4LFCE

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lfcE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfcE02
2UUAI 4LF7I 4DR1I 3Q1QA 1J5EE 3J80C 2EZ6A 3OTOE 3HULA 4DPXA 4JI2I 4X65I 2UUAE 2DEJA 1IBKE 2L3JA 4JYAE 4KHPI 1T4OA 5FLXC 1XNRE 1Z5CA 4XTJA 3K17A 1Z5BA 4LFBE 4M1KA 1N32I 2UU9E 2LJPA 4DV4E 1KVKA 1KKHA 3WU4A 3JAMC 3QT5A 4JV5I 2EFGA 4B3SE 2V8PA 3ZM7A 3ADLA 3V5RA 2L2KB 1D6TA 1N32E 4UTGA 4JI5I 3J7AG 5IT9Q 3GONA 4JI3E 1ZBTA 1PIEA 2X36A 4DR6E 3ADJA 3T1HE 1H73A 2KHXA 1VISA 4USKA 4JI4E 4WYQB 4DR7I 3LTOA 5A2QQ 2X7IA 4LF5I 1RR9A 1N0VC 1PKPA 2RTXA 1FNMA 4PRXA 2ZITA 4M30A 1X49A 1ELOA 3WU3A 2LBSB 2VF3A 4WUBA 3PYFA 4JI8E 5LMNI 2HKEA 2CZ9A 2N3GA 3ADIA 2LUQA 2ZM6I 4JI1E 4DUZE 1XHKA 4DU7A 1I94E 1H7UA 5BR8I 4URLA 4DU8A 1IBMI 5LMUI 5IT9C 4NXME 2J7KA 1NZ0A 4X65E 2B3TB 4HACA 4JI6E 3K1JA 4Z7CA 2B7TA 4KQVA 1IBLI 1N33E 3LPSA 1FI4A 4DR1E 1UEKA 4DV6E 4MYTA 2Q2EB 1EI1A 4B3RI 3LNUA 4YHHE 2UXCE 2HKJA 4DUZI 2LTSA 2UU9I 1HNZE 1FJGE 1MX0A 4DUYI 1ZM4A 4HACB 1HNZI 4HYMA 4KHPE 4JI7E 4B3TE 4FWHA 2DEIA 2IHR1 2UXBI 1IBLE 1X48A 2B7VA 3VYYA 1NHJA 2BM0A 2NA2A 1N36E 4RPFA 5GMEA 4FWGA 4DV6I 4LFCE 5IWAE 4UT4A 2OI2A 4I3HA 2AJ4A 3ZKBA 2HK2A 1J5EI 1MG7A 4USMA 1B63A 5FLXQ 5L3JA 1Z0GA 1Z0CA 5BR8E 4NXNI 1I94I 4FWDA 2V34A 3M6AA 4LFAI 4DR4E 1QZRA 1XMQE 2V2VA 2UUCE 2RSMA 1Z0BA 1O0WA 4X66I 1B62A 4DPTA 2BV3A 4OX9E 4P7AA 1WUUA 4HXZA 1RREA 4DR7E 4AQYE 1UHZA 1XNQI 1T4LB 4JI6I 3QT8A 4DKKA 4DR6I 4HY1A 1N36I 3WU5A 3T1YE 1XMOI 4LF8E 4JI3I 4LFBI 4WUDA 4YY3I 3C4BA 2N3HA 4B3MI 1HR0I 4B3SI 1WHQA 2ZM6E 4OX9I 1YZ9A 4LF6E 3J81C 3WU6A 4DR5I 2R3VA 4ZVIA 2LJHA 1XNRI 1YYWA 1PVGA 2E1RA 3J80Q 1HNXI 3P1XA 1XMQI 1NHIA 1N34I 2LRSA 2L2NA 1ZXNA 1Z59A 3JAMQ 3V2UC 3F0NA 4DV7I 4JI0E 1A6FA 2HK3A 1Z5AA 2HHHI 1KIJA 4JV5E 4PRVA 4DV1I 1YYOA 1GQEA 4DV0I 4EMDA 4YY3E 5A2QC 1N0UA 2UXDE 2DB2A 4DR4I 2DIXA 1HNWE 2F4VE 4JYAI 4DR2E 1XNQE 2UUBE 4DR3I 4AQYI 2A2DA 4JI7I 4DV7E 3J7AM 4X64I 2LTRA 2RS6A 4P52A 1WHNA 4JI2E 1FKAE 2F4VI 4DV3I 4LF4E 2WW4A 3QT6A 4DV0E 2GS8A 2JY9A 1N33I 2VQEI 2DMYA 1HNWI 4DV4I 4K0KI 4PU9A 4DV2I 1N34E 3H4LA 4GKKI 4DPWA 3VYXA 4OOGC 1HR0E 2VQEE 2NUGA 4FN5A 4M2ZA 4GKKE 4LFAE 1RQ0A 4DUYE 3ZZUA 4DXLA 2V2ZA 4K0KE 4LF4I 2HFSA 4Z7YA 3J7Yp 1J26A 1FWLA 1KTVA 3T1HI 4JI0I 2VQFE 4GKJE 1DARA 1U2RA 1S4EA 3ZZTA 4X64E 4LF7E 2A2CA 1H7SA 1H72C 4LF6I 1ZM9A 1NHHA 4LFCI 1X47A 3PYGA 4X8WA 1EA6A 3J81Q 2UUCI 2LUPB 1STUA 4X62I 1YYKA 4MYUA 1FWKA 2NUEA 4LF8I 1XMOE 4DR3E 4LF9E 2RS7A 4NXNE 4DPYA 3PYDA 3QT7A 2MDRA 2V2QA 2XEXA 3B82A 5LL6R 4LF5E 1H74A 4JG4A 3B78A 3CWVA 4JI4I 1HNXE 1S16A 4FW9A 2E5LI 3C4TA 2R42A 3OTOI 4JI5E 4DV2E 2ZBKB 5LMNE 4ED4A 4DR5E 3ZZ0A 1ZXMA 2L2MA 2NUFA 1UILA 2UXDI 4B3TI 1K47A 1IBME 3ADGA 2JVAA 1QU6A 5CFFE 4B3ME 2HHHE 2HFUA 1Z0WA 4DV3E 3B8HA 2CPNA 3LLHA 4DV5I 1ZM2A 1BKNA 1Z0EA 1OJ4A 2L3CA 2UUBI 4R1FA 4DR2I 1MU5A 4DV5E 1FJGI 2VQFI 4GKJI 2UXCI 3ZKDA 4WFTA 3HTXA 2NPFA 1Z0TA 1Z0VA 2YT4A 2L33A 2UXBE 4YHHI 4LF9I 1IBKI 4X66E 1T4NA 4NXMI 4DPUA 3PYEA 4X62E 1EKZA 5LMUE 1ZM3A 2BM1A 1RC7A 4WUCA 4DV1E 4JI1I 3T1YI 2E5LE 1DI2A 5GMDA 4JI8I 4B3RE 5IWAI 3D4JA
chains in the Genus database with same CATH superfamily
2UUAI 4LF7I 4DR1I 2EN4A 3Q1QA 2L92A 1UBDC 2EOZA 4IS9A 1J5EE 2D9HA 2EL6A 3J80C 2EZ6A 2YRHA 3OTOE 1Y5YA 3HULA 4FK5C 4DPXA 4JI2I 4X65I 1Y6ZA 5A6AA 4R2QA 3UK3C 4IFDD 2EOHA 3AV0A 2UUAE 2DEJA 2EPMX 1IBKE 2L3JA 2BA0D 3H09A 2JEBB 4JYAE 2EL4A 4KHPI 2EN3A 1T4OA 4GEQB 2ODRD 1A1FA 4IFDB 5FLXC 2EM4A 1XNRE 1Z5CA 4XTJA 4FW4A 3K17A 2PO1A 1Z5BA 1YPNA 4LFBE 4M1KA 1N32I 5IV8B 4R03A 1P47A 2C38B 3GCMA 2UU9E 2LJPA 4DV4E 1KVKA 1KKHA 3U1KA 3WU4A 3JAMC 2PNZB 4WSPA 2PO2A 2EFGA 3QT5A 4JV5I 4B3SE 3HKMA 1MEYC 2V8PA 2DRPA 3ZM7A 3ADLA 2EPRA 4WX9A 3V5RA 2YU8A 2L2KB 3D4JA 1D6TA 2PO2B 1N32E 3F6GA 4UTGA 4JI5I 4M0VA 3AUZA 3J7AG 3GONA 4JI3E 5IT9Q 1ZBTA 1USUA 1PIEA 2X36A 4DR6E 4BC9A 2NN6C 2EM0A 3ADJA 1YUIA 3T1HE 1H73A 4IFDE 2KHXA 4BMJA 1VISA 4USKA 4JI4E 4WYQB 4DR7I 3LTOA 5A2QQ 2KOUA 4NHRA 2X7IA 2K7IA 1YH8A 4LF5I 1RR9A 1N0VC 2EL5A 1PKPA 2RTXA 2EOFA 1AAYA 2EPLX 1FNMA 4PRXA 2ZITA 4MU0A 2EM2A 3EPKA 4M30A 1X49A 1ELOA 3WU3A 2LBSB 1UDQA 2VF3A 5KL7A 2EMHA 2EOYA 4WUBA 5K36F 3PYFA 4JI8E 5LMNI 2HKEA 2CZ9A 2N3GA 4J3DA 3ADIA 2YWQA 4R2AA 2LUQA 4F9BB 2O3ZA 3PS2A 2ZM6I 4JI1E 2YU5A 4DUZE 2EMIA 2PNLA 1XHKA 4DU7A 1I94E 5C0XB 