4LFCI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfcI00
4OX9E 4DV2E 1FNMA 3GONA 4GKJI 2V34A 4LFCE 2HHHI 4B3RE 1I94I 1OJ4A 4DR4I 3QT5A 4DUZE 1K47A 4LF7E 1ZM2A 3PYGA 4X65E 4LF4I 3T1YI 4LF6I 2X7IA 4DR3I 4JI3I 1HNXE 2E5LI 4DR3E 5LL6R 3WU3A 4JI5I 4DV3I 1H7SA 3J7AG 1Z5CA 4LF5E 4DV7E 2UU9E 5BR8E 4LFCI 2HHHE 4HXZA 4FN5A 1NZ0A 4DPXA 1FI4A 4X66E 1N0VC 1NHHA 3H4LA 4DPTA 1EA6A 2ZM6E 1KIJA 3WU4A 4JV5E 2E1RA 1S4EA 1U2RA 3K1JA 3J80Q 1HNXI 1H72C 2E5LE 4LFAI 4JI5E 4JG4A 4YY3E 4JI0E 4LFAE 1N36E 4LF5I 4UTGA 4JI6I 1N36I 1H73A 3ZZ0A 4X66I 4YHHI 1HR0I 4DV5E 1KTVA 4DV5I 4LFBE 4DV4I 4DU8A 4LFBI 4DV6I 4RPFA 1PVGA 1J5EE 1MX0A 1N33I 4HY1A 4I3HA 2UXCI 4JI1E 2A2DA 2X36A 1B63A 1IBLE 2XEXA 1FJGI 1Z0GA 4DUYE 4DV1I 4B3TE 4X62E 4B3TI 2UUAI 4HYMA 3LTOA 2BM0A 2UUAE 2ZBKB 2UUCE 1PIEA 1RREA 4JI4E 5IT9C 4B3MI 4PU9A 3ZM7A 4JI1I 3K17A 4K0KE 1MG7A 3ZZUA 4UT4A 4K0KI 1IBKE 4MYTA 2AJ4A 4LF8I 3B8HA 1FWKA 4KHPE 4B3SI 5A2QQ 1HNZI 2UUBE 3V5RA 1S16A 4WUBA 4USMA 4X62I 2UXBI 3B82A 2UXDI 4NXME 3QT7A 2GS8A 1D6TA 4X65I 4DR5E 4LF4E 4GKKI 2HFUA 4Z7CA 4LF6E 2VQEE 4DR5I 4DXLA 1H7UA 4JI2E 4FW9A 4XTJA 3WU6A 3D4JA 1IBKI 3J80C 1N34E 1NHJA 4DV7I 5GMEA 1N32E 4PRXA 4OX9I 3LPSA 1ZM9A 2A2CA 4JI7E 2CZ9A 3PYFA 2HFSA 3WU5A 2V2VA 1Z0WA 2UXDE 4P52A 4AQYI 1XHKA 4JV5I 1IBMI 4P7AA 4NXNE 4EMDA 1Z0EA 3Q1QA 2DEJA 2VQEI 1ZXMA 4M1KA 4DPYA 4YY3I 2HKJA 4ED4A 4X64I 3J81Q 4JI6E 1H74A 3QT8A 2J7KA 2Q2EB 4URLA 4JI8E 4DU7A 2VF3A 4JI8I 2EFGA 2V2QA 3M6AA 2HK2A 4R1FA 4HACA 4AQYE 1ZM4A 2ZM6I 1Z0CA 4LF7I 1KKHA 1FKAE 1Z59A 3PYDA 3T1YE 1Z5AA 2UXCE 2LJPA 4JI0I 5BR8I 1BKNA 3T1HI 4DV2I 4FWDA 1B62A 1XMQE 3CWVA 4B3RI 1KVKA 2V8PA 4YHHE 4DR1I 4DUYI 1I94E 1Z0VA 4DR1E 4DPWA 4DUZI 1VISA 4FWHA 4DV4E 1XMOI 3JAMQ 4WUDA 2NPFA 3ZKDA 4B3ME 2DEIA 2BV3A 1N33E 3B78A 1ELOA 4DV3E 2ZITA 4DR6E 1N0UA 3T1HE 2UU9I 5IWAE 4MYUA 1XMQI 3OTOE 2HKEA 5FLXQ 5GMDA 4DR7I 3OTOI 1FJGE 1RR9A 2OI2A 4WUCA 4DV6E 2UXBE 1XMOE 1J5EI 4DPUA 5IT9Q 3J7AM 4HACB 4DV0I 4JI4I 1MU5A 4DR6I 1XNRI 1IBLI 4USKA 1XNRE 4LF9E 5IWAI 5LMNE 4DR7E 3ZKBA 3LNUA 4KHPI 1HR0E 1EI1A 4B3SE 4FWGA 2F4VI 4JI7I 4DV1E 2R3VA 4KQVA 1FWLA 1UEKA 2UUCI 4DV0E 1WUUA 3ZZTA 5FLXC 2WW4A 1DARA 1Z0BA 4DR2I 4JI2I 4LF9I 2V2ZA 5LMNI 1NHIA 2R42A 4LF8E 1PKPA 5LMUE 1HNZE 1ZM3A 2UUBI 4GKJE 5A2QC 2F4VE 1QZRA 2VQFI 3J81C 1XNQE 3PYEA 2VQFE 3V2UC 4PRVA 4NXMI 1XNQI 4DR4E 4JYAE 3HULA 4JYAI 3F0NA 1IBME 2HK3A 4NXNI 4GKKE 1A6FA 1Z5BA 2BM1A 4Z7YA 4DR2E 4ZVIA 5L3JA 1Z0TA 4JI3E 3JAMC 1HNWE 1N34I 3QT6A 1HNWI 1N32I 5LMUI 1ZXNA 4X64E
chains in the Genus database with same CATH superfamily
