4LFCE

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lfcE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfcE02
1N0UA 3LNUA 4GKKI 4HXZA 4FN5A 2AJ4A 4OX9I 4YHHI 1T4OA 3H4LA 4DR7I 1GQEA 4DV7E 3T1HE 4USKA 2BV3A 2RS7A 4FWGA 1N36E 1O0WA 1NHIA 5IT9Q 3VYXA 2UUBE 2R42A 2KHXA 3ZZ0A 4DV7I 3T1HI 1RQ0A 1XNRE 1Z5BA 1ZM2A 4DUYE 1N36I 2WW4A 2UUBI 2NUFA 1U2RA 1PIEA 1XNRI 4HACA 4GKJE 1Z5AA 2A2DA 4DUYI 1ZXNA 1WHNA 2CZ9A 2HKJA 1HNXE 5BR8E 1YYWA 3J81C 1UHZA 4FW9A 1XHKA 1UEKA 1ZM9A 5IWAE 1RC7A 4FWDA 3ZM7A 2CPNA 4JI5E 4GKJI 1FI4A 1HNXI 5BR8I 3ADGA 4I3HA 2NPFA 3JAMQ 5IWAI 2ZM6E 4UTGA 1WUUA 4JI5I 4MYUA 4DR6E 4DV6E 2L33A 4LF8E 3QT8A 4JV5E 4DUZE 2ZM6I 2RSMA 3CWVA 4DU7A 2L2KB 4DR6I 2V2VA 4LFAE 2V2QA 2L3JA 4DV6I 4LF7E 1T4NA 1Z0CA 2X36A 3HULA 4LF8I 4JI0E 4JV5I 4DUZI 1Z0VA 4B3TE 2DEJA 2UXDE 4LFAI 3J7AG 4JI1E 3WU4A 4KQVA 3ZKBA 4LF7I 4Z7CA 3ZZUA 1N32E 1ZM3A 3QT7A 4M2ZA 2UUAE 4JI0I 3J80C 2HK2A 4B3TI 1STUA 2UXDI 1Z0EA 4HACB 4JI1I 5GMEA 3C4TA 1ZXMA 1Z0TA 1N32I 3ADIA 2NUEA 2UUAI 4LF9E 4JG4A 1YYOA 4DV1E 1FJGE 3D4JA 3B8HA 3J7AM 3PYDA 2UU9E 4LF9I 5CFFE 2DIXA 2ZITA 4DV1I 1J26A 1FJGI 3J7Yp 1A6FA 4X64E 1QZRA 2UU9I 1HNWE 4NXME 4P7AA 4DV2E 1N0VC 3B78A 1Z0BA 1WHQA 1QU6A 1HNZE 1FNMA 2L2MA 3M6AA 1XMQE 1I94E 1KTVA 4X64I 1PVGA 1K47A 1X49A 1HNWI 4NXMI 4DV2I 1XMOE 4DPTA 1HNZI 1EI1A 3T1YE 1H72C 1XMQI 1I94I 1EA6A 4AQYE 1H74A 1IBLE 4X65E 1ZM4A 4FWHA 4LF6E 1XMOI 4M30A 4JI2E 3T1YI 4B3SE 2B7VA 4AQYI 3J80Q 1NHJA 1IBLI 2F4VE 4X65I 2HFUA 4LF6I 4RPFA 5A2QC 1Z59A 2DEIA 4JI2I 1D6TA 4B3SI 3ADLA 4M1KA 4OOGC 1KIJA 2L2NA 2V34A 2F4VI 4WFTA 2UXBE 4PRXA 2LTRA 4URLA 4LFCE 2LBSB 2LTSA 2V2ZA 2UUCE 4K0KE 1FWKA 4WYQB 4DV0E 2IHR1 2LUPB 4ZVIA 4DPWA 2UXBI 2E5LE 3QT6A 4Z7YA 4LFCI 2N3GA 3ZKDA 3PYFA 4DU8A 2UUCI 4K0KI 4LF4E 4DV0I 2LRSA 4B3RE 1DARA 1H7UA 1YZ9A 1N33E 2E5LI 2VQEE 4DV4E 5GMDA 1BKNA 4DPXA 3LPSA 2EFGA 4LF4I 1Z0GA 1ZBTA 4B3RI 3P1XA 1IBKE 1KKHA 1N33I 2OI2A 3Q1QA 2VQEI 4DV3E 1X48A 2DMYA 4DV4I 3V5RA 2ZBKB 2N3HA 4DPYA 3J81Q 1FWLA 1IBKI 1VISA 4DXLA 3ZZTA 4DR3E 4DV3I 4PU9A 5A2QQ 3WU5A 5LMNE 1H7SA 4DR3I 4WUCA 4X66E 4JI4E 4WUBA 1Z0WA 1S16A 3PYGA 5LMNI 2GS8A 2LJHA 4X8WA 2MDRA 4DR5E 2DB2A 2B7TA 1S4EA 4X66I 1EKZA 4JI4I 1B62A 4JI8E 1B63A 4JI7E 3WU3A 3K17A 2UXCE 4DR5I 1MU5A 1HR0E 5L3JA 2NUGA 5FLXC 5LL6R 4MYTA 1Z5CA 2RS6A 2B3TB 4JI8I 4JI7I 3GONA 1IBME 1PKPA 2UXCI 3C4BA 4HY1A 3V2UC 1HR0I 2VQFE 2L3CA 5LMUE 2E1RA 2V8PA 4JI6E 1IBMI 3LLHA 4ED4A 1T4LB 4YY3E 4X62E 2LUQA 4PRVA 2VQFI 4NXNE 3K1JA 1N34E 5LMUI 2RTXA 2BM1A 2JY9A 2R3VA 4JI6I 1RR9A 1NZ0A 3F0NA 2BM0A 4DR1E 4YY3I 3OTOE 4HYMA 1MG7A 4X62I 2X7IA 4WUDA 4NXNI 1MX0A 1FKAE 1N34I 4JI3E 4DKKA 2VF3A 5IT9C 2NA2A 4LFBE 4USMA 2Q2EB 4DR2E 4DR1I 2J7KA 3OTOI 2HHHE 1KVKA 4DV5E 2LJPA 1J5EE 3VYYA 1ELOA 4JI3I 2A2CA 2EZ6A 3ADJA 4LFBI 4DR2I 4XTJA 4DPUA 2HK3A 2HHHI 2JVAA 1OJ4A 4DV5I 1XNQE 4DR4E 1J5EI 2YT4A 3B82A 1UILA 1H73A 3WU6A 4EMDA 4B3ME 1DI2A 5FLXQ 3QT5A 2HFSA 4LF5E 2XEXA 4JYAE 1XNQI 3HTXA 4DR4I 4KHPE 1RREA 4UT4A 3JAMC 4P52A 1YYKA 2HKEA 4GKKE 4B3MI 3LTOA 4LF5I 4R1FA 4OX9E 4YHHE 1X47A 4DR7E 4JYAI 3PYEA 1NHHA 4KHPI
chains in the Genus database with same CATH superfamily
1SR9A 1N0UA 3LNUA 2K7IA 4U3DA 4AIMA 1IQSA 1USUA 3VK6A 4GKKI 2NABA 2EOIA 4HXZA 1EH7A 4FN5A 2PO2B 2MC5A 1UBDC 2AJ4A 2V88A 4OX9I 5IXMB 4YHHI 1T4OA 3H4LA 4DR7I 1GQEA 2O1TA 2O1WA 2GPIA 2PNZA 2ELYA 4DV7E 2EN4A 3T1HE 2GO3A 3PS3A 4USKA 3HPZA 2BV3A 2RS7A 5ELWA 2L8TA 3CDJA 2BR2B 5K36A 4FWGA 2D9HA 5DNLA 1N36E 5JEAD 4RHBB 1O0WA 2EPXA 4OO1A 1NHIA 5IT9Q 4MU0A 3VYXA 2UUBE 5KL4A 2R42A 2KHXA 4ZYHA 1X6HA 3EPJA 3CDIA 3ZZ0A 4DV7I 3T1HI 1RQ0A 4WXDA 4FW4A 5A6BA 1N3GA 1XNRE 5C0XE 4F54A 1LLMC 1Z5BA 1ZM2A 2JOBA 5KL7A 4DUYE 2C37A 2JP9A 2PNLA 1N36I 2CVEA 4LPFA 2WW4A 2NN6E 2UUBI 2EPOA 2L92A 2NUFA 2M9AA 2L6MA 3FIGA 2RPCA 2AE8A 1U2RA 1PIEA 1XNRI 4HACA 3MSWA 2EMWA 4GKJE 1Z5AA 2A2DA 4DUYI 2ELZA 1WHNA 4X9JA 1ZXNA 2CZ9A 2HKJA 2EPAA 2MKNA 4Q35B 1HNXE 5BR8E 3J81C 3KZYA 1YYWA 1X6FA 2K4VA 4OZEA 2WP8A 2EMZA 5DRRA 1UHZA 4FW9A 1XHKA 4AIDA 5JEAA 1UEKA 2LO3A 2YRMA 5IWAE 2V8QB 1RC7A 1ZM9A 4FWDA 4QNJA 3ZM7A 2CPNA 1TF3A 2CGEA 4JI5E 2WZOA 4GKJI 1FI4A 5DNYA 1HNXI 5BR8I 2EN2A 1EH6A 3ADGA 1OYPA 4MDTA 4I3HA 1A1FA 2EPNA 1YSAC 2NPFA 3JAMQ 4N3OA 2A25A 4BBYA 5IWAI 4I8OA 2ZM6E 4UTGA 3P06A 1UDQA 1WUUA 4JI5I 2EM8A 4DR6E 4MYUA 