4LFCD

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 56
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4lfcD01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4lfcD02
4LF4D 4LFBD 2VQFD 4GKKD 4B3SD 1HNZD 4DV1D 4X64D 4JI8D 1N32D 4YHHD 4NXND 3DH3A 2UU9D 4DUYD 4JI4D 2JANA 4DV3D 4AQYD 2KTLA 4DV6D 4JI2D 1XNQD 1IBMD 4DV7D 5LMND 1XMOD 2UUBD 4B3RD 4JV5D 1HNWD 1FKAD 4DR5D 5BR8D 1KSVA 1IBLD 3T1HD 4DV2D 4B3TD 1C06A 4LGTA 1DM9A 2K6PA 1HR0D 4DV5D 4K0KD 4X62D 2UXDD 3KBGA 4DR4D 5IWAD 2ISTA 4NXMD 1VIOA 1IBKD 4YY3D 4JI0D 4LFCD 1XNRD 2E5LD 1FJGD 1JH3A 2UUAD 4OX9D 4JI6D 4LF9D 2F4VD 3T1YD 4DR1D 4LF6D 4X65D 1N34D 1P9KA 3OTOD 1KSLA 1XMQD 4KHPD 1N33D 5LMUD 4DR7D 4LF8D 1N36D 4JYAD 2UXCD 4DR3D 4JI3D 2ZM6D 1KSKA 1H3FA 2HHHD 4JI5D 2VQED 4LF7D 4DUZD 4LFAD 4B3MD 1H3EA 4OUDA 1HNXD 2UXBD 4JI7D 4DV4D 4GKJD 4DR2D 1J5ED 1I94D 2UUCD 3HP7A 4DV0D 4LF5D 4X66D 4JI1D 1C05A 4DR6D
chains in the Genus database with same CATH superfamily
4LF4D 4LFBD 2VQFD 2I1SA 4GKKD 1Y8RB 4B3SD 1HNZD 3J81E 4DV1D 4X64D 3CMMA 4JI8D 1N32D 4YHHD 4NXND 4NNJA 3DH3A 2UU9D 5A2QE 4DUYD 2ZTBA 4JI4D 2JANA 3FN1A 4DV3D 4AQYD 2KTLA 4DV6D 4JI2D 3KYDB 1XNQD 1IBMD 4DV7D 5LMND 1XMOD 2UUBD 4B3RD 4JV5D 1HNWD 1FKAD 4DR5D 5BR8D 2NVUB 1KSVA 1IBLD 3T1HD 5LL6S 4DV2D 2LQ7A 5KNLA 4B3TD 1C06A 4LGTA 3JAME 1DM9A 2K6PA 2L3NA 1HR0D 4DV5D 4K0KD 4X62D 2UXDD 3KBGA 4DR4D 1Y8XB 5IWAD 2ISTA 4NXMD 1VIOA 1IBKD 4YY3D 4JI0D 4LFCD 1XNRD 3J7AF 2E5LD 1FJGD 3J80E 1JH3A 5FQ2B 2UUAD 4OX9D 4JI6D 4LF9D 2F4VD 3T1YD 4DR1D 3KYCB 5FLXE 4LF6D 4X65D 1N34D 1P9KA 3OTOD 1KSLA 1XMQD 4KHPD 1N33D 1Y8QB 5LMUD 4II2A 4DR7D 4LF8D 1N36D 4W5VB 3ONGA 4JYAD 2UXCD 4DR3D 4JI3D 2ZM6D 1KSKA 4II3A 3ONHA 1H3FA 2HHHD 4JI5D 2VQED 4LF7D 4DUZD 4LFAD 4B3MD 1H3EA 4OUDA 1HNXD 2UXBD 4JI7D 4DV4D 4GKJD 4DR2D 1J5ED 1I94D 2UUCD 5IT9E 3HP7A 4DV0D 4LF5D 4X66D 4JI1D 1C05A 4DR6D
chains in the Genus database with same CATH topology
