4LFCE

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lfcE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfcE02
1UILA 4M2ZA 3CWVA 4LF9I 2LTRA 1H7SA 2ZM6I 4DR3I 4B3RE 1RREA 1Z0BA 2LJPA 4JI0I 4YY3I 4DV1I 4DUYE 4X62E 4JI8E 4DV6I 4YHHE 4JI4E 1N32I 1ZM9A 1IBKI 2UXDI 3QT5A 4JI2I 4PRXA 2UU9I 1B62A 2B7VA 2N3GA 3J81C 3V5RA 4DV3E 1XHKA 4FN5A 2AJ4A 2VQFE 2CPNA 4OX9E 2V2QA 4JI1I 2LJHA 1KIJA 4DV0E 1VISA 4UT4A 3PYFA 4DR6E 4DR1E 3J7Yp 1OJ4A 1XNRI 2BM0A 1Z5CA 4JI7I 4B3SE 1O0WA 2L3JA 2UXBE 2ZITA 4JG4A 5FLXQ 4DV7E 5LMNE 3ZZUA 1GQEA 3K1JA 1I94I 3LLHA 2UUAI 1EA6A 5CFFE 1WUUA 1NZ0A 2JY9A 5IT9Q 1IBLE 1ZXNA 4X65E 4NXNE 5A2QQ 4USMA 2HK3A 4LF8I 4NXME 4DR7E 3PYEA 4DR2I 2UXCE 2E1RA 1KVKA 4LF5I 2L33A 4DPXA 4DV4I 4JV5I 3J81Q 4ED4A 4UTGA 4JI3I 4GKJE 1XNQI 1H72C 4DV2I 4B3TE 1N33E 1HNWE 2R3VA 4HYMA 4GKKE 1HR0E 1NHIA 2OI2A 4K0KI 2HK2A 4M30A 4HXZA 3WU5A 4JI6I 2X7IA 4Z7CA 5IWAE 2EZ6A 4JI5E 1A6FA 1ELOA 1ZM4A 4DR5I 2CZ9A 4FW9A 3B82A 1HNXI 1X48A 3GONA 4X66E 1N36E 4AQYI 2GS8A 4KHPI 1YYOA 4DV5I 4USKA 2BV3A 5FLXC 2LUPB 2UUCE 3ADIA 3WU3A 1FWKA 2MDRA 4B3ME 1H73A 2UXDE 4JI2E 4LF6I 1XMQI 4HACA 1WHQA 4DPYA 5IT9C 1STUA 5A2QC 2NA2A 4MYUA 1XMOI 5BR8I 3ZM7A 3Q1QA 5LMUI 4DR4E 2Q2EB 1ZXMA 1Z0GA 1YYKA 4KQVA 2BM1A 1EKZA 1RQ0A 3OTOE 1PKPA 3ZKDA 2RS7A 1FKAE 4LF4I 4WFTA 4LFBE 3H4LA 3PYDA 2VQEE 4I3HA 1YZ9A 3ADLA 1J5EE 1PVGA 4B3RI 4WYQB 4JYAE 1FI4A 4FWDA 3J7AG 4LF7I 1B63A 2F4VE 3LPSA 2HHHE 4X62I 4LFCE 4DUYI 4LFAI 4JI8I 4YHHI 4JI4I 4R1FA 1N34E 2E5LI 1FJGE 1IBMI 4P52A 4JV5E 3LNUA 3C4BA 4DV3I 4JI3E 4XTJA 2VQFI 4OX9I 3LTOA 3ZZTA 2UUBI 1D6TA 4DV0I 2RSMA 4DR1I 1Z0CA 4X64E 2L2MA 2XEXA 1Z0VA 5L3JA 4X8WA 3B8HA 1Z0WA 4K0KE 4B3SI 2V2ZA 2UXBI 1HNZE 4DU8A 2LUQA 4DV7I 5LMNI 4FWGA 3J80Q 1K47A 4WUDA 1T4NA 3D4JA 2L3CA 2KHXA 3T1HE 2JVAA 2N3HA 3T1YE 2DB2A 1QZRA 1H74A 1NHHA 1IBLI 3M6AA 4DV5E 4P7AA 1H7UA 1J26A 4Z7YA 4DUZE 2WW4A 4NXMI 3C4TA 2NUEA 1MG7A 4DR7I 2B7TA 2DEIA 2UXCI 1RC7A 4RPFA 1T4OA 3ADGA 1X49A 2VF3A 4LF9E 3QT7A 3B78A 2ZM6E 4DR3E 1N0UA 4JI0E 4YY3E 4GKJI 4DV1E 1Z5AA 2HFSA 4WUCA 4B3TI 1N33I 1HNWI 4DV6E 1N32E 2R42A 1IBKE 2UU9E 4GKKI 1MU5A 1HR0I 1Z0TA 2J7KA 2RTXA 2L2KB 2HKJA 1ZM2A 3K17A 4JI1E 3WU6A 5IWAI 4JI5I 1DI2A 1QU6A 1U2RA 2B3TB 3ZZ0A 1X47A 1XNRE 1YYWA 3J7AM 4JI7E 1Z5BA 5GMEA 4X66I 1N36I 1Z0EA 1N0VC 4MYTA 4DKKA 1FNMA 1T4LB 1ZBTA 4OOGC 4LF7E 1S16A 1I94E 2UUCI 2UUAE 3J80C 4LFAE 2HKEA 4ZVIA 4DPUA 4B3MI 2E5LE 1IBME 1Z59A 3JAMQ 4WUBA 3QT8A 1EI1A 4DXLA 2YT4A 2LTSA 4DPTA 4LF8E 2UUBE 1UHZA 2EFGA 4DPWA 4DR2E 3P1XA 4HY1A 3V2UC 4URLA 4LF5E 2NUFA 4DV4E 4DR4I 2DIXA 1XNQE 4DV2E 4HACB 3ZKBA 3OTOI 2V2VA 4DR6I 2DMYA 4LFBI 3WU4A 4EMDA 2VQEI 3HTXA 2LBSB 4JI6E 2DEJA 1J5EI 4DU7A 4JYAI 2V34A 5LL6R 4DR5E 2A2DA 2F4VI 1PIEA 2HHHI 4LFCI 1BKNA 1HNXE 1N34I 5GMDA 4FWHA 4AQYE 1FJGI 1FWLA 1DARA 4KHPE 4X65I 4NXNI 2HFUA 1WHNA 2V8PA 3PYGA 1RR9A 1KTVA 1MX0A 2L2NA 4PRVA 4PU9A 4X64I 2A2CA 1ZM3A 1KKHA 4LF6E 2RS6A 1XMQE 3JAMC 1S4EA 2IHR1 1UEKA 1HNZI 4M1KA 1XMOE 5BR8E 5LMUE 3T1HI 2X36A 2LRSA 3T1YI 1NHJA 3VYXA 3HULA 2NUGA 3QT6A 4DUZI 3VYYA 4LF4E 3F0NA 3ADJA 2NPFA 2ZBKB
chains in the Genus database with same CATH superfamily
1UILA 4BC7A 4M0VA 4M2ZA 1VI7A 3CWVA 2PNLA 1MEYC 1NCSA 3MHHC 4LF9I 3NZKA 2LTRA 2BA1G 1H7SA 2ZM6I 4DR3I 2LO3A 5LLQA 4B3RE 1RREA 1Z0BA 2LJPA 2GPIA 2PO0A 4IFDD 4ZYEA 4WXCA 4JI0I 1E3HA 4YY3I 2I9IA 2EE8A 3QG5C 4DV1I 2HC5A 2JWOA 2YU8A 2BA0D 3P3EA 1A1HA 2NN6C 3K85A 2EOYA 1EH6A 4DUYE 4X62E 2PO2A 2EMWA 2PO1A 4JI8E 3EPLA 4DV6I 4YHHE 4JI4E 1N32I 2EOHA 2EOEA 5KL5A 1ZM9A 2EPRA 1IBKI 2JEAA 2EMHA 2UXDI 3QT5A 1OYSA 4JI2I 4PRXA 1EH7A 4OO1A 1RHYA 2UU9I 1B62A 2B7VA 4LCFA 2MC6A 2BR2A 2N3GA 3J81C 3V5RA 4DV3E 3EPKA 1XHKA 4FN5A 2FGGA 2FTXB 1IQSA 2AJ4A 2VQFE 4IZKB 2CPNA 4OX9E 4BA1A 2V2QA 2RPCA 5KL3A 2LJHA 1KIJA 4JI1I 4DV0E 1VISA 3PS3A 2YTPA 4UT4A 3PYFA 2EPNA 4DR6E 5C0XF 4DR1E 4RHBB 2PNZA 4L8NA 3UK3C 3EQ1A 2YRMA 1UN6B 2DMIA 2EPMX 3J7Yp 1OJ4A 1XNRI 2BM0A 2ELYA 1Z5CA 5DRQA 4JI7I 3Q6MA 1B69A 1O0WA 4B3SE 3KZZA 2L3JA 1A1GA 5A6BA 2JP9A 2UXBE 2ZITA 4IZJA 2YTNA 4LOMA 4JG4A 5FLXQ 4DV7E 2EPUA 1QNTA 5LMNE 2JEBB 3ZZUA 1GQEA 2Z5EA 5C0XB 3K1JA 1A1IA 1I94I 3LLHA 5AC4A 2UUAI 2JYAA 5K36D 2KONA 4BS9A 2JXPA 2N8XA 1X3CA 5CFFE 5A6AA 1EA6A 1P47A 1WUUA 1NZ0A 2G7HA 2M9AA 2EPPA 2EPKX 2D9HA 2JY9A 2GLIA 4ISAA 5IT9Q 1IBLE 