1QNTA 3ECRA 5C0XF 2EMKA 3UK3C 4P78A 4DV6E 2I9IA 3KWRA 4MU1A 5DROA 4M0VA 5K36C 2L33A 2F1DA 4LF8E 3QT8A 4JV5E 1AH5A 4DUZE 2I13A 2NN6F 2ZM6I 1DQ3A 1NEIA 2RSMA 3CWVA 4FW5A 4O43A 4DU7A 2L2KB 3HXLA 1JK2A 4DR6I 1A1JA 2V2VA 4LFAE 2V2QA 2L3JA 2YRKA 4LF7E 2FV4B 2EOFA 2LT7A 5KL6A 4F9AB 1T4NA 3C6MA 2WNRA 3PRYA 5K36B 5T6JA 1Z0CA 2X36A 2EM5A 3HULA 4LF8I 4JI0E 2RQLA 4DUZI 4JV5I 1Z0VA 4OO1B 4ZYGA 4LU9A 2EPCA 4B3TE 4IFDE 2DEJA 2NN6D 2UXDE 2J65A 2EPZA 1KYQA 2VE7C 4R2PA 2EQ3A 4LFAI 3J7AG 4JI1E 3WU4A 4GEQB 4KQVA 3ZKBA 4LF7I 4Z7CA 2YTNA 2C37B 1N32E 3ZZUA 5C0XC 3BBGA 1P47A 1ZM3A 5A6JA 2F8BA 3L7ZA 3QT7A 2EMBA 4M2ZA 4DMIA 2YWQA 2UUAE 3J80C 4OKGA 5DRQA 4JI0I 2YTFA 4MU4A 5AE1A 3HKMA 4FW3A 2YTIA 2HK2A 2NN6C 1STUA 4MLQA 4N4RB 4B3TI 2JR1A 4LTYA 2UXDI 1Z0EA 3IWBA 4HACB 4JI1I 4FK5C 5GMEA 3C4TA 1ZXMA 2EM2A 1Z0TA 1N32I 2H36X 3ADIA 1E3HA 2NUEA 3KRNA 2UUAI 4FW7A 4LF9E 2BA0D 2IOQA 2M7QA 4JG4A 5JEAB 1YYOA 4DV1E 1FJGE 1PJQA 3D4JA 2FTXB 3ZOQB 3BF2A 3B8HA 2C38A 2Z5BA 3J7AM 5AE3A 2LCEA 2GQ0A 3PYDA 1IMUA 2UU9E 5FWKA 2MC6A 2GHFA 4TUGA 2YTQA 4LF9I 5CFFE 2DIXA 3EQ1A 2ZITA 4DV1I 1TF6A 1J26A 1FJGI 4IFDF 3J7Yp 3F6HA 1A6FA 4X64E 2IESA 4BA1A 1ZAAC 5C0XD 3HJCA 1QZRA 2UU9I 1HNWE 2YTDA 2V87A 2YTJA 4L5NC 4NXME 4P7AA 1OYSA 4DV2E 1N0VC 3B78A 2YRHA 2ENCA 1WJPA 2WBSA 1Z0BA 2BBGA 1WHQA 1QU6A 4IJDA 2L2MA 1HNZE 1FNMA 2JEAB 3M6AA 1XMQE 1I94E 2YTPA 2DRPA 1KTVA 1ZU1A 3P3GA 5KL2A 2Z5EA 3HPSA 4X64I 1PVGA 3BIDA 1K47A 2B9DA 1X49A 5DNXA 4DV6I 1HNWI 4NXMI 2WNRB 4DV2I 1XMOE 2CT1A 4DPTA 4R2AA 1A1IA 2EMYA 1HK7A 2JOXA 1HNZI 2PO1A 1EI1A 2EL5A 3GCMA 4IZKA 3T1YE 1A1GA 1H72C 2JEBA 2M1SA 2E72A 5DRPA 1EA6A 1XMQI 1I94I 4AQYE 1H74A 1IBLE 2PO0A 3THNA 2YTOA 4O5GA 1YUIA 4X65E 2HGHA 1ZM4A 1YPNA 4LF6E 2DLKA 4WSGA 2JT2A 4FW6A 4FWHA 5KL5A 5C0XA 2EL6A 3EPKA 1XMOI 1UDSA 3L7ZB 2EPMX 3K85A 2EOQA 2EM3A 4M30A 4JI2E 2NN6A 3T1YI 2YZTA 4HEIA 2DGCA 4B3SE 4QNKA 2VESA 2B7VA 2EN6A 3J80Q 2ENHA 1NHJA 4AQYI 1IBLI 2F4VE 4X65I 2YTEA 2HFUA 4LF6I 4J8ZA 1PDAA 4RPFA 5A2QC 1A1LA 1Y6ZA 5A69A 2EQ1A 3F6GA 2HJJA 2J7JA 1YH8A 1Z59A 3U1KA 3PS1A 2DEIA 4JI2I 1D6TA 1GTKA 4BMJA 1DGCA 4B3SI 3ADLA 4M1KA 4OOGC 1KIJA 2L2NA 2EMXA 4ZYDA 2V34A 2F4VI 4WFTA 2C38B 2Z5BB 3M85D 2UXBE 4BHCA 4MU3A 2EWLA 4PRXA 1A1KA 2LTRA 4WPYA 4URLA 3AV0A 4LFCE 5LLQA 2LBSB 3P3CA 2LTSA 4IZJD 2V2ZA 2UUCE 4K0KE 1ZBQA 4O24A 2EL4A 1FWKA 4WYQB 2BA0G 2JEAA 4DV0E 2IHR1 4IFDD 4F9CB 3MHSC 2EN3A 4F2JC 4RH8A 2LUPB 2EP3A 4F6MA 4ZVIA 4BA1B 4DPWA 2UXBI 2VRDA 2E5LE 2JWOA 3QT6A 2EOYA 2EE8A 1BBOA 2N3GA 3EPLA 4Z7YA 2YSOA 4LFCI 3ZKDA 4TUIA 2WCC3 3PYFA 4DU8A 2UUCI 4K0KI 1RMDA 4LF4E 1Z1BA 4LCHA 4DV0I 1Y60A 2LRSA 1B69A 4B3RE 1DARA 1H7UA 1YZ9A 1A1HA 2R1FA 1N33E 2E5LI 1X6EA 2CTDA 2VQEE 4DV4E 2EOZA 5GMDA 1BKNA 1VI7A 4DPXA 3LMLA 3VHTB 4IZJA 4F9BB 2EFGA 3LPSA 4LF4I 3DF6A 2O1VA 2PO1B 4MLVA 4IZKB 4KZSA 2YU8A 2JEBB 1Z0GA 1ZBTA 4B3RI 4IFDA 1GZ6A 3P1XA 1IBKE 4WSPA 4R2CA 2PO0B 1PJTA 3HQ1A 5AC4A 1KKHA 1N33I 2C39A 3EPHA 2OI2A 5C0XB 2VQEI 4NBQA 3Q1QA 1X5WA 4DV3E 1X48A 2DMYA 2LVHA 4DV4I 3V5RA 2BB8A 4L8NA 3H09A 3M7ND 2ZBKB 3QG5C 2IERA 1WXRA 2N3HA 3OMLA 2JPAA 2EPUA 2EOXA 4BA2B 2NN6B 2N8XA 2EOMA 4DPYA 4IS9A 3J81Q 2LV2A 2GO4A 4R03A 4LOMA 2EMLA 2M4IA 1FWLA 1X3CA 2YU5A 1IBKI 2BA1D 1VISA 4DXLA 3ZZTA 4DR3E 4DV3I 2IOPA 3PS2A 4PU9A 3K6QA 5A2QQ 3WU5A 1TN9A 3M99B 1R6LA 1USVA 2EOEA 4NHRA 5LMNE 2LMZA 3KZZA 1H7SA 1UDNA 1UN6B 4GQUA 4DR3I 4BS9A 2YPNA 4U3BA 4WXCA 1E3PA 2EMAA 4WUCA 1RHYA 2EN7A 4X66E 5AASA 3JU0A 3IWCA 5K36E 4JI4E 2EMGA 2V86A 3TQMA 4WUBA 1Z0WA 2Z5CA 2DLQA 1S16A 3PYGA 5LMNI 4OO1E 4R2RA 2GS8A 3C6KA 2LJHA 4X8WA 2WBTA 2MDRA 2ODRC 4DR5E 2EM9A 3M85G 2Q8UA 4ZYEA 2JE6A 2EMHA 2DB2A 1YFHA 2B7TA 4O4KA 1S4EA 4X66I 1EKZA 1BB8A 2EJ4A 4JI4I 2EPLX 3AUZA 4GZNC 1XXEA 1B62A 1T38A 2EN8A 4JI8E 1B63A 4JI7E 2EORA 3L00A 3WU3A 3K17A 2UXCE 4R2DA 4IFDC 2FGGA 2MDGA 2EN1A 4DR5I 1MU5A 5AC5A 2O1UA 5AE2A 4J3DA 4M9VC 1HR0E 5L3JA 2NUGA 1BBGA 4NZVA 5IV8B 5FLXC 4IZJB 5LL6R 4BA2A 1YHCA 4MYTA 3RMPA 1Z5CA 3GLLA 1L4SA 2RS6A 2B3TB 2PRTA 4JI8I 4JI7I 3GONA 3MHHC 5JEAE 1IBME 1PKPA 4IFDB 3C4BA 2UXCI 2DMIA 2C39B 4HY1A 5EKWA 4WX9A 2R76A 2V85A 4HTGA 2EOHA 4ISAA 3V2UC 1HR0I 2VQFE 1WRJA 1UDOA 2L3CA 3H1CA 5K36F 2DSYA 5LMUE 2E1RA 2V8PA 1OYRA 3U1YA 4R2EA 2VF1A 4JI6E 1P42A 1R6MA 1IBMI 4OO1F 2ODRD 2E1MA 3LLHA 2CG9A 5F3WA 4ED4A 1T4LB 4YY3E 