4LFCI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfcI00
4LFCI 4JI0I 1ZM2A 1NHJA 1ZXNA 4AQYI 1WUUA 4DR1I 4DV1E 3LTOA 3B78A 4PRXA 3M6AA 1FJGE 2VQEE 4B3TE 4ZVIA 4HXZA 3ZZUA 4B3SI 4DR7E 4DPWA 4Z7CA 1XMQI 3OTOI 3K17A 5LL6R 1FNMA 4DV0I 1XNQE 4DV2E 5GMEA 1A6FA 3WU6A 1ZM9A 3WU3A 1FKAE 1PIEA 5IWAE 2CZ9A 2HHHI 4X66E 5BR8E 3ZZ0A 1N34E 3V2UC 4GKJE 2UUCE 4DV4E 1N34I 2NPFA 4PRVA 4LFBE 1MU5A 1FI4A 1IBKI 4LF6E 4DV6I 2UXCI 1NZ0A 2VF3A 5FLXQ 1Z0GA 4WUDA 1EA6A 4FWGA 3QT7A 4JG4A 3ZKBA 1N36E 4NXMI 1PVGA 1Z0WA 4JI4I 1PKPA 1NHIA 1Z0BA 3J7AG 4YY3I 1FWLA 1ZM4A 4JI5I 4JI0E 4R1FA 2DEIA 2HFSA 4DR5E 4B3MI 2A2DA 4I3HA 4LF6I 4K0KE 4DR2I 3WU4A 1I94I 1XHKA 3Q1QA 4HYMA 1MG7A 2UUAI 4JV5E 1Z59A 4DU8A 4OX9I 1HR0I 4P52A 4HY1A 2ZM6E 3PYEA 3B82A 3QT6A 2UXBI 4DPYA 2HKEA 4B3RI 4DV5I 4DR4I 4Z7YA 2E5LE 5GMDA 4DR1E 4M1KA 4DV7E 2UU9I 5IT9Q 3V5RA 5FLXC 1XNQI 4DV0E 4X64E 3ZZTA 3LPSA 3D4JA 1H7SA 3LNUA 4JI1E 4B3SE 2HFUA 3JAMQ 2F4VI 1Z5CA 4MYTA 1ELOA 3F0NA 2V2ZA 2R3VA 3QT8A 4LF7I 2GS8A 2ZBKB 1N32E 4JI8E 4NXNI 2V8PA 4JI1I 3J80C 1KVKA 5LMUI 1I94E 1KIJA 1ZM3A 1N0UA 3T1HE 3GONA 1S16A 1J5EE 1S4EA 2ZITA 3HULA 4YHHE 1HNZI 1K47A 3WU5A 1XMOI 2E5LI 4NXNE 4JI8I 2DEJA 2OI2A 1Z5AA 1NHHA 1N33I 4DPXA 4DU7A 4HACA 4JV5I 4LF4E 4LF5I 4LFCE 4X62E 4P7AA 3ZKDA 3PYFA 2UUBI 1Z0VA 4JYAE 1OJ4A 4K0KI 1HNXI 1EI1A 1QZRA 4DR3I 2VQFI 2HKJA 3K1JA 4B3RE 2UXBE 4KHPE 4USMA 4X62I 5A2QC 1H72C 3J80Q 1UEKA 4GKJI 3PYGA 5LMNI 4JI2E 5IWAI 2UUAE 1RREA 4JI3E 2BM0A 4XTJA 4WUCA 4DR5I 4B3ME 4ED4A 2HK2A 4DPUA 1BKNA 4DV3E 4JI3I 4URLA 4DPTA 1Z5BA 4JI5E 4JI2I 3J7AM 4LF9E 2UXDE 3CWVA 2EFGA 1N32I 4DV4I 2X36A 3PYDA 4DR6E 4UT4A 5BR8I 2VQFE 2WW4A 1IBLI 4USKA 1XMOE 1Z0CA 1IBKE 4DV6E 4DUZE 5L3JA 2J7KA 3QT5A 2Q2EB 1XMQE 3OTOE 4DUYE 2UU9E 3JAMC 4DXLA 4LFAE 1HNWE 2V34A 1H74A 4LF7E 4DV5E 4DR4E 4B3TI 2VQEI 4DR6I 5IT9C 4JI7I 1B62A 4DV1I 1Z0TA 4LFAI 4JYAI 