1ZXNA 4X65E 2EJ4A 4MLVA 4NXNE 1ZU1A 3VK6A 4USMA 2EN2A 2HK3A 5A2QQ 4LF8I 2EMBA 2EM0A 2WBSA 4NXME 2Q8UA 4DR7E 3PYEA 4OO1E 4WPYA 2JOXA 4DR2I 2UXCE 3DD6A 2C37A 2L92A 2E1RA 2EMGA 2R76A 4KZSA 1KVKA 2NN6D 4R2CA 1AH5A 4BMJA 4LF5I 2L33A 4DPXA 2PNMA 5FWKA 4DV4I 3J81Q 4JV5I 1IMUA 3HXLA 1X5WA 2C39B 4ED4A 5AE2A 4UTGA 4JI3I 2YTFA 4GKJE 3KRNA 1XNQI 1H72C 4F9CB 4DV2I 4B3TE 1N33E 1HNWE 4TUIA 2R3VA 3IWDA 3AV0A 1Y5YA 2MC5A 4BA1B 4N4RB 4HYMA 4LTYA 5AASA 2MDGA 4P7DA 2YTOA 4R2SA 1PJTA 4GKKE 1HR0E 1NHIA 2OI2A 4K0KI 1JK2A 4AM3A 2F1DA 2HK2A 4M30A 4HXZA 3L7ZB 3WU5A 2EMFA 3GLLA 4JI6I 2X7IA 3IWBA 4Z7CA 5IWAE 2EZ6A 4JI5E 1KJKA 1A6FA 2Z5BB 1ELOA 1ZM4A 2JE6B 2EM8A 4MQYA 3KZYA 1RMDA 4DR5I 2CZ9A 2O1TA 1Z1BA 1YUJA 4FW9A 3EPHA 3OMLA 3B82A 1HNXI 4R2PA 2O3ZA 4IZJD 1X48A 3GONA 4X66E 1N36E 4AQYI 2EMLA 5K36A 5AE3A 2EP3A 2GS8A 5EKWA 4IFDE 4R2AA 1X6HA 2WBUA 4KHPI 2EOZA 2DSYA 1YYOA 4DV5I 4USKA 2BV3A 5FLXC 2LUPB 2VF1A 2UUCE 3ADIA 3DJWA 3ZOQB 3WU3A 1DGCA 4NZVA 1LLMC 1FWKA 2MDRA 4GZNC 2FV4B 2YTJA 4B3ME 1H73A 2RSIA 4MU4A 2LMZA 4P78A 2UXDE 4IFDB 1WXRA 4JI2E 1P42A 4LF6I 2K4VA 3MHSC 4R2EA 2AE8A 4LPFA 1XMQI 1PDAA 4HACA 3JTZA 5JEAD 2NN6A 1WHQA 4DPYA 5IT9C 1PJSA 1GTKA 1Y6ZA 2WNRB 1STUA 2YTEA 4MU0A 4R03A 1USUA 2IOQA 5A2QC 2L8TA 5DRRA 2LVHA 2NA2A 2L6MA 3PS2A 4MYUA 5C0XC 1XMOI 5BR8I 2E72A 2V85A 1NEIA 3ZM7A 3Q1QA 2YWQA 4BBYA 2EQ3A 5LMUI 4DR4E 4KWYA 4LCGA 4IS1C 4BA2B 2Q2EB 1ZXMA 1Z0GA 1YYKA 3C6KA 4KQVA 3KWRA 2JT2A 3BIDA 2BM1A 5DRPA 1EKZA 1TN9A 4R8OA 2V89A 1XXEA 1RQ0A 4F54A 1PKPA 3OTOE 1JK1A 4O5GA 4IS9A 4MDTA 3ZKDA 2RS7A 2DRPA 5DNYA 1FKAE 4LF4I 3P06A 4WFTA 4LFBE 5K36E 2EMXA 3H4LA 3PYDA 2VQEE 3HJCA 2YU5A 4R2DA 2YTDA 4HEIA 4I3HA 2EMKA 2ODRC 5AC5A 1G2FC 2CG9A 1YZ9A 3ADLA 1J5EE 1PVGA 4B3RI 4WYQB 5KL6A 4JYAE 5K36B 1FI4A 2LT7A 4F6MA 3J7AG 2V83A 1BBGA 1B63A 4FWDA 4LF7I 3M7ND 5ELWA 2F4VE 3LPSA 2HHHE 2DLQA 4LFCE 2WZOA 4X62I 2EMZA 3P3GA 4JI8I 4DUYI 1KYQA 4YHHI 4R1FA 4JI4I 1N34E 2NN6E 1UBDC 2E5LI 1FJGE 1IBMI 4P52A 1WJPA 3HPZA 4JV5E 1YH8A 3PRYA 1T39A 3LNUA 1F2IG 3BF2A 2YRKA 3C4BA 4DV3I 2IESA 4JI3E 3C6MA 3DF6A 3P76A 4XTJA 4ZYHA 5JEAA 2VQFI 4OX9I 3LTOA 2DGCA 5T6JA 3ZZTA 3U1YA 2UUBI 4OO1F 4O4KA 4WSGA 2V8QB 1BBOA 2NN6B 4AIMA 4DV0I 2VESA 1D6TA 2E1MA 2PO0B 3M85D 2RSMA 4DR1I 2YRHA 4RH8A 1Z0CA 4X64E 4I8OA 2L2MA 3JU0A 2F8BA 2VE7C 5C0XD 2XEXA 1Z0VA 2WP8A 1A1LA 4X8WA 2PO2B 3B8HA 5L3JA 2NABA 2PO1B 1Z0WA 4ZYGA 1YFHA 4K0KE 2IOPA 4B3SI 5AE1A 2V2ZA 2EQ1A 2JEAB 2BA0G 2YTQA 2GO4A 2UXBI 1HNZE 4OO1B 4DU8A 4U3DA 3ECRA 2LUQA 2BA1D 4DV7I 5LMNI 2BR2B 2VRDA 4FWGA 3J80Q 1K47A 2YZTA 1T4NA 4WUDA 3D4JA 3U1KA 2ENCA 3THNA 2L3CA 2KHXA 3T1HE 2JVAA 2DLKA 2N3HA 3THOB 3T1YE 2DB2A 4OKGA 1QZRA 1H74A 4IFDC 1Y4UA 5ADZA 2PNZB 2JR1A 4Q28A 2BB8A 2EPAA 1Y4SA 1YSAC 1NHHA 1IBLI 3M6AA 1R6MA 4F9AB 4DV5E 5A69A 4P7AA 1H7UA 1J26A 1G2DC 2EMCA 2LJUA 4R2QA 1YPNA 2ODRD 2EOIA 4Z7YA 4BHBA 4DUZE 5A6JA 2WW4A 4NXMI 2YSPA 3C4TA 2NUEA 4IZJB 1MG7A 4DR7I 3GMEA 2WCC3 2B7TA 5DNXA 4N3OA 2DEIA 2UXCI 3BGHA 1RC7A 1SR9A 4O43A 2GHFA 4RPFA 1T4OA 2EN7A 3ADGA 4F6NA 1X6FA 1T38A 4IZKA 4IFDF 1X49A 2VF3A 4LF9E 3QT7A 5IXMB 5JEAE 2EPLX 3B78A 4FW6A 2ZM6E 2JOBA 4DR3E 1N0UA 2V88A 2EM4A 2J7JA 1AAYA 1HK7A 3UHMA 4JI0E 4YY3E 4GKJI 2EOJA 4DV1E 1Z5AA 2HFSA 2EM2A 4BC9A 4WUCA 4B3TI 2ENHA 1N33I 1ZBQA 2EPZA 2CT1A 1IQOA 1HNWI 4DV6E 4NHRA 1N32E 2EOOA 5KL7A 2Z5CA 4DMIA 5JEAB 2R42A 2V87A 1IBKE 4J8ZA 2IERA 4FK5C 2R1FA 3M99B 2UU9E 2EM7A 3K6QA 4GKKI 1MU5A 1HR0I 1Z0TA 2JEBA 2C37B 4MLQA 5C0XA 2J7KA 4QNKA 2RTXA 2L2KB 2HKJA 4FW4A 1SFEA 1ZM2A 4O24A 4JI1E 3K17A 1N3GA 3WU6A 3F6HA 2WP8B 5IWAI 2EM9A 4JI5I 1L4SA 2V86A 1E3PA 1DI2A 1QU6A 2B9DA 1U2RA 2B3TB 3ZZ0A 2C38A 4FW3A 2ENAA 4L5NC 2ADRA 1TF3A 1X47A 4NBQA 4OZEA 2GO3A 1XNRE 3FIGA 1YYWA 5A6KA 3J7AM 4IJDA 2BBGA 4JI7E 2O1VA 1Z5BA 5GMEA 4X66I 1N36I 3L00A 1OYPA 1Z0EA 1UDQA 3HQ1A 1N0VC 2HGHA 2J65A 4MYTA 4DKKA 2EN1A 4F9BB 1FNMA 3F6GA 1T4LB 1ZBTA 1EH8A 5K36F 2CVEA 4OOGC 4LF7E 1S16A 1I94E 2UUCI 2UUAE 4BCAA 3J80C 5KL2A 4LFAE 2HKEA 4ZVIA 2EL4A 3HKMA 2C39A 2O1WA 4DPUA 2E5LE 2GQ0A 4B3MI 1IBME 1Z59A 3JAMQ 2LV2A 3CDIA 4WUBA 4FW7A 3GCMA 1GZ6A 4MU1A 3QT8A 1EI1A 4DXLA 2YT4A 2M4IA 2LTSA 4DPTA 4LF8E 4OO1C 2HJJA 2UUBE 1Y60A 4GQUA 1UHZA 1A1KA 2EFGA 4DPWA 2EOMA 2EL5A 2NN6F 2EN6A 1ZAAC 1UDSA 4DR2E 2EN8A 2EOFA 3P1XA 4WXDA 4HY1A 3L7ZA 3V2UC 5C0XE 