4OX9E 4IZJA 4LCFA 4DV2E 1FNMA 3GONA 4GKJI 2V34A 4LFCE 3P3CA 2HHHI 4B3RE 3PS3A 2Z5CB 1I94I 1OJ4A 4DR4I 2JE6A 3QT5A 4DUZE 1K47A 5K36F 4MU3A 2PNZB 2C37A 4LF7E 4U3BA 1ZM2A 3PYGA 5JEAB 4X65E 4LF4I 3T1YI 4LF6I 2X7IA 2BA1D 4DR3I 4JI3I 4J3DA 1HNXE 4LPFA 2E5LI 4DR3E 5LL6R 2PO0B 3WU3A 4JI5I 4DV3I 1H7SA 2WNRB 3J7AG 4IS9A 1Z5CA 4LF5E 3HKMA 4DV7E 2UU9E 5BR8E 4LFCI 2HHHE 4HXZA 2PNLA 4FN5A 2NN6B 5DRRA 1NZ0A 4DPXA 1FI4A 4X66E 1N0VC 1NHHA 2BR2B 2CG9A 3H4LA 1P42A 2C38B 4DPTA 1EA6A 4IZKA 5EL9A 2ZM6E 1KIJA 3WU4A 5ELWA 4MU1A 4JV5E 2E1RA 1S4EA 1U2RA 3K1JA 2BA1G 2VESA 4U3DA 3HJCA 3J80Q 1UDOA 1H72C 3PRYA 1HNXI 2E5LE 4LFAI 4JI5E 3GMEA 2JEAA 4JG4A 4YY3E 4JI0E 4LFAE 1Y4SA 4FW4A 1N36E 4LF5I 4UTGA 4JI6I 4OZEA 5DROA 1N36I 1H73A 1XXEA 4LOMA 3ZZ0A 4X66I 2NN6C 4YHHI 2NN6E 1HR0I 4DV5E 1KTVA 4DV5I 4LFBE 4FW5A 2IERA 4DV4I 4DU8A 4LFBI 2IESA 4DV6I 4RPFA 4MQYA 1PVGA 1J5EE 1MX0A 3B4TA 1N33I 4HY1A 4I3HA 2UXCI 2PNZA 2C37B 5DNLA 4LCHA 4JI1E 1Y4UA 2A2DA 2X36A 5K36D 1B63A 1E3HA 4FW3A 4MU4A 1IBLE 2C39B 1USVA 2GO3A 2XEXA 2J65A 1FJGI 4BA1A 1Z0GA 4DUYE 4DV1I 4B3TE 2CVEA 3P76A 4X62E 4B3TI 2UUAI 4HYMA 5DRPA 3LTOA 2BM0A 2C38A 2UUAE 2ZBKB 2BA0G 2IOQA 2UUCE 5K36C 1PIEA 1RREA 4JI4E 5IT9C 4B3MI 4BA2A 4PU9A 3H1CA 5C0XB 1VI7A 3ZM7A 4JI1I 3K17A 1UDQA 4K0KE 4IFDE 1MG7A 1USUA 3ZZUA 4UT4A 4K0KI 3CDJA 1IBKE 4MYTA 2AJ4A 4LF8I 3B8HA 1FWKA 4KHPE 1R6MA 4B3SI 5A2QQ 1HNZI 2UUBE 2Z5CA 1HK7A 3V5RA 1S16A 4WUBA 5K36B 2PO2A 4USMA 1YH8A 2IOPA 2JE6B 4X62I 2UXBI 3M85G 3B82A 2UXDI 1OYSA 4NXME 3QT7A 5DRQA 2GS8A 1Y6ZA 1D6TA 3M7NG 4OO1A 4X65I 4DR5E 4LF4E 4GKKI 2HFUA 3L7ZB 2WP8B 3Q6NA 4Z7CA 4LF6E 2VQEE 4DR5I 4DXLA 4OO1E 4OO1D 1H7UA 4JI2E 4FW9A 2WNRA 5DNXA 1E3PA 4XTJA 3WU6A 3D4JA 1IBKI 3J80C 1N34E 1NHJA 4DV7I 5GMEA 1N32E 4PRXA 4OX9I 3LPSA 1ZM9A 4IFDB 2A2CA 4JI7E 2CZ9A 2Z5BA 3WU5A 2HFSA 3PYFA 2V2VA 3NZKA 4QNJA 1Z0WA 1UDSA 3CDIA 2UXDE 1Y5YA 4P52A 4AM3A 4AQYI 1XHKA 4JV5I 1IBMI 2BR2A 4P7AA 4NXNE 4GQUA 4EMDA 2F1DA 5JEAA 1Z0EA 4IZKB 3Q1QA 2O1WA 2DEJA 2VQEI 1ZXMA 3PS1A 3P3GA 4M1KA 4DPYA 2JT2A 4YY3I 2HKJA 4ED4A 4X64I 3J81Q 4JI6E 1H74A 3QT8A 4IZJB 2JEBA 2J7KA 2Q2EB 4URLA 4JI8E 4DU7A 3UHMA 2VF3A 4JI8I 2EFGA 2BA0D 2V2QA 3M6AA 2HK2A 4R1FA 2AE8A 4HACA 4AQYE 1ZM4A 2ZM6I 1Z0CA 4LF7I 5K36A 1KKHA 1FKAE 1Z59A 4IFDC 3PYDA 3T1YE 2PO1A 5K36E 1Z5AA 3GCMA 3Q6MA 5JEAE 4ISAA 2UXCE 5C0XC 2LJPA 4JI0I 5BR8I 1BKNA 3T1HI 4DV2I 1N32I 4FWDA 1B62A 5EKWA 1XMQE 3CWVA 4B3RI 4OO1F 1KVKA 2V8PA 4YHHE 3M7ND 5C0XF 4DR1I 4DUYI 2PNMA 1I94E 1Z0VA 4DR1E 4DPWA 4DUZI 4NBQA 1VISA 4FWHA 4DV4E 1UDNA 1XMOI 1YHCA 2Z5BB 3K85A 4OO1C 3JAMQ 3KRNA 4WUDA 2NPFA 5C0XD 4BA2B 3ZKDA 4B3ME 2DEIA 2BV3A 1N33E 4AIMA 3B78A 2NN6A 5JEAD 2JEAB 1ELOA 4DV3E 2ZITA 2O1VA 3U1YA 2PO0A 4DR6E 1N0UA 4OKGA 3T1HE 2UU9I 2CGEA 5IWAE 4MYUA 1XMQI 3OTOE 1R6LA 2HKEA 5FLXQ 5GMDA 5JEAF 4DR7I 3OTOI 1FJGE 1RR9A 2OI2A 3DD6A 4WUCA 3U1KA 2JEBB 3PS2A 4DV6E 2UXBE 4AIDA 1OYRA 3P3EA 1XMOE 4MDTA 1OYPA 1RHYA 5JEAC 1J5EI 4FW7A 4OO1B 4DPUA 5C0XE 2WP8A 5IT9Q 3J7AM 4HACB 4DV0I 4JI4I 1MU5A 2GO4A 3M85D 4DR6I 4LCGA 1XNRI 