1H7UA 5BR8I 4URLA 4MLVA 5DNXA 4DU8A 1IBMI 5LMUI 2FTXB 4TUGA 5KL3A 2AE8A 5IT9C 1GTKA 3M85D 2A25A 4WXDA 4NXME 3JU0A 1HK7A 1NZ0A 2J7KA 3PS3A 1KJKA 4X65E 1LLMC 4OO1F 2B3TB 2V83A 5ADZA 1BB8A 2EJ4A 4JI6E 2WP8A 4O4KA 2EMBA 2EMFA 3K1JA 2B7TA 2MC5A 4Z7CA 4KQVA 2EPUA 3IWBA 4X9JA 4IZJB 1IBLI 1N33E 3LPSA 2KONA 1X6EA 1FI4A 4DR1E 1UEKA 4MLQA 4DV6E 2CG9A 4MYTA 2Q2EB 1KYQA 4ZYHA 1EI1A 4B3RI 3LNUA 4O5GA 4YHHE 4IS1C 2WBSA 2UXCE 2Z5BA 2HKJA 2ENAA 2LTSA 4O43A 2L8TA 1HNZE 5JEAE 4DUZI 4WSGA 2UU9I 1FJGE 2MC6A 5C0XE 1MX0A 4N4RB 4QNJA 1A1KA 4DUYI 3M7ND 1ZM4A 2JOXA 4HACB 1HNZI 4HYMA 4GZNC 1G2FC 3BF2A 4OO1A 4KHPE 4JI7E 3KZZA 2JT2A 1X5WA 5IXMB 4RHBB 2O1TA 2R1FA 3C6KA 3THOB 4B3TE 3PRYA 4FWHA 2GO3A 3UHMA 2DLKA 2DEIA 2IHR1 2JPAA 2CT1A 1G2DC 2EMKA 1IBLE 1X48A 2B7VA 1UN6B 3P3GA 3VYYA 1UDNA 3CDJA 5FWKA 2JWOA 4P78A 1NHJA 3F6HA 1YSAC 1T38A 2BM0A 2NA2A 1N36E 4OO1D 2HC5A 4RPFA 2EN6A 5A69A 5GMEA 1YUJA 4HEIA 4FWGA 4DV6I 3M7NG 5C0XC 4LFCE 5IWAE 1X6FA 2EM7A 4UT4A 2OI2A 4I3HA 5K36B 2AJ4A 4ZYGA 3ZKBA 2EM5A 2HK2A 2M9AA 2I13A 1J5EI 2C39A 5JEAF 1MG7A 4USMA 2Q8UA 4BBYA 1B63A 2GPIA 5FLXQ 2FV4B 2PRTA 5L3JA 2K4VA 2IOPA 2WP8B 5AE1A 3DJWA 1Z0GA 2NN6E 2Z5CB 1IQOA 4QNKA 1Z0CA 5BR8E 2EPOA 4NXNI 3HQ1A 1I94I 4FWDA 2V34A 4FW6A 3M6AA 4LFAI 4DR4E 1QZRA 1XMQE 5AE3A 3KWRA 2V2VA 1IMUA 4AM3A 2PNMA 2UUCE 3PS1A 2EN8A 3MHSC 2RSMA 1Z0BA 1O0WA 4X66I 1B62A 1EH6A 5K36C 4DPTA 4MU1A 2BV3A 2LCEA 1B69A 4OX9E 4P7AA 2MKDA 1WUUA 4HXZA 4NBQA 2EM8A 1RREA 2EQ1A 4LOMA 4LCHA 5JEAC 4DR7E 2UXBI 5K36E 1OYSA 5DROA 4AQYE 4MU4A 1UHZA 1XNQI 1T4LB 4JI6I 2BR2A 3QT8A 4DKKA 4DR6I 5AASA 4HY1A 1N36I 3WU5A 3T1YE 2EOSA 3P3EA 2YTFA 5EL9A 4LF8E 2NN6D 2PO0B 1XMOI 4JI3I 4LFBI 2E1MA 4WUDA 2Z5BB 4YY3I 2BB8A 2ADRA 3C4BA 3M99B 2N3HA 4B3MI 1GZ6A 2O1WA 2YTOA 2ELYA 2VE7C 1HR0I 2EQ3A 3MSWA 1R6MA 4B3SI 1WHQA 3HXLA 2ZM6E 2LVHA 4OX9I 1XXEA 1YZ9A 4LF6E 4IJDA 3J81C 2LJUA 2EPAA 2LE2A 1JK1A 2WNRA 3WU6A 4Q28A 4DR5I 1E3PA 4L5NC 2R3VA 4F2JC 2DLQA 4F6NA 3FIGA 4ZVIA 5KL5A 1A1GA 4LCFA 1R6LA 2LJHA 5JEAD 1XNRI 2HGHA 4BS9A 1YYWA 1PVGA 2WNRB 3LMLA 2E1RA 2Z5CA 4F9AB 3J80Q 2LT7A 1T39A 2YRKA 1HNXI 3P1XA 1XMQI 3EQ1A 1NHIA 2GHFA 4IFDC 2PO1B 1N34I 4BC7A 4Q35B 4LU9A 1Y60A 2IOQA 2V89A 2IESA 2LRSA 2L2NA 2JEAA 4L8NA 3QG5C 2EMXA 4R2EA 2YRMA 4ZYDA 2CSHA 1Z59A 2JXPA 1ZXNA 3THNA 3JAMQ 3KZYA 3V2UC 3F0NA 2EMGA 4KWYA 4DV7I 4JI0E 3Q6NA 2YSOA 5C0XF 2YSPA 1A6FA 5JEAB 1NCSA 3K85A 2MDGA 2HK3A 2YZTA 1ZR9A 4LTYA 2YPNA 2HJJA 2EE8A 4HACA 1Z5AA 2HHHI 2V8QB 1KIJA 4JV5E 5T6JA 3M85G 2R76A 2EORA 1E3HA 1L4SA 4PRVA 4DV1I 1YYOA 1GQEA 4DV0I 4HTGA 2BR2B 4P7DA 5TSEA 4EMDA 4TUIA 4YY3E 2EN2A 4BHCA 5A2QC 4IFDF 1N0UA 2UXDE 3IWDA 5F3WA 5K36D 2EM3A 5DNLA 3EPLA 2GLIA 2DB2A 5A6BD 2G7HA 4LCGA 2DIXA 4DR4I 1HNWE 2ENHA 2F4VE 4JYAI 4DR2E 4R2DA 5AC4A 2UUBE 1XNQE 3CDIA 4DR3I 4AQYI 2EOJA 2A2DA 2O1VA 4U3BA 4JI7I 4DV7E 3J7AM 4X64I 4OZEA 2LTRA 2RPCA 2EMYA 2IERA 2RS6A 1VI7A 3HPZA 1WHNA 4JI2E 4P52A 4IZKA 1FKAE 2E72A 1OYRA 3JTZA 5A6BA 2F4VI 2EMZA 5AE2A 4F54A 1EH7A 4LPFA 4DV3I 2JYAA 2V87A 2V85A 2WZOA 4LF4E 2WW4A 4IFDA 3QT6A 2EPCA 1WJPA 3DF6A 5C0XD 3KRNA 4DV0E 1A1JA 2YTNA 2GS8A 2JY9A 1N33I 2VQEI 2JE6A 4ISAA 1SR9A 4O24A 1Y4SA 2DMYA 3OMLA 3Q6MA 4FW5A 4AIMA 2LO3A 1HNWI 4DV4I 5DRRA 2YTDA 2BBGA 1UDSA 4K0KI 2CGEA 4PU9A 4DV2I 4KZSA 2EPNA 1N34E 2C38A 3B4TA 4MQYA 3H4LA 4GKKI 4DPWA 1F2IG 4OO1B 3VYXA 4OOGC 1HR0E 1X6HA 2VQEE 2NUGA 4FN5A 4M2ZA 4GKKE 1NEIA 3MHHC 4LFAE 2O1UA 4U3DA 1RQ0A 2M7QA 4DUYE 4F6MA 2MKNA 2BA1D 3ZZUA 4DXLA 2V2ZA 4K0KE 4LF4I 2HFSA 3TQMA 3J7Yp 4Z7YA 1J26A 1FWLA 1KTVA 3T1HI 4JI0I 5DNYA 4R2RA 4BA1A 1IQSA 2VQFE 4GKJE 5KL4A 2EPZA 1YFHA 1DARA 2F8BA 1U2RA 4MDTA 1QNTA 1SFEA 2LMZA 4X64E 1S4EA 3P3CA 3ZZTA 5KL2A 2N8XA 4LF7E 2A2CA 2YTIA 1H7SA 1H72C 4FW3A 4LF6I 4R8OA 2EMWA 1NHHA 1ZM9A 4LFCI 1BBOA 2CTDA 1X47A 2I9IA 2ODRC 2EPPA 3PYGA 1Y4UA 5JEAA 2B9DA 4X8WA 3HPSA 3VHTB 4BA2A 1EA6A 3J81Q 5C0XA 1OYPA 2UUCI 2LUPB 2CVEA 1STUA 4X62I 1WXRA 4BA1B 1YYKA 2EOMA 2YTPA 4MYUA 1FWKA 2NUEA 4LF8I 2JEAB 2VRDA 1XMOE 2EMAA 4DR3E 4OO1E 3P06A 5KL6A 4LF9E 2EOIA 2RS7A 1USVA 3P76A 4NXNE 2ELZA 4DPYA 3NZKA 1ZAAC 3PYDA 3QT7A 1TF3A 4IZJA 3H1CA 2DMIA 1RMDA 2MDRA 4ZYEA 2V2QA 2NN6F 2XEXA 3B82A 1ZBQA 5LL6R 2EN7A 2YTQA 4WPYA 3ZOQB 3EPJA 3U1YA 2Z5EA 5ELWA 4LF5E 1H74A 4JG4A 2EPKX 3B78A 5EKWA 1ZU1A 3CWVA 4JI4I 2YTJA 1EH8A 