3VHTB 3CDJA 4URLA 4LF5E 2KOUA 2NUFA 4DV4E 4DR4I 2Z5BA 2EMIA 1BB8A 2Z5CB 4LCHA 2RQLA 3HPSA 2JE6A 2DIXA 3H1CA 1XNQE 4DV2E 4Q35B 2CSHA 4HACB 4J3DA 3ZKBA 2EWLA 3OTOI 2H36X 2V2VA 2EL6A 4DR6I 2LCEA 2ELZA 2DMYA 2EORA 2PRTA 4LFBI 3WU4A 1UDOA 4U3BA 1A1JA 1TF6A 4EMDA 1DQ3A 2VQEI 3EPJA 1ZR9A 2YTIA 4GEQB 2C38B 3HTXA 4WSPA 2LBSB 3LMLA 4JI6E 1OYRA 2DEJA 1J5EI 4FW5A 2EOSA 5DROA 4DU7A 4JYAI 2EN4A 2V34A 1PJQA 5LL6R 4IFDA 4LFAI 3PS1A 4DR5E 5F3WA 2A2DA 2F4VI 5KL4A 4ZYDA 2A25A 1PIEA 4QNJA 2LE2A 4LFCI 4AIDA 2HHHI 1BKNA 3H09A 2WBTA 1HNXE 2WNRA 5JEAC 2YTGA 1UDNA 1N34I 2EOQA 5GMDA 2EOXA 4AQYE 4FWHA 1FJGI 2EPCA 2EMAA 2EN3A 1FWLA 1DARA 4KHPE 4X65I 1X6EA 4NXNI 2HFUA 2CTDA 3MSWA 1WHNA 4F2JC 2V8PA 2JPAA 4HTGA 3PYGA 1RR9A 1KTVA 1MX0A 2M7QA 2L2NA 4BA2A 4PRVA 4OO1D 2EPOA 4PU9A 4X64I 2A2CA 1YUIA 5JEAF 1ZM3A 1KKHA 4LF6E 1WRJA 2EQ0A 3P3CA 2RS6A 5TSEA 1XMQE 3JAMC 1S4EA 2IHR1 3TQMA 5DNLA 1UEKA 3RMPA 2YPNA 3M7NG 5EL9A 1HNZI 4TUGA 4M1KA 3BBGA 2YSOA 3IWCA 2MKNA 1XMOE 2EM5A 5BR8E 4BHCA 3B4TA 2CGEA 4LU9A 1MGTA 2K7IA 5LMUE 3T1HI 2X36A 2LRSA 3T1YI 5A6BD 1NHJA 4X9JA 2I13A 4MU3A 3VYXA 1R6LA 4M9VC 3HULA 4WX9A 3Q6NA 2NUGA 1YHCA 3AUZA 3M85G 2EMYA 2MKDA 5K36C 1USVA 4R2RA 2EM3A 3QT6A 2M1SA 4DUZI 3VYYA 4LF4E 2O1UA 5IV8B 2EPXA 1A1FA 3F0NA 2EM6A 3ADJA 2NPFA 2ZBKB
chains in the Genus database with same CATH topology
1UILA 4BC7A 4M0VA 4M2ZA 3CWVA 2PNLA 4LF9I 2LTRA 1H7SA 2ZM6I 4DR3I 4B3RE 1RREA 1Z0BA 2LJPA 4JI0I 4YY3I 4DV1I 2JWOA 3K85A 4DUYE 4X62E 4JI8E 4DV6I 4YHHE 4JI4E 1N32I 1ZM9A 1IBKI 2UXDI 3QT5A 4JI2I 4PRXA 2UU9I 1B62A 2B7VA 2MC6A 2N3GA 3J81C 3V5RA 4DV3E 1XHKA 4FN5A 2FGGA 2FTXB 2AJ4A 4IZKB 2VQFE 2CPNA 4OX9E 2V2QA 4JI1I 2LJHA 1KIJA 4DV0E 1VISA 4UT4A 3PYFA 4DR6E 4DR1E 4L8NA 3J7Yp 1OJ4A 1XNRI 2BM0A 1Z5CA 4JI7I 3Q6MA 4B3SE 1O0WA 2L3JA 2UXBE 2ZITA 4IZJA 4JG4A 5FLXQ 4DV7E 5LMNE 3ZZUA 1GQEA 2Z5EA 3K1JA 1I94I 3LLHA 2UUAI 2KONA 4BS9A 1EA6A 5CFFE 1WUUA 1NZ0A 2G7HA 2JY9A 5IT9Q 1IBLE 1ZXNA 4X65E 4NXNE 3VK6A 4USMA 2HK3A 5A2QQ 4LF8I 4NXME 4DR7E 3PYEA 4WPYA 2JOXA 4DR2I 2UXCE 2L92A 2E1RA 4KZSA 1KVKA 4BMJA 4LF5I 2L33A 4DPXA 2PNMA 5FWKA 4DV4I 3J81Q 4JV5I 3HXLA 4ED4A 5AE2A 4UTGA 4JI3I 4GKJE 1XNQI 1H72C 4F9CB 4DV2I 4B3TE 1N33E 1HNWE 4TUIA 2R3VA 3IWDA 3AV0A 2MC5A 4HYMA 4LTYA 5AASA 4P7DA 4GKKE 1HR0E 1NHIA 2OI2A 4K0KI 2HK2A 4M30A 4HXZA 3WU5A 4JI6I 2X7IA 3IWBA 4Z7CA 5IWAE 2EZ6A 4JI5E 1A6FA 2Z5BB 1ELOA 1ZM4A 4DR5I 2CZ9A 2O1TA 4FW9A 3OMLA 3B82A 1HNXI 4IZJD 1X48A 3GONA 4X66E 1N36E 4AQYI 5AE3A 2GS8A 4KHPI 2DSYA 1YYOA 4DV5I 4USKA 2BV3A 5FLXC 2LUPB 2VF1A 2UUCE 3ADIA 3DJWA 3ZOQB 3WU3A 1FWKA 2MDRA 2FV4B 4B3ME 1H73A 2LMZA 4P78A 2UXDE 1WXRA 4JI2E 4LF6I 2K4VA 1XMQI 4HACA 3JTZA 1WHQA 4DPYA 5IT9C 1Y6ZA 1STUA 4R03A 1USUA 2IOQA 5A2QC 2L8TA 2NA2A 2L6MA 4MYUA 1XMOI 5BR8I 2V85A 3ZM7A 3Q1QA 4BBYA 5LMUI 4DR4E 2Q2EB 1ZXMA 1Z0GA 1YYKA 4KQVA 3KWRA 2BM1A 1EKZA 4R8OA 2V89A 1RQ0A 4F54A 1PKPA 3OTOE 3ZKDA 2RS7A 5DNYA 1FKAE 4LF4I 3P06A 4WFTA 4LFBE 3H4LA 3PYDA 2VQEE 3HJCA 4I3HA 2ODRC 2CG9A 1YZ9A 3ADLA 1J5EE 1PVGA 4B3RI 4WYQB 4JYAE 1FI4A 3J7AG 2V83A 4FWDA 1B63A 4LF7I 2F4VE 3LPSA 2HHHE 4X62I 4LFCE 2WZOA 4DUYI 4LFAI 4JI8I 4YHHI 4JI4I 4R1FA 1N34E 2E5LI 1FJGE 1IBMI 4P52A 3HPZA 4JV5E 3PRYA 3LNUA 3C4BA 4DV3I 4JI3E 4XTJA 3DF6A 2VQFI 4OX9I 3LTOA 5T6JA 3ZZTA 2UUBI 1D6TA 2V8QB 4DV0I 2E1MA 2RSMA 4DR1I 1Z0CA 4X64E 4I8OA 2L2MA 3JU0A 2F8BA 2VE7C 2XEXA 1Z0VA 5L3JA 4X8WA 3B8HA 1Z0WA 4K0KE 2IOPA 4B3SI 5AE1A 2V2ZA 2UXBI 1HNZE 4DU8A 2LUQA 4DV7I 5LMNI 4FWGA 3J80Q 1K47A 2YZTA 1T4NA 4WUDA 3D4JA 2L3CA 2KHXA 3T1HE 2JVAA 2N3HA 3T1YE 2DB2A 1QZRA 1H74A 1Y4UA 5ADZA 2JR1A 4Q28A 1Y4SA 1NHHA 1IBLI 3M6AA 4F9AB 4DV5E 4P7AA 1H7UA 1J26A 4Z7YA 2ODRD 4DUZE 2WW4A 4NXMI 3C4TA 2NUEA 4IZJB 1MG7A 4DR7I 2B7TA 4N3OA 2DEIA 2UXCI 1RC7A 1SR9A 4RPFA 1T4OA 3ADGA 4IZKA 1X49A 2VF3A 4LF9E 3QT7A 3B78A 2ZM6E 2JOBA 4DR3E 1N0UA 2V88A 1HK7A 4JI0E 4YY3E 4GKJI 4DV1E 1Z5AA 2HFSA 4BC9A 4WUCA 4B3TI 1N33I 1ZBQA 1HNWI 4DV6E 1N32E 2Z5CA 4DMIA 2R42A 2V87A 1IBKE 4J8ZA 2UU9E 3K6QA 4GKKI 1MU5A 1HR0I 1Z0TA 2J7KA 2RTXA 2L2KB 2HKJA 1ZM2A 3K17A 4JI1E 3WU6A 3F6HA 5IWAI 4JI5I 2V86A 1DI2A 1QU6A 2B9DA 1U2RA 2B3TB 3ZZ0A 4L5NC 1X47A 1XNRE 3FIGA 1YYWA 3J7AM 2O1VA 4JI7E 1Z5BA 5GMEA 4X66I 1N36I 1Z0EA 3HQ1A 1N0VC 4MYTA 4DKKA 4F9BB 1FNMA 3F6GA 1T4LB 1ZBTA 4OOGC 4LF7E 1S16A 1I94E 