5K A;  3KJO A;  1IL2 A;  4PZ6 A;  4DV0 Q;  1HZA A;  3GO5 A;  1JT8 A;  5C4J H;  4DNI A;  2D62 A;  4NB3 A;  5JEA G;  1MJC A;  5LMN Q;  2JQO A;  4AQY L;  3S1R H;  2EXD A;  1CKN A;  3CW2 C;  1KAW A;  1VQK A;  1TWG H;  2HQL A;  5M3M H;  2ATW A;  2Z6K A;  1OTC A;  2JA7 H;  3KOJ A;  3ULL A;  2E5L Q;  4A3J G;  1K8A C;  1A62 A;  5GAG C;  5GAD C;  1IBK L;  1BKB A;  2AHO B;  2JEA I;  3HOX H;  1W3S A;  2QEX A;  1OXS C;  4JYA L;  4JOI A;  2AMC B;  3KJP A;  4NXN Q;  2A1A A;  3SGI A;  4A3M H;  3CCQ A;  4LFC L;  1PH8 A;  4A3F H;  4IFD I;  4A3L H;  4UY8 C;  1QVF A;  3H0G G;  3RZD H;  2R7D A;  4LFB L;  1IZ6 A;  1VQ5 A;  1XNQ Q;  2I5M X;  1PA6 A;  4A3D H;  2Q2I A;  4IJL A;  1SFO H;  3CC2 A;  2B3G A;  3ZJY C;  1CSQ A;  4LF4 Q;  3RLN A;  4POG A;  1V1Q A;  2K50 A;  3S1N H;  4A3I H;  1UWV A;  3RN2 A;  4A3C H;  1HNW Q;  4DAM A;  4DUZ Q;  2VUM H;  5IP7 H;  3TS2 A;  2UUC Q;  1WCM G;  1B7Y B;  4X64 Q;  1VQ8 A;  4LF8 L;  1NMF A;  2XTI A;  4DR1 L;  1N32 Q;  1PH3 A;  3F8T A;  5LMU L;  4ME3 A;  1Q7Y C;  2HT1 A;  1A0I A;  2D0P A;  2KCT A;  4JI2 Q;  4A93 H;  1X9N A;  1IBL Q;  1KIX A;  2MFI A;  3T1Y L;  4JCV E;  2CQO A;  3I4N G;  3NBH B;  4X65 Q;  3TS0 A;  3HOY H;  3GDE A;  1EWI A;  1EOV A;  1V43 A;  4DV1 L;  2QA4 A;  2CCZ A;  1Y14 B;  1LM0 A;  3UE0 A;  1YJN A;  1IBM L;  2YTY A;  4P73 A;  5ELN A;  1UE5 A;  1VQG A;  1GO3 E;  1VQI A;  5IP9 H;  2RHS B;  3CME A;  3I4O A;  4K0K L;  2VQF Q;  2BH2 A;  5FJ8 G;  2GVA A;  1HR0 Q;  3KF6 A;  3GTP H;  4LF7 L;  3BJU A;  1HZC A;  1EUJ A;  2JA9 A;  3K7U C;  1NMG A;  3I4M G;  2ASB A;  3KLW A;  3PGZ A;  3MXN B;  2WB1 G;  2BA1 A;  3U58 A;  3S1M H;  2N49 A;  2Y0S G;  1GKH A;  4JI8 L;  1XMO L;  4A76 A;  3M4Q A;  4HIM A;  4X62 L;  3KDF B;  1EIF A;  4XTC S;  1N34 L;  1BBW A;  3GTQ H;  1QUQ A;  1C9O A;  1XNR Q;  1U0L A;  4YWL A;  2F52 A;  4GKJ Q;  4Y52 H;  1JB7 A;  3M4O H;  2JA6 G;  1TWH H;  3J81 c;  1VQO A;  3HOU G;  3HOZ H;  1JJ2 A;  3CP0 A;  5LMN L;  4GNX A;  2Q2U