1DGCA 1UDOA 3BGHA 1HNXE 4F9CB 1WRJA 1S16A 4FW9A 2E5LI 2DGCA 2LV2A 3C4TA 2R42A 1BBGA 1A1HA 4I8OA 3OTOI 4JI5E 2FGGA 2JR1A 4DV2E 2NABA 5LMNE 2ZBKB 4ED4A 2GO4A 3HJCA 4DR5E 5A6JA 3ZZ0A 1ZXMA 3EPHA 2L2MA 2NUFA 1UILA 2NN6A 4MU3A 4AIDA 2UXDI 2EP3A 3L00A 4BCAA 2ENCA 2EQ0A 1Z1BA 4B3TI 1K47A 5AC5A 2YTGA 1IBME 3ADGA 2BA1G 4IZKB 1JK2A 2F1DA 2JVAA 1DQ3A 1QU6A 5CFFE 4NZVA 2EOXA 4B3ME 2EMLA 2PO0A 2HHHE 2HFUA 1Z0WA 2VESA 2M4IA 2EN1A 4BA2B 5DRQA 4DV3E 1PJQA 2DSYA 1A1LA 3VK6A 2WBUA 3RMPA 2JE6B 3B8HA 2CPNA 1PJSA 2RQLA 1N3GA 1YHCA 2C39B 3LLHA 4DV5I 3ECRA 2VF1A 2BA0G 3IWCA 4BHBA 1ZM2A 2V86A 4R2PA 1BKNA 1Z0EA 1OJ4A 2JEBA 3L7ZB 2L3CA 4GQUA 2UUBI 2JP9A 5K36A 4R1FA 4DR2I 1MU5A 4DV5E 2WBTA 2EPXA 1FJGI 4RH8A 4M9VC 1P42A 1TF6A 2EMCA 2J7JA 5LLQA 2VQFI 4GKJI 3L7ZA 4J8ZA 2JOBA 2C37A 3ZKDA 2UXCI 4WFTA 3HTXA 2EOOA 4DMIA 2GQ0A 2J65A 3K6QA 4FW7A 4R2CA 2NPFA 3C6MA 2PNZA 4R2SA 1AH5A 1Z0TA 1Z0VA 2YT4A 2L33A 3GMEA 5DRPA 2UXBE 2EM9A 2H36X 2EOQA 4YHHI 4LF9I 2M1SA 3DD6A 2EOEA 2L6MA 1IBKI 4X66E 1T4NA 2YTEA 3BBGA 4NXMI 1PJTA 2EM6A 4DPUA 4WXCA 4IZJD 3PYEA 4N3OA 4X62E 1MGTA 1EKZA 5LMUE 1ZM3A 2BM1A 1RC7A 1X3CA 2C37B 5A6KA 2EWLA 1TN9A 4WUCA 1A1IA 4OO1C 4DV1E 1PDAA 4OKGA 2NN6B 4JI1I 3GLLA 2RSIA 3BIDA 3T1YI 2V88A 2E5LE 1DI2A 1RHYA 5GMDA 4JI8I 4B3RE 5IWAI 2WCC3
chains in the Genus database with same CATH topology
2UUAI 4LF7I 4DR1I 3Q1QA 2L92A 1J5EE 3J80C 2EZ6A 3OTOE 3HULA 4DPXA 4JI2I 4X65I 1Y6ZA 3AV0A 2UUAE 2DEJA 1IBKE 2L3JA 3H09A 4JYAE 4KHPI 1T4OA 4GEQB 2ODRD 5FLXC 1XNRE 1Z5CA 4XTJA 3K17A 1Z5BA 4LFBE 4M1KA 1N32I 4R03A 2UU9E 2LJPA 4DV4E 1KVKA 1KKHA 3WU4A 3JAMC 4WSPA 3QT5A 2EFGA 4JV5I 4B3SE 2V8PA 3ZM7A 3ADLA 3V5RA 2L2KB 1D6TA 1N32E 3F6GA 4UTGA 4JI5I 4M0VA 3AUZA 3J7AG 3GONA 4JI3E 5IT9Q 1ZBTA 1USUA 1PIEA 2X36A 4DR6E 4BC9A 3ADJA 3T1HE 1H73A 2KHXA 4BMJA 1VISA 4USKA 4JI4E 4WYQB 4DR7I 3LTOA 5A2QQ 2KOUA 2X7IA 4LF5I 1RR9A 1N0VC 1PKPA 2RTXA 1FNMA 4PRXA 2ZITA 4M30A 1X49A 1ELOA 3WU3A 2LBSB 2VF3A 4WUBA 3PYFA 4JI8E 5LMNI 2HKEA 2CZ9A 2N3GA 3ADIA 2LUQA 4F9BB 2ZM6I 4JI1E 4DUZE 2PNLA 1XHKA 4DU7A 1I94E 1H7UA 5BR8I 4URLA 4DU8A 1IBMI 5LMUI 2FTXB 4TUGA 5IT9C 4NXME 1HK7A 3JU0A 1NZ0A 2J7KA 4X65E 2B3TB 2V83A 5ADZA 4HACA 4JI6E 3K1JA 4Z7CA 2B7TA 2MC5A 4KQVA 3IWBA 4IZJB 1IBLI 1N33E 3LPSA 2KONA 1FI4A 4DR1E 1UEKA 4DV6E 2CG9A 4MYTA 2Q2EB 1EI1A 4B3RI 3LNUA 4YHHE 2UXCE 2Z5BA 2HKJA 4DUZI 2LTSA 2UU9I 2L8TA 1HNZE 1FJGE 2MC6A 1MX0A 4DUYI 1ZM4A 2JOXA 4HACB 1HNZI 4HYMA 4KHPE 4JI7E 2O1TA 4B3TE 3PRYA 4FWHA 2DEIA 2IHR1 2UXBI 1IBLE 1X48A 2B7VA 3VYYA 5FWKA 2JWOA 4P78A 1NHJA 3F6HA 2BM0A 2NA2A 1N36E 4RPFA 5GMEA 4FWGA 4DV6I 4LFCE 5IWAE 4UT4A 2OI2A 4I3HA 2AJ4A 3ZKBA 2HK2A 1J5EI 1MG7A 4USMA 4BBYA 1B63A 5FLXQ 2FV4B 5L3JA 2K4VA 2IOPA 5AE1A 3DJWA 1Z0GA 2Z5CB 1Z0CA 5BR8E 4NXNI 3HQ1A 1I94I 4FWDA 2V34A 3M6AA 4LFAI 4DR4E 1QZRA 1XMQE 5AE3A 3KWRA 2V2VA 2PNMA 2UUCE 2RSMA 1Z0BA 1O0WA 4X66I 1B62A 4DPTA 2BV3A 4OX9E 4P7AA 1WUUA 4HXZA 1RREA 4DR7E 4AQYE 1UHZA 1XNQI 1T4LB 4JI6I 3QT8A 4DKKA 4DR6I 5AASA 4HY1A 1N36I 3WU5A 3T1YE 1XMOI 4LF8E 4JI3I 4LFBI 2E1MA 4WUDA 2Z5BB 4YY3I 3C4BA 2N3HA 4B3MI 1GZ6A 2O1WA 2VE7C 1HR0I 3MSWA 4B3SI 1WHQA 3HXLA 2ZM6E 4OX9I 1YZ9A 4LF6E 3J81C 2LE2A 3WU6A 4Q28A 4DR5I 4L5NC 2R3VA 3FIGA 4ZVIA 2LJHA 1XNRI 4BS9A 1YYWA 1PVGA 3LMLA 2E1RA 2Z5CA 4F9AB 3J80Q 1HNXI 3P1XA 1XMQI 1NHIA 1N34I 4BC7A 4LU9A 2IOQA 2V89A 2LRSA 2L2NA 4L8NA 1ZXNA 1Z59A 3JAMQ 3V2UC 3F0NA 4DV7I 4JI0E 3Q6NA 1A6FA 3K85A 2HK3A 2YZTA 4LTYA 1Z5AA 2HHHI 2V8QB 1KIJA 4JV5E 5T6JA 4PRVA 4DV1I 1YYOA 1GQEA 4DV0I 4P7DA 4EMDA 4TUIA 4YY3E 5A2QC 1N0UA 2UXDE 3IWDA 5F3WA 2DB2A 4DR4I 2G7HA 2DIXA 1HNWE 2F4VE 4JYAI 4DR2E 1XNQE 2UUBE 4DR3I 4AQYI 2A2DA 2O1VA 4JI7I 4DV7E 3J7AM 4X64I 2LTRA 2RS6A 3HPZA 1WHNA 4JI2E 4P52A 4IZKA 1FKAE 3JTZA 2F4VI 5AE2A 4F54A 4DV3I 2V85A 2V87A 4LF4E 2WZOA 2WW4A 3QT6A 3DF6A 4DV0E 2GS8A 2JY9A 1N33I 2VQEI 1SR9A 1Y4SA 2DMYA 3OMLA 3Q6MA 1HNWI 4DV4I 4K0KI 2CGEA 4PU9A 4DV2I 4KZSA 1N34E 3H4LA 4GKKI 4DPWA 3VYXA 4OOGC 1HR0E 2VQEE 2NUGA 4FN5A 4M2ZA 4GKKE 4LFAE 2O1UA 1RQ0A 2M7QA 4DUYE 3ZZUA 4DXLA 2V2ZA 4K0KE 4LF4I 2HFSA 3J7Yp 4Z7YA 1J26A 1FWLA 1KTVA 3T1HI 4JI0I 5DNYA 4GKJE 2VQFE 1DARA 2F8BA 1U2RA 2LMZA 1S4EA 4X64E 3ZZTA 4LF7E 2A2CA 1H7SA 1H72C 4LF6I 4R8OA 1ZM9A 1NHHA 4LFCI 1X47A 2ODRC 3PYGA 1Y4UA 2B9DA 4X8WA 3HPSA 1EA6A 3J81Q 2UUCI 