4DUZI 2E1RA 4DV2I 3T1YE 4DR7I 4FWHA 4LF5E 1IBLE 4X65I 1DARA 2V2VA 4MYUA 4JI4E 2R42A 1RR9A 1IBMI 2A2CA 1H73A 4FW9A 4KHPI 1HNZE 2AJ4A 4LF9I 4X64I 4KQVA 2UXCE 2XEXA 4DV3I 4GKKE 4RPFA 4FWDA 4LF8E 4JI6E 1KTVA 4OX9E 4NXME 5LMNE 2F4VE 1HNWI 1HR0E 4JI6I 2UXDI 3B8HA 4LF8I 1U2RA 2BV3A 4DR3E 4DV7I 4DR2E 1FWKA 4YHHI 4GKKI 1KKHA 1VISA 2X7IA 4YY3E 2BM1A 1D6TA 1IBME 1H7UA 2ZM6I 4UTGA 4LF4I 1B63A 1MX0A 5A2QQ 3H4LA 1N33E 4EMDA 4AQYE 3ZM7A 4HACB 1J5EI 1Z0EA 3T1HI 4LFBI 2UUCI 1N0VC 4JI7E 1XNRI 1N36I 1FJGI 1ZXMA 4X66I 2HHHE 3J81C 1XNRE 2V2QA 4X65E 1HNXE 4DUYI 3J81Q 3T1YI 2HK3A 2UUBE 2LJPA 4WUBA 4PU9A 4FN5A 5LMUE
chains in the Genus database with same CATH superfamily
2NN6F 4LFCI 4JI0I 1ZM2A 1NHJA 1ZXNA 4AQYI 1WUUA 4DR1I 2PO2A 4DV1E 3LTOA 3B78A 4PRXA 5EKWA 3M6AA 2GO4A 1FJGE 2VQEE 4B3TE 2CVEA 1R6MA 5K36F 4ZVIA 3HKMA 4HXZA 2CG9A 3ZZUA 4B3SI 4DR7E 4DPWA 4Z7CA 2AE8A 1XMQI 3OTOI 3H1CA 3K17A 5LL6R 3M85G 1FNMA 4DV0I 1UDNA 4DV2E 1XNQE 4IZKA 5GMEA 1A6FA 3WU6A 1ZM9A 3WU3A 4IZKB 2IESA 1FKAE 1PIEA 5IWAE 2CZ9A 2HHHI 4X66E 5BR8E 3ZZ0A 4BA1A 1N34E 1OYRA 3V2UC 4IFDC 4GKJE 5DRPA 2UUCE 4DV4E 1N34I 1Y6ZA 2O1UA 2NPFA 4PRVA 4LFBE 1MU5A 1FI4A 2JEAA 1IBKI 4LF6E 4DV6I 2UXCI 2BA1D 1NZ0A 2VF3A 5FLXQ 1Z0GA 4BA2B 4NBQA 4WUDA 1EA6A 4FWGA 3QT7A 4JG4A 4N3OA 3ZKBA 1N36E 1OYSA 4NXMI 4IFDE 4U3DA 3DD6A 1PVGA 1Z0WA 4JI4I 1PKPA 2GO3A 1NHIA 1Z0BA 2PNLA 3J7AG 4YY3I 1FWLA 1ZM4A 4JI5I 3UHMA 4JI0E 2C39A 4R1FA 2DEIA 2HFSA 4DR5E 4B3MI 2A2DA 4I3HA 4LF6I 4K0KE 4DR2I 3WU4A 2C39B 1I94I 1XHKA 3Q1QA 4HYMA 3B4TA 5DROA 1MG7A 2UUAI 3M7ND 5C0XD 4JV5E 1Z59A 4DU8A 4OX9I 1HR0I 2NN6A 4P52A 4HY1A 2ZM6E 3PYEA 3B82A 3QT6A 2UXBI 2VESA 4DPYA 2HKEA 5C0XC 4B3RI 4DV5I 4DR4I 2PNMA 4Z7YA 3L7ZB 2E5LE 5GMDA 4DR1E 2BA0G 4QNJA 4M1KA 2PO0A 2C37A 4DV7E 2UU9I 5IT9Q 2O1TA 3V5RA 5FLXC 4FW6A 1XNQI 5DRQA 4DV0E 4LCFA 4X64E 3ZZTA 3LPSA 1YHCA 1Y4SA 