2UUCI 2UUAE 4BCAA 3J80C 4LFAE 2HKEA 4ZVIA 4DPUA 4B3MI 2O1WA 2E5LE 2GQ0A 1IBME 1Z59A 3JAMQ 4WUBA 1GZ6A 3QT8A 1EI1A 4DXLA 2YT4A 2M4IA 2LTSA 4DPTA 4LF8E 2UUBE 1UHZA 2EFGA 4DPWA 4DR2E 3P1XA 4HY1A 3V2UC 4URLA 4LF5E 2KOUA 2NUFA 4DV4E 4DR4I 2Z5BA 2Z5CB 3HPSA 2DIXA 1XNQE 4DV2E 4HACB 3ZKBA 2EWLA 3OTOI 2H36X 2V2VA 4DR6I 2DMYA 4LFBI 3WU4A 4EMDA 1DQ3A 2VQEI 4GEQB 3HTXA 4WSPA 2LBSB 3LMLA 4JI6E 2DEJA 1J5EI 4DU7A 4JYAI 2V34A 5LL6R 4DR5E 5F3WA 2A2DA 2F4VI 1PIEA 2HHHI 2LE2A 4LFCI 1BKNA 3H09A 1HNXE 1N34I 5GMDA 4FWHA 4AQYE 1FJGI 1FWLA 1DARA 4KHPE 4X65I 4NXNI 2HFUA 3MSWA 1WHNA 2V8PA 3PYGA 1RR9A 1KTVA 1MX0A 2M7QA 2L2NA 4PRVA 4PU9A 4X64I 2A2CA 1ZM3A 1KKHA 4LF6E 2RS6A 1XMQE 3JAMC 1S4EA 2IHR1 1UEKA 3RMPA 1HNZI 4TUGA 4M1KA 3IWCA 1XMOE 5BR8E 2CGEA 4LU9A 5LMUE 3T1HI 2X36A 2LRSA 3T1YI 1NHJA 3VYXA 3HULA 3Q6NA 2NUGA 3AUZA 1USVA 3QT6A 2M1SA 4DUZI 3VYYA 4LF4E 2O1UA 3F0NA 3ADJA 2NPFA 2ZBKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UIL A;  4M2Z A;  3CWV A;  4LF9 I;  2LTR A;  1H7S A;  2ZM6 I;  4DR3 I;  4B3R E;  1RRE A;  1Z0B A;  2LJP A;  4JI0 I;  4YY3 I;  4DV1 I;  4DUY E;  4X62 E;  4JI8 E;  4DV6 I;  4YHH E;  4JI4 E;  1N32 I;  1ZM9 A;  1IBK I;  2UXD I;  3QT5 A;  4JI2 I;  4PRX A;  2UU9 I;  1B62 A;  2B7V A;  2N3G A;  3J81 C;  3V5R A;  4DV3 E;  1XHK A;  4FN5 A;  2AJ4 A;  2VQF E;  2CPN A;  4OX9 E;  2V2Q A;  4JI1 I;  2LJH A;  1KIJ A;  4DV0 E;  1VIS A;  4UT4 A;  3PYF A;  4DR6 E;  4DR1 E;  3J7Y p;  1OJ4 A;  1XNR I;  2BM0 A;  1Z5C A;  4JI7 I;  4B3S E;  1O0W A;  2L3J A;  2UXB E;  2ZIT A;  4JG4 A;  5FLX Q;  4DV7 E;  5LMN E;  3ZZU A;  1GQE A;  3K1J A;  1I94 I;  3LLH A;  2UUA I;  1EA6 A;  5CFF E;  1WUU A;  1NZ0 A;  2JY9 A;  5IT9 Q;  1IBL E;  1ZXN A;  4X65 E;  4NXN E;  5A2Q Q;  4USM A;  2HK3 A;  4LF8 I;  4NXM E;  4DR7 E;  3PYE A;  4DR2 I;  2UXC E;  2E1R A;  1KVK A;  4LF5 I;  2L33 A;  4DPX A;  4DV4 I;  4JV5 I;  3J81 Q;  4ED4 A;  4UTG A;  4JI3 I;  4GKJ E;  1XNQ I;  1H72 C;  4DV2 I;  4B3T E;  1N33 E;  1HNW E;  2R3V A;  4HYM A;  4GKK E;  1HR0 E;  1NHI A;  2OI2 A;  4K0K I;  2HK2 A;  4M30 A;  4HXZ A;  3WU5 A;  4JI6 I;  2X7I A;  4Z7C A;  5IWA E;  2EZ6 A;  4JI5 E;  1A6F A;  1ELO A;  1ZM4 A;  4DR5 I;  2CZ9 A;  4FW9 A;  3B82 A;  1HNX I;  1X48 A;  3GON A;  4X66 E;  1N36 E;  4AQY I;  2GS8 A;  4KHP I;  1YYO A;  4DV5 I;  4USK A;  2BV3 A;  5FLX C;  2LUP B;  2UUC E;  3ADI A;  3WU3 A;  1FWK A;  2MDR A;  4B3M E;  1H73 A;  2UXD E;  4JI2 E;  4LF6 I;  1XMQ I;  4HAC A;  1WHQ A;  4DPY A;  5IT9 C;  1STU A;  5A2Q C;  2NA2 A;  4MYU A;  1XMO I;  5BR8 I;  3ZM7 A;  3Q1Q A;  5LMU I;  4DR4 E;  2Q2E B;  1ZXM A;  1Z0G A;  1YYK A;  4KQV A;  2BM1 A;  1EKZ A;  1RQ0 A;  3OTO E;  1PKP A;  3ZKD A;  2RS7 A;  1FKA E;  4LF4 I;  4WFT A;  4LFB E;  3H4L A;  3PYD A;  2VQE E;  4I3H A;  1YZ9 A;  3ADL A;  1J5E E;  1PVG A;  4B3R I;  4WYQ B;  4JYA E;  1FI4 A;  4FWD A;  3J7A G;  4LF7 I;  1B63 A;  2F4V E;  3LPS A;  2HHH E;  4X62 I;  4LFC E;  4DUY I;  4LFA I;  4JI8 I;  4YHH I;  4JI4 I;  4R1F A;  1N34 E;  2E5L I;  1FJG E;  1IBM I;  4P52 A;  4JV5 E;  3LNU A;  3C4B A;  4DV3 I;  4JI3 E;  4XTJ A;  2VQF I;  4OX9 I;  3LTO A;  3ZZT A;  2UUB I;  1D6T A;  4DV0 I;  2RSM A;  4DR1 I;  1Z0C A;  4X64 E;  2L2M A;  2XEX A;  1Z0V A;  5L3J A;  4X8W A;  3B8H A;  1Z0W A;  4K0K E;  4B3S I;  2V2Z A;  2UXB I;  1HNZ E;  4DU8 A;  2LUQ A;  4DV7 I;  5LMN I;  4FWG A;  3J80 Q;  1K47 A;  4WUD A;  1T4N A;  3D4J A;  2L3C A;  2KHX A;  3T1H E;  2JVA A;  2N3H A;  3T1Y E;  2DB2 A;  1QZR A;  1H74 A;  1NHH A;  1IBL I;  3M6A A;  4DV5 E;  4P7A A;  1H7U A;  1J26 A;  4Z7Y A;  4DUZ E;  2WW4 A;  4NXM I;  3C4T A;  2NUE A;  1MG7 A;  4DR7 I;  2B7T A;  2DEI A;  2UXC I;  1RC7 A;  4RPF A;  1T4O A;  3ADG A;  1X49 A;  2VF3 A;  4LF9 E;  3QT7 A;  3B78 A;  2ZM6 E;  4DR3 E;  1N0U A;  4JI0 E;  4YY3 E;  4GKJ I;  4DV1 E;  1Z5A A;  2HFS A;  4WUC A;  4B3T I;  1N33 I;  1HNW I;  4DV6 E;  1N32 E;  2R42 A;  1IBK E;  2UU9 E;  4GKK I;  1MU5 A;  1HR0 I;  1Z0T A;  2J7K A;  2RTX A;  2L2K B;  2HKJ A;  1ZM2 A;  3K17 A;  4JI1 E;  3WU6 A;  5IWA I;  4JI5 I;  1DI2 A;  1QU6 A;  1U2R A;  2B3T B;  3ZZ0 A;  1X47 A;  1XNR E;  1YYW A;  3J7A M;  4JI7 E;  1Z5B A;  5GME A;  4X66 I;  1N36 I;  1Z0E A;  1N0V C;  4MYT A;  4DKK A;  1FNM A;  1T4L B;  1ZBT A;  4OOG C;  4LF7 E;  