2LUPB 1STUA 4X62I 1WXRA 1YYKA 4MYUA 1FWKA 2NUEA 4LF8I 1XMOE 4DR3E 3P06A 4LF9E 1USVA 2RS7A 4NXNE 4DPYA 3PYDA 3QT7A 4IZJA 2MDRA 2V2QA 2XEXA 3B82A 1ZBQA 5LL6R 3ZOQB 4WPYA 2Z5EA 4LF5E 1H74A 4JG4A 3B78A 3CWVA 4JI4I 1HNXE 4F9CB 1S16A 4FW9A 2E5LI 3C4TA 2R42A 4I8OA 3OTOI 4JI5E 2FGGA 2JR1A 4DV2E 5LMNE 2ZBKB 4ED4A 3HJCA 4DR5E 3ZZ0A 1ZXMA 2L2MA 2NUFA 1UILA 2UXDI 4BCAA 4B3TI 1K47A 4IZKB 1IBME 3ADGA 2JVAA 1DQ3A 1QU6A 5CFFE 4B3ME 2HHHE 2HFUA 1Z0WA 2M4IA 4DV3E 2DSYA 3VK6A 3RMPA 3B8HA 2CPNA 3LLHA 4DV5I 2VF1A 3IWCA 1ZM2A 2V86A 1BKNA 1Z0EA 1OJ4A 2L3CA 2UUBI 4R1FA 4DR2I 1MU5A 4DV5E 1FJGI 2VQFI 4GKJI 2UXCI 4J8ZA 2JOBA 3ZKDA 4WFTA 3HTXA 2GQ0A 4DMIA 3K6QA 2NPFA 1Z0TA 1Z0VA 2YT4A 2L33A 2UXBE 2H36X 4YHHI 4LF9I 2M1SA 2L6MA 1IBKI 4X66E 1T4NA 4NXMI 4DPUA 4IZJD 3PYEA 4N3OA 4X62E 1EKZA 5LMUE 1ZM3A 2BM1A 1RC7A 4WUCA 2EWLA 4DV1E 4JI1I 3T1YI 2V88A 2E5LE 1DI2A 5GMDA 4JI8I 4B3RE 5IWAI 3D4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA I;  4LF7 I;  4DR1 I;  3Q1Q A;  1J5E E;  3J80 C;  2EZ6 A;  3OTO E;  3HUL A;  4DPX A;  4JI2 I;  4X65 I;  2UUA E;  2DEJ A;  1IBK E;  2L3J A;  4JYA E;  4KHP I;  1T4O A;  5FLX C;  1XNR E;  1Z5C A;  4XTJ A;  3K17 A;  1Z5B A;  4LFB E;  4M1K A;  1N32 I;  2UU9 E;  2LJP A;  4DV4 E;  1KVK A;  1KKH A;  3WU4 A;  3JAM C;  3QT5 A;  4JV5 I;  2EFG A;  4B3S E;  2V8P A;  3ZM7 A;  3ADL A;  3V5R A;  2L2K B;  1D6T A;  1N32 E;  4UTG A;  4JI5 I;  3J7A G;  5IT9 Q;  3GON A;  4JI3 E;  1ZBT A;  1PIE A;  2X36 A;  4DR6 E;  3ADJ A;  3T1H E;  1H73 A;  2KHX A;  1VIS A;  4USK A;  4JI4 E;  4WYQ B;  4DR7 I;  3LTO A;  5A2Q Q;  2X7I A;  4LF5 I;  1RR9 A;  1N0V C;  1PKP A;  2RTX A;  1FNM A;  4PRX A;  2ZIT A;  4M30 A;  1X49 A;  1ELO A;  3WU3 A;  2LBS B;  2VF3 A;  4WUB A;  3PYF A;  4JI8 E;  5LMN I;  2HKE A;  2CZ9 A;  2N3G A;  3ADI A;  2LUQ A;  2ZM6 I;  4JI1 E;  4DUZ E;  1XHK A;  4DU7 A;  1I94 E;  1H7U A;  5BR8 I;  4URL A;  4DU8 A;  1IBM I;  5LMU I;  5IT9 C;  4NXM E;  2J7K A;  1NZ0 A;  4X65 E;  2B3T B;  4HAC A;  4JI6 E;  3K1J A;  4Z7C A;  2B7T A;  4KQV A;  1IBL I;  1N33 E;  3LPS A;  1FI4 A;  4DR1 E;  1UEK A;  4DV6 E;  4MYT A;  2Q2E B;  1EI1 A;  4B3R I;  3LNU A;  4YHH E;  2UXC E;  2HKJ A;  4DUZ I;  2LTS A;  2UU9 I;  1HNZ E;  1FJG E;  1MX0 A;  4DUY I;  1ZM4 A;  4HAC B;  1HNZ I;  4HYM A;  4KHP E;  4JI7 E;  4B3T E;  4FWH A;  2DEI A;  2IHR 1;  2UXB I;  1IBL E;  1X48 A;  2B7V A;  3VYY A;  1NHJ A;  2BM0 A;  2NA2 A;  1N36 E;  4RPF A;  5GME A;  4FWG A;  4DV6 I;  4LFC E;  5IWA E;  4UT4 A;  2OI2 A;  4I3H A;  2AJ4 A;  3ZKB A;  2HK2 A;  1J5E I;  1MG7 A;  4USM A;  1B63 A;  5FLX Q;  5L3J A;  1Z0G A;  1Z0C A;  5BR8 E;  4NXN I;  1I94 I;  4FWD A;  2V34 A;  3M6A A;  4LFA I;  4DR4 E;  1QZR A;  1XMQ E;  2V2V A;  2UUC E;  2RSM A;  1Z0B A;  1O0W A;  4X66 I;  1B62 A;  4DPT A;  2BV3 A;  4OX9 E;  4P7A A;  1WUU A;  4HXZ A;  1RRE A;  4DR7 E;  4AQY E;  1UHZ A;  1XNQ I;  1T4L B;  4JI6 I;  3QT8 A;  4DKK A;  4DR6 I;  4HY1 A;  1N36 I;  3WU5 A;  3T1Y E;  1XMO I;  4LF8 E;  4JI3 I;  4LFB I;  4WUD A;  4YY3 I;  3C4B A;  2N3H A;  4B3M I;  1HR0 I;  4B3S I;  1WHQ A;  2ZM6 E;  4OX9 I;  1YZ9 A;  4LF6 E;  3J81 C;  3WU6 A;  4DR5 I;  2R3V A;  4ZVI A;  2LJH A;  1XNR I;  1YYW A;  1PVG A;  2E1R A;  3J80 Q;  1HNX I;  3P1X A;  1XMQ I;  1NHI A;  1N34 I;  2LRS A;  2L2N A;  1ZXN A;  1Z59 A;  3JAM Q;  3V2U C;  3F0N A;  4DV7 I;  4JI0 E;  1A6F A;  2HK3 A;  1Z5A A;  2HHH I;  1KIJ A;  4JV5 E;  4PRV A;  4DV1 I;  1YYO A;  1GQE A;  4DV0 I;  4EMD A;  4YY3 E;  5A2Q C;  1N0U A;  2UXD E;  2DB2 A;  4DR4 I;  2DIX A;  1HNW E;  2F4V E;  4JYA I;  4DR2 E;  1XNQ E;  2UUB E;  4DR3 I;  4AQY I;  2A2D A;  4JI7 I;  4DV7 E;  3J7A M;  4X64 I;  2LTR A;  2RS6 A;  4P52 A;  1WHN A;  4JI2 E;  1FKA E;  2F4V I;  4DV3 I;  4LF4 E;  2WW4 A;  3QT6 A;  4DV0 E;  2GS8 A;  2JY9 A;  1N33 I;  2VQE I;  2DMY A;  1HNW I;  4DV4 I;  4K0K I;  4PU9 A;  4DV2 I;  1N34 E;  3H4L A;  4GKK I;  4DPW A;  3VYX A;  4OOG C;  1HR0 E;  2VQE E;  2NUG A;  4FN5 A;  4M2Z A;  4GKK E;  4LFA E;  1RQ0 A;  4DUY E;  3ZZU A;  4DXL A;  2V2Z A;  4K0K E;  4LF4 I;  2HFS A;  4Z7Y A;  3J7Y p;  1J26 A;  1FWL A;  1KTV A;  3T1H I;  4JI0 I;  2VQF E;  4GKJ E;  1DAR A;  1U2R A;  1S4E A;  3ZZT A;  4X64 E;  4LF7 E;  2A2C A;  1H7S A;  1H72 C;  4LF6 I;  1ZM9 A;  1NHH A;  