4IZJD 3D4JA 1H7SA 3LNUA 3P3GA 4JI1E 4B3SE 2HFUA 3JAMQ 2BA0D 2F4VI 1Y60A 1Z5CA 4IZJA 4MYTA 1ELOA 1Y5YA 3F0NA 2V2ZA 2R3VA 3QT8A 4LF7I 4IFDF 2GS8A 5K36E 2JT2A 2ZBKB 1N32E 2NN6C 4JI8E 4OO1B 4NXNI 2V8PA 2NN6B 4JI1I 2Z5BA 3J80C 2CGEA 1KVKA 5LMUI 4FW7A 1I94E 1KIJA 1ZM3A 5JEAE 1N0UA 3T1HE 3GONA 1S16A 1J5EE 1S4EA 2ZITA 2NN6D 3HULA 4OO1F 4YHHE 1HNZI 5K36D 2JE6A 1K47A 3WU5A 1XMOI 2E5LI 4NXNE 4JI8I 2DEJA 2OI2A 1Z5AA 1YH8A 5ELWA 1NHHA 3P3EA 1N33I 4DPXA 1P42A 3CDJA 4DU7A 4HACA 4JV5I 3P76A 3M85D 4LF4E 5DNLA 4LF5I 4AM3A 4LFCE 4X62E 4P7AA 3PRYA 3ZKDA 3HJCA 3NZKA 3PYFA 2UUBI 1Z0VA 4JYAE 1OJ4A 4K0KI 1HNXI 1EI1A 1QZRA 4DR3I 2Z5BB 3Q6NA 5C0XA 2HKJA 3K1JA 2VQFI 4B3RE 2UXBE 4KHPE 4USMA 4X62I 5A2QC 2PO1B 1H72C 4LPFA 3J80Q 1UEKA 1E3HA 4GKJI 3PYGA 5LMNI 4JI2E 5IWAI 3GCMA 2UUAE 4GQUA 1RREA 4JI3E 2BM0A 4OO1C 4XTJA 2IOQA 2O3ZA 4WUCA 4DR5I 4MU3A 3U1YA 4ED4A 4B3ME 2HK2A 4DPUA 1BKNA 4J3DA 4DV3E 4JI3I 4OKGA 4URLA 4DPTA 1Z5BA 4JI5E 4JI2I 3J7AM 4LF9E 2UXDE 1E3PA 5K36A 3CWVA 2EFGA 1N32I 4DV4I 2X36A 1USUA 3PYDA 5JEAC 4DR6E 4UT4A 5BR8I 2VQFE 2WW4A 2BA1G 1IBLI 4USKA 5DRRA 1XMOE 2GQ0A 4BA1B 1Z0CA 4LCHA 1UDSA 1IBKE 3U1KA 4DV6E 4DUZE 2WP8A 5L3JA 2J7KA 3QT5A 2Q2EB 1XMQE 3OTOE 4DUYE 2PO2B 2UU9E 3JAMC 4DXLA 4LFAE 4MU4A 5JEAA 2BR2A 1HNWE 5EL9A 1XXEA 4IFDA 2V34A 5JEAF 1H74A 4LF7E 4DV5E 4DR4E 2IOPA 4IFDB 4B3TI 2C38B 2VQEI 4DR6I 5IT9C 3GMEA 4JI7I 1B62A 2C38A 4DV1I 5C0XE 2J65A 1Z0TA 4LFAI 3L7ZA 4JYAI 4IS9A 4DUZI 2O1VA 2E1RA 4DV2I 3T1YE 2C37B 4DR7I 2JEBB 4FWHA 1VI7A 4LF5E 1IBLE 4X65I 1DARA 2V2VA 3Q6MA 2WP8B 1R6LA 4MYUA 4JI4E 2R42A 1RR9A 4IZJB 4LCGA 4FW5A 5JEAB 1IBMI 2BR2B 2A2CA 1H73A 2JEAB 3M7NG 4FW9A 4KHPI 1HNZE 2AJ4A 4LF9I 3PS1A 4BA2A 4X64I 3P3CA 4KQVA 2UXCE 2XEXA 4DV3I 4GKKE 4QNKA 4RPFA 2Z5EA 4FWDA 4IFDD 4LF8E 5JEAD 4OZEA 3K85A 4JI6E 2JE6B 1KTVA 2WNRB 2JEBA 4OX9E 2Z5CB 4NXME 5LMNE 2PO0B 2WNRA 2F4VE 