1S16 A;  1I94 E;  2UUC I;  2UUA E;  3J80 C;  4LFA E;  2HKE A;  4ZVI A;  4DPU A;  4B3M I;  2E5L E;  1IBM E;  1Z59 A;  3JAM Q;  4WUB A;  3QT8 A;  1EI1 A;  4DXL A;  2YT4 A;  2LTS A;  4DPT A;  4LF8 E;  2UUB E;  1UHZ A;  2EFG A;  4DPW A;  4DR2 E;  3P1X A;  4HY1 A;  3V2U C;  4URL A;  4LF5 E;  2NUF A;  4DV4 E;  4DR4 I;  2DIX A;  1XNQ E;  4DV2 E;  4HAC B;  3ZKB A;  3OTO I;  2V2V A;  4DR6 I;  2DMY A;  4LFB I;  3WU4 A;  4EMD A;  2VQE I;  3HTX A;  2LBS B;  4JI6 E;  2DEJ A;  1J5E I;  4DU7 A;  4JYA I;  2V34 A;  5LL6 R;  4DR5 E;  2A2D A;  2F4V I;  1PIE A;  2HHH I;  4LFC I;  1BKN A;  1HNX E;  1N34 I;  5GMD A;  4FWH A;  4AQY E;  1FJG I;  1FWL A;  1DAR A;  4KHP E;  4X65 I;  4NXN I;  2HFU A;  1WHN A;  2V8P A;  3PYG A;  1RR9 A;  1KTV A;  1MX0 A;  2L2N A;  4PRV A;  4PU9 A;  4X64 I;  2A2C A;  1ZM3 A;  1KKH A;  4LF6 E;  2RS6 A;  1XMQ E;  3JAM C;  1S4E A;  2IHR 1;  1UEK A;  1HNZ I;  4M1K A;  1XMO E;  5BR8 E;  5LMU E;  3T1H I;  2X36 A;  2LRS A;  3T1Y I;  1NHJ A;  3VYX A;  3HUL A;  2NUG A;  3QT6 A;  4DUZ I;  3VYY A;  4LF4 E;  3F0N A;  3ADJ A;  2NPF A;  2ZBK B; 
#chains in the Genus database with same CATH topology
 1UIL A;  4BC7 A;  4M0V A;  4M2Z A;  1VI7 A;  3CWV A;  2PNL A;  1MEY C;  1NCS A;  3MHH C;  4LF9 I;  3NZK A;  2LTR A;  2BA1 G;  1H7S A;  2ZM6 I;  4DR3 I;  2LO3 A;  5LLQ A;  4B3R E;  1RRE A;  1Z0B A;  2LJP A;  2GPI A;  2PO0 A;  4IFD D;  4ZYE A;  4WXC A;  4JI0 I;  1E3H A;  4YY3 I;  2I9I A;  2EE8 A;  3QG5 C;  4DV1 I;  2HC5 A;  2JWO A;  2YU8 A;  2BA0 D;  3P3E A;  1A1H A;  2NN6 C;  3K85 A;  2EOY A;  1EH6 A;  4DUY E;  4X62 E;  2PO2 A;  2EMW A;  2PO1 A;  4JI8 E;  3EPL A;  4DV6 I;  4YHH E;  4JI4 E;  1N32 I;  2EOH A;  2EOE A;  5KL5 A;  1ZM9 A;  2EPR A;  1IBK I;  2JEA A;  2EMH A;  2UXD I;  3QT5 A;  1OYS A;  4JI2 I;  4PRX A;  1EH7 A;  4OO1 A;  1RHY A;  2UU9 I;  1B62 A;  2B7V A;  4LCF A;  2MC6 A;  2BR2 A;  2N3G A;  3J81 C;  3V5R A;  4DV3 E;  3EPK A;  1XHK A;  4FN5 A;  2FGG A;  2FTX B;  1IQS A;  2AJ4 A;  2VQF E;  4IZK B;  2CPN A;  4OX9 E;  4BA1 A;  2V2Q A;  2RPC A;  5KL3 A;  2LJH A;  1KIJ A;  4JI1 I;  4DV0 E;  1VIS A;  3PS3 A;  2YTP A;  4UT4 A;  3PYF A;  2EPN A;  4DR6 E;  5C0X F;  4DR1 E;  4RHB B;  2PNZ A;  4L8N A;  3UK3 C;  3EQ1 A;  2YRM A;  1UN6 B;  2DMI A;  2EPM X;  3J7Y p;  1OJ4 A;  1XNR I;  2BM0 A;  2ELY A;  1Z5C A;  5DRQ A;  4JI7 I;  3Q6M A;  1B69 A;  1O0W A;  4B3S E;  3KZZ A;  2L3J A;  1A1G A;  5A6B A;  2JP9 A;  2UXB E;  2ZIT A;  4IZJ A;  2YTN A;  4LOM A;  4JG4 A;  5FLX Q;  4DV7 E;  2EPU A;  1QNT A;  5LMN E;  2JEB B;  3ZZU A;  1GQE A;  2Z5E A;  5C0X B;  3K1J A;  1A1I A;  1I94 I;  3LLH A;  5AC4 A;  2UUA I;  2JYA A;  5K36 D;  2KON A;  4BS9 A;  2JXP A;  2N8X A;  1X3C A;  5CFF E;  5A6A A;  1EA6 A;  1P47 A;  1WUU A;  1NZ0 A;  2G7H A;  2M9A A;  2EPP A;  2EPK X;  2D9H A;  2JY9 A;  2GLI A;  4ISA A;  5IT9 Q;  1IBL E;  1ZXN A;  4X65 E;  2EJ4 A;  4MLV A;  4NXN E;  1ZU1 A;  3VK6 A;  4USM A;  2EN2 A;  2HK3 A;  5A2Q Q;  4LF8 I;  2EMB A;  2EM0 A;  2WBS A;  4NXM E;  2Q8U A;  4DR7 E;  3PYE A;  4OO1 E;  4WPY A;  2JOX A;  4DR2 I;  2UXC E;  3DD6 A;  2C37 A;  2L92 A;  2E1R A;  2EMG A;  2R76 A;  4KZS A;  1KVK A;  2NN6 D;  4R2C A;  1AH5 A;  4BMJ A;  4LF5 I;  2L33 A;  4DPX A;  2PNM A;  5FWK A;  4DV4 I;  3J81 Q;  4JV5 I;  1IMU A;  3HXL A;  1X5W A;  2C39 B;  4ED4 A;  5AE2 A;  4UTG A;  4JI3 I;  2YTF A;  4GKJ E;  3KRN A;  1XNQ I;  1H72 C;  4F9C B;  4DV2 I;  4B3T E;  1N33 E;  1HNW E;  4TUI A;  2R3V A;  3IWD A;  3AV0 A;  1Y5Y A;  2MC5 A;  4BA1 B;  4N4R B;  4HYM A;  4LTY A;  5AAS A;  2MDG A;  4P7D A;  2YTO A;  4R2S A;  1PJT A;  4GKK E;  1HR0 E;  1NHI A;  2OI2 A;  4K0K I;  1JK2 A;  4AM3 A;  2F1D A;  2HK2 A;  4M30 A;  4HXZ A;  3L7Z B;  3WU5 A;  2EMF A;  3GLL A;  4JI6 I;  2X7I A;  3IWB A;  4Z7C A;  5IWA E;  2EZ6 A;  4JI5 E;  1KJK A;  1A6F A;  2Z5B B;  1ELO A;  1ZM4 A;  2JE6 B;  2EM8 A;  4MQY A;  3KZY A;  1RMD A;  4DR5 I;  2CZ9 A;  2O1T A;  1Z1B A;  1YUJ A;  4FW9 A;  3EPH A;  3OML A;  3B82 A;  1HNX I;  4R2P A;  2O3Z A;  4IZJ D;  1X48 A;  3GON A;  4X66 E;  1N36 E;  4AQY I;  2EML A;  5K36 A;  5AE3 A;  2EP3 A;  2GS8 A;  5EKW A;  4IFD E;  4R2A A;  1X6H A;  2WBU A;  4KHP I;  2EOZ A;  2DSY A;  1YYO A;  4DV5 I;  4USK A;  2BV3 A;  5FLX C;  2LUP B;  2VF1 A;  