4LFCE

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lfcE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfcE02
4DR1E 3VYXA 1X49A 3PYDA 2CPNA 2UU9I 2YT4A 2N3HA 3D4JA 2L2MA 1MG7A 3K17A 3H4LA 1N0VC 1IBMI 4DR7I 1H73A 2N3GA 2UUAI 4KHPI 1ZM3A 1IBME 4DR7E 4B3SI 2UXDI 2UUAE 2X36A 1T4NA 4DV4I 1T4OA 4B3SE 4WUDA 5IT9Q 2B7TA 1PIEA 4WUBA 1D6TA 4R1FA 5IT9C 2V2ZA 1IBLI 3WU4A 1PVGA 4DXLA 1IBLE 1Z5CA 3LNUA 4DV6I 2LRSA 4DV6E 4Z7CA 2HHHI 1KKHA 4ED4A 4X65I 4USMA 2HHHE 4NXMI 4JYAI 1MX0A 4X65E 1EA6A 4NXME 4JYAE 3V5RA 1WUUA 4DV1I 4JV5I 4UT4A 4DV5I 4DV1E 1UHZA 2V2QA 4JV5E 4DV5E 3QT5A 3M6AA 2JY9A 4FWGA 5FLXC 1H7SA 5LMUI 4UTGA 2UXCI 5LMUE 1YYKA 4DKKA 4GKJI 4JI7I 2UXBI 3ZZ0A 2VF3A 1RREA 1X48A 4GKJE 4JI7E 1WHNA 2UXBE 1IBKI 3WU3A 4B3MI 4DPXA 1IBKE 1Z5BA 4B3ME 4USKA 1I94I 4JI4I 2L3CA 4LF4I 1I94E 4JI4E 1UILA 2EFGA 4LF5I 4LF4E 4FWHA 4LF5E 4JI6I 4X62I 1N33I 3OTOE 4JI6E 4X62E 1N33E 1J5EI 3T1HI 2OI2A 1J5EE 4DV3I 3T1HE 1BKNA 1OJ4A 4DV2I 2DB2A 4DV2E 4JI0I 1XNQI 2UUBI 2XEXA 4DPWA 4JI0E 1XNQE 2UUBE 2A2CA 1XMOE 4HYMA 3ZZTA 2LBSB 2UUCI 2ZM6I 4OOGC 2ZM6E 2L3JA 4JI5I 2A2DA 1KIJA 4GKKI 4JI5E 2L2NA 3C4BA 4GKKE 4FWDA 2NUEA 3J81Q 2UU9E 1FI4A 5A2QQ 2HK2A 3J7AG 4DU7A 4DV7I 2NUFA 3JAMQ 4DR5I 3ZKBA 4KHPE 4K0KI 1EI1A 2UXDE 1N34I 2LJHA 4K0KE 4HY1A 4DV4E 3VYYA 1DARA 2VQEI 4P52A 1YYOA 4DPYA 1ZM4A 4YY3I 3ADJA 4LFBI 4YY3E 3V2UC 1FWLA 4XTJA 4LFBE 3LTOA 2MDRA 5CFFE 4JI8I 4JI8E 1NHJA 1NHIA 4M1KA 3PYGA 1HNZI 3Q1QA 1Z0CA 2RS6A 1B62A 2ZBKB 4EMDA 4X8WA 3QT6A 3F0NA 1NZ0A 1Z5AA 4MYUA 2NPFA 2HFUA 4X64I 2IHR1 4LFAI 4X64E 4LFAE 1RC7A 4PRVA 5IWAI 3C4TA 1S16A 4LF7I 4AQYI 2LTSA 2DEJA 1N32I 3B82A 4AQYE 1EKZA 1N32E 3ZM7A 3LLHA 2UXCE 2NUGA 1N36I 1XNRI 4NXNI 2VQFI 1N36E 3B78A 4PU9A 4WUCA 1XNRE 2VQFE 4HACB 2DMYA 2LUQA 2J7KA 4JI2I 2KHXA 1NHHA 1Z59A 4JI2E 1RQ0A 2HKJA 4YHHI 5LMNI 4Z7YA 4YHHE 3ADIA 2LTRA 2DIXA 3ADGA 5GMDA 1YYWA 4P7AA 3ADLA 4LF9I 2L2KB 4DV3E 1Z0GA 4FW9A 4LF9E 2RTXA 4B3TI 1HR0I 1FJGI 1Z0TA 3K1JA 2E1RA 1HR0E 2X7IA 4DPTA 1FJGE 2RS7A 4DR2I 3J7Yp 5GMEA 2NA2A 2UUCE 2BM1A 4DR2E 4DU8A 4DUZI 4M30A 4URLA 4DUZE 3B8HA 1HNWI 3WU6A 4DR1I 3J81C 2BV3A 3HULA 3J80Q 4LF6I 5A2QC 2R42A 5LL6R 4DV7E 3LPSA 1X47A 1ZXNA 4DR5E 4LF6E 3JAMC 1O0WA 3J80C 1UEKA 4PRXA 4ZVIA 3PYFA 5L3JA 1N34E 2WW4A 3T1YI 2VQEE 1Z0WA 3T1YE 2R3VA 4WFTA 4B3RI 4B3RE 2BM0A 1J26A 1B63A 2Q2EB 3J7AM 1KVKA 1WHQA 1HNZE 2E5LI 4LF8I 4FN5A 2F4VI 2E5LE 4LF8E 2F4VE 1ZXMA 1FWKA 1U2RA 2HK3A 1STUA 4M2ZA 1A6FA 4HXZA 1Z0BA 4KQVA 2L33A 4HACA 1ELOA 2HKEA 4LFCI 4JI3I 1K47A 4I3HA 5IWAE 4LFCE 4JI3E 1XHKA 1RR9A 4LF7E 1ZM9A 2ZITA 3PYEA 2B3TB 4DPUA 1Z0VA 1ZBTA 3CWVA 4OX9I 5FLXQ 4NXNE 4OX9E 5BR8I 4RPFA 1DI2A 5BR8E 1H7UA 3P1XA 1Z0EA 2V2VA 2LJPA 1QZRA 1PKPA 5LMNE 2RSMA 2CZ9A 1S4EA 1FNMA 4JI1I 1KTVA 3ZKDA 1VISA 4JI1E 2AJ4A 1QU6A 3HTXA 4X66I 1N0UA 3QT8A 1ZM2A 4DR3I 4X66E 2V8PA 4B3TE 3OTOI 1HNXI 4DR3E 4DR4I 4MYTA 2LUPB 1HNXE 2B7VA 3WU5A 4DR4E 4WYQB 3GONA 1FKAE 1GQEA 4JG4A 2JVAA 1T4LB 1H74A 2GS8A 2DEIA 2EZ6A 4DV0I 3ZZUA 4DR6I 3QT7A 4DUYI 1YZ9A 4DV0E 2HFSA 2V34A 1XMQI 4DR6E 4DUYE 1MU5A 1XMOI 1XMQE 1H72C 1HNWE
chains in the Genus database with same CATH superfamily
3TQMA 4DR1E 2EMHA 2PNZB 5C0XD 3J81Q 1X5WA 3L7ZB 2EOZA 3VYXA 3CDIA 5EKWA 4DMIA 1KYQA 1X49A 1F2IG 5JEAB 1A1KA 3P06A 2M9AA 2CG9A 4HEIA 5A6BA 2YU8A 2VF1A 3PYDA 2CPNA 2EPRA 2ELZA 2EOSA 1YH8A 2WP8B 3DF6A 1TN9A 2UU9I 3K6QA 2WBUA 2Z5CB 2YT4A 2VE7C 2EPZA 2JE6A 2EMLA 2EMBA 2JYAA 2L2MA 2LVHA 2N3HA 1MG7A 3D4JA 2EN7A 2RPCA 3H4LA 1N0VC 3K17A 2JEAB 1IBMI 4F9CB 4DR7I 1YPNA 2YTJA 2N3GA 1H73A 2UUAI 4KHPI 3HXLA 1ZM3A 1IBME 4DR7E 4B3SI 2EMAA 2UUAE 2X36A 2UXDI 1T4NA 4DV4I 1T4OA 2EQ1A 2MKDA 2YTIA 4B3SE 1OYPA 2EPLX 2BR2A 4WUDA 5C0XC 5IT9Q 4IFDC 1RMDA 2B7TA 3C6MA 5JEAD 1PIEA 1A1JA 2MKNA 1DGCA 1Y5YA 4WUBA 1D6TA 4R1FA 2V85A 5IT9C 2I9IA 5KL2A 3ZOQB 4R2QA 2V2ZA 5AE3A 4F9AB 1IBLI 3WU4A 1PVGA 4DXLA 2C38B 4LPFA 1NCSA 1IMUA 4MDTA 1IBLE 3H09A 3M7NG 3U1YA 4BC7A 4F6MA 2GLIA 1Z5CA 1NEIA 4O24A 2DGCA 4KZSA 5F3WA 3LNUA 3PS2A 4DV6I 4WXCA 5JEAE 2LRSA 1MGTA 4RHBB 4DV6E 4M9VC 4Z7CA 2PO1A 2NN6A 4IZJD 3PS1A 3VK6A 2HHHI 2BBGA 2EOIA 1KKHA 4GEQB 4ED4A 4RH8A 4X65I 4USMA 2HHHE 4NXMI 4JYAI 1MX0A 2PNLA 4X65E 1EA6A 1WRJA 3VHTB 4NXME 5KL7A 2EP3A 4JYAE 2EN8A 3DJWA 1WUUA 2D9HA 2C37B 3V5RA 4DV1I 3P76A 4JV5I 4UT4A 4X9JA 2Z5EA 