1IBLI 4USKA 4FW6A 2GQ0A 1XNRE 4LF9E 5IWAI 5LMNE 3L7ZA 4MU0A 2NN6D 4DR7E 3ZKBA 4IZJD 2O1TA 3LNUA 4KHPI 1HR0E 1EI1A 4B3SE 4FWGA 2F4VI 4JI7I 4DV1E 2R3VA 4KQVA 2NN6F 1FWLA 3P06A 4IFDA 1UEKA 2UUCI 4DV0E 1WUUA 3ZZTA 5FLXC 2C39A 4QNKA 2WW4A 5C0XA 1DARA 2O1UA 1Z0BA 4DR2I 4JI2I 4LF9I 2V2ZA 5LMNI 1NHIA 2R42A 4LF8E 1PKPA 5LMUE 1HNZE 1ZM3A 2UUBI 4GKJE 5A2QC 2F4VE 4BA1B 1QZRA 2Z5EA 2VQFI 3J81C 1XNQE 3PYEA 4IFDF 2VQFE 3V2UC 4PRVA 4NXMI 1XNQI 4DR4E 4JYAE 3HULA 4JYAI 3F0NA 1IBME 4N3OA 2HK3A 4NXNI 4GKKE 1A6FA 1Z5BA 2BM1A 4IFDD 4Z7YA 4ZVIA 5FWKA 5L3JA 4DR2E 1Z0TA 4JI3E 3GLLA 3JAMC 1HNWE 2PO1B 1Y60A 2O3ZA 3QT6A 1N34I 1HNWI 2PO2B 5LMUI 1ZXNA 4X64E
chains in the Genus database with same CATH topology
4OX9E 4IZJA 4DV2E 1FNMA 3GONA 4GKJI 2V34A 4LFCE 2HHHI 4B3RE 2Z5CB 1I94I 1OJ4A 4DR4I 3QT5A 4DUZE 1K47A 4LF7E 1ZM2A 3PYGA 4X65E 4LF4I 3T1YI 4LF6I 2X7IA 4DR3I 4JI3I 1HNXE 2E5LI 4DR3E 5LL6R 3WU3A 4JI5I 4DV3I 1H7SA 3J7AG 1Z5CA 4LF5E 4DV7E 2UU9E 5BR8E 4LFCI 2HHHE 4HXZA 2PNLA 4FN5A 1NZ0A 4DPXA 1FI4A 4X66E 1N0VC 1NHHA 2CG9A 3H4LA 4DPTA 1EA6A 4IZKA 2ZM6E 1KIJA 3WU4A 4JV5E 2E1RA 1S4EA 1U2RA 3K1JA 3HJCA 3J80Q 2E5LE 3PRYA 1H72C 1HNXI 4LFAI 4JI5E 4JG4A 4YY3E 4JI0E 4LFAE 1Y4SA 1N36E 4LF5I 4UTGA 4JI6I 1N36I 1H73A 3ZZ0A 4X66I 4YHHI 1HR0I 4DV5E 1KTVA 4DV5I 4LFBE 4DV4I 4DU8A 4LFBI 4DV6I 4RPFA 1PVGA 1J5EE 1MX0A 1N33I 4HY1A 4I3HA 2UXCI 4JI1E 1Y4UA 2A2DA 2X36A 1B63A 1IBLE 1USVA 2XEXA 1FJGI 1Z0GA 4DUYE 4DV1I 4B3TE 4X62E 4B3TI 2UUAI 4HYMA 3LTOA 2BM0A 2UUAE 2ZBKB 2IOQA 2UUCE 1PIEA 1RREA 4JI4E 5IT9C 4B3MI 4PU9A 3ZM7A 4JI1I 3K17A 4K0KE 1MG7A 1USUA 3ZZUA 4UT4A 4K0KI 1IBKE 4MYTA 2AJ4A 4LF8I 3B8HA 1FWKA 4KHPE 4B3SI 5A2QQ 1HNZI 2UUBE 2Z5CA 1HK7A 3V5RA 1S16A 4WUBA 4USMA 2IOPA 4X62I 2UXBI 3B82A 2UXDI 4NXME 3QT7A 2GS8A 1Y6ZA 1D6TA 4X65I 4DR5E 4LF4E 4GKKI 2HFUA 3Q6NA 4Z7CA 4LF6E 2VQEE 4DR5I 4DXLA 1H7UA 4JI2E 4FW9A 4XTJA 3WU6A 3D4JA 1IBKI 3J80C 1N34E 1NHJA 4DV7I 5GMEA 1N32E 4PRXA 4OX9I 3LPSA 1ZM9A 2A2CA 4JI7E 2CZ9A 2Z5BA 2HFSA 3PYFA 3WU5A 2V2VA 1Z0WA 2UXDE 4P52A 4AQYI 1XHKA 4JV5I 1IBMI 4P7AA 4NXNE 4EMDA 1Z0EA 4IZKB 3Q1QA 2O1WA 2DEJA 2VQEI 1ZXMA 4M1KA 4DPYA 4YY3I 2HKJA 4ED4A 4X64I 3J81Q 4JI6E 1H74A 3QT8A 4IZJB 2J7KA 2Q2EB 4URLA 4JI8E 4DU7A 2VF3A 4JI8I 2EFGA 2V2QA 3M6AA 2HK2A 4R1FA 4HACA 4AQYE 1ZM4A 2ZM6I 1Z0CA 4LF7I 1KKHA 1FKAE 1Z59A 3PYDA 3T1YE 1Z5AA 3Q6MA 2UXCE 2LJPA 4JI0I 5BR8I 1BKNA 3T1HI 4DV2I 4FWDA 1B62A 1XMQE 3CWVA 4B3RI 1KVKA 2V8PA 4YHHE 4DR1I 4DUYI 2PNMA 1I94E 1Z0VA 4DR1E 4DPWA 4DUZI 1VISA 4FWHA 4DV4E 1XMOI 2Z5BB 3K85A 3JAMQ 4WUDA 2NPFA 3ZKDA 4B3ME 2DEIA 2BV3A 1N33E 3B78A 1ELOA 4DV3E 2ZITA 2O1VA 4DR6E 1N0UA 3T1HE 2UU9I 2CGEA 5IWAE 1XMQI 4MYUA 3OTOE 2HKEA 5FLXQ 5GMDA 4DR7I 3OTOI 1FJGE 1RR9A 2OI2A 4WUCA 4DV6E 2UXBE 1XMOE 1J5EI 4DPUA 5IT9Q 3J7AM 4HACB 4DV0I 4JI4I 1MU5A 