4LFC I;  1X47 A;  3PYG A;  4X8W A;  1EA6 A;  3J81 Q;  2UUC I;  2LUP B;  1STU A;  4X62 I;  1YYK A;  4MYU A;  1FWK A;  2NUE A;  4LF8 I;  1XMO E;  4DR3 E;  4LF9 E;  2RS7 A;  4NXN E;  4DPY A;  3PYD A;  3QT7 A;  2MDR A;  2V2Q A;  2XEX A;  3B82 A;  5LL6 R;  4LF5 E;  1H74 A;  4JG4 A;  3B78 A;  3CWV A;  4JI4 I;  1HNX E;  1S16 A;  4FW9 A;  2E5L I;  3C4T A;  2R42 A;  3OTO I;  4JI5 E;  4DV2 E;  2ZBK B;  5LMN E;  4ED4 A;  4DR5 E;  3ZZ0 A;  1ZXM A;  2L2M A;  2NUF A;  1UIL A;  2UXD I;  4B3T I;  1K47 A;  1IBM E;  3ADG A;  2JVA A;  1QU6 A;  5CFF E;  4B3M E;  2HHH E;  2HFU A;  1Z0W A;  4DV3 E;  3B8H A;  2CPN A;  3LLH A;  4DV5 I;  1ZM2 A;  1BKN A;  1Z0E A;  1OJ4 A;  2L3C A;  2UUB I;  4R1F A;  4DR2 I;  1MU5 A;  4DV5 E;  1FJG I;  2VQF I;  4GKJ I;  2UXC I;  3ZKD A;  4WFT A;  3HTX A;  2NPF A;  1Z0T A;  1Z0V A;  2YT4 A;  2L33 A;  2UXB E;  4YHH I;  4LF9 I;  1IBK I;  4X66 E;  1T4N A;  4NXM I;  4DPU A;  3PYE A;  4X62 E;  1EKZ A;  5LMU E;  1ZM3 A;  2BM1 A;  1RC7 A;  4WUC A;  4DV1 E;  4JI1 I;  3T1Y I;  2E5L E;  1DI2 A;  5GMD A;  4JI8 I;  4B3R E;  5IWA I;  3D4J A; 
#chains in the Genus database with same CATH topology
 2UUA I;  4LF7 I;  4DR1 I;  2EN4 A;  3Q1Q A;  2L92 A;  1UBD C;  2EOZ A;  4IS9 A;  1J5E E;  2D9H A;  2EL6 A;  3J80 C;  2EZ6 A;  2YRH A;  3OTO E;  1Y5Y A;  3HUL A;  4FK5 C;  4DPX A;  4JI2 I;  4X65 I;  1Y6Z A;  5A6A A;  4R2Q A;  3UK3 C;  4IFD D;  2EOH A;  3AV0 A;  2UUA E;  2DEJ A;  2EPM X;  1IBK E;  2L3J A;  2BA0 D;  3H09 A;  2JEB B;  4JYA E;  2EL4 A;  4KHP I;  2EN3 A;  1T4O A;  4GEQ B;  2ODR D;  1A1F A;  4IFD B;  5FLX C;  2EM4 A;  1XNR E;  1Z5C A;  4XTJ A;  4FW4 A;  3K17 A;  2PO1 A;  1Z5B A;  1YPN A;  4LFB E;  4M1K A;  1N32 I;  5IV8 B;  4R03 A;  1P47 A;  2C38 B;  3GCM A;  2UU9 E;  2LJP A;  4DV4 E;  1KVK A;  1KKH A;  3U1K A;  3WU4 A;  3JAM C;  2PNZ B;  4WSP A;  2PO2 A;  2EFG A;  3QT5 A;  4JV5 I;  4B3S E;  3HKM A;  1MEY C;  2V8P A;  2DRP A;  3ZM7 A;  3ADL A;  2EPR A;  4WX9 A;  3V5R A;  2YU8 A;  2L2K B;  3D4J A;  1D6T A;  2PO2 B;  1N32 E;  3F6G A;  4UTG A;  4JI5 I;  4M0V A;  3AUZ A;  3J7A G;  3GON A;  4JI3 E;  5IT9 Q;  1ZBT A;  1USU A;  1PIE A;  2X36 A;  4DR6 E;  4BC9 A;  2NN6 C;  2EM0 A;  3ADJ A;  1YUI A;  3T1H E;  1H73 A;  4IFD E;  2KHX A;  4BMJ A;  1VIS A;  4USK A;  4JI4 E;  4WYQ B;  4DR7 I;  3LTO A;  5A2Q Q;  2KOU A;  4NHR A;  2X7I A;  2K7I A;  1YH8 A;  4LF5 I;  1RR9 A;  1N0V C;  2EL5 A;  1PKP A;  2RTX A;  2EOF A;  1AAY A;  2EPL X;  1FNM A;  4PRX A;  2ZIT A;  4MU0 A;  2EM2 A;  3EPK A;  4M30 A;  1X49 A;  1ELO A;  3WU3 A;  2LBS B;  1UDQ A;  2VF3 A;  5KL7 A;  2EMH A;  2EOY A;  4WUB A;  5K36 F;  3PYF A;  4JI8 E;  5LMN I;  2HKE A;  2CZ9 A;  2N3G A;  4J3D A;  3ADI A;  2YWQ A;  4R2A A;  2LUQ A;  4F9B B;  2O3Z A;  3PS2 A;  2ZM6 I;  4JI1 E;  2YU5 A;  4DUZ E;  2EMI A;  2PNL A;  1XHK A;  4DU7 A;  1I94 E;  5C0X B;  1H7U A;  5BR8 I;  4URL A;  4MLV A;  5DNX A;  4DU8 A;  1IBM I;  5LMU I;  2FTX B;  4TUG A;  5KL3 A;  2AE8 A;  5IT9 C;  1GTK A;  3M85 D;  2A25 A;  4WXD A;  4NXM E;  3JU0 A;  1HK7 A;  1NZ0 A;  2J7K A;  3PS3 A;  1KJK A;  4X65 E;  1LLM C;  4OO1 F;  2B3T B;  2V83 A;  5ADZ A;  1BB8 A;  2EJ4 A;  4JI6 E;  2WP8 A;  4O4K A;  2EMB A;  2EMF A;  3K1J A;  2B7T A;  2MC5 A;  4Z7C A;  4KQV A;  2EPU A;  3IWB A;  4X9J A;  4IZJ B;  1IBL I;  1N33 E;  3LPS A;  2KON A;  1X6E A;  1FI4 A;  4DR1 E;  1UEK A;  4MLQ A;  4DV6 E;  2CG9 A;  4MYT A;  2Q2E B;  1KYQ A;  4ZYH A;  1EI1 A;  4B3R I;  3LNU A;  4O5G A;  4YHH E;  4IS1 C;  2WBS A;  2UXC E;  2Z5B A;  2HKJ A;  2ENA A;  2LTS A;  4O43 A;  2L8T A;  1HNZ E;  5JEA E;  4DUZ I;  4WSG A;  2UU9 I;  1FJG E;  2MC6 A;  5C0X E;  1MX0 A;  4N4R B;  4QNJ A;  1A1K A;  4DUY I;  3M7N D;  1ZM4 A;  2JOX A;  4HAC B;  1HNZ I;  4HYM A;  4GZN C;  1G2F C;  3BF2 A;  4OO1 A;  4KHP E;  4JI7 E;  3KZZ A;  2JT2 A;  1X5W A;  5IXM B;  4RHB B;  2O1T A;  2R1F A;  3C6K A;  3THO B;  4B3T E;  3PRY A;  4FWH A;  2GO3 A;  3UHM A;  2DLK A;  2DEI A;  2IHR 1;  2JPA A;  2CT1 A;  1G2D C;  2EMK A;  1IBL E;  1X48 A;  2B7V A;  1UN6 B;  3P3G A;  3VYY A;  1UDN A;  3CDJ A;  5FWK A;  2JWO A;  4P78 A;  1NHJ A;  3F6H A;  1YSA C;  1T38 A;  2BM0 A;  2NA2 A;  1N36 E;  4OO1 D;  2HC5 A;  4RPF A;  2EN6 A;  5A69 A;  5GME A;  1YUJ A;  4HEI A;  4FWG A;  