5TSEA 4F6NA 1F2IG 4X62E 2LUQA 4PRVA 2VQFI 4NXNE 2EM0A 3K1JA 3Q6NA 2EPRA 2KONA 1N34E 3M7NG 5LMUI 4BC7A 2RTXA 2EPPA 2LJUA 2BM1A 2JY9A 2R3VA 1MGTA 4JI6I 1RR9A 5A6AA 2EOJA 1AAYA 2PO2A 2EM6A 1NZ0A 3F0NA 1MEYC 2JXPA 4DR1E 2MKDA 2BM0A 5EL9A 2KOUA 2BA1G 4YY3I 3OTOE 4HYMA 3DJWA 1MG7A 4X62I 1T39A 2X7IA 3DD6A 4WUDA 5ADZA 4NXNI 1MX0A 2RSIA 1FKAE 1N34I 4Q28A 4P7DA 2YTGA 4JI3E 4BC9A 2BR2A 3IWDA 4DKKA 5IT9C 2VF3A 2EMIA 2NA2A 2Z5CB 2ENAA 3NZKA 2ADRA 4LFBE 2EOOA 4USMA 5JEAF 2Q2EB 4DR2E 1PJSA 4DR1I 3JTZA 2J7KA 3OTOI 4OO1C 2HHHE 1KVKA 2PNZB 3P3EA 2EM4A 2JE6B 4DV5E 2LJPA 1J5EE 3VYYA 1ELOA 2EM7A 1Y4UA 4JI3I 4IS1C 2WBUA 5KL3A 1IQOA 1NCSA 2YSPA 2CSHA 2A2CA 2EZ6A 3ADJA 3B4TA 4LFBI 4LCFA 4DR2I 4XTJA 4DPUA 4KWYA 2HK3A 1JK1A 3UHMA 2HHHI 2JYAA 2JVAA 4AM3A 4R8OA 1OJ4A 1G2DC 1ZR9A 1XNQE 4DV5I 4MQYA 4DR4E 1J5EI 2YT4A 3Q6MA 3B82A 1UILA 1H73A 2GLIA 2PNMA 2G7HA 3WU6A 4EMDA 2HC5A 1KJKA 4B3ME 1DI2A 4R2QA 4LCGA 1Y5YA 5FLXQ 1EH8A 3QT5A 2HFSA 3THOB 4LF5E 2XEXA 5JEAC 2EMCA 2EOSA 4JYAE 1XNQI 2EPKX 3HTXA 4DR4I 1SFEA 3P76A 4KHPE 1Y4SA 5K36D 1RREA 5A6KA 4UT4A 3JAMC 4P52A 1YYKA 2EMFA 2HKEA 4R2SA 4GKKE 4B3MI 4BCAA 1YUJA 2EQ0A 2V83A 1G2FC 3LTOA 2WP8B 4OO1D 3BGHA 4LF5I 4R1FA 4OX9E 4YHHE 1X47A 4DR7E 2V89A 4JYAI 3GMEA 3PYEA 5A6BD 2LE2A 4BHBA 2O3ZA 1NHHA 4KHPI
chains in the Genus database with same CATH topology
1SR9A 1N0UA 3LNUA 1USUA 3VK6A 4GKKI 4HXZA 4FN5A 2MC5A 2AJ4A 2V88A 4OX9I 4YHHI 1T4OA 3H4LA 4DR7I 1GQEA 2O1TA 2O1WA 4DV7E 3T1HE 4USKA 3HPZA 2BV3A 2RS7A 2L8TA 4FWGA 1N36E 1O0WA 1NHIA 5IT9Q 3VYXA 2UUBE 2R42A 2KHXA 3ZZ0A 4DV7I 3T1HI 1RQ0A 1XNRE 4F54A 1Z5BA 1ZM2A 2JOBA 4DUYE 2PNLA 1N36I 2WW4A 2UUBI 2L92A 2NUFA 2L6MA 3FIGA 1U2RA 1PIEA 1XNRI 4HACA 3MSWA 4GKJE 1Z5AA 2A2DA 4DUYI 1ZXNA 1WHNA 2CZ9A 2HKJA 1HNXE 5BR8E 3J81C 1YYWA 2K4VA 1UHZA 4FW9A 1XHKA 1UEKA 1ZM9A 5IWAE 2V8QB 1RC7A 4FWDA 3ZM7A 2CPNA 2CGEA 4JI5E 2WZOA 4GKJI 1FI4A 5DNYA 1HNXI 5BR8I 3ADGA 4I3HA 2NPFA 3JAMQ 4N3OA 4BBYA 5IWAI 4I8OA 2ZM6E 4UTGA 3P06A 1WUUA 4JI5I 4MYUA 4DR6E 4P78A 4DV6E 3KWRA 4M0VA 2L33A 4LF8E 3QT8A 4JV5E 4DUZE 2ZM6I 1DQ3A 2RSMA 3CWVA 4DU7A 2L2KB 3HXLA 4DR6I 2V2VA 4LFAE 2V2QA 2L3JA 4DV6I 4LF7E 2FV4B 4F9AB 1T4NA 3PRYA 5T6JA 1Z0CA 2X36A 3HULA 4LF8I 4JI0E 4JV5I 4DUZI 1Z0VA 4LU9A 4B3TE 2DEJA 2UXDE 2VE7C 4LFAI 3J7AG 4JI1E 3WU4A 4GEQB 4KQVA 3ZKBA 4LF7I 4Z7CA 3ZZUA 1N32E 1ZM3A 2F8BA 3QT7A 4M2ZA 4DMIA 2UUAE 4JI0I 3J80C 5AE1A 2HK2A 4B3TI 1STUA 2JR1A 4LTYA 2UXDI 1Z0EA 3IWBA 4HACB 4JI1I 5GMEA 3C4TA 1ZXMA 1Z0TA 1N32I 2H36X 3ADIA 2NUEA 2UUAI 4LF9E 2IOQA 2M7QA 4JG4A 1YYOA 4DV1E 1FJGE 3D4JA 2FTXB 3ZOQB 3B8HA 3J7AM 2Z5BA 5AE3A 2GQ0A 3PYDA 2UU9E 5FWKA 2MC6A 4TUGA 4LF9I 5CFFE 2DIXA 2ZITA 4DV1I 1J26A 1FJGI 3J7Yp 1A6FA 3F6HA 4X64E 3HJCA 1QZRA 2UU9I 1HNWE 4NXME 2V87A 4L5NC 4P7AA 4DV2E 1N0VC 3B78A 1Z0BA 1WHQA 1QU6A 1HNZE 1FNMA 2L2MA 3M6AA 1XMQE 1I94E 1KTVA 2Z5EA 3HPSA 4X64I 1PVGA 1K47A 2B9DA 1X49A 1HNWI 4NXMI 4DV2I 1XMOE 4DPTA 1HK7A 2JOXA 1HNZI 1EI1A 4IZKA 3T1YE 1H72C 1XMQI 2M1SA 1I94I 1EA6A 4AQYE 1H74A 1IBLE 4X65E 1ZM4A 4FWHA 4LF6E 1XMOI 3K85A 4M30A 4JI2E 3T1YI 2YZTA 4B3SE 2B7VA 4AQYI 3J80Q 1NHJA 1IBLI 2F4VE 4X65I 2HFUA 4LF6I 4J8ZA 4RPFA 5A2QC 1Y6ZA 3F6GA 1Z59A 2DEIA 4JI2I 1D6TA 4BMJA 4B3SI 3ADLA 4M1KA 4OOGC 1KIJA 2L2NA 2V34A 2F4VI 4WFTA 2Z5BB 2UXBE 2EWLA 4PRXA 2LTRA 4WPYA 4URLA 3AV0A 4LFCE 2LBSB 4IZJD 2LTSA 2V2ZA 2UUCE 4K0KE 1ZBQA 1FWKA 4WYQB 4DV0E 2IHR1 4F9CB 2LUPB 4ZVIA 4DPWA 2UXBI 2E5LE 2JWOA 3QT6A 4Z7YA 4LFCI 2N3GA 3ZKDA 4TUIA 3PYFA 4DU8A 2UUCI 4K0KI 4LF4E 4DV0I 2LRSA 4B3RE 1DARA 1H7UA 1YZ9A 1N33E 2E5LI 2VQEE 4DV4E 5GMDA 1BKNA 4DPXA 3LMLA 4IZJA 4F9BB 2EFGA 3LPSA 4LF4I 3DF6A 2O1VA 4IZKB 4KZSA 1Z0GA 1ZBTA 4B3RI 1GZ6A 3P1XA 1IBKE 4WSPA 3HQ1A 1KKHA 1N33I 2OI2A 3Q1QA 2VQEI 4DV3E 1X48A 2DMYA 4DV4I 3V5RA 4L8NA 3H09A 2ZBKB 1WXRA 2N3HA 3OMLA 4DPYA 3J81Q 4R03A 2M4IA 1FWLA 1IBKI 1VISA 4DXLA 3ZZTA 4DR3E 4DV3I 2IOPA 4PU9A 3K6QA 5A2QQ 3WU5A 1USVA 5LMNE 2LMZA 1H7SA 4DR3I 4BS9A 4WUCA 4X66E 5AASA 3JU0A 3IWCA 4JI4E 2V86A 4WUBA 1Z0WA 2Z5CA 1S16A 3PYGA 5LMNI 2GS8A 2LJHA 4X8WA 2MDRA 2ODRC 4DR5E 2DB2A 2B7TA 1S4EA 4X66I 1EKZA 4JI4I 3AUZA 1B62A 4JI8E 1B63A 4JI7E 3WU3A 3K17A 2UXCE 2FGGA 4DR5I 1MU5A 2O1UA 5AE2A 1HR0E 5L3JA 2NUGA 5FLXC 4IZJB 5LL6R 4MYTA 3RMPA 1Z5CA 2RS6A 2B3TB 4JI8I 4JI7I 3GONA 1IBME 1PKPA 2UXCI 