2JXPA 2JEBB 4DV5I 4DV1E 1UBDC 2PO2B 1UHZA 2V2QA 4JV5E 2YSOA 4DV5E 3QT5A 1TF6A 3IWBA 1T39A 3M6AA 1G2FC 2EPCA 2JY9A 2GHFA 5FLXC 4FWGA 2VESA 1H7SA 2EPMX 2GO4A 3IWCA 5LMUI 4UTGA 2LE2A 3OMLA 4BHCA 1Y6ZA 2EM4A 3M7ND 4P78A 2UXCI 5LMUE 1YYKA 2EM3A 4MLQA 1UDOA 4DKKA 2EL4A 4AIMA 5JEAF 4GKJI 4JI7I 2UXBI 3ZZ0A 3PS3A 2O3ZA 4WPYA 1RREA 2VF3A 1X48A 4GKJE 4JI7E 3HJCA 3PRYA 1WHNA 2JOXA 2YTEA 2UXBE 4IZKB 1IBKI 3WU3A 4B3MI 2YZTA 4DPXA 4FW6A 1IBKE 1Z5BA 4B3ME 2EM8A 4ZYGA 4USKA 1I94I 4JI4I 2M4IA 3F6GA 2L3CA 4IJDA 4LF4I 1I94E 4JI4E 4FK5C 2V89A 1UILA 1AH5A 2EFGA 4LF4E 4LF5I 2IOPA 2M1SA 4BA2B 2GQ0A 2BA0D 4FWHA 4LF5E 5C0XB 5DROA 2YPNA 4TUIA 4X62I 4JI6I 4IS9A 4OO1D 5LLQA 2C39A 1N33I 3OTOE 4JI6E 2V86A 4X62E 2GO3A 2PO0B 2PNZA 1N33E 1N34I 1J5EI 2BA1G 3T1HI 1DQ3A 2OI2A 2EM0A 4LTYA 1J5EE 4DV3I 3T1HE 2EMXA 2WBSA 4MU0A 1A1LA 1BKNA 2EN6A 1OJ4A 2DB2A 4DV2I 4MLVA 1VI7A 4DV2E 4OO1E 1X6FA 4JI0I 2CTDA 2G7HA 1XNQI 2UUBI 2EOQA 2XEXA 4DPWA 4LOMA 4JI0E 5TSEA 5DRPA 1XNQE 2UUBE 2HC5A 2A2CA 4F54A 1XMOE 4HYMA 3EPHA 3ZZTA 4R2CA 4IFDD 2LBSB 2UUCI 4OO1C 2EMGA 2ZM6I 4OOGC 2ZM6E 2L3JA 1Y60A 2YRHA 3ECRA 4JI5I 2A2DA 2HGHA 1PJSA 1KIJA 2CSHA 5AC5A 4GKKI 4JI5E 2YU5A 4O5GA 2L2NA 2IERA 3C4BA 4GKKE 2YRMA 2NUEA 3EPJA 4FWDA 1WJPA 5EL9A 3LMLA 4KWYA 1XXEA 2BA1D 2UU9E 3UK3C 2BB8A 4M0VA 2K7IA 1E3PA 1FI4A 5A2QQ 5C0XE 3P3CA 1X6EA 4IFDE 2HK2A 3J7AG 2NN6C 2C38A 4DU7A 2A25A 4O43A 5AE2A 2NUFA 3JAMQ 2J65A 4DV7I 1EH8A 2EMKA 1ZAAC 2EMFA 2EPAA 2YTPA 4DR5I 3HQ1A 1ZBQA 3ZKBA 2EOJA 4KHPE 4K0KI 3P3EA 3M85G 2E72A 5K36A 1EI1A 2L8TA 4BC9A 2LJHA 4K0KE 2UXDE 3H1CA 4HY1A 4DV4E 4QNKA 3VYYA 1DARA 2Z5BB 4P52A 4IZJB 2VQEI 1YYOA 1EH7A 4DPYA 4AIDA 2WBTA 3QG5C 3EPKA 1ZM4A 2ADRA 4YY3I 1L4SA 3ADJA 2ELYA 4LFBI 1OYRA 4YY3E 3V2UC 1X3CA 1FWLA 4XTJA 2B9DA 4LFBE 3LTOA 2MDRA 3JU0A 5CFFE 4P7DA 3DD6A 4JI8I 2EPPA 2EOHA 1A1HA 4JI8E 1NHJA 1NHIA 2C37A 4M1KA 2CGEA 1USUA 3PYGA 2AE8A 3AUZA 2JEBA 4R2RA 2O1TA 1HNZI 2PO2A 3Q1QA 1Z0CA 2DLQA 5C0XF 2RS6A 4NZVA 2O1VA 2FV4B 1B62A 1IQSA 2ZBKB 4EMDA 1KJKA 2ENAA 2DLKA 2K4VA 4WSGA 4X8WA 2GPIA 2E1MA 3RMPA 3QT6A 3F0NA 2KONA 1NZ0A 4FW4A 1YUJA 1Z5AA 4MYUA 2NPFA 2HFUA 5ELWA 4X64I 3KZYA 2IHR1 1ZU1A 2JOBA 2LT7A 3THNA 4LFAI 4WX9A 4IZKA 2EJ4A 4X64E 2IOQA 5DNYA 4LFAE 1RC7A 4PRVA 5IWAI 3C4TA 5IV8B 1S16A 5T6JA 2F8BA 4J8ZA 4LF7I 1BB8A 4ZYDA 4AQYI 2LTSA 5A6BD 2DEJA 1N32I 2YWQA 2YTQA 2JPAA 3B82A 2LO3A 2V8QB 4AQYE 1EKZA 1N32E 3ZM7A 3LLHA 5AASA 1PJQA 4OO1B 2MC5A 2Q8UA 2UXCE 2EPNA 5C0XA 3UHMA 4WSPA 2NUGA 1N36I 1XNRI 1JK1A 2JWOA 4NXNI 2VQFI 1N36E 3B78A 2WZOA 4PU9A 1XNRE 4WUCA 4R8OA 1RHYA 3KZZA 2VQFE 1P47A 2DMYA 4HACB 2LUQA 2J7KA 4JI2I 2KHXA 1NHHA 2V87A 4R2PA 1Z59A 5A69A 3L00A 4JI2E 5K36D 3BF2A 2NN6B 1RQ0A 2ODRD 2WNRB 2EMYA 4ISAA 4R2AA 3BIDA 2HKJA 1JK2A 4YHHI 5A6KA 2EOEA 5LMNI 4Z7YA 2H36X 4YHHE 3ADIA 2LJUA 2LTRA 2EOMA 1YFHA 4IFDB 1BBOA 4FW5A 2DIXA 2EWLA 2V83A 3ADGA 5GMDA 1YYWA 3L7ZA 2JP9A 2J7JA 2EOXA 4L5NC 3GMEA 4P7AA 5KL5A 2EMIA 3MHSC 3ADLA 5JEAA 4LF9I 2L2KB 4QNJA 4DV3E 4F6NA 1Z0GA 4FW9A 4LF9E 2RTXA 2EN4A 4OKGA 2WP8A 2NN6D 4B3TI 5K36C 2Z5CA 4BCAA 1PDAA 2ODRC 1HR0I 2CVEA 1FJGI 4ZYHA 2JEAA 1Z0TA 4ZYEA 2E1RA 1HR0E 2X7IA 3K1JA 2O1UA 3GCMA 3FIGA 1FJGE 4DPTA 1T38A 2R76A 3B4TA 2YTFA 2RS7A 4U3DA 3J7Yp 4DR2I 4FW3A 5GMEA 3MSWA 4TUGA 2NA2A 2UUCE 4FW7A 2BM1A 4DR2E 2V88A 3HPZA 1R6MA 1R6LA 4DU8A 2EPXA 2NN6E 4DUZI 3HPSA 4IZJA 2LMZA 4M30A 1G2DC 4F9BB 3THOB 2EOOA 4N4RB 4URLA 4DUZE 2ENHA 3B8HA 4BA1B 1HNWI 3WU6A 4DR1I 2R1FA 3J81C 5KL3A 3U1KA 5DRRA 2BV3A 2CT1A 3HULA 2EE8A 3J80Q 4LF6I 5A2QC 3KRNA 2R42A 5LL6R 2WCC3 1P42A 4DV7E 1YSAC 3LPSA 1X47A 1ZXNA 1Y4SA 4DR5E 2LCEA 4LF6E 4OO1F 3JAMC 1O0WA 4R03A 3J80C 1UEKA 2EMWA 4PRXA 1ZR9A 2EN1A 3KWRA 2MC6A 3PYFA 2DSYA 4NBQA 4ZVIA 5L3JA 1N34E 2WW4A 3T1YI 2DRPA 3HKMA 4GZNC 1WXRA 5AE1A 2L92A 2VQEE 1YUIA 1Z0WA 3GLLA 5KL6A 4F2JC 3T1YE 4Q35B 2R3VA 2FGGA 2NABA 4WFTA 2PNMA 2EOYA 4B3RI 3BGHA 4B3RE 2BM0A 4BHBA 2NN6F 1J26A 1A1FA 2EPOA 1B63A 2Q2EB 3J7AM 4NHRA 1KVKA 3IWDA 1WHQA 3M99B 4L8NA 1HNZE 1MEYC 2DMIA 4IFDF 2E5LI 2YTNA 4LCFA 2EOFA 4LF8I 4FN5A 2M7QA 3EPLA 2F4VI 2E5LE 2JT2A 4LF8E 2JE6B 2F4VE 1ZXMA 1FWKA 4OO1A 4IS1C 1U2RA 2HK3A 2VRDA 3M85D 5DNLA 1STUA 3F6HA 1HK7A 1SFEA 3MHHC 2EMZA 3C6KA 2N8XA 5ADZA 1AAYA 4M2ZA 1A6FA 4R2EA 4HXZA 1Z0BA 4LCHA 4KQVA 4R2DA 5K36B 2L33A 1UDQA 2BR2B 