A;  1O7I A;  2RCN A;  1OXV A;  1N33 Q;  2NN6 I;  4LWC A;  1X3E A;  2XGT A;  1E3P A;  4A3K H;  1E7Z A;  5M5Y H;  1K83 H;  2E5L L;  4BA2 I;  2PI2 E;  4X6A H;  3PCO B;  1VQC A;  4EQ5 A;  4DV3 L;  3S2D H;  4JI0 L;  4HID A;  1KRS A;  3A5Z B;  3S15 H;  4R4C A;  1PH7 A;  4GOP A;  3T1H L;  2K75 A;  1S40 A;  5BR8 Q;  4A3J H;  4NXN L;  1VQN A;  4NXM Q;  4A3B G;  4MZ9 A;  1DGS A;  4A3G H;  2GN5 A;  4B3T Q;  5C44 G;  2PI2 A;  2RF4 A;  2WB1 E;  2YU9 H;  2L15 A;  2Y0S E;  3PIO A;  4DR2 L;  4KI0 A;  4DV2 Q;  3NEM A;  3UDG A;  1EFW A;  2WFW A;  5IYC G;  2YTV A;  1KQS A;  1XNQ L;  1HNZ Q;  4PZ7 A;  1X65 A;  2A19 A;  3PO3 H;  1VQM A;  3H0G H;  3STB D;  3K0X A;  4GN4 B;  4YCW A;  1HNX Q;  4JI3 Q;  1EQR A;  5IYB G;  1AH9 A;  1Q1E A;  1V9P A;  1Q12 A;  1RIP A;  3KYH C;  3RN5 A;  1N36 Q;  1Q46 A;  1HNW L;  4DUZ L;  3IRB A;  4IPC A;  1X54 A;  1VQA A;  4A4I A;  4BA1 I;  1I3Q H;  4X64 L;  4HJ8 A;  2UUC L;  5C0X J;  4OWX B;  2ZM6 Q;  1Q1B A;  3I7F A;  1N32 L;  1MJE A;  2K4K A;  2JEB I;  4H02 A;  4JI2 L;  4LF9 Q;  3GTO H;  4DR6 Q;  1IBL L;  2IY5 B;  4HIO A;  2MQH A;  3AFP A;  5K36 G;  1YIJ A;  1FJG Q;  4X65 L;  2KEN A;  2YV5 A;  1SE8 A;  5M3F H;  4B3R Q;  2KCM A;  1KXL A;  4KLK A;  3KF6 B;  4B3M Q;  4POF A;  2LXK A;  1PH5 A;  4JBK A;  4JI4 Q;  4DV7 L;  5EAY A;  2VQF L;  4BY1 H;  1QZG A;  2R7Z H;  2PQA A;  1HR0 L;  1E1T A;  3UDF A;  5IYD G;  2GVB A;  4QQB X;  1TWC H;  1N9W A;  2B63 G;  2HHH Q;  3L2P A;  3E0E A;  1X56 A;  2CKZ B;  5FJ8 H;  1QUQ B;  3RZO H;  3K8A A;  3HOV G;  2WAQ G;  4NPS A;  3F2D A;  1VQH A;  4JOI C;  1BVS A;  3G71 A;  5JJK A;  1HZB A;  3I4M H;  1PYB A;  5AJ3 Q;  3CCV A;  4APV A;  4OX9 Q;  4DV5 L;  4IOC A;  4FDB A;  2K5V A;  4JG2 A;  2V1C C;  1Z9F A;  1L0W A;  2ZTE A;  3I55 A;  3S24 A;  3ULP A;  1B70 B;  4DK6 C;  3A5U A;  4GNX B;  2NVQ H;  3CD6 A;  1Z47 A;  3S14 H;  4BY7 G;  2IT1 A;  4OO1 I;  1PH6 A;  1X55 A;  5LMN W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...