3C4BA 4HY1A 2V85A 3V2UC 1HR0I 2VQFE 2L3CA 2DSYA 5LMUE 2E1RA 2V8PA 2VF1A 4JI6E 1IBMI 2ODRD 2E1MA 3LLHA 2CG9A 5F3WA 4ED4A 1T4LB 4YY3E 4X62E 2LUQA 4PRVA 2VQFI 4NXNE 3K1JA 3Q6NA 2KONA 1N34E 5LMUI 4BC7A 2RTXA 2BM1A 2JY9A 2R3VA 4JI6I 1RR9A 1NZ0A 3F0NA 2BM0A 4DR1E 2KOUA 4YY3I 3OTOE 4HYMA 3DJWA 1MG7A 4X62I 2X7IA 4WUDA 5ADZA 4NXNI 1MX0A 1FKAE 1N34I 4Q28A 4P7DA 4JI3E 4BC9A 3IWDA 4DKKA 5IT9C 2VF3A 2NA2A 2Z5CB 4LFBE 4USMA 2Q2EB 4DR2E 4DR1I 3JTZA 2J7KA 3OTOI 2HHHE 1KVKA 4DV5E 2LJPA 1J5EE 3VYYA 1ELOA 1Y4UA 4JI3I 2A2CA 2EZ6A 3ADJA 4LFBI 4DR2I 4XTJA 4DPUA 2HK3A 2HHHI 2JVAA 4R8OA 1OJ4A 4DV5I 1XNQE 4DR4E 1J5EI 2YT4A 3Q6MA 3B82A 1UILA 1H73A 2PNMA 3WU6A 2G7HA 4EMDA 4B3ME 1DI2A 5FLXQ 3QT5A 2HFSA 4LF5E 2XEXA 4JYAE 1XNQI 3HTXA 4DR4I 4KHPE 1Y4SA 1RREA 4UT4A 3JAMC 4P52A 1YYKA 2HKEA 4GKKE 4B3MI 4BCAA 2V83A 3LTOA 4LF5I 4R1FA 4OX9E 4YHHE 1X47A 4DR7E 2V89A 4JYAI 3PYEA 2LE2A 1NHHA 4KHPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0U A;  3LNU A;  4GKK I;  4HXZ A;  4FN5 A;  2AJ4 A;  4OX9 I;  4YHH I;  1T4O A;  3H4L A;  4DR7 I;  1GQE A;  4DV7 E;  3T1H E;  4USK A;  2BV3 A;  2RS7 A;  4FWG A;  1N36 E;  1O0W A;  1NHI A;  5IT9 Q;  3VYX A;  2UUB E;  2R42 A;  2KHX A;  3ZZ0 A;  4DV7 I;  3T1H I;  1RQ0 A;  1XNR E;  1Z5B A;  1ZM2 A;  4DUY E;  1N36 I;  2WW4 A;  2UUB I;  2NUF A;  1U2R A;  1PIE A;  1XNR I;  4HAC A;  4GKJ E;  1Z5A A;  2A2D A;  4DUY I;  1ZXN A;  1WHN A;  2CZ9 A;  2HKJ A;  1HNX E;  5BR8 E;  1YYW A;  3J81 C;  1UHZ A;  4FW9 A;  1XHK A;  1UEK A;  1ZM9 A;  5IWA E;  1RC7 A;  4FWD A;  3ZM7 A;  2CPN A;  4JI5 E;  4GKJ I;  1FI4 A;  1HNX I;  5BR8 I;  3ADG A;  4I3H A;  2NPF A;  3JAM Q;  5IWA I;  2ZM6 E;  4UTG A;  1WUU A;  4JI5 I;  4MYU A;  4DR6 E;  4DV6 E;  2L33 A;  4LF8 E;  3QT8 A;  4JV5 E;  4DUZ E;  2ZM6 I;  2RSM A;  3CWV A;  4DU7 A;  2L2K B;  4DR6 I;  2V2V A;  4LFA E;  2V2Q A;  2L3J A;  4DV6 I;  4LF7 E;  1T4N A;  1Z0C A;  2X36 A;  3HUL A;  4LF8 I;  4JI0 E;  4JV5 I;  4DUZ I;  1Z0V A;  4B3T E;  2DEJ A;  2UXD E;  4LFA I;  3J7A G;  4JI1 E;  3WU4 A;  4KQV A;  3ZKB A;  4LF7 I;  4Z7C A;  3ZZU A;  1N32 E;  1ZM3 A;  3QT7 A;  4M2Z A;  2UUA E;  4JI0 I;  3J80 C;  2HK2 A;  4B3T I;  1STU A;  2UXD I;  1Z0E A;  4HAC B;  4JI1 I;  5GME A;  3C4T A;  1ZXM A;  1Z0T A;  1N32 I;  3ADI A;  2NUE A;  2UUA I;  4LF9 E;  4JG4 A;  1YYO A;  4DV1 E;  1FJG E;  3D4J A;  3B8H A;  3J7A M;  3PYD A;  2UU9 E;  4LF9 I;  5CFF E;  2DIX A;  2ZIT A;  4DV1 I;  1J26 A;  1FJG I;  3J7Y p;  1A6F A;  4X64 E;  1QZR A;  2UU9 I;  1HNW E;  4NXM E;  4P7A A;  4DV2 E;  1N0V C;  3B78 A;  1Z0B A;  1WHQ A;  1QU6 A;  1HNZ E;  1FNM A;  2L2M A;  3M6A A;  1XMQ E;  1I94 E;  1KTV A;  4X64 I;  1PVG A;  1K47 A;  1X49 A;  1HNW I;  4NXM I;  4DV2 I;  1XMO E;  4DPT A;  1HNZ I;  1EI1 A;  3T1Y E;  1H72 C;  1XMQ I;  1I94 I;  1EA6 A;  4AQY E;  1H74 A;  1IBL E;  4X65 E;  1ZM4 A;  4FWH A;  4LF6 E;  1XMO I;  4M30 A;  4JI2 E;  3T1Y I;  4B3S E;  2B7V A;  4AQY I;  3J80 Q;  1NHJ A;  1IBL I;  2F4V E;  4X65 I;  2HFU A;  4LF6 I;  4RPF A;  5A2Q C;  1Z59 A;  2DEI A;  4JI2 I;  1D6T A;  4B3S I;  3ADL A;  4M1K A;  4OOG C;  1KIJ A;  2L2N A;  2V34 A;  2F4V I;  4WFT A;  2UXB E;  4PRX A;  2LTR A;  4URL A;  4LFC E;  2LBS B;  2LTS A;  2V2Z A;  2UUC E;  4K0K E;  1FWK A;  4WYQ B;  4DV0 E;  2IHR 1;  2LUP B;  4ZVI A;  4DPW A;  2UXB I;  2E5L E;  3QT6 A;  4Z7Y A;  4LFC I;  2N3G A;  3ZKD A;  3PYF A;  4DU8 A;  2UUC I;  4K0K I;  4LF4 E;  4DV0 I;  2LRS A;  4B3R E;  1DAR A;  1H7U A;  1YZ9 A;  1N33 E;  2E5L I;  2VQE E;  4DV4 E;  5GMD A;  1BKN A;  4DPX A;  3LPS A;  2EFG A;  4LF4 I;  1Z0G A;  1ZBT A;  4B3R I;  3P1X A;  1IBK E;  1KKH A;  1N33 I;  2OI2 A;  3Q1Q A;  2VQE I;  4DV3 E;  1X48 A;  2DMY A;  4DV4 I;  3V5R A;  2ZBK B;  2N3H A;  4DPY A;  3J81 Q;  1FWL A;  1IBK I;  1VIS A;  4DXL A;  3ZZT A;  4DR3 E;  4DV3 I;  4PU9 A;  5A2Q Q;  3WU5 A;  5LMN E;  1H7S A;  4DR3 I;  4WUC A;  4X66 E;  4JI4 E;  4WUB A;  1Z0W A;  1S16 A;  3PYG A;  5LMN I;  2GS8 A;  2LJH A;  4X8W A;  2MDR A;  4DR5 E;  2DB2 A;  2B7T A;  1S4E A;  4X66 I;  1EKZ A;  4JI4 I;  1B62 A;  4JI8 E;  1B63 A;  4JI7 E;  3WU3 A;  3K17 A;  2UXC E;  4DR5 I;  1MU5 A;  1HR0 E;  5L3J A;  2NUG A;  5FLX C;  5LL6 R;  4MYT A;  1Z5C A;  2RS6 A;  2B3T B;  4JI8 I;  4JI7 I;  3GON A;  1IBM E;  1PKP A;  