4BMJA 4HACA 1ELOA 2HKEA 4LFCI 4JI3I 4HTGA 1K47A 3K85A 4I3HA 1GTKA 3NZKA 1UN6B 5IWAE 2EN2A 2EMCA 4JI3E 4LFCE 1RR9A 1XHKA 5FWKA 2EL6A 2EPUA 2WNRA 2I13A 4LF7E 3Q6MA 1ZM9A 2ZITA 1QNTA 3PYEA 2ENCA 4BA2A 5JEAC 2RQLA 2B3TB 1E3HA 3CDJA 4J3DA 1USVA 4DPUA 4IFDA 1Z0VA 1ZBTA 3CWVA 4OX9I 2PO0A 1UDSA 1N3GA 4BBYA 2BA0G 5FLXQ 4NXNE 2EORA 2YTDA 4OX9E 5AC4A 5BR8I 2O1WA 2EL5A 4RPFA 1DI2A 2EM2A 2MDGA 5BR8E 5DNXA 2PO1B 1H7UA 3P1XA 1Z0EA 1PJTA 2EM6A 4R2SA 2PRTA 2EQ3A 2V2VA 4LCGA 2YSPA 1TF3A 3AV0A 3EQ1A 1A1GA 1QZRA 2LJPA 1PKPA 1BBGA 2HJJA 4O4KA 1SR9A 4MU1A 5LMNE 2RSMA 1IQOA 2CZ9A 2EM9A 5A6AA 4MU4A 2EM5A 1X6HA 1S4EA 4I8OA 2RSIA 1FNMA 5K36E 4JI1I 2YRKA 1KTVA 1Y4UA 3ZKDA 1VISA 2EQ0A 4JI1E 4GQUA 2AJ4A 1QU6A 1YHCA 3HTXA 1UDNA 4X66I 1GZ6A 2YTOA 3JTZA 1EH6A 1N0UA 1ZM2A 3QT8A 4DR3I 4X66E 3P3GA 4N3OA 4BA1A 2V8PA 4B3TE 4MU3A 2IESA 3OTOI 1HNXI 4DR3E 1OYSA 4DR4I 4MYTA 2LUPB 4LU9A 2KOUA 1HNXE 2B7VA 1A1IA 4DR4E 2EN3A 5A6JA 4WYQB 3GONA 1FKAE 2EM7A 3WU5A 2FTXB 1Z1BA 4AM3A 4WXDA 5DRQA 1B69A 5IXMB 1GQEA 3Q6NA 4JG4A 4BS9A 2JVAA 1T4LB 1H74A 4Q28A 2GS8A 2DEIA 2LV2A 2Z5BA 2EZ6A 2EPKX 4MQYA 5KL4A 4DV0I 1LLMC 3ZZUA 4DR6I 3QT7A 4DUYI 2JR1A 1YZ9A 2L6MA 4DV0E 2YTGA 2HFSA 2V34A 4OZEA 4U3BA 4DR6E 1XMQI 5K36F 4DUYE 1MU5A 2F1DA 2C39B 1XMOI 1XMQE 1H72C 3BBGA 1HNWE
chains in the Genus database with same CATH topology
4DR1E 3VYXA 4DMIA 1X49A 3P06A 2CG9A 2VF1A 3PYDA 2CPNA 3DF6A 2UU9I 3K6QA 2Z5CB 2YT4A 2VE7C 2N3HA 3D4JA 2L2MA 1MG7A 3K17A 3H4LA 1N0VC 1IBMI 4F9CB 4DR7I 1H73A 2N3GA 2UUAI 4KHPI 3HXLA 1ZM3A 1IBME 4DR7E 4B3SI 2UXDI 2UUAE 2X36A 1T4NA 4DV4I 1T4OA 4B3SE 4WUDA 5IT9Q 2B7TA 1PIEA 4WUBA 1D6TA 4R1FA 2V85A 5IT9C 3ZOQB 2V2ZA 5AE3A 4F9AB 1IBLI 3WU4A 1PVGA 4DXLA 1IBLE 3H09A 4BC7A 1Z5CA 4KZSA 5F3WA 3LNUA 4DV6I 2LRSA 4DV6E 4Z7CA 4IZJD 3VK6A 2HHHI 1KKHA 4GEQB 4ED4A 4X65I 4USMA 2HHHE 4NXMI 4JYAI 1MX0A 2PNLA 4X65E 1EA6A 4NXME 4JYAE 3DJWA 3V5RA 1WUUA 4DV1I 4JV5I 4UT4A 2Z5EA 4DV5I 4DV1E 1UHZA 2V2QA 4JV5E 4DV5E 3QT5A 3IWBA 3M6AA 2JY9A 5FLXC 4FWGA 1H7SA 3IWCA 5LMUI 4UTGA 2LE2A 3OMLA 1Y6ZA 4P78A 2UXCI 5LMUE 1YYKA 4DKKA 4GKJI 4JI7I 2UXBI 3ZZ0A 4WPYA 1RREA 2VF3A 1X48A 4GKJE 4JI7E 3HJCA 3PRYA 1WHNA 2JOXA 2UXBE 4IZKB 1IBKI 3WU3A 4B3MI 2YZTA 4DPXA 1IBKE 1Z5BA 4B3ME 4USKA 1I94I 4JI4I 2M4IA 3F6GA 2L3CA 4LF4I 1I94E 4JI4E 2V89A 1UILA 2EFGA 4LF5I 4LF4E 2IOPA 2M1SA 2GQ0A 4FWHA 4LF5E 4TUIA 4JI6I 4X62I 1N33I 3OTOE 4JI6E 2V86A 4X62E 1N33E 1J5EI 3T1HI 1DQ3A 2OI2A 4LTYA 1J5EE 4DV3I 3T1HE 1BKNA 1OJ4A 4DV2I 2DB2A 4DV2E 4JI0I 2G7HA 1XNQI 2UUBI 2XEXA 4DPWA 4JI0E 1XNQE 2UUBE 2A2CA 4F54A 1XMOE 4HYMA 3ZZTA 2LBSB 2UUCI 2ZM6I 4OOGC 2ZM6E 2L3JA 4JI5I 2A2DA 1KIJA 4GKKI 4JI5E 2L2NA 3C4BA 4GKKE 4FWDA 2NUEA 3J81Q 3LMLA 2UU9E 4M0VA 1FI4A 5A2QQ 2HK2A 3J7AG 4DU7A 4DV7I 5AE2A 2NUFA 3JAMQ 4DR5I 3HQ1A 1ZBQA 3ZKBA 4KHPE 4K0KI 1EI1A 2L8TA 4BC9A 2LJHA 4K0KE 2UXDE 4HY1A 1N34I 4DV4E 3VYYA 1DARA 2Z5BB 4P52A 4IZJB 2VQEI 1YYOA 4DPYA 1ZM4A 4YY3I 3ADJA 4LFBI 4YY3E 3V2UC 1FWLA 4XTJA 2B9DA 4LFBE 3LTOA 2MDRA 3JU0A 5CFFE 4P7DA 4JI8I 4JI8E 1NHJA 1NHIA 4M1KA 2CGEA 1USUA 3PYGA 3AUZA 1HNZI 2O1TA 3Q1QA 1Z0CA 2RS6A 2O1VA 1B62A 2FV4B 2ZBKB 4EMDA 2K4VA 4X8WA 2E1MA 3RMPA 3QT6A 3F0NA 2KONA 1NZ0A 1Z5AA 4MYUA 2NPFA 2HFUA 4X64I 2IHR1 2JOBA 4LFAI 4IZKA 4X64E 2IOQA 5DNYA 4LFAE 1RC7A 4PRVA 5IWAI 3C4TA 1S16A 5T6JA 2F8BA 4J8ZA 4LF7I 4AQYI 2LTSA 2DEJA 1N32I 3B82A 2V8QB 4AQYE 1EKZA 1N32E 3ZM7A 3LLHA 5AASA 2MC5A 2UXCE 4WSPA 2NUGA 1N36I 1XNRI 2JWOA 4NXNI 2VQFI 1N36E 3B78A 2WZOA 4PU9A 1XNRE 4WUCA 4R8OA 2VQFE 4HACB 2DMYA 2LUQA 2J7KA 4JI2I 2KHXA 1NHHA 2V87A 1Z59A 4JI2E 1RQ0A 2ODRD 2HKJA 4YHHI 5LMNI 4Z7YA 2H36X 4YHHE 3ADIA 2LTRA 2DIXA 2EWLA 2V83A 3ADGA 5GMDA 1YYWA 4L5NC 4P7AA 3ADLA 4LF9I 2L2KB 4DV3E 1Z0GA 4FW9A 4LF9E 2RTXA 4B3TI 2Z5CA 4BCAA 2ODRC 1HR0I 1FJGI 1Z0TA 3K1JA 2E1RA 1HR0E 2X7IA 2O1UA 3FIGA 1FJGE 4DPTA 2RS7A 4DR2I 3J7Yp 5GMEA 3MSWA 4TUGA 2NA2A 2UUCE 2BM1A 4DR2E 2V88A 3HPZA 4DU8A 4DUZI 3HPSA 4IZJA 2LMZA 4M30A 4F9BB 4URLA 4DUZE 3B8HA 1HNWI 3WU6A 4DR1I 3J81C 2BV3A 3HULA 3J80Q 4LF6I 5A2QC 2R42A 5LL6R 4DV7E 3LPSA 1X47A 1ZXNA 1Y4SA 4DR5E 4LF6E 3JAMC 1O0WA 4R03A 3J80C 1UEKA 4PRXA 3KWRA 2MC6A 3PYFA 2DSYA 4ZVIA 5L3JA 1N34E 2WW4A 3T1YI 1WXRA 5AE1A 2L92A 2VQEE 1Z0WA 3T1YE 2R3VA 2FGGA 4WFTA 2PNMA 4B3RI 4B3RE 2BM0A 1J26A 1B63A 2Q2EB 3J7AM 