4LF4D 4LFBD 2VQFD 4GKKD 4B3SD 1HNZD 4DV1D 4X64D 4JI8D 1N32D 4YHHD 4NXND 3DH3A 2UU9D 4DUYD 4JI4D 2JANA 4DV3D 4AQYD 2KTLA 4DV6D 4JI2D 1XNQD 1IBMD 4DV7D 5LMND 1XMOD 2UUBD 4B3RD 4JV5D 1HNWD 1FKAD 4DR5D 5BR8D 1KSVA 1IBLD 3T1HD 4DV2D 4B3TD 1C06A 4LGTA 1DM9A 2K6PA 2L3NA 1HR0D 4DV5D 4K0KD 4X62D 2UXDD 3KBGA 4DR4D 5IWAD 2ISTA 4NXMD 1VIOA 1IBKD 4YY3D 4JI0D 4LFCD 1XNRD 2E5LD 1FJGD 1JH3A 2UUAD 4OX9D 4JI6D 4LF9D 2F4VD 3T1YD 4DR1D 4LF6D 4X65D 1N34D 1P9KA 3OTOD 1KSLA 1XMQD 4KHPD 1N33D 5LMUD 4DR7D 4LF8D 1N36D 4JYAD 2UXCD 4DR3D 4JI3D 2ZM6D 1KSKA 1H3FA 2HHHD 4JI5D 2VQED 4LF7D 4DUZD 4LFAD 4B3MD 1H3EA 4OUDA 1HNXD 2UXBD 4JI7D 4DV4D 4GKJD 4DR2D 1J5ED 1I94D 2UUCD 3HP7A 4DV0D 4LF5D 4X66D 4JI1D 1C05A 4DR6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 D;  4LFB D;  2VQF D;  4GKK D;  4B3S D;  1HNZ D;  4DV1 D;  4X64 D;  4JI8 D;  1N32 D;  4YHH D;  4NXN D;  3DH3 A;  2UU9 D;  4DUY D;  4JI4 D;  2JAN A;  4DV3 D;  4AQY D;  2KTL A;  4DV6 D;  4JI2 D;  1XNQ D;  1IBM D;  4DV7 D;  5LMN D;  1XMO D;  2UUB D;  4B3R D;  4JV5 D;  1HNW D;  1FKA D;  4DR5 D;  5BR8 D;  1KSV A;  1IBL D;  3T1H D;  4DV2 D;  4B3T D;  1C06 A;  4LGT A;  1DM9 A;  2K6P A;  1HR0 D;  4DV5 D;  4K0K D;  4X62 D;  2UXD D;  3KBG A;  4DR4 D;  5IWA D;  2IST A;  4NXM D;  1VIO A;  1IBK D;  4YY3 D;  4JI0 D;  4LFC D;  1XNR D;  2E5L D;  1FJG D;  1JH3 A;  2UUA D;  4OX9 D;  4JI6 D;  4LF9 D;  2F4V D;  3T1Y D;  4DR1 D;  4LF6 D;  4X65 D;  1N34 D;  1P9K A;  3OTO D;  1KSL A;  1XMQ D;  4KHP D;  1N33 D;  5LMU D;  4DR7 D;  4LF8 D;  1N36 D;  4JYA D;  2UXC D;  4DR3 D;  4JI3 D;  2ZM6 D;  1KSK A;  1H3F A;  2HHH D;  4JI5 D;  2VQE D;  4LF7 D;  4DUZ D;  4LFA D;  4B3M D;  1H3E A;  4OUD A;  1HNX D;  2UXB D;  4JI7 D;  4DV4 D;  4GKJ D;  4DR2 D;  1J5E D;  1I94 D;  2UUC D;  3HP7 A;  4DV0 D;  4LF5 D;  4X66 D;  4JI1 D;  1C05 A;  4DR6 D; 
#chains in the Genus database with same CATH topology
 4LF4 D;  4LFB D;  2VQF D;  2I1S A;  4GKK D;  1Y8R B;  4B3S D;  1HNZ D;  3J81 E;  4DV1 D;  4X64 D;  3CMM A;  4JI8 D;  1N32 D;  4YHH D;  4NXN D;  4NNJ A;  3DH3 A;  2UU9 D;  5A2Q E;  4DUY D;  2ZTB A;  4JI4 D;  2JAN A;  3FN1 A;  4DV3 D;  4AQY D;  2KTL A;  4DV6 D;  4JI2 D;  3KYD B;  1XNQ D;  1IBM D;  4DV7 D;  5LMN D;  1XMO D;  2UUB D;  4B3R D;  4JV5 D;  1HNW D;  1FKA D;  4DR5 D;  5BR8 D;  2NVU B;  