2PNZA 1HNWI 2Z5CA 4FW3A 1HR0E 4JI6I 3P06A 4OO1E 3PS2A 2UXDI 3B8HA 4LF8I 5FWKA 1U2RA 2BV3A 4DR3E 1RHYA 4DV7I 4DR2E 1FWKA 4YHHI 1Y4UA 4GKKI 1KKHA 4MU0A 1VISA 1UDQA 2X7IA 4YY3E 4MQYA 4OO1D 3KRNA 2BM1A 5C0XB 4OO1A 1D6TA 1IBME 1H7UA 2F1DA 2ZM6I 4ISAA 4UTGA 5C0XF 4LF4I 1B63A 1MX0A 3PS3A 5A2QQ 3H4LA 1N33E 4EMDA 2O1WA 4AQYE 3ZM7A 4LOMA 2PNZB 4HACB 1OYPA 2IERA 1J5EI 1Z0EA 3T1HI 4LFBI 3GLLA 2UUCI 1N0VC 4U3BA 4JI7E 1XNRI 5DNXA 1N36I 1FJGI 1ZXMA 5K36B 4X66I 2HHHE 5K36C 3J81C 4AIMA 2NN6E 1XNRE 2V2QA 1UDOA 4X65E 3CDIA 4FW4A 2PO1A 1HNXE 4DUYI 4AIDA 1HK7A 3J81Q 3T1YI 2HK3A 1USVA 2UUBE 2LJPA 4WUBA 4PU9A 4FN5A 4MU1A 4MDTA 5LMUE
chains in the Genus database with same CATH topology
4LFCI 4JI0I 1ZM2A 1NHJA 1ZXNA 4AQYI 1WUUA 4DR1I 4DV1E 3LTOA 3B78A 4PRXA 3M6AA 1FJGE 2VQEE 4B3TE 4ZVIA 4HXZA 2CG9A 3ZZUA 4B3SI 4DR7E 4DPWA 4Z7CA 1XMQI 3OTOI 3K17A 5LL6R 1FNMA 4DV0I 1XNQE 4DV2E 4IZKA 5GMEA 1A6FA 3WU6A 1ZM9A 3WU3A 4IZKB 1FKAE 1PIEA 5IWAE 2CZ9A 2HHHI 4X66E 5BR8E 3ZZ0A 1N34E 3V2UC 4GKJE 2UUCE 4DV4E 1N34I 1Y6ZA 2O1UA 2NPFA 4PRVA 4LFBE 1MU5A 1FI4A 1IBKI 4LF6E 4DV6I 2UXCI 1NZ0A 2VF3A 5FLXQ 1Z0GA 4WUDA 1EA6A 4FWGA 3QT7A 4JG4A 4N3OA 3ZKBA 1N36E 4NXMI 1PVGA 1Z0WA 4JI4I 1PKPA 1NHIA 1Z0BA 2PNLA 3J7AG 4YY3I 1FWLA 1ZM4A 4JI5I 4JI0E 4R1FA 2DEIA 2HFSA 4B3MI 4DR5E 2A2DA 4I3HA 4LF6I 4K0KE 4DR2I 3WU4A 1I94I 1XHKA 3Q1QA 4HYMA 1MG7A 2UUAI 4JV5E 1Z59A 4DU8A 4OX9I 1HR0I 4P52A 4HY1A 2ZM6E 3PYEA 3B82A 3QT6A 2UXBI 4DPYA 2HKEA 4B3RI 4DV5I 4DR4I 2PNMA 4Z7YA 2E5LE 5GMDA 4DR1E 4M1KA 4DV7E 2UU9I 5IT9Q 2O1TA 3V5RA 5FLXC 1XNQI 4DV0E 4X64E 3ZZTA 3LPSA 1Y4SA 4IZJD 3D4JA 1H7SA 3LNUA 4JI1E 4B3SE 2HFUA 3JAMQ 2F4VI 1Z5CA 4IZJA 4MYTA 1ELOA 3F0NA 2V2ZA 2R3VA 3QT8A 4LF7I 2GS8A 2ZBKB 1N32E 4JI8E 4NXNI 2V8PA 4JI1I 2Z5BA 3J80C 2CGEA 1KVKA 5LMUI 1I94E 1KIJA 1ZM3A 1N0UA 3T1HE 3GONA 1S16A 1J5EE 1S4EA 2ZITA 3HULA 4YHHE 1HNZI 