1KVKA 3IWDA 1WHQA 4L8NA 1HNZE 2E5LI 4LF8I 4FN5A 2M7QA 2F4VI 2E5LE 4LF8E 2F4VE 1ZXMA 1FWKA 1U2RA 2HK3A 1STUA 3F6HA 1HK7A 4M2ZA 5ADZA 1A6FA 4HXZA 1Z0BA 4KQVA 2L33A 4HACA 4BMJA 1ELOA 2HKEA 4LFCI 4JI3I 1K47A 3K85A 4I3HA 5IWAE 4LFCE 4JI3E 1XHKA 1RR9A 5FWKA 4LF7E 3Q6MA 1ZM9A 2ZITA 3PYEA 2B3TB 1USVA 4DPUA 1Z0VA 1ZBTA 3CWVA 4OX9I 4BBYA 5FLXQ 4NXNE 4OX9E 5BR8I 2O1WA 4RPFA 1DI2A 5BR8E 1H7UA 3P1XA 1Z0EA 2V2VA 3AV0A 2LJPA 1QZRA 1PKPA 1SR9A 5LMNE 2RSMA 2CZ9A 1S4EA 4I8OA 1FNMA 4JI1I 1KTVA 1Y4UA 3ZKDA 1VISA 4JI1E 2AJ4A 1QU6A 3HTXA 4X66I 1GZ6A 1N0UA 3JTZA 3QT8A 1ZM2A 4DR3I 4X66E 4N3OA 2V8PA 4B3TE 3OTOI 1HNXI 4DR3E 4DR4I 4MYTA 2LUPB 4LU9A 2KOUA 1HNXE 2B7VA 3WU5A 4DR4E 4WYQB 3GONA 1FKAE 2FTXB 1GQEA 3Q6NA 4JG4A 4BS9A 2JVAA 1T4LB 1H74A 4Q28A 2GS8A 2DEIA 2Z5BA 2EZ6A 4DV0I 3ZZUA 4DR6I 3QT7A 4DUYI 2JR1A 1YZ9A 2L6MA 4DV0E 2HFSA 2V34A 1XMQI 4DR6E 4DUYE 1MU5A 1XMOI 1XMQE 1H72C 1HNWE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 E;  3VYX A;  1X49 A;  3PYD A;  2CPN A;  2UU9 I;  2YT4 A;  2N3H A;  3D4J A;  2L2M A;  1MG7 A;  3K17 A;  3H4L A;  1N0V C;  1IBM I;  4DR7 I;  1H73 A;  2N3G A;  2UUA I;  4KHP I;  1ZM3 A;  1IBM E;  4DR7 E;  4B3S I;  2UXD I;  2UUA E;  2X36 A;  1T4N A;  4DV4 I;  1T4O A;  4B3S E;  4WUD A;  5IT9 Q;  2B7T A;  1PIE A;  4WUB A;  1D6T A;  4R1F A;  5IT9 C;  2V2Z A;  1IBL I;  3WU4 A;  1PVG A;  4DXL A;  1IBL E;  1Z5C A;  3LNU A;  4DV6 I;  2LRS A;  4DV6 E;  4Z7C A;  2HHH I;  1KKH A;  4ED4 A;  4X65 I;  4USM A;  2HHH E;  4NXM I;  4JYA I;  1MX0 A;  4X65 E;  1EA6 A;  4NXM E;  4JYA E;  3V5R A;  1WUU A;  4DV1 I;  4JV5 I;  4UT4 A;  4DV5 I;  4DV1 E;  1UHZ A;  2V2Q A;  4JV5 E;  4DV5 E;  3QT5 A;  3M6A A;  2JY9 A;  4FWG A;  5FLX C;  1H7S A;  5LMU I;  4UTG A;  2UXC I;  5LMU E;  1YYK A;  4DKK A;  4GKJ I;  4JI7 I;  2UXB I;  3ZZ0 A;  2VF3 A;  1RRE A;  1X48 A;  4GKJ E;  4JI7 E;  1WHN A;  2UXB E;  1IBK I;  3WU3 A;  4B3M I;  4DPX A;  1IBK E;  1Z5B A;  4B3M E;  4USK A;  1I94 I;  4JI4 I;  2L3C A;  4LF4 I;  1I94 E;  4JI4 E;  1UIL A;  2EFG A;  4LF5 I;  4LF4 E;  4FWH A;  4LF5 E;  4JI6 I;  4X62 I;  1N33 I;  3OTO E;  4JI6 E;  4X62 E;  1N33 E;  1J5E I;  3T1H I;  2OI2 A;  1J5E E;  4DV3 I;  3T1H E;  1BKN A;  1OJ4 A;  4DV2 I;  2DB2 A;  4DV2 E;  4JI0 I;  1XNQ I;  2UUB I;  2XEX A;  4DPW A;  4JI0 E;  1XNQ E;  2UUB E;  2A2C A;  1XMO E;  4HYM A;  3ZZT A;  2LBS B;  2UUC I;  2ZM6 I;  4OOG C;  2ZM6 E;  2L3J A;  4JI5 I;  2A2D A;  1KIJ A;  4GKK I;  4JI5 E;  2L2N A;  3C4B A;  4GKK E;  4FWD A;  2NUE A;  3J81 Q;  2UU9 E;  1FI4 A;  5A2Q Q;  2HK2 A;  3J7A G;  4DU7 A;  4DV7 I;  2NUF A;  3JAM Q;  4DR5 I;  3ZKB A;  4KHP E;  4K0K I;  1EI1 A;  2UXD E;  1N34 I;  2LJH A;  4K0K E;  4HY1 A;  4DV4 E;  3VYY A;  1DAR A;  2VQE I;  4P52 A;  1YYO A;  4DPY A;  1ZM4 A;  4YY3 I;  3ADJ A;  4LFB I;  4YY3 E;  3V2U C;  1FWL A;  4XTJ A;  4LFB E;  3LTO A;  2MDR A;  5CFF E;  4JI8 I;  4JI8 E;  1NHJ A;  1NHI A;  4M1K A;  3PYG A;  1HNZ I;  3Q1Q A;  1Z0C A;  2RS6 A;  1B62 A;  2ZBK B;  4EMD A;  4X8W A;  3QT6 A;  3F0N A;  1NZ0 A;  1Z5A A;  4MYU A;  2NPF A;  2HFU A;  4X64 I;  2IHR 1;  4LFA I;  4X64 E;  4LFA E;  1RC7 A;  4PRV A;  5IWA I;  3C4T A;  1S16 A;  4LF7 I;  4AQY I;  2LTS A;  2DEJ A;  1N32 I;  3B82 A;  4AQY E;  1EKZ A;  1N32 E;  3ZM7 A;  3LLH A;  2UXC E;  2NUG A;  1N36 I;  1XNR I;  4NXN I;  2VQF I;  1N36 E;  3B78 A;  4PU9 A;  4WUC A;  1XNR E;  2VQF E;  4HAC B;  2DMY A;  2LUQ A;  2J7K A;  4JI2 I;  2KHX A;  1NHH A;  1Z59 A;  4JI2 E;  1RQ0 A;  2HKJ A;  4YHH I;  5LMN I;  4Z7Y A;  4YHH E;  3ADI A;  2LTR A;  2DIX A;  3ADG A;  5GMD A;  1YYW A;  4P7A A;  3ADL A;  4LF9 I;  2L2K B;  4DV3 E;  1Z0G A;  4FW9 A;  4LF9 E;  2RTX A;  4B3T I;  1HR0 I;  1FJG I;  1Z0T A;  3K1J A;  2E1R A;  1HR0 E;  2X7I A;  4DPT A;  1FJG E;  2RS7 A;  4DR2 I;  3J7Y p;  5GME A;  2NA2 A;  2UUC E;  2BM1 A;  4DR2 E;  4DU8 A;  4DUZ I;  4M30 A;  4URL A;  4DUZ E;  3B8H A;  1HNW I;  3WU6 A;  4DR1 I;  3J81 C;  2BV3 A;  3HUL A;  3J80 Q;  4LF6 I;  5A2Q C;  2R42 A;  5LL6 R;  4DV7 E;  3LPS A;  1X47 A;  1ZXN A;  4DR5 E;  4LF6 E;  3JAM C;  1O0W A;  3J80 C;  1UEK A;  4PRX A;  4ZVI A;  3PYF A;  5L3J A;  1N34 E;  2WW4 A;  3T1Y I;  2VQE E;  1Z0W A;  3T1Y E;  2R3V A;  4WFT A;  4B3R I;  4B3R E;  2BM0 A;  1J26 A;  1B63 A;  2Q2E B;  