2UUC E;  3ADI A;  3DJW A;  3ZOQ B;  3WU3 A;  1DGC A;  4NZV A;  1LLM C;  1FWK A;  2MDR A;  4GZN C;  2FV4 B;  2YTJ A;  4B3M E;  1H73 A;  2RSI A;  4MU4 A;  2LMZ A;  4P78 A;  2UXD E;  4IFD B;  1WXR A;  4JI2 E;  1P42 A;  4LF6 I;  2K4V A;  3MHS C;  4R2E A;  2AE8 A;  4LPF A;  1XMQ I;  1PDA A;  4HAC A;  3JTZ A;  5JEA D;  2NN6 A;  1WHQ A;  4DPY A;  5IT9 C;  1PJS A;  1GTK A;  1Y6Z A;  2WNR B;  1STU A;  2YTE A;  4MU0 A;  4R03 A;  1USU A;  2IOQ A;  5A2Q C;  2L8T A;  5DRR A;  2LVH A;  2NA2 A;  2L6M A;  3PS2 A;  4MYU A;  5C0X C;  1XMO I;  5BR8 I;  2E72 A;  2V85 A;  1NEI A;  3ZM7 A;  3Q1Q A;  2YWQ A;  4BBY A;  2EQ3 A;  5LMU I;  4DR4 E;  4KWY A;  4LCG A;  4IS1 C;  4BA2 B;  2Q2E B;  1ZXM A;  1Z0G A;  1YYK A;  3C6K A;  4KQV A;  3KWR A;  2JT2 A;  3BID A;  2BM1 A;  5DRP A;  1EKZ A;  1TN9 A;  4R8O A;  2V89 A;  1XXE A;  1RQ0 A;  4F54 A;  1PKP A;  3OTO E;  1JK1 A;  4O5G A;  4IS9 A;  4MDT A;  3ZKD A;  2RS7 A;  2DRP A;  5DNY A;  1FKA E;  4LF4 I;  3P06 A;  4WFT A;  4LFB E;  5K36 E;  2EMX A;  3H4L A;  3PYD A;  2VQE E;  3HJC A;  2YU5 A;  4R2D A;  2YTD A;  4HEI A;  4I3H A;  2EMK A;  2ODR C;  5AC5 A;  1G2F C;  2CG9 A;  1YZ9 A;  3ADL A;  1J5E E;  1PVG A;  4B3R I;  4WYQ B;  5KL6 A;  4JYA E;  5K36 B;  1FI4 A;  2LT7 A;  4F6M A;  3J7A G;  2V83 A;  1BBG A;  1B63 A;  4FWD A;  4LF7 I;  3M7N D;  5ELW A;  2F4V E;  3LPS A;  2HHH E;  2DLQ A;  4LFC E;  2WZO A;  4X62 I;  2EMZ A;  3P3G A;  4JI8 I;  4DUY I;  1KYQ A;  4YHH I;  4R1F A;  4JI4 I;  1N34 E;  2NN6 E;  1UBD C;  2E5L I;  1FJG E;  1IBM I;  4P52 A;  1WJP A;  3HPZ A;  4JV5 E;  1YH8 A;  3PRY A;  1T39 A;  3LNU A;  1F2I G;  3BF2 A;  2YRK A;  3C4B A;  4DV3 I;  2IES A;  4JI3 E;  3C6M A;  3DF6 A;  3P76 A;  4XTJ A;  4ZYH A;  5JEA A;  2VQF I;  4OX9 I;  3LTO A;  2DGC A;  5T6J A;  3ZZT A;  3U1Y A;  2UUB I;  4OO1 F;  4O4K A;  4WSG A;  2V8Q B;  1BBO A;  2NN6 B;  4AIM A;  4DV0 I;  2VES A;  1D6T A;  2E1M A;  2PO0 B;  3M85 D;  2RSM A;  4DR1 I;  2YRH A;  4RH8 A;  1Z0C A;  4X64 E;  4I8O A;  2L2M A;  3JU0 A;  2F8B A;  2VE7 C;  5C0X D;  2XEX A;  1Z0V A;  2WP8 A;  1A1L A;  4X8W A;  2PO2 B;  3B8H A;  5L3J A;  2NAB A;  2PO1 B;  1Z0W A;  4ZYG A;  1YFH A;  4K0K E;  2IOP A;  4B3S I;  5AE1 A;  2V2Z A;  2EQ1 A;  2JEA B;  2BA0 G;  2YTQ A;  2GO4 A;  2UXB I;  1HNZ E;  4OO1 B;  4DU8 A;  4U3D A;  3ECR A;  2LUQ A;  2BA1 D;  4DV7 I;  5LMN I;  2BR2 B;  2VRD A;  4FWG A;  3J80 Q;  1K47 A;  2YZT A;  1T4N A;  4WUD A;  3D4J A;  3U1K A;  2ENC A;  3THN A;  2L3C A;  2KHX A;  3T1H E;  2JVA A;  2DLK A;  2N3H A;  3THO B;  3T1Y E;  2DB2 A;  4OKG A;  1QZR A;  1H74 A;  4IFD C;  1Y4U A;  5ADZ A;  2PNZ B;  2JR1 A;  4Q28 A;  2BB8 A;  2EPA A;  1Y4S A;  1YSA C;  1NHH A;  1IBL I;  3M6A A;  1R6M A;  4F9A B;  4DV5 E;  5A69 A;  4P7A A;  1H7U A;  1J26 A;  1G2D C;  2EMC A;  2LJU A;  4R2Q A;  1YPN A;  2ODR D;  2EOI A;  4Z7Y A;  4BHB A;  4DUZ E;  5A6J A;  2WW4 A;  4NXM I;  2YSP A;  3C4T A;  2NUE A;  4IZJ B;  1MG7 A;  4DR7 I;  3GME A;  2WCC 3;  2B7T A;  5DNX A;  4N3O A;  2DEI A;  2UXC I;  3BGH A;  1RC7 A;  1SR9 A;  4O43 A;  2GHF A;  4RPF A;  1T4O A;  2EN7 A;  3ADG A;  4F6N A;  1X6F A;  1T38 A;  4IZK A;  4IFD F;  1X49 A;  2VF3 A;  4LF9 E;  3QT7 A;  5IXM B;  5JEA E;  2EPL X;  3B78 A;  4FW6 A;  2ZM6 E;  2JOB A;  4DR3 E;  1N0U A;  2V88 A;  2EM4 A;  2J7J A;  1AAY A;  1HK7 A;  3UHM A;  4JI0 E;  4YY3 E;  4GKJ I;  2EOJ A;  4DV1 E;  1Z5A A;  2HFS A;  2EM2 A;  4BC9 A;  4WUC A;  4B3T I;  2ENH A;  1N33 I;  1ZBQ A;  2EPZ A;  2CT1 A;  1IQO A;  1HNW I;  4DV6 E;  4NHR A;  1N32 E;  2EOO A;  5KL7 A;  2Z5C A;  4DMI A;  5JEA B;  2R42 A;  2V87 A;  1IBK E;  4J8Z A;  2IER A;  4FK5 C;  2R1F A;  3M99 B;  2UU9 E;  2EM7 A;  3K6Q A;  4GKK I;  1MU5 A;  1HR0 I;  1Z0T A;  2JEB A;  2C37 B;  4MLQ A;  5C0X A;  2J7K A;  4QNK A;  2RTX A;  2L2K B;  2HKJ A;  4FW4 A;  1SFE A;  1ZM2 A;  4O24 A;  4JI1 E;  3K17 A;  1N3G A;  3WU6 A;  3F6H A;  2WP8 B;  5IWA I;  2EM9 A;  4JI5 I;  1L4S A;  2V86 A;  1E3P A;  1DI2 A;  1QU6 A;  2B9D A;  1U2R A;  2B3T B;  3ZZ0 A;  2C38 A;  4FW3 A;  2ENA A;  4L5N C;  2ADR A;  1TF3 A;  1X47 A;  4NBQ A;  4OZE A;  2GO3 A;  1XNR E;  3FIG A;  1YYW A;  5A6K A;  3J7A M;  4IJD A;  2BBG A;  4JI7 E;  2O1V A;  1Z5B A;  5GME A;  4X66 I;  1N36 I;  3L00 A;  1OYP A;  1Z0E A;  