1K47A 3WU5A 1XMOI 2E5LI 4NXNE 4JI8I 2DEJA 2OI2A 1Z5AA 1NHHA 1N33I 4DPXA 4DU7A 4HACA 4JV5I 4LF4E 4LF5I 4LFCE 4X62E 4P7AA 3PRYA 3ZKDA 3HJCA 3PYFA 2UUBI 1Z0VA 4JYAE 1OJ4A 4K0KI 1HNXI 1EI1A 1QZRA 4DR3I 2Z5BB 3Q6NA 2VQFI 2HKJA 3K1JA 4B3RE 2UXBE 4KHPE 4USMA 4X62I 5A2QC 1H72C 3J80Q 1UEKA 4GKJI 3PYGA 5LMNI 4JI2E 5IWAI 2UUAE 1RREA 4JI3E 2BM0A 4XTJA 2IOQA 4WUCA 4DR5I 4B3ME 4ED4A 2HK2A 4DPUA 1BKNA 4DV3E 4JI3I 4URLA 4DPTA 1Z5BA 4JI5E 4JI2I 3J7AM 4LF9E 2UXDE 3CWVA 2EFGA 1N32I 4DV4I 2X36A 1USUA 3PYDA 4DR6E 4UT4A 5BR8I 2VQFE 2WW4A 1IBLI 4USKA 1XMOE 2GQ0A 1Z0CA 1IBKE 4DV6E 4DUZE 5L3JA 2J7KA 3QT5A 2Q2EB 1XMQE 3OTOE 4DUYE 2UU9E 3JAMC 4DXLA 4LFAE 1HNWE 2V34A 1H74A 4LF7E 4DV5E 4DR4E 2IOPA 4B3TI 2VQEI 4DR6I 5IT9C 4JI7I 1B62A 4DV1I 1Z0TA 4LFAI 4JYAI 4DUZI 2O1VA 2E1RA 4DV2I 3T1YE 4DR7I 4FWHA 4LF5E 1IBLE 4X65I 1DARA 2V2VA 3Q6MA 4MYUA 4JI4E 2R42A 1RR9A 4IZJB 1IBMI 2A2CA 1H73A 4FW9A 4KHPI 1HNZE 2AJ4A 4LF9I 4X64I 4KQVA 2UXCE 2XEXA 4DV3I 4GKKE 4RPFA 2Z5EA 4FWDA 4LF8E 3K85A 4JI6E 1KTVA 4OX9E 2Z5CB 4NXME 5LMNE 2F4VE 1HNWI 2Z5CA 1HR0E 4JI6I 3P06A 2UXDI 3B8HA 4LF8I 5FWKA 1U2RA 2BV3A 4DR3E 4DV7I 4DR2E 1FWKA 4YHHI 1Y4UA 4GKKI 1KKHA 1VISA 2X7IA 4YY3E 2BM1A 1D6TA 1IBME 1H7UA 2ZM6I 4UTGA 4LF4I 1B63A 1MX0A 5A2QQ 3H4LA 1N33E 4EMDA 2O1WA 4AQYE 3ZM7A 4HACB 1J5EI 1Z0EA 3T1HI 4LFBI 2UUCI 1N0VC 4JI7E 1XNRI 1N36I 1FJGI 1ZXMA 4X66I 2HHHE 3J81C 1XNRE 2V2QA 4X65E 1HNXE 4DUYI 1HK7A 3J81Q 3T1YI 2HK3A 1USVA 2UUBE 2LJPA 4WUBA 4PU9A 4FN5A 5LMUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC I;  4JI0 I;  1ZM2 A;  1NHJ A;  1ZXN A;  4AQY I;  1WUU A;  4DR1 I;  4DV1 E;  3LTO A;  3B78 A;  4PRX A;  3M6A A;  1FJG E;  2VQE E;  4B3T E;  4ZVI A;  4HXZ A;  3ZZU A;  4B3S I;  4DR7 E;  4DPW A;  4Z7C A;  1XMQ I;  3OTO I;  3K17 A;  5LL6 R;  1FNM A;  4DV0 I;  1XNQ E;  4DV2 E;  5GME A;  1A6F A;  3WU6 A;  1ZM9 A;  