3J7A M;  1KVK A;  1WHQ A;  1HNZ E;  2E5L I;  4LF8 I;  4FN5 A;  2F4V I;  2E5L E;  4LF8 E;  2F4V E;  1ZXM A;  1FWK A;  1U2R A;  2HK3 A;  1STU A;  4M2Z A;  1A6F A;  4HXZ A;  1Z0B A;  4KQV A;  2L33 A;  4HAC A;  1ELO A;  2HKE A;  4LFC I;  4JI3 I;  1K47 A;  4I3H A;  5IWA E;  4LFC E;  4JI3 E;  1XHK A;  1RR9 A;  4LF7 E;  1ZM9 A;  2ZIT A;  3PYE A;  2B3T B;  4DPU A;  1Z0V A;  1ZBT A;  3CWV A;  4OX9 I;  5FLX Q;  4NXN E;  4OX9 E;  5BR8 I;  4RPF A;  1DI2 A;  5BR8 E;  1H7U A;  3P1X A;  1Z0E A;  2V2V A;  2LJP A;  1QZR A;  1PKP A;  5LMN E;  2RSM A;  2CZ9 A;  1S4E A;  1FNM A;  4JI1 I;  1KTV A;  3ZKD A;  1VIS A;  4JI1 E;  2AJ4 A;  1QU6 A;  3HTX A;  4X66 I;  1N0U A;  3QT8 A;  1ZM2 A;  4DR3 I;  4X66 E;  2V8P A;  4B3T E;  3OTO I;  1HNX I;  4DR3 E;  4DR4 I;  4MYT A;  2LUP B;  1HNX E;  2B7V A;  3WU5 A;  4DR4 E;  4WYQ B;  3GON A;  1FKA E;  1GQE A;  4JG4 A;  2JVA A;  1T4L B;  1H74 A;  2GS8 A;  2DEI A;  2EZ6 A;  4DV0 I;  3ZZU A;  4DR6 I;  3QT7 A;  4DUY I;  1YZ9 A;  4DV0 E;  2HFS A;  2V34 A;  1XMQ I;  4DR6 E;  4DUY E;  1MU5 A;  1XMO I;  1XMQ E;  1H72 C;  1HNW E; 
#chains in the Genus database with same CATH topology
 3TQM A;  4DR1 E;  2EMH A;  2PNZ B;  5C0X D;  3J81 Q;  1X5W A;  3L7Z B;  2EOZ A;  3VYX A;  3CDI A;  5EKW A;  4DMI A;  1KYQ A;  1X49 A;  1F2I G;  5JEA B;  1A1K A;  3P06 A;  2M9A A;  2CG9 A;  4HEI A;  5A6B A;  2YU8 A;  2VF1 A;  3PYD A;  2CPN A;  2EPR A;  2ELZ A;  2EOS A;  1YH8 A;  2WP8 B;  3DF6 A;  1TN9 A;  2UU9 I;  3K6Q A;  2WBU A;  2Z5C B;  2YT4 A;  2VE7 C;  2EPZ A;  2JE6 A;  2EML A;  2EMB A;  2JYA A;  2L2M A;  2LVH A;  2N3H A;  1MG7 A;  3D4J A;  2EN7 A;  2RPC A;  3H4L A;  1N0V C;  3K17 A;  2JEA B;  1IBM I;  4F9C B;  4DR7 I;  1YPN A;  2YTJ A;  2N3G A;  1H73 A;  2UUA I;  4KHP I;  3HXL A;  1ZM3 A;  1IBM E;  4DR7 E;  4B3S I;  2EMA A;  2UUA E;  2X36 A;  2UXD I;  1T4N A;  4DV4 I;  1T4O A;  2EQ1 A;  2MKD A;  2YTI A;  4B3S E;  1OYP A;  2EPL X;  2BR2 A;  4WUD A;  5C0X C;  5IT9 Q;  4IFD C;  1RMD A;  2B7T A;  3C6M A;  5JEA D;  1PIE A;  1A1J A;  2MKN A;  1DGC A;  1Y5Y A;  4WUB A;  1D6T A;  4R1F A;  2V85 A;  5IT9 C;  2I9I A;  5KL2 A;  3ZOQ B;  4R2Q A;  2V2Z A;  5AE3 A;  4F9A B;  1IBL I;  3WU4 A;  1PVG A;  4DXL A;  2C38 B;  4LPF A;  1NCS A;  1IMU A;  4MDT A;  1IBL E;  3H09 A;  3M7N G;  3U1Y A;  4BC7 A;  4F6M A;  2GLI A;  1Z5C A;  1NEI A;  4O24 A;  2DGC A;  4KZS A;  5F3W A;  3LNU A;  3PS2 A;  4DV6 I;  4WXC A;  5JEA E;  2LRS A;  1MGT A;  4RHB B;  4DV6 E;  4M9V C;  4Z7C A;  2PO1 A;  2NN6 A;  4IZJ D;  3PS1 A;  3VK6 A;  2HHH I;  2BBG A;  2EOI A;  1KKH A;  4GEQ B;  4ED4 A;  4RH8 A;  4X65 I;  4USM A;  2HHH E;  4NXM I;  4JYA I;  1MX0 A;  2PNL A;  4X65 E;  1EA6 A;  1WRJ A;  3VHT B;  4NXM E;  5KL7 A;  2EP3 A;  4JYA E;  2EN8 A;  3DJW A;  1WUU A;  2D9H A;  2C37 B;  3V5R A;  4DV1 I;  3P76 A;  4JV5 I;  4UT4 A;  4X9J A;  2Z5E A;  2JXP A;  2JEB B;  4DV5 I;  4DV1 E;  1UBD C;  2PO2 B;  1UHZ A;  2V2Q A;  4JV5 E;  2YSO A;  4DV5 E;  3QT5 A;  1TF6 A;  3IWB A;  1T39 A;  3M6A A;  1G2F C;  2EPC A;  2JY9 A;  2GHF A;  5FLX C;  4FWG A;  2VES A;  1H7S A;  2EPM X;  2GO4 A;  3IWC A;  5LMU I;  4UTG A;  2LE2 A;  3OML A;  4BHC A;  1Y6Z A;  2EM4 A;  3M7N D;  4P78 A;  2UXC I;  5LMU E;  1YYK A;  2EM3 A;  4MLQ A;  1UDO A;  4DKK A;  2EL4 A;  4AIM A;  5JEA F;  4GKJ I;  4JI7 I;  2UXB I;  3ZZ0 A;  3PS3 A;  2O3Z A;  4WPY A;  1RRE A;  2VF3 A;  1X48 A;  4GKJ E;  4JI7 E;  3HJC A;  3PRY A;  1WHN A;  2JOX A;  2YTE A;  2UXB E;  4IZK B;  1IBK I;  3WU3 A;  4B3M I;  2YZT A;  4DPX A;  4FW6 A;  1IBK E;  1Z5B A;  4B3M E;  2EM8 A;  4ZYG A;  4USK A;  1I94 I;  4JI4 I;  2M4I A;  3F6G A;  2L3C A;  4IJD A;  4LF4 I;  1I94 E;  4JI4 E;  4FK5 C;  2V89 A;  1UIL A;  1AH5 A;  2EFG A;  4LF4 E;  4LF5 I;  2IOP A;  2M1S A;  4BA2 B;  2GQ0 A;  2BA0 D;  4FWH A;  4LF5 E;  5C0X B;  5DRO A;  2YPN A;  4TUI A;  4X62 I;  4JI6 I;  4IS9 A;  4OO1 D;  5LLQ A;  2C39 A;  1N33 I;  3OTO E;  4JI6 E;  2V86 A;  4X62 E;  2GO3 A;  2PO0 B;  2PNZ A;  1N33 E;  1N34 I;  1J5E I;  2BA1 G;  3T1H I;  1DQ3 A;  2OI2 A;  2EM0 A;  4LTY A;  1J5E E;  4DV3 I;  3T1H E;  2EMX A;  2WBS A;  4MU0 A;  1A1L A;  1BKN A;  2EN6 A;  1OJ4 A;  2DB2 A;  4DV2 I;  4MLV A;  1VI7 A;  4DV2 E;  4OO1 E;  1X6F A;  4JI0 I;  2CTD A;  2G7H A;  1XNQ I;  