2UXC I;  3C4B A;  4HY1 A;  3V2U C;  1HR0 I;  2VQF E;  2L3C A;  5LMU E;  2E1R A;  2V8P A;  4JI6 E;  1IBM I;  3LLH A;  4ED4 A;  1T4L B;  4YY3 E;  4X62 E;  2LUQ A;  4PRV A;  2VQF I;  4NXN E;  3K1J A;  1N34 E;  5LMU I;  2RTX A;  2BM1 A;  2JY9 A;  2R3V A;  4JI6 I;  1RR9 A;  1NZ0 A;  3F0N A;  2BM0 A;  4DR1 E;  4YY3 I;  3OTO E;  4HYM A;  1MG7 A;  4X62 I;  2X7I A;  4WUD A;  4NXN I;  1MX0 A;  1FKA E;  1N34 I;  4JI3 E;  4DKK A;  2VF3 A;  5IT9 C;  2NA2 A;  4LFB E;  4USM A;  2Q2E B;  4DR2 E;  4DR1 I;  2J7K A;  3OTO I;  2HHH E;  1KVK A;  4DV5 E;  2LJP A;  1J5E E;  3VYY A;  1ELO A;  4JI3 I;  2A2C A;  2EZ6 A;  3ADJ A;  4LFB I;  4DR2 I;  4XTJ A;  4DPU A;  2HK3 A;  2HHH I;  2JVA A;  1OJ4 A;  4DV5 I;  1XNQ E;  4DR4 E;  1J5E I;  2YT4 A;  3B82 A;  1UIL A;  1H73 A;  3WU6 A;  4EMD A;  4B3M E;  1DI2 A;  5FLX Q;  3QT5 A;  2HFS A;  4LF5 E;  2XEX A;  4JYA E;  1XNQ I;  3HTX A;  4DR4 I;  4KHP E;  1RRE A;  4UT4 A;  3JAM C;  4P52 A;  1YYK A;  2HKE A;  4GKK E;  4B3M I;  3LTO A;  4LF5 I;  4R1F A;  4OX9 E;  4YHH E;  1X47 A;  4DR7 E;  4JYA I;  3PYE A;  1NHH A;  4KHP I; 
#chains in the Genus database with same CATH topology
 1SR9 A;  1N0U A;  3LNU A;  2K7I A;  4U3D A;  4AIM A;  1IQS A;  1USU A;  3VK6 A;  4GKK I;  2NAB A;  2EOI A;  4HXZ A;  1EH7 A;  4FN5 A;  2PO2 B;  2MC5 A;  1UBD C;  2AJ4 A;  2V88 A;  4OX9 I;  5IXM B;  4YHH I;  1T4O A;  3H4L A;  4DR7 I;  1GQE A;  2O1T A;  2O1W A;  2GPI A;  2PNZ A;  2ELY A;  4DV7 E;  2EN4 A;  3T1H E;  2GO3 A;  3PS3 A;  4USK A;  3HPZ A;  2BV3 A;  2RS7 A;  5ELW A;  2L8T A;  3CDJ A;  2BR2 B;  5K36 A;  4FWG A;  2D9H A;  5DNL A;  1N36 E;  5JEA D;  4RHB B;  1O0W A;  2EPX A;  4OO1 A;  1NHI A;  5IT9 Q;  4MU0 A;  3VYX A;  2UUB E;  5KL4 A;  2R42 A;  2KHX A;  4ZYH A;  1X6H A;  3EPJ A;  3CDI A;  3ZZ0 A;  4DV7 I;  3T1H I;  1RQ0 A;  4WXD A;  4FW4 A;  5A6B A;  1N3G A;  1XNR E;  5C0X E;  4F54 A;  1LLM C;  1Z5B A;  1ZM2 A;  2JOB A;  5KL7 A;  4DUY E;  2C37 A;  2JP9 A;  2PNL A;  1N36 I;  2CVE A;  4LPF A;  2WW4 A;  2NN6 E;  2UUB I;  2EPO A;  2L92 A;  2NUF A;  2M9A A;  2L6M A;  3FIG A;  2RPC A;  2AE8 A;  1U2R A;  1PIE A;  1XNR I;  4HAC A;  3MSW A;  2EMW A;  4GKJ E;  1Z5A A;  2A2D A;  4DUY I;  2ELZ A;  1WHN A;  4X9J A;  1ZXN A;  2CZ9 A;  2HKJ A;  2EPA A;  2MKN A;  4Q35 B;  1HNX E;  5BR8 E;  3J81 C;  3KZY A;  1YYW A;  1X6F A;  2K4V A;  4OZE A;  2WP8 A;  2EMZ A;  5DRR A;  1UHZ A;  4FW9 A;  1XHK A;  4AID A;  5JEA A;  1UEK A;  2LO3 A;  2YRM A;  5IWA E;  2V8Q B;  1RC7 A;  1ZM9 A;  4FWD A;  4QNJ A;  3ZM7 A;  2CPN A;  1TF3 A;  2CGE A;  4JI5 E;  2WZO A;  4GKJ I;  1FI4 A;  5DNY A;  1HNX I;  5BR8 I;  2EN2 A;  1EH6 A;  3ADG A;  1OYP A;  4MDT A;  4I3H A;  1A1F A;  2EPN A;  1YSA C;  2NPF A;  3JAM Q;  4N3O A;  2A25 A;  4BBY A;  5IWA I;  4I8O A;  2ZM6 E;  4UTG A;  3P06 A;  1UDQ A;  1WUU A;  4JI5 I;  2EM8 A;  4DR6 E;  4MYU A;  1QNT A;  3ECR A;  5C0X F;  2EMK A;  3UK3 C;  4P78 A;  4DV6 E;  2I9I A;  3KWR A;  4MU1 A;  5DRO A;  4M0V A;  5K36 C;  2L33 A;  2F1D A;  4LF8 E;  3QT8 A;  4JV5 E;  1AH5 A;  4DUZ E;  2I13 A;  2NN6 F;  2ZM6 I;  1DQ3 A;  1NEI A;  2RSM A;  3CWV A;  4FW5 A;  4O43 A;  4DU7 A;  2L2K B;  3HXL A;  1JK2 A;  4DR6 I;  1A1J A;  2V2V A;  4LFA E;  2V2Q A;  2L3J A;  2YRK A;  4LF7 E;  2FV4 B;  2EOF A;  2LT7 A;  5KL6 A;  4F9A B;  1T4N A;  3C6M A;  2WNR A;  3PRY A;  5K36 B;  5T6J A;  1Z0C A;  2X36 A;  2EM5 A;  3HUL A;  4LF8 I;  4JI0 E;  2RQL A;  4DUZ I;  4JV5 I;  1Z0V A;  4OO1 B;  4ZYG A;  4LU9 A;  2EPC A;  4B3T E;  4IFD E;  2DEJ A;  2NN6 D;  2UXD E;  2J65 A;  2EPZ A;  1KYQ A;  2VE7 C;  4R2P A;  2EQ3 A;  4LFA I;  3J7A G;  4JI1 E;  3WU4 A;  4GEQ B;  4KQV A;  3ZKB A;  4LF7 I;  4Z7C A;  2YTN A;  2C37 B;  1N32 E;  3ZZU A;  5C0X C;  3BBG A;  1P47 A;  1ZM3 A;  5A6J A;  2F8B A;  3L7Z A;  3QT7 A;  2EMB A;  4M2Z A;  4DMI A;  2YWQ A;  2UUA E;  3J80 C;  4OKG A;  5DRQ A;  4JI0 I;  2YTF A;  4MU4 A;  5AE1 A;  3HKM A;  4FW3 A;  2YTI A;  2HK2 A;  2NN6 C;  1STU A;  4MLQ A;  4N4R B;  4B3T I;  2JR1 A;  4LTY A;  2UXD I;  1Z0E A;  3IWB A;  4HAC B;  4JI1 I;  4FK5 C;  5GME A;  3C4T A;  1ZXM A;  2EM2 A;  1Z0T A;  1N32 I;  2H36 X;  3ADI A;  1E3H A;  2NUE A;  3KRN A;  2UUA I;  4FW7 A;  4LF9 E;  2BA0 D;  2IOQ A;  2M7Q A;  4JG4 A;  5JEA B;  1YYO A;  4DV1 E;  