3WU3 A;  1FKA E;  1PIE A;  5IWA E;  2CZ9 A;  2HHH I;  4X66 E;  5BR8 E;  3ZZ0 A;  1N34 E;  3V2U C;  4GKJ E;  2UUC E;  4DV4 E;  1N34 I;  2NPF A;  4PRV A;  4LFB E;  1MU5 A;  1FI4 A;  1IBK I;  4LF6 E;  4DV6 I;  2UXC I;  1NZ0 A;  2VF3 A;  5FLX Q;  1Z0G A;  4WUD A;  1EA6 A;  4FWG A;  3QT7 A;  4JG4 A;  3ZKB A;  1N36 E;  4NXM I;  1PVG A;  1Z0W A;  4JI4 I;  1PKP A;  1NHI A;  1Z0B A;  3J7A G;  4YY3 I;  1FWL A;  1ZM4 A;  4JI5 I;  4JI0 E;  4R1F A;  2DEI A;  2HFS A;  4DR5 E;  4B3M I;  2A2D A;  4I3H A;  4LF6 I;  4K0K E;  4DR2 I;  3WU4 A;  1I94 I;  1XHK A;  3Q1Q A;  4HYM A;  1MG7 A;  2UUA I;  4JV5 E;  1Z59 A;  4DU8 A;  4OX9 I;  1HR0 I;  4P52 A;  4HY1 A;  2ZM6 E;  3PYE A;  3B82 A;  3QT6 A;  2UXB I;  4DPY A;  2HKE A;  4B3R I;  4DV5 I;  4DR4 I;  4Z7Y A;  2E5L E;  5GMD A;  4DR1 E;  4M1K A;  4DV7 E;  2UU9 I;  5IT9 Q;  3V5R A;  5FLX C;  1XNQ I;  4DV0 E;  4X64 E;  3ZZT A;  3LPS A;  3D4J A;  1H7S A;  3LNU A;  4JI1 E;  4B3S E;  2HFU A;  3JAM Q;  2F4V I;  1Z5C A;  4MYT A;  1ELO A;  3F0N A;  2V2Z A;  2R3V A;  3QT8 A;  4LF7 I;  2GS8 A;  2ZBK B;  1N32 E;  4JI8 E;  4NXN I;  2V8P A;  4JI1 I;  3J80 C;  1KVK A;  5LMU I;  1I94 E;  1KIJ A;  1ZM3 A;  1N0U A;  3T1H E;  3GON A;  1S16 A;  1J5E E;  1S4E A;  2ZIT A;  3HUL A;  4YHH E;  1HNZ I;  1K47 A;  3WU5 A;  1XMO I;  2E5L I;  4NXN E;  4JI8 I;  2DEJ A;  2OI2 A;  1Z5A A;  1NHH A;  1N33 I;  4DPX A;  4DU7 A;  4HAC A;  4JV5 I;  4LF4 E;  4LF5 I;  4LFC E;  4X62 E;  4P7A A;  3ZKD A;  3PYF A;  2UUB I;  1Z0V A;  4JYA E;  1OJ4 A;  4K0K I;  1HNX I;  1EI1 A;  1QZR A;  4DR3 I;  2VQF I;  2HKJ A;  3K1J A;  4B3R E;  2UXB E;  4KHP E;  4USM A;  4X62 I;  5A2Q C;  1H72 C;  3J80 Q;  1UEK A;  4GKJ I;  3PYG A;  5LMN I;  4JI2 E;  5IWA I;  2UUA E;  1RRE A;  4JI3 E;  2BM0 A;  4XTJ A;  4WUC A;  4DR5 I;  4B3M E;  4ED4 A;  2HK2 A;  4DPU A;  1BKN A;  4DV3 E;  4JI3 