4DV6 I;  3M7N G;  5C0X C;  4LFC E;  5IWA E;  1X6F A;  2EM7 A;  4UT4 A;  2OI2 A;  4I3H A;  5K36 B;  2AJ4 A;  4ZYG A;  3ZKB A;  2EM5 A;  2HK2 A;  2M9A A;  2I13 A;  1J5E I;  2C39 A;  5JEA F;  1MG7 A;  4USM A;  2Q8U A;  4BBY A;  1B63 A;  2GPI A;  5FLX Q;  2FV4 B;  2PRT A;  5L3J A;  2K4V A;  2IOP A;  2WP8 B;  5AE1 A;  3DJW A;  1Z0G A;  2NN6 E;  2Z5C B;  1IQO A;  4QNK A;  1Z0C A;  5BR8 E;  2EPO A;  4NXN I;  3HQ1 A;  1I94 I;  4FWD A;  2V34 A;  4FW6 A;  3M6A A;  4LFA I;  4DR4 E;  1QZR A;  1XMQ E;  5AE3 A;  3KWR A;  2V2V A;  1IMU A;  4AM3 A;  2PNM A;  2UUC E;  3PS1 A;  2EN8 A;  3MHS C;  2RSM A;  1Z0B A;  1O0W A;  4X66 I;  1B62 A;  1EH6 A;  5K36 C;  4DPT A;  4MU1 A;  2BV3 A;  2LCE A;  1B69 A;  4OX9 E;  4P7A A;  2MKD A;  1WUU A;  4HXZ A;  4NBQ A;  2EM8 A;  1RRE A;  2EQ1 A;  4LOM A;  4LCH A;  5JEA C;  4DR7 E;  2UXB I;  5K36 E;  1OYS A;  5DRO A;  4AQY E;  4MU4 A;  1UHZ A;  1XNQ I;  1T4L B;  4JI6 I;  2BR2 A;  3QT8 A;  4DKK A;  4DR6 I;  5AAS A;  4HY1 A;  1N36 I;  3WU5 A;  3T1Y E;  2EOS A;  3P3E A;  2YTF A;  5EL9 A;  4LF8 E;  2NN6 D;  2PO0 B;  1XMO I;  4JI3 I;  4LFB I;  2E1M A;  4WUD A;  2Z5B B;  4YY3 I;  2BB8 A;  2ADR A;  3C4B A;  3M99 B;  2N3H A;  4B3M I;  1GZ6 A;  2O1W A;  2YTO A;  2ELY A;  2VE7 C;  1HR0 I;  2EQ3 A;  3MSW A;  1R6M A;  4B3S I;  1WHQ A;  3HXL A;  2ZM6 E;  2LVH A;  4OX9 I;  1XXE A;  1YZ9 A;  4LF6 E;  4IJD A;  3J81 C;  2LJU A;  2EPA A;  2LE2 A;  1JK1 A;  2WNR A;  3WU6 A;  4Q28 A;  4DR5 I;  1E3P A;  4L5N C;  2R3V A;  4F2J C;  2DLQ A;  4F6N A;  3FIG A;  4ZVI A;  5KL5 A;  1A1G A;  4LCF A;  1R6L A;  2LJH A;  5JEA D;  1XNR I;  2HGH A;  4BS9 A;  1YYW A;  1PVG A;  2WNR B;  3LML A;  2E1R A;  2Z5C A;  4F9A B;  3J80 Q;  2LT7 A;  1T39 A;  2YRK A;  1HNX I;  3P1X A;  1XMQ I;  3EQ1 A;  1NHI A;  2GHF A;  4IFD C;  2PO1 B;  1N34 I;  4BC7 A;  4Q35 B;  4LU9 A;  1Y60 A;  2IOQ A;  2V89 A;  2IES A;  2LRS A;  2L2N A;  2JEA A;  4L8N A;  3QG5 C;  2EMX A;  4R2E A;  2YRM A;  4ZYD A;  2CSH A;  1Z59 A;  2JXP A;  1ZXN A;  3THN A;  3JAM Q;  3KZY A;  3V2U C;  3F0N A;  2EMG A;  4KWY A;  4DV7 I;  4JI0 E;  3Q6N A;  2YSO A;  5C0X F;  2YSP A;  1A6F A;  5JEA B;  1NCS A;  3K85 A;  2MDG A;  2HK3 A;  2YZT A;  1ZR9 A;  4LTY A;  2YPN A;  2HJJ A;  2EE8 A;  4HAC A;  1Z5A A;  2HHH I;  2V8Q B;  1KIJ A;  4JV5 E;  5T6J A;  3M85 G;  2R76 A;  2EOR A;  1E3H A;  1L4S A;  4PRV A;  4DV1 I;  1YYO A;  1GQE A;  4DV0 I;  4HTG A;  2BR2 B;  4P7D A;  5TSE A;  4EMD A;  4TUI A;  4YY3 E;  2EN2 A;  4BHC A;  5A2Q C;  4IFD F;  1N0U A;  2UXD E;  3IWD A;  5F3W A;  5K36 D;  2EM3 A;  5DNL A;  3EPL A;  2GLI A;  2DB2 A;  5A6B D;  2G7H A;  4LCG A;  2DIX A;  4DR4 I;  1HNW E;  2ENH A;  2F4V E;  4JYA I;  4DR2 E;  4R2D A;  5AC4 A;  2UUB E;  1XNQ E;  3CDI A;  4DR3 I;  4AQY I;  2EOJ A;  2A2D A;  2O1V A;  4U3B A;  4JI7 I;  4DV7 E;  3J7A M;  4X64 I;  4OZE A;  2LTR A;  2RPC A;  2EMY A;  2IER A;  2RS6 A;  1VI7 A;  3HPZ A;  1WHN A;  4JI2 E;  4P52 A;  4IZK A;  1FKA E;  2E72 A;  1OYR A;  3JTZ A;  5A6B A;  2F4V I;  2EMZ A;  5AE2 A;  4F54 A;  1EH7 A;  4LPF A;  4DV3 I;  2JYA A;  2V87 A;  2V85 A;  2WZO A;  4LF4 E;  2WW4 A;  4IFD A;  3QT6 A;  2EPC A;  1WJP A;  3DF6 A;  5C0X D;  3KRN A;  4DV0 E;  1A1J A;  2YTN A;  2GS8 A;  2JY9 A;  1N33 I;  2VQE I;  2JE6 A;  4ISA A;  1SR9 A;  4O24 A;  1Y4S A;  2DMY A;  3OML A;  3Q6M A;  4FW5 A;  4AIM A;  2LO3 A;  1HNW I;  4DV4 I;  5DRR A;  2YTD A;  2BBG A;  1UDS A;  4K0K I;  2CGE A;  4PU9 A;  4DV2 I;  4KZS A;  2EPN A;  1N34 E;  2C38 A;  3B4T A;  4MQY A;  3H4L A;  4GKK I;  4DPW A;  1F2I G;  4OO1 B;  3VYX A;  4OOG C;  1HR0 E;  1X6H A;  2VQE E;  2NUG A;  4FN5 A;  4M2Z A;  4GKK E;  1NEI A;  3MHH C;  4LFA E;  2O1U A;  4U3D A;  1RQ0 A;  2M7Q A;  4DUY E;  4F6M A;  2MKN A;  2BA1 D;  3ZZU A;  4DXL A;  2V2Z A;  4K0K E;  4LF4 I;  2HFS A;  3TQM A;  3J7Y p;  4Z7Y A;  1J26 A;  1FWL A;  1KTV A;  3T1H I;  4JI0 I;  5DNY A;  4R2R A;  4BA1 A;  1IQS A;  2VQF E;  4GKJ E;  5KL4 A;  2EPZ A;  1YFH A;  1DAR A;  2F8B A;  1U2R A;  4MDT A;  1QNT A;  1SFE A;  2LMZ A;  4X64 E;  1S4E A;  3P3C A;  3ZZT A;  5KL2 A;  2N8X A;  4LF7 E;  2A2C A;  2YTI A;  1H7S A;  1H72 C;  4FW3 A;  4LF6 I;  4R8O A;  2EMW A;  1NHH A;  1ZM9 A;  4LFC I;  1BBO A;  2CTD A;  1X47 A;  2I9I A;  2ODR C;  2EPP A;  