2UUB I;  2EOQ A;  2XEX A;  4DPW A;  4LOM A;  4JI0 E;  5TSE A;  5DRP A;  1XNQ E;  2UUB E;  2HC5 A;  2A2C A;  4F54 A;  1XMO E;  4HYM A;  3EPH A;  3ZZT A;  4R2C A;  4IFD D;  2LBS B;  2UUC I;  4OO1 C;  2EMG A;  2ZM6 I;  4OOG C;  2ZM6 E;  2L3J A;  1Y60 A;  2YRH A;  3ECR A;  4JI5 I;  2A2D A;  2HGH A;  1PJS A;  1KIJ A;  2CSH A;  5AC5 A;  4GKK I;  4JI5 E;  2YU5 A;  4O5G A;  2L2N A;  2IER A;  3C4B A;  4GKK E;  2YRM A;  2NUE A;  3EPJ A;  4FWD A;  1WJP A;  5EL9 A;  3LML A;  4KWY A;  1XXE A;  2BA1 D;  2UU9 E;  3UK3 C;  2BB8 A;  4M0V A;  2K7I A;  1E3P A;  1FI4 A;  5A2Q Q;  5C0X E;  3P3C A;  1X6E A;  4IFD E;  2HK2 A;  3J7A G;  2NN6 C;  2C38 A;  4DU7 A;  2A25 A;  4O43 A;  5AE2 A;  2NUF A;  3JAM Q;  2J65 A;  4DV7 I;  1EH8 A;  2EMK A;  1ZAA C;  2EMF A;  2EPA A;  2YTP A;  4DR5 I;  3HQ1 A;  1ZBQ A;  3ZKB A;  2EOJ A;  4KHP E;  4K0K I;  3P3E A;  3M85 G;  2E72 A;  5K36 A;  1EI1 A;  2L8T A;  4BC9 A;  2LJH A;  4K0K E;  2UXD E;  3H1C A;  4HY1 A;  4DV4 E;  4QNK A;  3VYY A;  1DAR A;  2Z5B B;  4P52 A;  4IZJ B;  2VQE I;  1YYO A;  1EH7 A;  4DPY A;  4AID A;  2WBT A;  3QG5 C;  3EPK A;  1ZM4 A;  2ADR A;  4YY3 I;  1L4S A;  3ADJ A;  2ELY A;  4LFB I;  1OYR A;  4YY3 E;  3V2U C;  1X3C A;  1FWL A;  4XTJ A;  2B9D A;  4LFB E;  3LTO A;  2MDR A;  3JU0 A;  5CFF E;  4P7D A;  3DD6 A;  4JI8 I;  2EPP A;  2EOH A;  1A1H A;  4JI8 E;  1NHJ A;  1NHI A;  2C37 A;  4M1K A;  2CGE A;  1USU A;  3PYG A;  2AE8 A;  3AUZ A;  2JEB A;  4R2R A;  2O1T A;  1HNZ I;  2PO2 A;  3Q1Q A;  1Z0C A;  2DLQ A;  5C0X F;  2RS6 A;  4NZV A;  2O1V A;  2FV4 B;  1B62 A;  1IQS A;  2ZBK B;  4EMD A;  1KJK A;  2ENA A;  2DLK A;  2K4V A;  4WSG A;  4X8W A;  2GPI A;  2E1M A;  3RMP A;  3QT6 A;  3F0N A;  2KON A;  1NZ0 A;  4FW4 A;  1YUJ A;  1Z5A A;  4MYU A;  2NPF A;  2HFU A;  5ELW A;  4X64 I;  3KZY A;  2IHR 1;  1ZU1 A;  2JOB A;  2LT7 A;  3THN A;  4LFA I;  4WX9 A;  4IZK A;  2EJ4 A;  4X64 E;  2IOQ A;  5DNY A;  4LFA E;  1RC7 A;  4PRV A;  5IWA I;  3C4T A;  5IV8 B;  1S16 A;  5T6J A;  2F8B A;  4J8Z A;  4LF7 I;  1BB8 A;  4ZYD A;  4AQY I;  2LTS A;  5A6B D;  2DEJ A;  1N32 I;  2YWQ A;  2YTQ A;  2JPA A;  3B82 A;  2LO3 A;  2V8Q B;  4AQY E;  1EKZ A;  1N32 E;  3ZM7 A;  3LLH A;  5AAS A;  1PJQ A;  4OO1 B;  2MC5 A;  2Q8U A;  2UXC E;  2EPN A;  5C0X A;  3UHM A;  4WSP A;  2NUG A;  1N36 I;  1XNR I;  1JK1 A;  2JWO A;  4NXN I;  2VQF I;  1N36 E;  3B78 A;  2WZO A;  4PU9 A;  1XNR E;  4WUC A;  4R8O A;  1RHY A;  3KZZ A;  2VQF E;  1P47 A;  2DMY A;  4HAC B;  2LUQ A;  2J7K A;  4JI2 I;  2KHX A;  1NHH A;  2V87 A;  4R2P A;  1Z59 A;  5A69 A;  3L00 A;  4JI2 E;  5K36 D;  3BF2 A;  2NN6 B;  1RQ0 A;  2ODR D;  2WNR B;  2EMY A;  4ISA A;  4R2A A;  3BID A;  2HKJ A;  1JK2 A;  4YHH I;  5A6K A;  2EOE A;  5LMN I;  4Z7Y A;  2H36 X;  4YHH E;  3ADI A;  2LJU A;  2LTR A;  2EOM A;  1YFH A;  4IFD B;  1BBO A;  4FW5 A;  2DIX A;  2EWL A;  2V83 A;  3ADG A;  5GMD A;  1YYW A;  3L7Z A;  2JP9 A;  2J7J A;  2EOX A;  4L5N C;  3GME A;  4P7A A;  5KL5 A;  2EMI A;  3MHS C;  3ADL A;  5JEA A;  4LF9 I;  2L2K B;  4QNJ A;  4DV3 E;  4F6N A;  1Z0G A;  4FW9 A;  4LF9 E;  2RTX A;  2EN4 A;  4OKG A;  2WP8 A;  2NN6 D;  4B3T I;  5K36 C;  2Z5C A;  4BCA A;  1PDA A;  2ODR C;  1HR0 I;  2CVE A;  1FJG I;  4ZYH A;  2JEA A;  1Z0T A;  4ZYE A;  2E1R A;  1HR0 E;  2X7I A;  3K1J A;  2O1U A;  3GCM A;  3FIG A;  1FJG E;  4DPT A;  1T38 A;  2R76 A;  3B4T A;  2YTF A;  2RS7 A;  4U3D A;  3J7Y p;  4DR2 I;  4FW3 A;  5GME A;  3MSW A;  4TUG A;  2NA2 A;  2UUC E;  4FW7 A;  2BM1 A;  4DR2 E;  2V88 A;  3HPZ A;  1R6M A;  1R6L A;  4DU8 A;  2EPX A;  2NN6 E;  4DUZ I;  3HPS A;  4IZJ A;  2LMZ A;  4M30 A;  1G2D C;  4F9B B;  3THO B;  2EOO A;  4N4R B;  4URL A;  4DUZ E;  2ENH A;  3B8H A;  4BA1 B;  1HNW I;  3WU6 A;  4DR1 I;  2R1F A;  3J81 C;  5KL3 A;  3U1K A;  5DRR A;  2BV3 A;  2CT1 A;  3HUL A;  2EE8 A;  3J80 Q;  4LF6 I;  5A2Q C;  3KRN A;  2R42 A;  5LL6 R;  2WCC 3;  1P42 A;  4DV7 E;  1YSA C;  3LPS A;  1X47 A;  1ZXN A;  1Y4S A;  4DR5 E;  2LCE A;  4LF6 E;  4OO1 F;  3JAM C;  1O0W A;  4R03 A;  3J80 C;  1UEK A;  2EMW A;  4PRX A;  1ZR9 A;  2EN1 A;  3KWR A;  2MC6 A;  3PYF A;  2DSY A;  4NBQ A;  4ZVI A;  5L3J A;  1N34 E;  2WW4 A;  3T1Y I;  2DRP A;  3HKM A;  4GZN C;  1WXR A;  5AE1 A;  2L92 A;  2VQE E;  1YUI A;  1Z0W A;  