4DR6I 1XNRI 1IBLI 4USKA 2GQ0A 1XNRE 4LF9E 5IWAI 5LMNE 4DR7E 3ZKBA 4IZJD 2O1TA 3LNUA 4KHPI 1HR0E 1EI1A 4B3SE 4FWGA 2F4VI 4JI7I 4DV1E 2R3VA 4KQVA 1FWLA 3P06A 1UEKA 2UUCI 4DV0E 1WUUA 3ZZTA 5FLXC 2WW4A 1DARA 2O1UA 1Z0BA 4DR2I 4JI2I 4LF9I 2V2ZA 5LMNI 1NHIA 2R42A 4LF8E 1PKPA 5LMUE 1HNZE 1ZM3A 2UUBI 4GKJE 5A2QC 2F4VE 1QZRA 2Z5EA 2VQFI 3J81C 1XNQE 3PYEA 2VQFE 3V2UC 4PRVA 4NXMI 1XNQI 4DR4E 4JYAE 3HULA 4JYAI 3F0NA 1IBME 4N3OA 2HK3A 4NXNI 4GKKE 1A6FA 1Z5BA 2BM1A 4Z7YA 5L3JA 4DR2E 5FWKA 4ZVIA 1Z0TA 4JI3E 3JAMC 1HNWE 1N34I 3QT6A 1HNWI 1N32I 5LMUI 1ZXNA 4X64E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 E;  4DV2 E;  1FNM A;  3GON A;  4GKJ I;  2V34 A;  4LFC E;  2HHH I;  4B3R E;  1I94 I;  1OJ4 A;  4DR4 I;  3QT5 A;  4DUZ E;  1K47 A;  4LF7 E;  1ZM2 A;  3PYG A;  4X65 E;  4LF4 I;  3T1Y I;  4LF6 I;  2X7I A;  4DR3 I;  4JI3 I;  1HNX E;  2E5L I;  4DR3 E;  5LL6 R;  3WU3 A;  4JI5 I;  4DV3 I;  1H7S A;  3J7A G;  1Z5C A;  4LF5 E;  4DV7 E;  2UU9 E;  5BR8 E;  4LFC I;  2HHH E;  4HXZ A;  4FN5 A;  1NZ0 A;  4DPX A;  1FI4 A;  4X66 E;  1N0V C;  1NHH A;  3H4L A;  4DPT A;  1EA6 A;  2ZM6 E;  1KIJ A;  3WU4 A;  4JV5 E;  2E1R A;  1S4E A;  1U2R A;  3K1J A;  3J80 Q;  1HNX I;  1H72 C;  2E5L E;  4LFA I;  4JI5 E;  4JG4 A;  4YY3 E;  4JI0 E;  4LFA E;  1N36 E;  4LF5 I;  4UTG A;  4JI6 I;  1N36 I;  1H73 A;  3ZZ0 A;  4X66 I;  4YHH I;  1HR0 I;  4DV5 E;  1KTV A;  4DV5 I;  4LFB E;  4DV4 I;  4DU8 A;  4LFB I;  4DV6 I;  4RPF A;  1PVG A;  1J5E E;  1MX0 A;  1N33 I;  4HY1 A;  4I3H A;  2UXC I;  4JI1 E;  2A2D A;  2X36 A;  1B63 A;  1IBL E;  2XEX A;  1FJG I;  1Z0G A;  4DUY E;  4DV1 I;  4B3T E;  4X62 E;  4B3T I;  2UUA I;  4HYM A;  3LTO A;  2BM0 A;  2UUA E;  2ZBK B;  2UUC E;  1PIE A;  1RRE A;  4JI4 E;  5IT9 C;  4B3M I;  4PU9 A;  3ZM7 A;  4JI1 I;  3K17 A;  4K0K E;  1MG7 A;  3ZZU A;  4UT4 A;  4K0K I;  1IBK E;  4MYT A;  2AJ4 A;  4LF8 I;  3B8H A;  1FWK A;  4KHP E;  4B3S I;  5A2Q Q;  1HNZ I;  2UUB E;  3V5R A;  1S16 A;  4WUB A;  4USM A;  4X62 I;  2UXB I;  3B82 A;  2UXD I;  4NXM E;  3QT7 A;  2GS8 A;  1D6T A;  4X65 I;  4DR5 E;  4LF4 E;  4GKK I;  2HFU A;  4Z7C A;  4LF6 E;  2VQE E;  4DR5 I;  4DXL A;  1H7U A;  4JI2 E;  4FW9 A;  4XTJ A;  3WU6 A;  3D4J A;  1IBK I;  3J80 C;  1N34 E;  1NHJ A;  4DV7 I;  5GME A;  1N32 E;  4PRX A;  4OX9 I;  3LPS A;  1ZM9 A;  2A2C A;  4JI7 E;  2CZ9 A;  3PYF A;  2HFS A;  3WU5 A;  2V2V A;  1Z0W A;  2UXD E;  4P52 A;  4AQY I;  1XHK A;  4JV5 I;  1IBM I;  4P7A A;  4NXN E;  4EMD A;  1Z0E A;  3Q1Q A;  2DEJ A;  2VQE I;  1ZXM A;  4M1K A;  4DPY A;  4YY3 I;  2HKJ A;  4ED4 A;  4X64 I;  3J81 Q;  4JI6 E;  1H74 A;  3QT8 A;  2J7K A;  2Q2E B;  4URL A;  4JI8 E;  4DU7 A;  2VF3 A;  4JI8 I;  2EFG A;  2V2Q A;  3M6A A;  2HK2 A;  4R1F A;  4HAC A;  4AQY E;  1ZM4 A;  2ZM6 I;  1Z0C A;  