1UDQ A;  3HQ1 A;  1N0V C;  2HGH A;  2J65 A;  4MYT A;  4DKK A;  2EN1 A;  4F9B B;  1FNM A;  3F6G A;  1T4L B;  1ZBT A;  1EH8 A;  5K36 F;  2CVE A;  4OOG C;  4LF7 E;  1S16 A;  1I94 E;  2UUC I;  2UUA E;  4BCA A;  3J80 C;  5KL2 A;  4LFA E;  2HKE A;  4ZVI A;  2EL4 A;  3HKM A;  2C39 A;  2O1W A;  4DPU A;  2E5L E;  2GQ0 A;  4B3M I;  1IBM E;  1Z59 A;  3JAM Q;  2LV2 A;  3CDI A;  4WUB A;  4FW7 A;  3GCM A;  1GZ6 A;  4MU1 A;  3QT8 A;  1EI1 A;  4DXL A;  2YT4 A;  2M4I A;  2LTS A;  4DPT A;  4LF8 E;  4OO1 C;  2HJJ A;  2UUB E;  1Y60 A;  4GQU A;  1UHZ A;  1A1K A;  2EFG A;  4DPW A;  2EOM A;  2EL5 A;  2NN6 F;  2EN6 A;  1ZAA C;  1UDS A;  4DR2 E;  2EN8 A;  2EOF A;  3P1X A;  4WXD A;  4HY1 A;  3L7Z A;  3V2U C;  5C0X E;  3VHT B;  3CDJ A;  4URL A;  4LF5 E;  2KOU A;  2NUF A;  4DV4 E;  4DR4 I;  2Z5B A;  2EMI A;  1BB8 A;  2Z5C B;  4LCH A;  2RQL A;  3HPS A;  2JE6 A;  2DIX A;  3H1C A;  1XNQ E;  4DV2 E;  4Q35 B;  2CSH A;  4HAC B;  4J3D A;  3ZKB A;  2EWL A;  3OTO I;  2H36 X;  2V2V A;  2EL6 A;  4DR6 I;  2LCE A;  2ELZ A;  2DMY A;  2EOR A;  2PRT A;  4LFB I;  3WU4 A;  1UDO A;  4U3B A;  1A1J A;  1TF6 A;  4EMD A;  1DQ3 A;  2VQE I;  3EPJ A;  1ZR9 A;  2YTI A;  4GEQ B;  2C38 B;  3HTX A;  4WSP A;  2LBS B;  3LML A;  4JI6 E;  1OYR A;  2DEJ A;  1J5E I;  4FW5 A;  2EOS A;  5DRO A;  4DU7 A;  4JYA I;  2EN4 A;  2V34 A;  1PJQ A;  5LL6 R;  4IFD A;  4LFA I;  3PS1 A;  4DR5 E;  5F3W A;  2A2D A;  2F4V I;  5KL4 A;  4ZYD A;  2A25 A;  1PIE A;  4QNJ A;  2LE2 A;  4LFC I;  4AID A;  2HHH I;  1BKN A;  3H09 A;  2WBT A;  1HNX E;  2WNR A;  5JEA C;  2YTG A;  1UDN A;  1N34 I;  2EOQ A;  5GMD A;  2EOX A;  4AQY E;  4FWH A;  1FJG I;  2EPC A;  2EMA A;  2EN3 A;  1FWL A;  1DAR A;  4KHP E;  4X65 I;  1X6E A;  4NXN I;  2HFU A;  2CTD A;  3MSW A;  1WHN A;  4F2J C;  2V8P A;  2JPA A;  4HTG A;  3PYG A;  1RR9 A;  1KTV A;  1MX0 A;  2M7Q A;  2L2N A;  4BA2 A;  4PRV A;  4OO1 D;  2EPO A;  4PU9 A;  4X64 I;  2A2C A;  1YUI A;  5JEA F;  1ZM3 A;  1KKH A;  4LF6 E;  1WRJ A;  2EQ0 A;  3P3C A;  2RS6 A;  5TSE A;  1XMQ E;  3JAM C;  1S4E A;  2IHR 1;  3TQM A;  5DNL A;  1UEK A;  3RMP A;  2YPN A;  3M7N G;  5EL9 A;  1HNZ I;  4TUG A;  4M1K A;  3BBG A;  2YSO A;  3IWC A;  2MKN A;  1XMO E;  2EM5 A;  5BR8 E;  4BHC A;  3B4T A;  2CGE A;  4LU9 A;  1MGT A;  2K7I A;  5LMU E;  3T1H I;  2X36 A;  2LRS A;  3T1Y I;  5A6B D;  1NHJ A;  4X9J A;  2I13 A;  4MU3 A;  3VYX A;  1R6L A;  4M9V C;  3HUL A;  4WX9 A;  3Q6N A;  2NUG A;  1YHC A;  3AUZ A;  3M85 G;  2EMY A;  2MKD A;  5K36 C;  1USV A;  4R2R A;  2EM3 A;  3QT6 A;  2M1S A;  4DUZ I;  3VYY A;  4LF4 E;  2O1U A;  5IV8 B;  2EPX A;  1A1F A;  3F0N A;  2EM6 A;  3ADJ A;  2NPF A;  2ZBK B; 
#chains in the Genus database with same CATH homology
 1UIL A;  4BC7 A;  4M0V A;  4M2Z A;  3CWV A;  2PNL A;  4LF9 I;  2LTR A;  1H7S A;  2ZM6 I;  4DR3 I;  4B3R E;  1RRE A;  1Z0B A;  2LJP A;  4JI0 I;  4YY3 I;  4DV1 I;  2JWO A;  3K85 A;  4DUY E;  4X62 E;  4JI8 E;  4DV6 I;  4YHH E;  4JI4 E;  1N32 I;  1ZM9 A;  1IBK I;  2UXD I;  3QT5 A;  4JI2 I;  4PRX A;  2UU9 I;  1B62 A;  2B7V A;  2MC6 A;  2N3G A;  3J81 C;  3V5R A;  4DV3 E;  1XHK A;  4FN5 A;  2FGG A;  2FTX B;  2AJ4 A;  4IZK B;  2VQF E;  2CPN A;  4OX9 E;  2V2Q A;  4JI1 I;  2LJH A;  1KIJ A;  4DV0 E;  1VIS A;  4UT4 A;  3PYF A;  4DR6 E;  4DR1 E;  4L8N A;  3J7Y p;  1OJ4 A;  1XNR I;  2BM0 A;  1Z5C A;  4JI7 I;  3Q6M A;  4B3S E;  1O0W A;  2L3J A;  2UXB E;  2ZIT A;  4IZJ A;  4JG4 A;  5FLX Q;  4DV7 E;  5LMN E;  3ZZU A;  1GQE A;  2Z5E A;  3K1J A;  1I94 I;  3LLH A;  2UUA I;  2KON A;  4BS9 A;  1EA6 A;  5CFF E;  1WUU A;  1NZ0 A;  2G7H A;  2JY9 A;  5IT9 Q;  1IBL E;  1ZXN A;  4X65 E;  4NXN E;  3VK6 A;  4USM A;  2HK3 A;  5A2Q Q;  4LF8 I;  4NXM E;  4DR7 E;  3PYE A;  4WPY A;  2JOX A;  4DR2 I;  2UXC E;  2L92 A;  2E1R A;  4KZS A;  1KVK A;  4BMJ A;  4LF5 I;  2L33 A;  4DPX A;  2PNM A;  5FWK A;  4DV4 I;  3J81 Q;  4JV5 I;  3HXL A;  4ED4 A;  5AE2 A;  4UTG A;  4JI3 I;  4GKJ E;  1XNQ I;  1H72 C;  4F9C B;  4DV2 I;  4B3T E;  1N33 E;  1HNW E;  4TUI A;  2R3V A;  3IWD A;  3AV0 A;  2MC5 A;  4HYM A;  4LTY A;  5AAS A;  4P7D A;  4GKK E;  1HR0 E;  1NHI A;  2OI2 A;  4K0K I;  2HK2 A;  4M30 A;  4HXZ A;  3WU5 A;  4JI6 I;  2X7I A;  3IWB A;  4Z7C A;  5IWA E;  2EZ6 A;  4JI5 E;  1A6F A;  2Z5B