1FJG E;  1PJQ A;  3D4J A;  2FTX B;  3ZOQ B;  3BF2 A;  3B8H A;  2C38 A;  2Z5B A;  3J7A M;  5AE3 A;  2LCE A;  2GQ0 A;  3PYD A;  1IMU A;  2UU9 E;  5FWK A;  2MC6 A;  2GHF A;  4TUG A;  2YTQ A;  4LF9 I;  5CFF E;  2DIX A;  3EQ1 A;  2ZIT A;  4DV1 I;  1TF6 A;  1J26 A;  1FJG I;  4IFD F;  3J7Y p;  3F6H A;  1A6F A;  4X64 E;  2IES A;  4BA1 A;  1ZAA C;  5C0X D;  3HJC A;  1QZR A;  2UU9 I;  1HNW E;  2YTD A;  2V87 A;  2YTJ A;  4L5N C;  4NXM E;  4P7A A;  1OYS A;  4DV2 E;  1N0V C;  3B78 A;  2YRH A;  2ENC A;  1WJP A;  2WBS A;  1Z0B A;  2BBG A;  1WHQ A;  1QU6 A;  4IJD A;  2L2M A;  1HNZ E;  1FNM A;  2JEA B;  3M6A A;  1XMQ E;  1I94 E;  2YTP A;  2DRP A;  1KTV A;  1ZU1 A;  3P3G A;  5KL2 A;  2Z5E A;  3HPS A;  4X64 I;  1PVG A;  3BID A;  1K47 A;  2B9D A;  1X49 A;  5DNX A;  4DV6 I;  1HNW I;  4NXM I;  2WNR B;  4DV2 I;  1XMO E;  2CT1 A;  4DPT A;  4R2A A;  1A1I A;  2EMY A;  1HK7 A;  2JOX A;  1HNZ I;  2PO1 A;  1EI1 A;  2EL5 A;  3GCM A;  4IZK A;  3T1Y E;  1A1G A;  1H72 C;  2JEB A;  2M1S A;  2E72 A;  5DRP A;  1EA6 A;  1XMQ I;  1I94 I;  4AQY E;  1H74 A;  1IBL E;  2PO0 A;  3THN A;  2YTO A;  4O5G A;  1YUI A;  4X65 E;  2HGH A;  1ZM4 A;  1YPN A;  4LF6 E;  2DLK A;  4WSG A;  2JT2 A;  4FW6 A;  4FWH A;  5KL5 A;  5C0X A;  2EL6 A;  3EPK A;  1XMO I;  1UDS A;  3L7Z B;  2EPM X;  3K85 A;  2EOQ A;  2EM3 A;  4M30 A;  4JI2 E;  2NN6 A;  3T1Y I;  2YZT A;  4HEI A;  2DGC A;  4B3S E;  4QNK A;  2VES A;  2B7V A;  2EN6 A;  3J80 Q;  2ENH A;  1NHJ A;  4AQY I;  1IBL I;  2F4V E;  4X65 I;  2YTE A;  2HFU A;  4LF6 I;  4J8Z A;  1PDA A;  4RPF A;  5A2Q C;  1A1L A;  1Y6Z A;  5A69 A;  2EQ1 A;  3F6G A;  2HJJ A;  2J7J A;  1YH8 A;  1Z59 A;  3U1K A;  3PS1 A;  2DEI A;  4JI2 I;  1D6T A;  1GTK A;  4BMJ A;  1DGC A;  4B3S I;  3ADL A;  4M1K A;  4OOG C;  1KIJ A;  2L2N A;  2EMX A;  4ZYD A;  2V34 A;  2F4V I;  4WFT A;  2C38 B;  2Z5B B;  3M85 D;  2UXB E;  4BHC A;  4MU3 A;  2EWL A;  4PRX A;  1A1K A;  2LTR A;  4WPY A;  4URL A;  3AV0 A;  4LFC E;  5LLQ A;  2LBS B;  3P3C A;  2LTS A;  4IZJ D;  2V2Z A;  2UUC E;  4K0K E;  1ZBQ A;  4O24 A;  2EL4 A;  1FWK A;  4WYQ B;  2BA0 G;  2JEA A;  4DV0 E;  2IHR 1;  4IFD D;  4F9C B;  3MHS C;  2EN3 A;  4F2J C;  4RH8 A;  2LUP B;  2EP3 A;  4F6M A;  4ZVI A;  4BA1 B;  4DPW A;  2UXB I;  2VRD A;  2E5L E;  2JWO A;  3QT6 A;  2EOY A;  2EE8 A;  1BBO A;  2N3G A;  3EPL A;  4Z7Y A;  2YSO A;  4LFC I;  3ZKD A;  4TUI A;  2WCC 3;  3PYF A;  4DU8 A;  2UUC I;  4K0K I;  1RMD A;  4LF4 E;  1Z1B A;  4LCH A;  4DV0 I;  1Y60 A;  2LRS A;  1B69 A;  4B3R E;  1DAR A;  1H7U A;  1YZ9 A;  1A1H A;  2R1F A;  1N33 E;  2E5L I;  1X6E A;  2CTD A;  2VQE E;  4DV4 E;  2EOZ A;  5GMD A;  1BKN A;  1VI7 A;  4DPX A;  3LML A;  3VHT B;  4IZJ A;  4F9B B;  2EFG A;  3LPS A;  4LF4 I;  3DF6 A;  2O1V A;  2PO1 B;  4MLV A;  4IZK B;  4KZS A;  2YU8 A;  2JEB B;  1Z0G A;  1ZBT A;  4B3R I;  4IFD A;  1GZ6 A;  3P1X A;  1IBK E;  4WSP A;  4R2C A;  2PO0 B;  1PJT A;  3HQ1 A;  5AC4 A;  1KKH A;  1N33 I;  2C39 A;  3EPH A;  2OI2 A;  5C0X B;  2VQE I;  4NBQ A;  3Q1Q A;  1X5W A;  4DV3 E;  1X48 A;  2DMY A;  2LVH A;  4DV4 I;  3V5R A;  2BB8 A;  4L8N A;  3H09 A;  3M7N D;  2ZBK B;  3QG5 C;  2IER A;  1WXR A;  2N3H A;  3OML A;  2JPA A;  2EPU A;  2EOX A;  4BA2 B;  2NN6 B;  2N8X A;  2EOM A;  4DPY A;  4IS9 A;  3J81 Q;  2LV2 A;  2GO4 A;  4R03 A;  4LOM A;  2EML A;  2M4I A;  1FWL A;  1X3C A;  2YU5 A;  1IBK I;  2BA1 D;  1VIS A;  4DXL A;  3ZZT A;  4DR3 E;  4DV3 I;  2IOP A;  3PS2 A;  4PU9 A;  3K6Q A;  5A2Q Q;  3WU5 A;  1TN9 A;  3M99 B;  1R6L A;  1USV A;  2EOE A;  4NHR A;  5LMN E;  2LMZ A;  3KZZ A;  1H7S A;  1UDN A;  1UN6 B;  4GQU A;  4DR3 I;  4BS9 A;  2YPN A;  4U3B A;  4WXC A;  1E3P A;  2EMA A;  4WUC A;  1RHY A;  2EN7 A;  4X66 E;  5AAS A;  3JU0 A;  3IWC A;  5K36 E;  4JI4 E;  2EMG A;  2V86 A;  3TQM A;  4WUB A;  1Z0W A;  2Z5C A;  2DLQ A;  1S16 A;  3PYG A;  5LMN I;  4OO1 E;  4R2R A;  2GS8 A;  3C6K A;  2LJH A;  4X8W A;  2WBT A;  2MDR A;  2ODR C;  4DR5 E;  2EM9 A;  3M85 G;  2Q8U A;  4ZYE A;  2JE6 A;  2EMH A;  2DB2 A;  1YFH A;  2B7T A;  4O4K A;  1S4E A;  4X66 I;  1EKZ A;  1BB8 A;  2EJ4 A;  4JI4 I;  2EPL X;  3AUZ A;  4GZN C;  1XXE A;  1B62 A;  1T38 A;  2EN8 A;  4JI8 E;  1B63 A;  4JI7 E;  2EOR A;  3L00 A;  3WU3 A;  3K17 A;  2UXC E;  4R2D A;  4IFD C;  