4LF7 I;  1KKH A;  1FKA E;  1Z59 A;  3PYD A;  3T1Y E;  1Z5A A;  2UXC E;  2LJP A;  4JI0 I;  5BR8 I;  1BKN A;  3T1H I;  4DV2 I;  4FWD A;  1B62 A;  1XMQ E;  3CWV A;  4B3R I;  1KVK A;  2V8P A;  4YHH E;  4DR1 I;  4DUY I;  1I94 E;  1Z0V A;  4DR1 E;  4DPW A;  4DUZ I;  1VIS A;  4FWH A;  4DV4 E;  1XMO I;  3JAM Q;  4WUD A;  2NPF A;  3ZKD A;  4B3M E;  2DEI A;  2BV3 A;  1N33 E;  3B78 A;  1ELO A;  4DV3 E;  2ZIT A;  4DR6 E;  1N0U A;  3T1H E;  2UU9 I;  5IWA E;  4MYU A;  1XMQ I;  3OTO E;  2HKE A;  5FLX Q;  5GMD A;  4DR7 I;  3OTO I;  1FJG E;  1RR9 A;  2OI2 A;  4WUC A;  4DV6 E;  2UXB E;  1XMO E;  1J5E I;  4DPU A;  5IT9 Q;  3J7A M;  4HAC B;  4DV0 I;  4JI4 I;  1MU5 A;  4DR6 I;  1XNR I;  1IBL I;  4USK A;  1XNR E;  4LF9 E;  5IWA I;  5LMN E;  4DR7 E;  3ZKB A;  3LNU A;  4KHP I;  1HR0 E;  1EI1 A;  4B3S E;  4FWG A;  2F4V I;  4JI7 I;  4DV1 E;  2R3V A;  4KQV A;  1FWL A;  1UEK A;  2UUC I;  4DV0 E;  1WUU A;  3ZZT A;  5FLX C;  2WW4 A;  1DAR A;  1Z0B A;  4DR2 I;  4JI2 I;  4LF9 I;  2V2Z A;  5LMN I;  1NHI A;  2R42 A;  4LF8 E;  1PKP A;  5LMU E;  1HNZ E;  1ZM3 A;  2UUB I;  4GKJ E;  5A2Q C;  2F4V E;  1QZR A;  2VQF I;  3J81 C;  1XNQ E;  3PYE A;  2VQF E;  3V2U C;  4PRV A;  4NXM I;  1XNQ I;  4DR4 E;  4JYA E;  3HUL A;  4JYA I;  3F0N A;  1IBM E;  2HK3 A;  4NXN I;  4GKK E;  1A6F A;  1Z5B A;  2BM1 A;  4Z7Y A;  4DR2 E;  4ZVI A;  5L3J A;  1Z0T A;  4JI3 E;  3JAM C;  1HNW E;  1N34 I;  3QT6 A;  1HNW I;  1N32 I;  5LMU I;  1ZXN A;  4X64 E; 
#chains in the Genus database with same CATH topology
 4OX9 E;  4IZJ A;  4LCF A;  4DV2 E;  1FNM A;  3GON A;  4GKJ I;  2V34 A;  4LFC E;  3P3C A;  2HHH I;  4B3R E;  3PS3 A;  2Z5C B;  1I94 I;  1OJ4 A;  4DR4 I;  2JE6 A;  3QT5 A;  4DUZ E;  1K47 A;  5K36 F;  4MU3 A;  2PNZ B;  2C37 A;  4LF7 E;  4U3B A;  1ZM2 A;  3PYG A;  5JEA B;  4X65 E;  4LF4 I;  3T1Y I;  4LF6 I;  2X7I A;  2BA1 D;  4DR3 I;  4JI3 I;  4J3D A;  1HNX E;  4LPF A;  2E5L I;  4DR3 E;  5LL6 R;  2PO0 B;  3WU3 A;  4JI5 I;  4DV3 I;  1H7S A;  2WNR B;  3J7A G;  4IS9 A;  1Z5C A;  4LF5 E;  3HKM A;  4DV7 E;  2UU9 E;  5BR8 E;  4LFC I;  2HHH E;  4HXZ A;  2PNL A;  4FN5 A;  2NN6 B;  5DRR A;  1NZ0 A;  4DPX A;  1FI4 A;  4X66 E;  1N0V C;  1NHH A;  2BR2 B;  2CG9 A;  3H4L A;  1P42 A;  2C38 B;  4DPT A;  1EA6 A;  4IZK A;  5EL9 A;  2ZM6 E;  1KIJ A;  3WU4 A;  5ELW A;  4MU1 A;  4JV5 E;  2E1R A;  1S4E A;  1U2R A;  3K1J A;  2BA1 G;  2VES A;  4U3D A;  3HJC A;  3J80 Q;  1UDO A;  1H72 C;  3PRY A;  1HNX I;  2E5L E;  4LFA I;  4JI5 E;  3GME A;  2JEA A;  4JG4 A;  4YY3 E;  4JI0 E;  4LFA E;  1Y4S A;  4FW4 A;  1N36 E;  4LF5 I;  4UTG A;  4JI6 I;  4OZE A;  5DRO A;  1N36 I;  1H73 A;  1XXE A;  4LOM A;  3ZZ0 A;  4X66 I;  2NN6 C;  4YHH I;  2NN6 E;  1HR0 I;  4DV5 E;  1KTV A;  4DV5 I;  4LFB E;  4FW5 A;  2IER A;  4DV4 