B;  1ELO A;  1ZM4 A;  4DR5 I;  2CZ9 A;  2O1T A;  4FW9 A;  3OML A;  3B82 A;  1HNX I;  4IZJ D;  1X48 A;  3GON A;  4X66 E;  1N36 E;  4AQY I;  5AE3 A;  2GS8 A;  4KHP I;  2DSY A;  1YYO A;  4DV5 I;  4USK A;  2BV3 A;  5FLX C;  2LUP B;  2VF1 A;  2UUC E;  3ADI A;  3DJW A;  3ZOQ B;  3WU3 A;  1FWK A;  2MDR A;  2FV4 B;  4B3M E;  1H73 A;  2LMZ A;  4P78 A;  2UXD E;  1WXR A;  4JI2 E;  4LF6 I;  2K4V A;  1XMQ I;  4HAC A;  3JTZ A;  1WHQ A;  4DPY A;  5IT9 C;  1Y6Z A;  1STU A;  4R03 A;  1USU A;  2IOQ A;  5A2Q C;  2L8T A;  2NA2 A;  2L6M A;  4MYU A;  1XMO I;  5BR8 I;  2V85 A;  3ZM7 A;  3Q1Q A;  4BBY A;  5LMU I;  4DR4 E;  2Q2E B;  1ZXM A;  1Z0G A;  1YYK A;  4KQV A;  3KWR A;  2BM1 A;  1EKZ A;  4R8O A;  2V89 A;  1RQ0 A;  4F54 A;  1PKP A;  3OTO E;  3ZKD A;  2RS7 A;  5DNY A;  1FKA E;  4LF4 I;  3P06 A;  4WFT A;  4LFB E;  3H4L A;  3PYD A;  2VQE E;  3HJC A;  4I3H A;  2ODR C;  2CG9 A;  1YZ9 A;  3ADL A;  1J5E E;  1PVG A;  4B3R I;  4WYQ B;  4JYA E;  1FI4 A;  3J7A G;  2V83 A;  4FWD A;  1B63 A;  4LF7 I;  2F4V E;  3LPS A;  2HHH E;  4X62 I;  4LFC E;  2WZO A;  4DUY I;  4LFA I;  4JI8 I;  4YHH I;  4JI4 I;  4R1F A;  1N34 E;  2E5L I;  1FJG E;  1IBM I;  4P52 A;  3HPZ A;  4JV5 E;  3PRY A;  3LNU A;  3C4B A;  4DV3 I;  4JI3 E;  4XTJ A;  3DF6 A;  2VQF I;  4OX9 I;  3LTO A;  5T6J A;  3ZZT A;  2UUB I;  1D6T A;  2V8Q B;  4DV0 I;  2E1M A;  2RSM A;  4DR1 I;  1Z0C A;  4X64 E;  4I8O A;  2L2M A;  3JU0 A;  2F8B A;  2VE7 C;  2XEX A;  1Z0V A;  5L3J A;  4X8W A;  3B8H A;  1Z0W A;  4K0K E;  2IOP A;  4B3S I;  5AE1 A;  2V2Z A;  2UXB I;  1HNZ E;  4DU8 A;  2LUQ A;  4DV7 I;  5LMN I;  4FWG A;  3J80 Q;  1K47 A;  2YZT A;  1T4N A;  4WUD A;  3D4J A;  2L3C A;  2KHX A;  3T1H E;  2JVA A;  2N3H A;  3T1Y E;  2DB2 A;  1QZR A;  1H74 A;  1Y4U A;  5ADZ A;  2JR1 A;  4Q28 A;  1Y4S A;  1NHH A;  1IBL I;  3M6A A;  4F9A B;  4DV5 E;  4P7A A;  1H7U A;  1J26 A;  4Z7Y A;  2ODR D;  4DUZ E;  2WW4 A;  4NXM I;  3C4T A;  2NUE A;  4IZJ B;  1MG7 A;  4DR7 I;  2B7T A;  4N3O A;  2DEI A;  2UXC I;  1RC7 A;  1SR9 A;  4RPF A;  1T4O A;  3ADG A;  4IZK A;  1X49 A;  2VF3 A;  4LF9 E;  3QT7 A;  3B78 A;  2ZM6 E;  2JOB A;  4DR3 E;  1N0U A;  2V88 A;  1HK7 A;  4JI0 E;  4YY3 E;  4GKJ I;  4DV1 E;  1Z5A A;  2HFS A;  4BC9 A;  4WUC A;  4B3T I;  1N33 I;  1ZBQ A;  1HNW I;  4DV6 E;  1N32 E;  2Z5C A;  4DMI A;  2R42 A;  2V87 A;  1IBK E;  4J8Z A;  2UU9 E;  3K6Q A;  4GKK I;  1MU5 A;  1HR0 I;  1Z0T A;  2J7K A;  2RTX A;  2L2K B;  2HKJ A;  1ZM2 A;  3K17 A;  4JI1 E;  3WU6 A;  3F6H A;  5IWA I;  4JI5 I;  2V86 A;  1DI2 A;  1QU6 A;  2B9D A;  1U2R A;  2B3T B;  3ZZ0 A;  4L5N C;  1X47 A;  1XNR E;  3FIG A;  1YYW A;  3J7A M;  2O1V A;  4JI7 E;  1Z5B A;  5GME A;  4X66 I;  1N36 I;  1Z0E A;  3HQ1 A;  1N0V C;  4MYT A;  4DKK A;  4F9B B;  1FNM A;  3F6G A;  1T4L B;  1ZBT A;  4OOG C;  4LF7 E;  1S16 A;  1I94 E;  2UUC I;  2UUA E;  4BCA A;  3J80 C;  4LFA E;  2HKE A;  4ZVI A;  4DPU A;  4B3M I;  2O1W A;  2E5L E;  2GQ0 A;  1IBM E;  1Z59 A;  3JAM Q;  4WUB A;  1GZ6 A;  3QT8 A;  1EI1 A;  4DXL A;  2YT4 A;  2M4I A;  2LTS A;  4DPT A;  4LF8 E;  2UUB E;  1UHZ A;  2EFG A;  4DPW A;  4DR2 E;  3P1X A;  4HY1 A;  3V2U C;  4URL A;  4LF5 E;  2KOU A;  2NUF A;  4DV4 E;  4DR4 I;  2Z5B A;  2Z5C B;  3HPS A;  2DIX A;  1XNQ E;  4DV2 E;  4HAC B;  3ZKB A;  2EWL A;  3OTO I;  2H36 X;  2V2V A;  4DR6 I;  2DMY A;  4LFB I;  3WU4 A;  4EMD A;  1DQ3 A;  2VQE I;  4GEQ B;  3HTX A;  4WSP A;  2LBS B;  3LML A;  4JI6 E;  2DEJ A;  1J5E I;  4DU7 A;  4JYA I;  2V34 A;  5LL6 R;  4DR5 E;  5F3W A;  2A2D A;  2F4V I;  1PIE A;  2HHH I;  2LE2 A;  4LFC I;  1BKN A;  3H09 A;  1HNX E;  1N34 I;  5GMD A;  4FWH A;  4AQY E;  1FJG I;  1FWL A;  1DAR A;  4KHP E;  4X65 I;  4NXN I;  2HFU A;  3MSW A;  1WHN A;  2V8P A;  3PYG A;  1RR9 A;  1KTV A;  1MX0 A;  2M7Q A;  2L2N A;  4PRV A;  4PU9 A;  4X64 I;  2A2C A;  1ZM3 A;  1KKH A;  4LF6 E;  2RS6 A;  1XMQ E;  3JAM C;  1S4E A;  2IHR 1;  1UEK A;  3RMP A;  1HNZ I;  4TUG A;  4M1K A;  3IWC A;  1XMO E;  5BR8 E;  2CGE A;  4LU9 A;  5LMU E;  3T1H I;  2X36 A;  2LRS A;  3T1Y I;  1NHJ A;  3VYX A;  3HUL A;  3Q6N A;  2NUG A;  3AUZ A;  1USV A;  3QT6 A;  2M1S A;  4DUZ I;  3VYY A;  4LF4 E;  2O1U A;  3F0N A;  3ADJ A;  2NPF A;  2ZBK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...