I;  4URL A;  4DPT A;  1Z5B A;  4JI5 E;  4JI2 I;  3J7A M;  4LF9 E;  2UXD E;  3CWV A;  2EFG A;  1N32 I;  4DV4 I;  2X36 A;  3PYD A;  4DR6 E;  4UT4 A;  5BR8 I;  2VQF E;  2WW4 A;  1IBL I;  4USK A;  1XMO E;  1Z0C A;  1IBK E;  4DV6 E;  4DUZ E;  5L3J A;  2J7K A;  3QT5 A;  2Q2E B;  1XMQ E;  3OTO E;  4DUY E;  2UU9 E;  3JAM C;  4DXL A;  4LFA E;  1HNW E;  2V34 A;  1H74 A;  4LF7 E;  4DV5 E;  4DR4 E;  4B3T I;  2VQE I;  4DR6 I;  5IT9 C;  4JI7 I;  1B62 A;  4DV1 I;  1Z0T A;  4LFA I;  4JYA I;  4DUZ I;  2E1R A;  4DV2 I;  3T1Y E;  4DR7 I;  4FWH A;  4LF5 E;  1IBL E;  4X65 I;  1DAR A;  2V2V A;  4MYU A;  4JI4 E;  2R42 A;  1RR9 A;  1IBM I;  2A2C A;  1H73 A;  4FW9 A;  4KHP I;  1HNZ E;  2AJ4 A;  4LF9 I;  4X64 I;  4KQV A;  2UXC E;  2XEX A;  4DV3 I;  4GKK E;  4RPF A;  4FWD A;  4LF8 E;  4JI6 E;  1KTV A;  4OX9 E;  4NXM E;  5LMN E;  2F4V E;  1HNW I;  1HR0 E;  4JI6 I;  2UXD I;  3B8H A;  4LF8 I;  1U2R A;  2BV3 A;  4DR3 E;  4DV7 I;  4DR2 E;  1FWK A;  4YHH I;  4GKK I;  1KKH A;  1VIS A;  2X7I A;  4YY3 E;  2BM1 A;  1D6T A;  1IBM E;  1H7U A;  2ZM6 I;  4UTG A;  4LF4 I;  1B63 A;  1MX0 A;  5A2Q Q;  3H4L A;  1N33 E;  4EMD A;  4AQY E;  3ZM7 A;  4HAC B;  1J5E I;  1Z0E A;  3T1H I;  4LFB I;  2UUC I;  1N0V C;  4JI7 E;  1XNR I;  1N36 I;  1FJG I;  1ZXM A;  4X66 I;  2HHH E;  3J81 C;  1XNR E;  2V2Q A;  4X65 E;  1HNX E;  4DUY I;  3J81 Q;  3T1Y I;  2HK3 A;  2UUB E;  2LJP A;  4WUB A;  4PU9 A;  4FN5 A;  5LMU E; 
#chains in the Genus database with same CATH topology
 2NN6 F;  4LFC I;  4JI0 I;  1ZM2 A;  1NHJ A;  1ZXN A;  4AQY I;  1WUU A;  4DR1 I;  2PO2 A;  4DV1 E;  3LTO A;  3B78 A;  4PRX A;  5EKW A;  3M6A A;  2GO4 A;  1FJG E;  2VQE E;  4B3T E;  2CVE A;  1R6M A;  5K36 F;  4ZVI A;  3HKM A;  4HXZ A;  2CG9 A;  3ZZU A;  4B3S I;  4DR7 E;  4DPW A;  4Z7C A;  2AE8 A;  1XMQ I;  3OTO I;  3H1C A;  3K17 A;  5LL6 R;  3M85 