I;  4DU8 A;  4LFB I;  2IES A;  4DV6 I;  4RPF A;  4MQY A;  1PVG A;  1J5E E;  1MX0 A;  3B4T A;  1N33 I;  4HY1 A;  4I3H A;  2UXC I;  2PNZ A;  2C37 B;  5DNL A;  4LCH A;  4JI1 E;  1Y4U A;  2A2D A;  2X36 A;  5K36 D;  1B63 A;  1E3H A;  4FW3 A;  4MU4 A;  1IBL E;  2C39 B;  1USV A;  2GO3 A;  2XEX A;  2J65 A;  1FJG I;  4BA1 A;  1Z0G A;  4DUY E;  4DV1 I;  4B3T E;  2CVE A;  3P76 A;  4X62 E;  4B3T I;  2UUA I;  4HYM A;  5DRP A;  3LTO A;  2BM0 A;  2C38 A;  2UUA E;  2ZBK B;  2BA0 G;  2IOQ A;  2UUC E;  5K36 C;  1PIE A;  1RRE A;  4JI4 E;  5IT9 C;  4B3M I;  4BA2 A;  4PU9 A;  3H1C A;  5C0X B;  1VI7 A;  3ZM7 A;  4JI1 I;  3K17 A;  1UDQ A;  4K0K E;  4IFD E;  1MG7 A;  1USU A;  3ZZU A;  4UT4 A;  4K0K I;  3CDJ A;  1IBK E;  4MYT A;  2AJ4 A;  4LF8 I;  3B8H A;  1FWK A;  4KHP E;  1R6M A;  4B3S I;  5A2Q Q;  1HNZ I;  2UUB E;  2Z5C A;  1HK7 A;  3V5R A;  1S16 A;  4WUB A;  5K36 B;  2PO2 A;  4USM A;  1YH8 A;  2IOP A;  2JE6 B;  4X62 I;  2UXB I;  3M85 G;  3B82 A;  2UXD I;  1OYS A;  4NXM E;  3QT7 A;  5DRQ A;  2GS8 A;  1Y6Z A;  1D6T A;  3M7N G;  4OO1 A;  4X65 I;  4DR5 E;  4LF4 E;  4GKK I;  2HFU A;  3L7Z B;  2WP8 B;  3Q6N A;  4Z7C A;  4LF6 E;  2VQE E;  4DR5 I;  4DXL A;  4OO1 E;  4OO1 D;  1H7U A;  4JI2 E;  4FW9 A;  2WNR A;  5DNX A;  1E3P A;  4XTJ A;  3WU6 A;  3D4J A;  1IBK I;  3J80 C;  1N34 E;  1NHJ A;  4DV7 I;  5GME A;  1N32 E;  4PRX A;  4OX9 I;  3LPS A;  1ZM9 A;  4IFD B;  2A2C A;  4JI7 E;  2CZ9 A;  2Z5B A;  3WU5 A;  2HFS A;  3PYF A;  2V2V A;  3NZK A;  4QNJ A;  1Z0W A;  1UDS A;  3CDI A;  2UXD E;  1Y5Y A;  4P52 A;  4AM3 A;  4AQY I;  1XHK A;  4JV5 I;  1IBM I;  2BR2 A;  4P7A A;  4NXN E;  4GQU A;  4EMD A;  2F1D A;  5JEA A;  1Z0E A;  4IZK B;  3Q1Q A;  2O1W A;  2DEJ A;  2VQE I;  1ZXM A;  3PS1 A;  3P3G A;  4M1K A;  4DPY A;  2JT2 A;  4YY3 I;  2HKJ A;  4ED4 A;  4X64 I;  3J81 Q;  4JI6 E;  1H74 A;  3QT8 A;  4IZJ B;  2JEB A;  2J7K A;  2Q2E B;  4URL A;  4JI8 E;  4DU7 A;  3UHM A;  2VF3 A;  4JI8 I;  2EFG A;  2BA0 D;  2V2Q A;  3M6A A;  2HK2 A;  4R1F A;  2AE8 A;  4HAC A;  4AQY E;  1ZM4 A;  2ZM6 I;  1Z0C A;  4LF7 I;  5K36 A;  1KKH A;  1FKA E;  1Z59 A;  4IFD C;  3PYD A;  3T1Y E;  2PO1 A;  5K36 E;  1Z5A A;  3GCM A;  3Q6M A;  5JEA E;  4ISA A;  2UXC E;  5C0X C;  2LJP A;  4JI0 I;  5BR8 I;  1BKN A;  3T1H I;  4DV2 I;  1N32 I;  4FWD A;  1B62 A;  5EKW A;  1XMQ E;  3CWV A;  4B3R I;  4OO1 F;  1KVK A;  2V8P A;  4YHH E;  3M7N D;  5C0X F;  4DR1 I;  4DUY I;  2PNM A;  1I94 E;  1Z0V A;  4DR1 E;  4DPW A;  4DUZ I;  4NBQ A;  1VIS A;  4FWH A;  4DV4 E;  1UDN A;  1XMO I;  1YHC A;  2Z5B B;  3K85 A;  4OO1 C;  3JAM Q;  3KRN A;  4WUD A;  2NPF A;  5C0X D;  4BA2 B;  3ZKD A;  4B3M E;  2DEI A;  2BV3 A;  1N33 E;  4AIM A;  3B78 A;  2NN6 A;  5JEA D;  2JEA B;  1ELO A;  4DV3 E;  2ZIT A;  2O1V A;  3U1Y A;  2PO0 