2FGG A;  2MDG A;  2EN1 A;  4DR5 I;  1MU5 A;  5AC5 A;  2O1U A;  5AE2 A;  4J3D A;  4M9V C;  1HR0 E;  5L3J A;  2NUG A;  1BBG A;  4NZV A;  5IV8 B;  5FLX C;  4IZJ B;  5LL6 R;  4BA2 A;  1YHC A;  4MYT A;  3RMP A;  1Z5C A;  3GLL A;  1L4S A;  2RS6 A;  2B3T B;  2PRT A;  4JI8 I;  4JI7 I;  3GON A;  3MHH C;  5JEA E;  1IBM E;  1PKP A;  4IFD B;  3C4B A;  2UXC I;  2DMI A;  2C39 B;  4HY1 A;  5EKW A;  4WX9 A;  2R76 A;  2V85 A;  4HTG A;  2EOH A;  4ISA A;  3V2U C;  1HR0 I;  2VQF E;  1WRJ A;  1UDO A;  2L3C A;  3H1C A;  5K36 F;  2DSY A;  5LMU E;  2E1R A;  2V8P A;  1OYR A;  3U1Y A;  4R2E A;  2VF1 A;  4JI6 E;  1P42 A;  1R6M A;  1IBM I;  4OO1 F;  2ODR D;  2E1M A;  3LLH A;  2CG9 A;  5F3W A;  4ED4 A;  1T4L B;  4YY3 E;  5TSE A;  4F6N A;  1F2I G;  4X62 E;  2LUQ A;  4PRV A;  2VQF I;  4NXN E;  2EM0 A;  3K1J A;  3Q6N A;  2EPR A;  2KON A;  1N34 E;  3M7N G;  5LMU I;  4BC7 A;  2RTX A;  2EPP A;  2LJU A;  2BM1 A;  2JY9 A;  2R3V A;  1MGT A;  4JI6 I;  1RR9 A;  5A6A A;  2EOJ A;  1AAY A;  2PO2 A;  2EM6 A;  1NZ0 A;  3F0N A;  1MEY C;  2JXP A;  4DR1 E;  2MKD A;  2BM0 A;  5EL9 A;  2KOU A;  2BA1 G;  4YY3 I;  3OTO E;  4HYM A;  3DJW A;  1MG7 A;  4X62 I;  1T39 A;  2X7I A;  3DD6 A;  4WUD A;  5ADZ A;  4NXN I;  1MX0 A;  2RSI A;  1FKA E;  1N34 I;  4Q28 A;  4P7D A;  2YTG A;  4JI3 E;  4BC9 A;  2BR2 A;  3IWD A;  4DKK A;  5IT9 C;  2VF3 A;  2EMI A;  2NA2 A;  2Z5C B;  2ENA A;  3NZK A;  2ADR A;  4LFB E;  2EOO A;  4USM A;  5JEA F;  2Q2E B;  4DR2 E;  1PJS A;  4DR1 I;  3JTZ A;  2J7K A;  3OTO I;  4OO1 C;  2HHH E;  1KVK A;  2PNZ B;  3P3E A;  2EM4 A;  2JE6 B;  4DV5 E;  2LJP A;  1J5E E;  3VYY A;  1ELO A;  2EM7 A;  1Y4U A;  4JI3 I;  4IS1 C;  2WBU A;  5KL3 A;  1IQO A;  1NCS A;  2YSP A;  2CSH A;  2A2C A;  2EZ6 A;  3ADJ A;  3B4T A;  4LFB I;  4LCF A;  4DR2 I;  4XTJ A;  4DPU A;  4KWY A;  2HK3 A;  1JK1 A;  3UHM A;  2HHH I;  2JYA A;  2JVA A;  4AM3 A;  4R8O A;  1OJ4 A;  1G2D C;  1ZR9 A;  1XNQ E;  4DV5 I;  4MQY A;  4DR4 E;  1J5E I;  2YT4 A;  3Q6M A;  3B82 A;  1UIL A;  1H73 A;  2GLI A;  2PNM A;  2G7H A;  3WU6 A;  4EMD A;  2HC5 A;  1KJK A;  4B3M E;  1DI2 A;  4R2Q A;  4LCG A;  1Y5Y A;  5FLX Q;  1EH8 A;  3QT5 A;  2HFS A;  3THO B;  4LF5 E;  2XEX A;  5JEA C;  2EMC A;  2EOS A;  4JYA E;  1XNQ I;  2EPK X;  3HTX A;  4DR4 I;  1SFE A;  3P76 A;  4KHP E;  1Y4S A;  5K36 D;  1RRE A;  5A6K A;  4UT4 A;  3JAM C;  4P52 A;  1YYK A;  2EMF A;  2HKE A;  4R2S A;  4GKK E;  4B3M I;  4BCA A;  1YUJ A;  2EQ0 A;  2V83 A;  1G2F C;  3LTO A;  2WP8 B;  4OO1 D;  3BGH A;  4LF5 I;  4R1F A;  4OX9 E;  4YHH E;  1X47 A;  4DR7 E;  2V89 A;  4JYA I;  3GME A;  3PYE A;  5A6B D;  2LE2 A;  4BHB A;  2O3Z A;  1NHH A;  4KHP I; 
#chains in the Genus database with same CATH homology
 1SR9 A;  1N0U A;  3LNU A;  1USU A;  3VK6 A;  4GKK I;  4HXZ A;  4FN5 A;  2MC5 A;  2AJ4 A;  2V88 A;  4OX9 I;  4YHH I;  1T4O A;  3H4L A;  4DR7 I;  1GQE A;  2O1T A;  2O1W A;  4DV7 E;  3T1H E;  4USK A;  3HPZ A;  2BV3 A;  2RS7 A;  2L8T A;  4FWG A;  1N36 E;  1O0W A;  1NHI A;  5IT9 Q;  3VYX A;  2UUB E;  2R42 A;  2KHX A;  3ZZ0 A;  4DV7 I;  3T1H I;  1RQ0 A;  1XNR E;  4F54 A;  1Z5B A;  1ZM2 A;  2JOB A;  4DUY E;  2PNL A;  1N36 I;  2WW4 A;  2UUB I;  2L92 A;  2NUF A;  2L6M A;  3FIG A;  1U2R A;  1PIE A;  1XNR I;  4HAC A;  3MSW A;  4GKJ E;  1Z5A A;  2A2D A;  4DUY I;  1ZXN A;  1WHN A;  2CZ9 A;  2HKJ A;  1HNX E;  5BR8 E;  3J81 C;  1YYW A;  2K4V A;  1UHZ A;  4FW9 A;  1XHK A;  1UEK A;  1ZM9 A;  5IWA E;  2V8Q B;  1RC7 A;  4FWD A;  3ZM7 A;  2CPN A;  2CGE A;  4JI5 E;  2WZO A;  4GKJ I;  1FI4 A;  5DNY A;  1HNX I;  5BR8 I;  3ADG A;  4I3H A;  2NPF A;  3JAM Q;  4N3O A;  4BBY A;  5IWA I;  4I8O A;  2ZM6 E;  4UTG A;  3P06 A;  1WUU A;  4JI5 I;  4MYU A;  4DR6 E;  4P78 A;  4DV6 E;  3KWR A;  4M0V A;  2L33 A;  4LF8 E;  3QT8 A;  4JV5 E;  4DUZ E;  2ZM6 I;  1DQ3 A;  2RSM A;  3CWV A;  4DU7 A;  2L2K B;  3HXL A;  4DR6 I;  2V2V A;  4LFA E;  2V2Q A;  2L3J A;  4DV6 I;  4LF7 E;  2FV4 B;  4F9A B;  1T4N A;  3PRY A;  5T6J A;  1Z0C A;  2X36 A;  3HUL A;  4LF8 I;  4JI0 E;  4JV5 I;  4DUZ I;  1Z0V A;  4LU9 A;  4B3T E;  2DEJ A;  2UXD E;  2VE7 C;  4LFA I;  3J7A G;  4JI1 E;  3WU4 A;  4GEQ B;  4KQV A;  3ZKB A;  4LF7 I;  4Z7C A;  3ZZU A;  1N32 E;  1ZM3 A;  2F8B A;  3QT7 A;  4M2Z A;  4DMI A;  2UUA