3PYG A;  1Y4U A;  5JEA A;  2B9D A;  4X8W A;  3HPS A;  3VHT B;  4BA2 A;  1EA6 A;  3J81 Q;  5C0X A;  1OYP A;  2UUC I;  2LUP B;  2CVE A;  1STU A;  4X62 I;  1WXR A;  4BA1 B;  1YYK A;  2EOM A;  2YTP A;  4MYU A;  1FWK A;  2NUE A;  4LF8 I;  2JEA B;  2VRD A;  1XMO E;  2EMA A;  4DR3 E;  4OO1 E;  3P06 A;  5KL6 A;  4LF9 E;  2EOI A;  2RS7 A;  1USV A;  3P76 A;  4NXN E;  2ELZ A;  4DPY A;  3NZK A;  1ZAA C;  3PYD A;  3QT7 A;  1TF3 A;  4IZJ A;  3H1C A;  2DMI A;  1RMD A;  2MDR A;  4ZYE A;  2V2Q A;  2NN6 F;  2XEX A;  3B82 A;  1ZBQ A;  5LL6 R;  2EN7 A;  2YTQ A;  4WPY A;  3ZOQ B;  3EPJ A;  3U1Y A;  2Z5E A;  5ELW A;  4LF5 E;  1H74 A;  4JG4 A;  2EPK X;  3B78 A;  5EKW A;  1ZU1 A;  3CWV A;  4JI4 I;  2YTJ A;  1EH8 A;  1DGC A;  1UDO A;  3BGH A;  1HNX E;  4F9C B;  1WRJ A;  1S16 A;  4FW9 A;  2E5L I;  2DGC A;  2LV2 A;  3C4T A;  2R42 A;  1BBG A;  1A1H A;  4I8O A;  3OTO I;  4JI5 E;  2FGG A;  2JR1 A;  4DV2 E;  2NAB A;  5LMN E;  2ZBK B;  4ED4 A;  2GO4 A;  3HJC A;  4DR5 E;  5A6J A;  3ZZ0 A;  1ZXM A;  3EPH A;  2L2M A;  2NUF A;  1UIL A;  2NN6 A;  4MU3 A;  4AID A;  2UXD I;  2EP3 A;  3L00 A;  4BCA A;  2ENC A;  2EQ0 A;  1Z1B A;  4B3T I;  1K47 A;  5AC5 A;  2YTG A;  1IBM E;  3ADG A;  2BA1 G;  4IZK B;  1JK2 A;  2F1D A;  2JVA A;  1DQ3 A;  1QU6 A;  5CFF E;  4NZV A;  2EOX A;  4B3M E;  2EML A;  2PO0 A;  2HHH E;  2HFU A;  1Z0W A;  2VES A;  2M4I A;  2EN1 A;  4BA2 B;  5DRQ A;  4DV3 E;  1PJQ A;  2DSY A;  1A1L A;  3VK6 A;  2WBU A;  3RMP A;  2JE6 B;  3B8H A;  2CPN A;  1PJS A;  2RQL A;  1N3G A;  1YHC A;  2C39 B;  3LLH A;  4DV5 I;  3ECR A;  2VF1 A;  2BA0 G;  3IWC A;  4BHB A;  1ZM2 A;  2V86 A;  4R2P A;  1BKN A;  1Z0E A;  1OJ4 A;  2JEB A;  3L7Z B;  2L3C A;  4GQU A;  2UUB I;  2JP9 A;  5K36 A;  4R1F A;  4DR2 I;  1MU5 A;  4DV5 E;  2WBT A;  2EPX A;  1FJG I;  4RH8 A;  4M9V C;  1P42 A;  1TF6 A;  2EMC A;  2J7J A;  5LLQ A;  2VQF I;  4GKJ I;  3L7Z A;  4J8Z A;  2JOB A;  2C37 A;  3ZKD A;  2UXC I;  4WFT A;  3HTX A;  2EOO A;  4DMI A;  2GQ0 A;  2J65 A;  3K6Q A;  4FW7 A;  4R2C A;  2NPF A;  3C6M A;  2PNZ A;  4R2S A;  1AH5 A;  1Z0T A;  1Z0V A;  2YT4 A;  2L33 A;  3GME A;  5DRP A;  2UXB E;  2EM9 A;  2H36 X;  2EOQ A;  4YHH I;  4LF9 I;  2M1S A;  3DD6 A;  2EOE A;  2L6M A;  1IBK I;  4X66 E;  1T4N A;  2YTE A;  3BBG A;  4NXM I;  1PJT A;  2EM6 A;  4DPU A;  4WXC A;  4IZJ D;  3PYE A;  4N3O A;  4X62 E;  1MGT A;  1EKZ A;  5LMU E;  1ZM3 A;  2BM1 A;  1RC7 A;  1X3C A;  2C37 B;  5A6K A;  2EWL A;  1TN9 A;  4WUC A;  1A1I A;  4OO1 C;  4DV1 E;  1PDA A;  4OKG A;  2NN6 B;  4JI1 I;  3GLL A;  2RSI A;  3BID A;  3T1Y I;  2V88 A;  2E5L E;  1DI2 A;  1RHY A;  5GMD A;  4JI8 I;  4B3R E;  5IWA I;  2WCC 3; 
#chains in the Genus database with same CATH homology
 2UUA I;  4LF7 I;  4DR1 I;  3Q1Q A;  2L92 A;  1J5E E;  3J80 C;  2EZ6 A;  3OTO E;  3HUL A;  4DPX A;  4JI2 I;  4X65 I;  1Y6Z A;  3AV0 A;  2UUA E;  2DEJ A;  1IBK E;  2L3J A;  3H09 A;  4JYA E;  4KHP I;  1T4O A;  4GEQ B;  2ODR D;  5FLX C;  1XNR E;  1Z5C A;  4XTJ A;  3K17 A;  1Z5B A;  4LFB E;  4M1K A;  1N32 I;  4R03 A;  2UU9 E;  2LJP A;  4DV4 E;  1KVK A;  1KKH A;  3WU4 A;  3JAM C;  4WSP A;  3QT5 A;  2EFG A;  4JV5 I;  4B3S E;  2V8P A;  3ZM7 A;  3ADL A;  3V5R A;  2L2K B;  1D6T A;  1N32 E;  3F6G A;  4UTG A;  4JI5 I;  4M0V A;  3AUZ A;  3J7A G;  3GON A;  4JI3 E;  5IT9 Q;  1ZBT A;  1USU A;  1PIE A;  2X36 A;  4DR6 E;  4BC9 A;  3ADJ A;  3T1H E;  1H73 A;  2KHX A;  4BMJ A;  1VIS A;  4USK A;  4JI4 E;  4WYQ B;  4DR7 I;  3LTO A;  5A2Q Q;  2KOU A;  2X7I A;  4LF5 I;  1RR9 A;  1N0V C;  1PKP A;  2RTX A;  1FNM A;  4PRX A;  2ZIT A;  4M30 A;  1X49 A;  1ELO A;  3WU3 A;  2LBS B;  2VF3 A;  4WUB A;  3PYF A;  4JI8 E;  5LMN I;  2HKE A;  2CZ9 A;  2N3G A;  3ADI A;  2LUQ A;  4F9B B;  2ZM6 I;  4JI1 E;  4DUZ E;  2PNL A;  1XHK A;  4DU7 A;  1I94 E;  1H7U A;  5BR8 I;  4URL A;  4DU8 A;  1IBM I;  5LMU I;  2FTX B;  4TUG A;  5IT9 C;  4NXM E;  1HK7 A;  3JU0 A;  1NZ0 A;  2J7K A;  4X65 E;  2B3T B;  2V83 A;  5ADZ A;  4HAC A;  4JI6 E;  3K1J A;  4Z7C A;  2B7T A;  2MC5 A;  4KQV A;  3IWB A;  4IZJ B;  1IBL I;  1N33 E;  3LPS A;  2KON A;  1FI4 A;  4DR1 E;  1UEK A;  4DV6 E;  2CG9 A;  4MYT A;  2Q2E B;  1EI1 A;  4B3R I;  3LNU A;  4YHH E;  2UXC E;  2Z5B A;  2HKJ A;  4DUZ I;  2LTS A;  2UU9 I;  2L8T