A;  4DR6 E;  1N0U A;  4OKG A;  3T1H E;  2UU9 I;  2CGE A;  5IWA E;  4MYU A;  1XMQ I;  3OTO E;  1R6L A;  2HKE A;  5FLX Q;  5GMD A;  5JEA F;  4DR7 I;  3OTO I;  1FJG E;  1RR9 A;  2OI2 A;  3DD6 A;  4WUC A;  3U1K A;  2JEB B;  3PS2 A;  4DV6 E;  2UXB E;  4AID A;  1OYR A;  3P3E A;  1XMO E;  4MDT A;  1OYP A;  1RHY A;  5JEA C;  1J5E I;  4FW7 A;  4OO1 B;  4DPU A;  5C0X E;  2WP8 A;  5IT9 Q;  3J7A M;  4HAC B;  4DV0 I;  4JI4 I;  1MU5 A;  2GO4 A;  3M85 D;  4DR6 I;  4LCG A;  1XNR I;  1IBL I;  4USK A;  4FW6 A;  2GQ0 A;  1XNR E;  4LF9 E;  5IWA I;  5LMN E;  3L7Z A;  4MU0 A;  2NN6 D;  4DR7 E;  3ZKB A;  4IZJ D;  2O1T A;  3LNU A;  4KHP I;  1HR0 E;  1EI1 A;  4B3S E;  4FWG A;  2F4V I;  4JI7 I;  4DV1 E;  2R3V A;  4KQV A;  2NN6 F;  1FWL A;  3P06 A;  4IFD A;  1UEK A;  2UUC I;  4DV0 E;  1WUU A;  3ZZT A;  5FLX C;  2C39 A;  4QNK A;  2WW4 A;  5C0X A;  1DAR A;  2O1U A;  1Z0B A;  4DR2 I;  4JI2 I;  4LF9 I;  2V2Z A;  5LMN I;  1NHI A;  2R42 A;  4LF8 E;  1PKP A;  5LMU E;  1HNZ E;  1ZM3 A;  2UUB I;  4GKJ E;  5A2Q C;  2F4V E;  4BA1 B;  1QZR A;  2Z5E A;  2VQF I;  3J81 C;  1XNQ E;  3PYE A;  4IFD F;  2VQF E;  3V2U C;  4PRV A;  4NXM I;  1XNQ I;  4DR4 E;  4JYA E;  3HUL A;  4JYA I;  3F0N A;  1IBM E;  4N3O A;  2HK3 A;  4NXN I;  4GKK E;  1A6F A;  1Z5B A;  2BM1 A;  4IFD D;  4Z7Y A;  4ZVI A;  5FWK A;  5L3J A;  4DR2 E;  1Z0T A;  4JI3 E;  3GLL A;  3JAM C;  1HNW E;  2PO1 B;  1Y60 A;  2O3Z A;  3QT6 A;  1N34 I;  1HNW I;  2PO2 B;  5LMU I;  1ZXN A;  4X64 E; 
#chains in the Genus database with same CATH homology
 4OX9 E;  4IZJ A;  4DV2 E;  1FNM A;  3GON A;  4GKJ I;  2V34 A;  4LFC E;  2HHH I;  4B3R E;  2Z5C B;  1I94 I;  1OJ4 A;  4DR4 I;  3QT5 A;  4DUZ E;  1K47 A;  4LF7 E;  1ZM2 A;  3PYG A;  4X65 E;  4LF4 I;  3T1Y I;  4LF6 I;  2X7I A;  4DR3 I;  4JI3 I;  1HNX E;  2E5L I;  4DR3 E;  5LL6 R;  3WU3 A;  4JI5 I;  4DV3 I;  1H7S A;  3J7A G;  1Z5C A;  4LF5 E;  4DV7 E;  2UU9 E;  5BR8 E;  4LFC I;  2HHH E;  4HXZ A;  2PNL A;  4FN5 A;  1NZ0 A;  4DPX A;  1FI4 A;  4X66 E;  1N0V C;  1NHH A;  2CG9 A;  3H4L A;  4DPT A;  1EA6 A;  4IZK A;  2ZM6 E;  1KIJ A;  3WU4 A;  4JV5 E;  2E1R A;  1S4E A;  1U2R A;  3K1J A;  3HJC A;  3J80 Q;  2E5L E;  3PRY A;  1H72 C;  1HNX I;  4LFA I;  4JI5 E;  4JG4 A;  4YY3 E;  4JI0 E;  4LFA E;  1Y4S A;  1N36 E;  4LF5 I;  4UTG A;  4JI6 I;  1N36 I;  1H73 A;  3ZZ0 A;  4X66 I;  4YHH I;  1HR0 I;  4DV5 E;  1KTV A;  4DV5 I;  4LFB E;  4DV4 I;  4DU8 A;  4LFB I;  4DV6 I;  4RPF A;  1PVG A;  1J5E E;  1MX0 A;  1N33 I;  4HY1 A;  4I3H A;  2UXC I;  4JI1 E;  1Y4U A;  2A2D A;  2X36 A;  1B63 A;  1IBL E;  1USV A;  2XEX A;  1FJG I;  1Z0G A;  4DUY E;  4DV1 I;  4B3T E;  4X62 E;  4B3T I;  2UUA I;  4HYM A;  3LTO A;  2BM0 A;  2UUA E;  2ZBK B;  2IOQ A;  2UUC E;  1PIE A;  1RRE A;  4JI4 E;  5IT9 C;  