E;  4JI0 I;  3J80 C;  5AE1 A;  2HK2 A;  4B3T I;  1STU A;  2JR1 A;  4LTY A;  2UXD I;  1Z0E A;  3IWB A;  4HAC B;  4JI1 I;  5GME A;  3C4T A;  1ZXM A;  1Z0T A;  1N32 I;  2H36 X;  3ADI A;  2NUE A;  2UUA I;  4LF9 E;  2IOQ A;  2M7Q A;  4JG4 A;  1YYO A;  4DV1 E;  1FJG E;  3D4J A;  2FTX B;  3ZOQ B;  3B8H A;  3J7A M;  2Z5B A;  5AE3 A;  2GQ0 A;  3PYD A;  2UU9 E;  5FWK A;  2MC6 A;  4TUG A;  4LF9 I;  5CFF E;  2DIX A;  2ZIT A;  4DV1 I;  1J26 A;  1FJG I;  3J7Y p;  1A6F A;  3F6H A;  4X64 E;  3HJC A;  1QZR A;  2UU9 I;  1HNW E;  4NXM E;  2V87 A;  4L5N C;  4P7A A;  4DV2 E;  1N0V C;  3B78 A;  1Z0B A;  1WHQ A;  1QU6 A;  1HNZ E;  1FNM A;  2L2M A;  3M6A A;  1XMQ E;  1I94 E;  1KTV A;  2Z5E A;  3HPS A;  4X64 I;  1PVG A;  1K47 A;  2B9D A;  1X49 A;  1HNW I;  4NXM I;  4DV2 I;  1XMO E;  4DPT A;  1HK7 A;  2JOX A;  1HNZ I;  1EI1 A;  4IZK A;  3T1Y E;  1H72 C;  1XMQ I;  2M1S A;  1I94 I;  1EA6 A;  4AQY E;  1H74 A;  1IBL E;  4X65 E;  1ZM4 A;  4FWH A;  4LF6 E;  1XMO I;  3K85 A;  4M30 A;  4JI2 E;  3T1Y I;  2YZT A;  4B3S E;  2B7V A;  4AQY I;  3J80 Q;  1NHJ A;  1IBL I;  2F4V E;  4X65 I;  2HFU A;  4LF6 I;  4J8Z A;  4RPF A;  5A2Q C;  1Y6Z A;  3F6G A;  1Z59 A;  2DEI A;  4JI2 I;  1D6T A;  4BMJ A;  4B3S I;  3ADL A;  4M1K A;  4OOG C;  1KIJ A;  2L2N A;  2V34 A;  2F4V I;  4WFT A;  2Z5B B;  2UXB E;  2EWL A;  4PRX A;  2LTR A;  4WPY A;  4URL A;  3AV0 A;  4LFC E;  2LBS B;  4IZJ D;  2LTS A;  2V2Z A;  2UUC E;  4K0K E;  1ZBQ A;  1FWK A;  4WYQ B;  4DV0 E;  2IHR 1;  4F9C B;  2LUP B;  4ZVI A;  4DPW A;  2UXB I;  2E5L E;  2JWO A;  3QT6 A;  4Z7Y A;  4LFC I;  2N3G A;  3ZKD A;  4TUI A;  3PYF A;  4DU8 A;  2UUC I;  4K0K I;  4LF4 E;  4DV0 I;  2LRS A;  4B3R E;  1DAR A;  1H7U A;  1YZ9 A;  1N33 E;  2E5L I;  2VQE E;  4DV4 E;  5GMD A;  1BKN A;  4DPX A;  3LML A;  4IZJ A;  4F9B B;  2EFG A;  3LPS A;  4LF4 I;  3DF6 A;  2O1V A;  4IZK B;  4KZS A;  1Z0G A;  1ZBT A;  4B3R I;  1GZ6 A;  3P1X A;  1IBK E;  4WSP A;  3HQ1 A;  1KKH A;  1N33 I;  2OI2 A;  3Q1Q A;  2VQE I;  4DV3 E;  1X48 A;  2DMY A;  4DV4 I;  3V5R A;  4L8N A;  3H09 A;  2ZBK B;  1WXR A;  2N3H A;  3OML A;  4DPY A;  3J81 Q;  4R03 A;  2M4I A;  1FWL A;  1IBK I;  1VIS A;  4DXL A;  3ZZT A;  4DR3 E;  4DV3 I;  2IOP A;  4PU9 A;  3K6Q A;  5A2Q Q;  3WU5 A;  1USV A;  5LMN E;  2LMZ A;  1H7S A;  4DR3 I;  4BS9 A;  4WUC A;  4X66 E;  5AAS A;  3JU0 A;  3IWC A;  4JI4 E;  2V86 A;  4WUB A;  1Z0W A;  2Z5C A;  1S16 A;  3PYG A;  5LMN I;  2GS8 A;  2LJH A;  4X8W A;  2MDR A;  2ODR C;  4DR5 E;  2DB2 A;  2B7T A;  1S4E A;  4X66 I;  1EKZ A;  4JI4 I;  3AUZ A;  1B62 A;  4JI8 E;  1B63 A;  4JI7 E;  3WU3 A;  3K17 A;  2UXC E;  2FGG A;  4DR5 I;  1MU5 A;  2O1U A;  5AE2 A;  1HR0 E;  5L3J A;  2NUG A;  5FLX C;  4IZJ B;  5LL6 R;  4MYT A;  3RMP A;  1Z5C A;  2RS6 A;  2B3T B;  4JI8 I;  4JI7 I;  3GON A;  1IBM E;  1PKP A;  2UXC I;  3C4B A;  4HY1 A;  2V85 A;  3V2U C;  1HR0 I;  2VQF E;  2L3C A;  2DSY A;  5LMU E;  2E1R A;  2V8P A;  2VF1 A;  4JI6 E;  1IBM I;  2ODR D;  2E1M A;  3LLH A;  2CG9 A;  5F3W A;  4ED4 A;  1T4L B;  4YY3 E;  4X62 E;  2LUQ A;  4PRV A;  2VQF I;  4NXN E;  3K1J A;  3Q6N A;  2KON A;  1N34 E;  5LMU I;  4BC7 A;  2RTX A;  2BM1 A;  2JY9 A;  2R3V A;  4JI6 I;  1RR9 A;  1NZ0 A;  3F0N A;  2BM0 A;  4DR1 E;  2KOU A;  4YY3 I;  3OTO E;  4HYM A;  3DJW A;  1MG7 A;  4X62 I;  2X7I A;  4WUD A;  5ADZ A;  4NXN I;  1MX0 A;  1FKA E;  1N34 I;  4Q28 A;  4P7D A;  4JI3 E;  4BC9 A;  3IWD A;  4DKK A;  5IT9 C;  2VF3 A;  2NA2 A;  2Z5C B;  4LFB E;  4USM A;  2Q2E B;  4DR2 E;  4DR1 I;  3JTZ A;  2J7K A;  3OTO I;  2HHH E;  1KVK A;  4DV5 E;  2LJP A;  1J5E E;  3VYY A;  1ELO A;  1Y4U A;  4JI3 I;  2A2C A;  2EZ6 A;  3ADJ A;  4LFB I;  4DR2 I;  4XTJ A;  4DPU A;  2HK3 A;  2HHH I;  2JVA A;  4R8O A;  1OJ4 A;  4DV5 I;  1XNQ E;  4DR4 E;  1J5E I;  2YT4 A;  3Q6M A;  3B82 A;  1UIL A;  1H73 A;  2PNM A;  3WU6 A;  2G7H A;  4EMD A;  4B3M E;  1DI2 A;  5FLX Q;  3QT5 A;  2HFS A;  4LF5 E;  2XEX A;  4JYA E;  1XNQ I;  3HTX A;  4DR4 I;  4KHP E;  1Y4S A;  1RRE A;  4UT4 A;  3JAM C;  4P52 A;  1YYK A;  2HKE A;  4GKK E;  4B3M I;  4BCA A;  2V83 A;  3LTO A;  4LF5 I;  4R1F A;  4OX9 E;  4YHH E;  1X47 A;  4DR7 E;  2V89 A;  4JYA I;  3PYE A;  2LE2 A;  1NHH A;  4KHP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...