A;  1HNZ E;  1FJG E;  2MC6 A;  1MX0 A;  4DUY I;  1ZM4 A;  2JOX A;  4HAC B;  1HNZ I;  4HYM A;  4KHP E;  4JI7 E;  2O1T A;  4B3T E;  3PRY A;  4FWH A;  2DEI A;  2IHR 1;  2UXB I;  1IBL E;  1X48 A;  2B7V A;  3VYY A;  5FWK A;  2JWO A;  4P78 A;  1NHJ A;  3F6H A;  2BM0 A;  2NA2 A;  1N36 E;  4RPF A;  5GME A;  4FWG A;  4DV6 I;  4LFC E;  5IWA E;  4UT4 A;  2OI2 A;  4I3H A;  2AJ4 A;  3ZKB A;  2HK2 A;  1J5E I;  1MG7 A;  4USM A;  4BBY A;  1B63 A;  5FLX Q;  2FV4 B;  5L3J A;  2K4V A;  2IOP A;  5AE1 A;  3DJW A;  1Z0G A;  2Z5C B;  1Z0C A;  5BR8 E;  4NXN I;  3HQ1 A;  1I94 I;  4FWD A;  2V34 A;  3M6A A;  4LFA I;  4DR4 E;  1QZR A;  1XMQ E;  5AE3 A;  3KWR A;  2V2V A;  2PNM A;  2UUC E;  2RSM A;  1Z0B A;  1O0W A;  4X66 I;  1B62 A;  4DPT A;  2BV3 A;  4OX9 E;  4P7A A;  1WUU A;  4HXZ A;  1RRE A;  4DR7 E;  4AQY E;  1UHZ A;  1XNQ I;  1T4L B;  4JI6 I;  3QT8 A;  4DKK A;  4DR6 I;  5AAS A;  4HY1 A;  1N36 I;  3WU5 A;  3T1Y E;  1XMO I;  4LF8 E;  4JI3 I;  4LFB I;  2E1M A;  4WUD A;  2Z5B B;  4YY3 I;  3C4B A;  2N3H A;  4B3M I;  1GZ6 A;  2O1W A;  2VE7 C;  1HR0 I;  3MSW A;  4B3S I;  1WHQ A;  3HXL A;  2ZM6 E;  4OX9 I;  1YZ9 A;  4LF6 E;  3J81 C;  2LE2 A;  3WU6 A;  4Q28 A;  4DR5 I;  4L5N C;  2R3V A;  3FIG A;  4ZVI A;  2LJH A;  1XNR I;  4BS9 A;  1YYW A;  1PVG A;  3LML A;  2E1R A;  2Z5C A;  4F9A B;  3J80 Q;  1HNX I;  3P1X A;  1XMQ I;  1NHI A;  1N34 I;  4BC7 A;  4LU9 A;  2IOQ A;  2V89 A;  2LRS A;  2L2N A;  4L8N A;  1ZXN A;  1Z59 A;  3JAM Q;  3V2U C;  3F0N A;  4DV7 I;  4JI0 E;  3Q6N A;  1A6F A;  3K85 A;  2HK3 A;  2YZT A;  4LTY A;  1Z5A A;  2HHH I;  2V8Q B;  1KIJ A;  4JV5 E;  5T6J A;  4PRV A;  4DV1 I;  1YYO A;  1GQE A;  4DV0 I;  4P7D A;  4EMD A;  4TUI A;  4YY3 E;  5A2Q C;  1N0U A;  2UXD E;  3IWD A;  5F3W A;  2DB2 A;  4DR4 I;  2G7H A;  2DIX A;  1HNW E;  2F4V E;  4JYA I;  4DR2 E;  1XNQ E;  2UUB E;  4DR3 I;  4AQY I;  2A2D A;  2O1V A;  4JI7 I;  4DV7 E;  3J7A M;  4X64 I;  2LTR A;  2RS6 A;  3HPZ A;  1WHN A;  4JI2 E;  4P52 A;  4IZK A;  1FKA E;  3JTZ A;  2F4V I;  5AE2 A;  4F54 A;  4DV3 I;  2V85 A;  2V87 A;  4LF4 E;  2WZO A;  2WW4 A;  3QT6 A;  3DF6 A;  4DV0 E;  2GS8 A;  2JY9 A;  1N33 I;  2VQE I;  1SR9 A;  1Y4S A;  2DMY A;  3OML A;  3Q6M A;  1HNW I;  4DV4 I;  4K0K I;  2CGE A;  4PU9 A;  4DV2 I;  4KZS A;  1N34 E;  3H4L A;  4GKK I;  4DPW A;  3VYX A;  4OOG C;  1HR0 E;  2VQE E;  2NUG A;  4FN5 A;  4M2Z A;  4GKK E;  4LFA E;  2O1U A;  1RQ0 A;  2M7Q A;  4DUY E;  3ZZU A;  4DXL A;  2V2Z A;  4K0K E;  4LF4 I;  2HFS A;  3J7Y p;  4Z7Y A;  1J26 A;  1FWL A;  1KTV A;  3T1H I;  4JI0 I;  5DNY A;  4GKJ E;  2VQF E;  1DAR A;  2F8B A;  1U2R A;  2LMZ A;  1S4E A;  4X64 E;  3ZZT A;  4LF7 E;  2A2C A;  1H7S A;  1H72 C;  4LF6 I;  4R8O A;  1ZM9 A;  1NHH A;  4LFC I;  1X47 A;  2ODR C;  3PYG A;  1Y4U A;  2B9D A;  4X8W A;  3HPS A;  1EA6 A;  3J81 Q;  2UUC I;  2LUP B;  1STU A;  4X62 I;  1WXR A;  1YYK A;  4MYU A;  1FWK A;  2NUE A;  4LF8 I;  1XMO E;  4DR3 E;  3P06 A;  4LF9 E;  1USV A;  2RS7 A;  4NXN E;  4DPY A;  3PYD A;  3QT7 A;  4IZJ A;  2MDR A;  2V2Q A;  2XEX A;  3B82 A;  1ZBQ A;  5LL6 R;  3ZOQ B;  4WPY A;  2Z5E A;  4LF5 E;  1H74 A;  4JG4 A;  3B78 A;  3CWV A;  4JI4 I;  1HNX E;  4F9C B;  1S16 A;  4FW9 A;  2E5L I;  3C4T A;  2R42 A;  4I8O A;  3OTO I;  4JI5 E;  2FGG A;  2JR1 A;  4DV2 E;  5LMN E;  2ZBK B;  4ED4 A;  3HJC A;  4DR5 E;  3ZZ0 A;  1ZXM A;  2L2M A;  2NUF A;  1UIL A;  2UXD I;  4BCA A;  4B3T I;  1K47 A;  4IZK B;  1IBM E;  3ADG A;  2JVA A;  1DQ3 A;  1QU6 A;  5CFF E;  4B3M E;  2HHH E;  2HFU A;  1Z0W A;  2M4I A;  4DV3 E;  2DSY A;  3VK6 A;  3RMP A;  3B8H A;  2CPN A;  3LLH A;  4DV5 I;  2VF1 A;  3IWC A;  1ZM2 A;  2V86 A;  1BKN A;  1Z0E A;  1OJ4 A;  2L3C A;  2UUB I;  4R1F A;  4DR2 I;  1MU5 A;  4DV5 E;  1FJG I;  2VQF I;  4GKJ I;  2UXC I;  4J8Z A;  2JOB A;  3ZKD A;  4WFT A;  3HTX A;  2GQ0 A;  4DMI A;  3K6Q A;  2NPF A;  1Z0T A;  1Z0V A;  2YT4 A;  2L33 A;  2UXB E;  2H36 X;  4YHH I;  4LF9 I;  2M1S A;  2L6M A;  1IBK I;  4X66 E;  1T4N A;  4NXM I;  4DPU A;  4IZJ D;  3PYE A;  4N3O A;  4X62 E;  1EKZ A;  5LMU E;  1ZM3 A;  2BM1 A;  1RC7 A;  4WUC A;  2EWL A;  4DV1 E;  4JI1 I;  3T1Y I;  2V88 A;  2E5L E;  1DI2 A;  5GMD A;  4JI8 I;  4B3R E;  5IWA I;  3D4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...