3GLL A;  5KL6 A;  4F2J C;  3T1Y E;  4Q35 B;  2R3V A;  2FGG A;  2NAB A;  4WFT A;  2PNM A;  2EOY A;  4B3R I;  3BGH A;  4B3R E;  2BM0 A;  4BHB A;  2NN6 F;  1J26 A;  1A1F A;  2EPO A;  1B63 A;  2Q2E B;  3J7A M;  4NHR A;  1KVK A;  3IWD A;  1WHQ A;  3M99 B;  4L8N A;  1HNZ E;  1MEY C;  2DMI A;  4IFD F;  2E5L I;  2YTN A;  4LCF A;  2EOF A;  4LF8 I;  4FN5 A;  2M7Q A;  3EPL A;  2F4V I;  2E5L E;  2JT2 A;  4LF8 E;  2JE6 B;  2F4V E;  1ZXM A;  1FWK A;  4OO1 A;  4IS1 C;  1U2R A;  2HK3 A;  2VRD A;  3M85 D;  5DNL A;  1STU A;  3F6H A;  1HK7 A;  1SFE A;  3MHH C;  2EMZ A;  3C6K A;  2N8X A;  5ADZ A;  1AAY A;  4M2Z A;  1A6F A;  4R2E A;  4HXZ A;  1Z0B A;  4LCH A;  4KQV A;  4R2D A;  5K36 B;  2L33 A;  1UDQ A;  2BR2 B;  4BMJ A;  4HAC A;  1ELO A;  2HKE A;  4LFC I;  4JI3 I;  4HTG A;  1K47 A;  3K85 A;  4I3H A;  1GTK A;  3NZK A;  1UN6 B;  5IWA E;  2EN2 A;  2EMC A;  4JI3 E;  4LFC E;  1RR9 A;  1XHK A;  5FWK A;  2EL6 A;  2EPU A;  2WNR A;  2I13 A;  4LF7 E;  3Q6M A;  1ZM9 A;  2ZIT A;  1QNT A;  3PYE A;  2ENC A;  4BA2 A;  5JEA C;  2RQL A;  2B3T B;  1E3H A;  3CDJ A;  4J3D A;  1USV A;  4DPU A;  4IFD A;  1Z0V A;  1ZBT A;  3CWV A;  4OX9 I;  2PO0 A;  1UDS A;  1N3G A;  4BBY A;  2BA0 G;  5FLX Q;  4NXN E;  2EOR A;  2YTD A;  4OX9 E;  5AC4 A;  5BR8 I;  2O1W A;  2EL5 A;  4RPF A;  1DI2 A;  2EM2 A;  2MDG A;  5BR8 E;  5DNX A;  2PO1 B;  1H7U A;  3P1X A;  1Z0E A;  1PJT A;  2EM6 A;  4R2S A;  2PRT A;  2EQ3 A;  2V2V A;  4LCG A;  2YSP A;  1TF3 A;  3AV0 A;  3EQ1 A;  1A1G A;  1QZR A;  2LJP A;  1PKP A;  1BBG A;  2HJJ A;  4O4K A;  1SR9 A;  4MU1 A;  5LMN E;  2RSM A;  1IQO A;  2CZ9 A;  2EM9 A;  5A6A A;  4MU4 A;  2EM5 A;  1X6H A;  1S4E A;  4I8O A;  2RSI A;  1FNM A;  5K36 E;  4JI1 I;  2YRK A;  1KTV A;  1Y4U A;  3ZKD A;  1VIS A;  2EQ0 A;  4JI1 E;  4GQU A;  2AJ4 A;  1QU6 A;  1YHC A;  3HTX A;  1UDN A;  4X66 I;  1GZ6 A;  2YTO A;  3JTZ A;  1EH6 A;  1N0U A;  1ZM2 A;  3QT8 A;  4DR3 I;  4X66 E;  3P3G A;  4N3O A;  4BA1 A;  2V8P A;  4B3T E;  4MU3 A;  2IES A;  3OTO I;  1HNX I;  4DR3 E;  1OYS A;  4DR4 I;  4MYT A;  2LUP B;  4LU9 A;  2KOU A;  1HNX E;  2B7V A;  1A1I A;  4DR4 E;  2EN3 A;  5A6J A;  4WYQ B;  3GON A;  1FKA E;  2EM7 A;  3WU5 A;  2FTX B;  1Z1B A;  4AM3 A;  4WXD A;  5DRQ A;  1B69 A;  5IXM B;  1GQE A;  3Q6N A;  4JG4 A;  4BS9 A;  2JVA A;  1T4L B;  1H74 A;  4Q28 A;  2GS8 A;  2DEI A;  2LV2 A;  2Z5B A;  2EZ6 A;  2EPK X;  4MQY A;  5KL4 A;  4DV0 I;  1LLM C;  3ZZU A;  4DR6 I;  3QT7 A;  4DUY I;  2JR1 A;  1YZ9 A;  2L6M A;  4DV0 E;  2YTG A;  2HFS A;  2V34 A;  4OZE A;  4U3B A;  4DR6 E;  1XMQ I;  5K36 F;  4DUY E;  1MU5 A;  2F1D A;  2C39 B;  1XMO I;  1XMQ E;  1H72 C;  3BBG A;  1HNW E; 
#chains in the Genus database with same CATH homology
 4DR1 E;  3VYX A;  4DMI A;  1X49 A;  3P06 A;  2CG9 A;  2VF1 A;  3PYD A;  2CPN A;  3DF6 A;  2UU9 I;  3K6Q A;  2Z5C B;  2YT4 A;  2VE7 C;  2N3H A;  3D4J A;  2L2M A;  1MG7 A;  3K17 A;  3H4L A;  1N0V C;  1IBM I;  4F9C B;  4DR7 I;  1H73 A;  2N3G A;  2UUA I;  4KHP I;  3HXL A;  1ZM3 A;  1IBM E;  4DR7 E;  4B3S I;  2UXD I;  2UUA E;  2X36 A;  1T4N A;  4DV4 I;  1T4O A;  4B3S E;  4WUD A;  5IT9 Q;  2B7T A;  1PIE A;  4WUB A;  1D6T A;  4R1F A;  2V85 A;  5IT9 C;  3ZOQ B;  2V2Z A;  5AE3 A;  4F9A B;  1IBL I;  3WU4 A;  1PVG A;  4DXL A;  1IBL E;  3H09 A;  4BC7 A;  1Z5C A;  4KZS A;  5F3W A;  3LNU A;  4DV6 I;  2LRS A;  4DV6 E;  4Z7C A;  4IZJ D;  3VK6 A;  2HHH I;  1KKH A;  4GEQ B;  4ED4 A;  4X65 I;  4USM A;  2HHH E;  4NXM I;  4JYA I;  1MX0 A;  2PNL A;  4X65 E;  1EA6 A;  4NXM E;  4JYA E;  3DJW A;  3V5R A;  1WUU A;  4DV1 I;  4JV5 I;  4UT4 A;  2Z5E A;  4DV5 I;  4DV1 E;  1UHZ A;  2V2Q A;  4JV5 E;  4DV5 E;  3QT5 A;  3IWB A;  3M6A A;  2JY9 A;  5FLX C;  4FWG A;  1H7S A;  3IWC A;  5LMU I;  4UTG A;  2LE2 A;  3OML A;  1Y6Z A;  4P78 A;  2UXC I;  5LMU E;  1YYK A;  4DKK A;  4GKJ I;  4JI7 I;  2UXB I;  3ZZ0 A;  4WPY A;  1RRE A;  2VF3 A;  1X48 A;  4GKJ E;  4JI7 E;  3HJC A;  3PRY A;  1WHN A;  2JOX A;  2UXB E;  4IZK B;  1IBK I;  3WU3 A;  4B3M I;  2YZT A;  4DPX A;  1IBK E;  1Z5B A;  4B3M E;  4USK A;  1I94 I;  4JI4 I;  2M4I A;  3F6G A;  2L3C A;  4LF4 I;  1I94 E;  4JI4 E;  2V89 A;  1UIL A;  2EFG A;  4LF5 I;  4LF4 E;  2IOP A;  2M1S A;  2GQ0 A;  4FWH A;  4LF5 E;  4TUI A;  4JI6 I;  4X62 I;  