4B3M I;  4PU9 A;  3ZM7 A;  4JI1 I;  3K17 A;  4K0K E;  1MG7 A;  1USU A;  3ZZU A;  4UT4 A;  4K0K I;  1IBK E;  4MYT A;  2AJ4 A;  4LF8 I;  3B8H A;  1FWK A;  4KHP E;  4B3S I;  5A2Q Q;  1HNZ I;  2UUB E;  2Z5C A;  1HK7 A;  3V5R A;  1S16 A;  4WUB A;  4USM A;  2IOP A;  4X62 I;  2UXB I;  3B82 A;  2UXD I;  4NXM E;  3QT7 A;  2GS8 A;  1Y6Z A;  1D6T A;  4X65 I;  4DR5 E;  4LF4 E;  4GKK I;  2HFU A;  3Q6N A;  4Z7C A;  4LF6 E;  2VQE E;  4DR5 I;  4DXL A;  1H7U A;  4JI2 E;  4FW9 A;  4XTJ A;  3WU6 A;  3D4J A;  1IBK I;  3J80 C;  1N34 E;  1NHJ A;  4DV7 I;  5GME A;  1N32 E;  4PRX A;  4OX9 I;  3LPS A;  1ZM9 A;  2A2C A;  4JI7 E;  2CZ9 A;  2Z5B A;  2HFS A;  3PYF A;  3WU5 A;  2V2V A;  1Z0W A;  2UXD E;  4P52 A;  4AQY I;  1XHK A;  4JV5 I;  1IBM I;  4P7A A;  4NXN E;  4EMD A;  1Z0E A;  4IZK B;  3Q1Q A;  2O1W A;  2DEJ A;  2VQE I;  1ZXM A;  4M1K A;  4DPY A;  4YY3 I;  2HKJ A;  4ED4 A;  4X64 I;  3J81 Q;  4JI6 E;  1H74 A;  3QT8 A;  4IZJ B;  2J7K A;  2Q2E B;  4URL A;  4JI8 E;  4DU7 A;  2VF3 A;  4JI8 I;  2EFG A;  2V2Q A;  3M6A A;  2HK2 A;  4R1F A;  4HAC A;  4AQY E;  1ZM4 A;  2ZM6 I;  1Z0C A;  4LF7 I;  1KKH A;  1FKA E;  1Z59 A;  3PYD A;  3T1Y E;  1Z5A A;  3Q6M A;  2UXC E;  2LJP A;  4JI0 I;  5BR8 I;  1BKN A;  3T1H I;  4DV2 I;  4FWD A;  1B62 A;  1XMQ E;  3CWV A;  4B3R I;  1KVK A;  2V8P A;  4YHH E;  4DR1 I;  4DUY I;  2PNM A;  1I94 E;  1Z0V A;  4DR1 E;  4DPW A;  4DUZ I;  1VIS A;  4FWH A;  4DV4 E;  1XMO I;  2Z5B B;  3K85 A;  3JAM Q;  4WUD A;  2NPF A;  3ZKD A;  4B3M E;  2DEI A;  2BV3 A;  1N33 E;  3B78 A;  1ELO A;  4DV3 E;  2ZIT A;  2O1V A;  4DR6 E;  1N0U A;  3T1H E;  2UU9 I;  2CGE A;  5IWA E;  1XMQ I;  4MYU A;  3OTO E;  2HKE A;  5FLX Q;  5GMD A;  4DR7 I;  3OTO I;  1FJG E;  1RR9 A;  2OI2 A;  4WUC A;  4DV6 E;  2UXB E;  1XMO E;  1J5E I;  4DPU A;  5IT9 Q;  3J7A M;  4HAC B;  4DV0 I;  4JI4 I;  1MU5 A;  4DR6 I;  1XNR I;  1IBL I;  4USK A;  2GQ0 A;  1XNR E;  4LF9 E;  5IWA I;  5LMN E;  4DR7 E;  3ZKB A;  4IZJ D;  2O1T A;  3LNU A;  4KHP I;  1HR0 E;  1EI1 A;  4B3S E;  4FWG A;  2F4V I;  4JI7 I;  4DV1 E;  2R3V A;  4KQV A;  1FWL A;  3P06 A;  1UEK A;  2UUC I;  4DV0 E;  1WUU A;  3ZZT A;  5FLX C;  2WW4 A;  1DAR A;  2O1U A;  1Z0B A;  4DR2 I;  4JI2 I;  4LF9 I;  2V2Z A;  5LMN I;  1NHI A;  2R42 A;  4LF8 E;  1PKP A;  5LMU E;  1HNZ E;  1ZM3 A;  2UUB I;  4GKJ E;  5A2Q C;  2F4V E;  1QZR A;  2Z5E A;  2VQF I;  3J81 C;  1XNQ E;  3PYE A;  2VQF E;  3V2U C;  4PRV A;  4NXM I;  1XNQ I;  4DR4 E;  4JYA E;  3HUL A;  4JYA I;  3F0N A;  1IBM E;  4N3O A;  2HK3 A;  4NXN I;  4GKK E;  1A6F A;  1Z5B A;  2BM1 A;  4Z7Y A;  5L3J A;  4DR2 E;  5FWK A;  4ZVI A;  1Z0T A;  4JI3 E;  3JAM C;  1HNW E;  1N34 I;  3QT6 A;  1HNW I;  1N32 I;  5LMU I;  1ZXN A;  4X64 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...