1KSV A;  1IBL D;  3T1H D;  5LL6 S;  4DV2 D;  2LQ7 A;  5KNL A;  4B3T D;  1C06 A;  4LGT A;  3JAM E;  1DM9 A;  2K6P A;  2L3N A;  1HR0 D;  4DV5 D;  4K0K D;  4X62 D;  2UXD D;  3KBG A;  4DR4 D;  1Y8X B;  5IWA D;  2IST A;  4NXM D;  1VIO A;  1IBK D;  4YY3 D;  4JI0 D;  4LFC D;  1XNR D;  3J7A F;  2E5L D;  1FJG D;  3J80 E;  1JH3 A;  5FQ2 B;  2UUA D;  4OX9 D;  4JI6 D;  4LF9 D;  2F4V D;  3T1Y D;  4DR1 D;  3KYC B;  5FLX E;  4LF6 D;  4X65 D;  1N34 D;  1P9K A;  3OTO D;  1KSL A;  1XMQ D;  4KHP D;  1N33 D;  1Y8Q B;  5LMU D;  4II2 A;  4DR7 D;  4LF8 D;  1N36 D;  4W5V B;  3ONG A;  4JYA D;  2UXC D;  4DR3 D;  4JI3 D;  2ZM6 D;  1KSK A;  4II3 A;  3ONH A;  1H3F A;  2HHH D;  4JI5 D;  2VQE D;  4LF7 D;  4DUZ D;  4LFA D;  4B3M D;  1H3E A;  4OUD A;  1HNX D;  2UXB D;  4JI7 D;  4DV4 D;  4GKJ D;  4DR2 D;  1J5E D;  1I94 D;  2UUC D;  5IT9 E;  3HP7 A;  4DV0 D;  4LF5 D;  4X66 D;  4JI1 D;  1C05 A;  4DR6 D; 
#chains in the Genus database with same CATH homology
 4LF4 D;  4LFB D;  2VQF D;  4GKK D;  4B3S D;  1HNZ D;  4DV1 D;  4X64 D;  4JI8 D;  1N32 D;  4YHH D;  4NXN D;  3DH3 A;  2UU9 D;  4DUY D;  4JI4 D;  2JAN A;  4DV3 D;  4AQY D;  2KTL A;  4DV6 D;  4JI2 D;  1XNQ D;  1IBM D;  4DV7 D;  5LMN D;  1XMO D;  2UUB D;  4B3R D;  4JV5 D;  1HNW D;  1FKA D;  4DR5 D;  5BR8 D;  1KSV A;  1IBL D;  3T1H D;  4DV2 D;  4B3T D;  1C06 A;  4LGT A;  1DM9 A;  2K6P A;  2L3N A;  1HR0 D;  4DV5 D;  4K0K D;  4X62 D;  2UXD D;  3KBG A;  4DR4 D;  5IWA D;  2IST A;  4NXM D;  1VIO A;  1IBK D;  4YY3 D;  4JI0 D;  4LFC D;  1XNR D;  2E5L D;  1FJG D;  1JH3 A;  2UUA D;  4OX9 D;  4JI6 D;  4LF9 D;  2F4V D;  3T1Y D;  4DR1 D;  4LF6 D;  4X65 D;  1N34 D;  1P9K A;  3OTO D;  1KSL A;  1XMQ D;  4KHP D;  1N33 D;  5LMU D;  4DR7 D;  4LF8 D;  1N36 D;  4JYA D;  2UXC D;  4DR3 D;  4JI3 D;  2ZM6 D;  1KSK A;  1H3F A;  2HHH D;  4JI5 D;  2VQE D;  4LF7 D;  4DUZ D;  4LFA D;  4B3M D;  1H3E A;  4OUD A;  1HNX D;  2UXB D;  4JI7 D;  4DV4 D;  4GKJ D;  4DR2 D;  1J5E D;  1I94 D;  2UUC D;  3HP7 A;  4DV0 D;  4LF5 D;  4X66 D;  4JI1 D;  1C05 A;  4DR6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...