1N33 I;  3OTO E;  4JI6 E;  2V86 A;  4X62 E;  1N33 E;  1J5E I;  3T1H I;  1DQ3 A;  2OI2 A;  4LTY A;  1J5E E;  4DV3 I;  3T1H E;  1BKN A;  1OJ4 A;  4DV2 I;  2DB2 A;  4DV2 E;  4JI0 I;  2G7H A;  1XNQ I;  2UUB I;  2XEX A;  4DPW A;  4JI0 E;  1XNQ E;  2UUB E;  2A2C A;  4F54 A;  1XMO E;  4HYM A;  3ZZT A;  2LBS B;  2UUC I;  2ZM6 I;  4OOG C;  2ZM6 E;  2L3J A;  4JI5 I;  2A2D A;  1KIJ A;  4GKK I;  4JI5 E;  2L2N A;  3C4B A;  4GKK E;  4FWD A;  2NUE A;  3J81 Q;  3LML A;  2UU9 E;  4M0V A;  1FI4 A;  5A2Q Q;  2HK2 A;  3J7A G;  4DU7 A;  4DV7 I;  5AE2 A;  2NUF A;  3JAM Q;  4DR5 I;  3HQ1 A;  1ZBQ A;  3ZKB A;  4KHP E;  4K0K I;  1EI1 A;  2L8T A;  4BC9 A;  2LJH A;  4K0K E;  2UXD E;  4HY1 A;  1N34 I;  4DV4 E;  3VYY A;  1DAR A;  2Z5B B;  4P52 A;  4IZJ B;  2VQE I;  1YYO A;  4DPY A;  1ZM4 A;  4YY3 I;  3ADJ A;  4LFB I;  4YY3 E;  3V2U C;  1FWL A;  4XTJ A;  2B9D A;  4LFB E;  3LTO A;  2MDR A;  3JU0 A;  5CFF E;  4P7D A;  4JI8 I;  4JI8 E;  1NHJ A;  1NHI A;  4M1K A;  2CGE A;  1USU A;  3PYG A;  3AUZ A;  1HNZ I;  2O1T A;  3Q1Q A;  1Z0C A;  2RS6 A;  2O1V A;  1B62 A;  2FV4 B;  2ZBK B;  4EMD A;  2K4V A;  4X8W A;  2E1M A;  3RMP A;  3QT6 A;  3F0N A;  2KON A;  1NZ0 A;  1Z5A A;  4MYU A;  2NPF A;  2HFU A;  4X64 I;  2IHR 1;  2JOB A;  4LFA I;  4IZK A;  4X64 E;  2IOQ A;  5DNY A;  4LFA E;  1RC7 A;  4PRV A;  5IWA I;  3C4T A;  1S16 A;  5T6J A;  2F8B A;  4J8Z A;  4LF7 I;  4AQY I;  2LTS A;  2DEJ A;  1N32 I;  3B82 A;  2V8Q B;  4AQY E;  1EKZ A;  1N32 E;  3ZM7 A;  3LLH A;  5AAS A;  2MC5 A;  2UXC E;  4WSP A;  2NUG A;  1N36 I;  1XNR I;  2JWO A;  4NXN I;  2VQF I;  1N36 E;  3B78 A;  2WZO A;  4PU9 A;  1XNR E;  4WUC A;  4R8O A;  2VQF E;  4HAC B;  2DMY A;  2LUQ A;  2J7K A;  4JI2 I;  2KHX A;  1NHH A;  2V87 A;  1Z59 A;  4JI2 E;  1RQ0 A;  2ODR D;  2HKJ A;  4YHH I;  5LMN I;  4Z7Y A;  2H36 X;  4YHH E;  3ADI A;  2LTR A;  2DIX A;  2EWL A;  2V83 A;  3ADG A;  5GMD A;  1YYW A;  4L5N C;  4P7A A;  3ADL A;  4LF9 I;  2L2K B;  4DV3 E;  1Z0G A;  4FW9 A;  4LF9 E;  2RTX A;  4B3T I;  2Z5C A;  4BCA A;  2ODR C;  1HR0 I;  1FJG I;  1Z0T A;  3K1J A;  2E1R A;  1HR0 E;  2X7I A;  2O1U A;  3FIG A;  1FJG E;  4DPT A;  2RS7 A;  4DR2 I;  3J7Y p;  5GME A;  3MSW A;  4TUG A;  2NA2 A;  2UUC E;  2BM1 A;  4DR2 E;  2V88 A;  3HPZ A;  4DU8 A;  4DUZ I;  3HPS A;  4IZJ A;  2LMZ A;  4M30 A;  4F9B B;  4URL A;  4DUZ E;  3B8H A;  1HNW I;  3WU6 A;  4DR1 I;  3J81 C;  2BV3 A;  3HUL A;  3J80 Q;  4LF6 I;  5A2Q C;  2R42 A;  5LL6 R;  4DV7 E;  3LPS A;  1X47 A;  1ZXN A;  1Y4S A;  4DR5 E;  4LF6 E;  3JAM C;  1O0W A;  4R03 A;  3J80 C;  1UEK A;  4PRX A;  3KWR A;  2MC6 A;  3PYF A;  2DSY A;  4ZVI A;  5L3J A;  1N34 E;  2WW4 A;  3T1Y I;  1WXR A;  5AE1 A;  2L92 A;  2VQE E;  1Z0W A;  3T1Y E;  2R3V A;  2FGG A;  4WFT A;  2PNM A;  4B3R I;  4B3R E;  2BM0 A;  1J26 A;  1B63 A;  2Q2E B;  3J7A M;  1KVK A;  3IWD A;  1WHQ A;  4L8N A;  1HNZ E;  2E5L I;  4LF8 I;  4FN5 A;  2M7Q A;  2F4V I;  2E5L E;  4LF8 E;  2F4V E;  1ZXM A;  1FWK A;  1U2R A;  2HK3 A;  1STU A;  3F6H A;  1HK7 A;  4M2Z A;  5ADZ A;  1A6F A;  4HXZ A;  1Z0B A;  4KQV A;  2L33 A;  4HAC A;  4BMJ A;  1ELO A;  2HKE A;  4LFC I;  4JI3 I;  1K47 A;  3K85 A;  4I3H A;  5IWA E;  4LFC E;  4JI3 E;  1XHK A;  1RR9 A;  5FWK A;  4LF7 E;  3Q6M A;  1ZM9 A;  2ZIT A;  3PYE A;  2B3T B;  1USV A;  4DPU A;  1Z0V A;  1ZBT A;  3CWV A;  4OX9 I;  4BBY A;  5FLX Q;  4NXN E;  4OX9 E;  5BR8 I;  2O1W A;  4RPF A;  1DI2 A;  5BR8 E;  1H7U A;  3P1X A;  1Z0E A;  2V2V A;  3AV0 A;  2LJP A;  1QZR A;  1PKP A;  1SR9 A;  5LMN E;  2RSM A;  2CZ9 A;  1S4E A;  4I8O A;  1FNM A;  4JI1 I;  1KTV A;  1Y4U A;  3ZKD A;  1VIS A;  4JI1 E;  2AJ4 A;  1QU6 A;  3HTX A;  4X66 I;  1GZ6 A;  1N0U A;  3JTZ A;  3QT8 A;  1ZM2 A;  4DR3 I;  4X66 E;  4N3O A;  2V8P A;  4B3T E;  3OTO I;  1HNX I;  4DR3 E;  4DR4 I;  4MYT A;  2LUP B;  4LU9 A;  2KOU A;  1HNX E;  2B7V A;  3WU5 A;  4DR4 E;  4WYQ B;  3GON A;  1FKA E;  2FTX B;  1GQE A;  3Q6N A;  4JG4 A;  4BS9 A;  2JVA A;  1T4L B;  1H74 A;  4Q28 A;  2GS8 A;  2DEI A;  2Z5B A;  2EZ6 A;  4DV0 I;  3ZZU A;  4DR6 I;  3QT7 A;  4DUY I;  2JR1 A;  1YZ9 A;  2L6M A;  4DV0 E;  2HFS A;  2V34 A;  1XMQ I;  4DR6 E;  4DUY E;  1MU5 A;  1XMO I;  1XMQ E;  1H72 C;  1HNW E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...