G;  1FNM A;  4DV0 I;  1UDN A;  4DV2 E;  1XNQ E;  4IZK A;  5GME A;  1A6F A;  3WU6 A;  1ZM9 A;  3WU3 A;  4IZK B;  2IES A;  1FKA E;  1PIE A;  5IWA E;  2CZ9 A;  2HHH I;  4X66 E;  5BR8 E;  3ZZ0 A;  4BA1 A;  1N34 E;  1OYR A;  3V2U C;  4IFD C;  4GKJ E;  5DRP A;  2UUC E;  4DV4 E;  1N34 I;  1Y6Z A;  2O1U A;  2NPF A;  4PRV A;  4LFB E;  1MU5 A;  1FI4 A;  2JEA A;  1IBK I;  4LF6 E;  4DV6 I;  2UXC I;  2BA1 D;  1NZ0 A;  2VF3 A;  5FLX Q;  1Z0G A;  4BA2 B;  4NBQ A;  4WUD A;  1EA6 A;  4FWG A;  3QT7 A;  4JG4 A;  4N3O A;  3ZKB A;  1N36 E;  1OYS A;  4NXM I;  4IFD E;  4U3D A;  3DD6 A;  1PVG A;  1Z0W A;  4JI4 I;  1PKP A;  2GO3 A;  1NHI A;  1Z0B A;  2PNL A;  3J7A G;  4YY3 I;  1FWL A;  1ZM4 A;  4JI5 I;  3UHM A;  4JI0 E;  2C39 A;  4R1F A;  2DEI A;  2HFS A;  4DR5 E;  4B3M I;  2A2D A;  4I3H A;  4LF6 I;  4K0K E;  4DR2 I;  3WU4 A;  2C39 B;  1I94 I;  1XHK A;  3Q1Q A;  4HYM A;  3B4T A;  5DRO A;  1MG7 A;  2UUA I;  3M7N D;  5C0X D;  4JV5 E;  1Z59 A;  4DU8 A;  4OX9 I;  1HR0 I;  2NN6 A;  4P52 A;  4HY1 A;  2ZM6 E;  3PYE A;  3B82 A;  3QT6 A;  2UXB I;  2VES A;  4DPY A;  2HKE A;  5C0X C;  4B3R I;  4DV5 I;  4DR4 I;  2PNM A;  4Z7Y A;  3L7Z B;  2E5L E;  5GMD A;  4DR1 E;  2BA0 G;  4QNJ A;  4M1K A;  2PO0 A;  2C37 A;  4DV7 E;  2UU9 I;  5IT9 Q;  2O1T A;  3V5R A;  5FLX C;  4FW6 A;  1XNQ I;  5DRQ A;  4DV0 E;  4LCF A;  4X64 E;  3ZZT A;  3LPS A;  1YHC A;  1Y4S A;  4IZJ D;  3D4J A;  1H7S A;  3LNU A;  3P3G A;  4JI1 E;  4B3S E;  2HFU A;  3JAM Q;  2BA0 D;  2F4V I;  1Y60 A;  1Z5C A;  4IZJ A;  4MYT A;  1ELO A;  1Y5Y A;  3F0N A;  2V2Z A;  2R3V A;  3QT8 A;  4LF7 I;  4IFD F;  2GS8 A;  5K36 E;  2JT2 A;  2ZBK B;  1N32 E;  2NN6 C;  4JI8 E;  4OO1 B;  4NXN I;  2V8P A;  2NN6 B;  4JI1 I;  2Z5B A;  3J80 C;  2CGE A;  1KVK A;  5LMU I;  4FW7 A;  1I94 E;  1KIJ A;  1ZM3 A;  5JEA E;  1N0U A;  3T1H E;  3GON A;  1S16 A;  1J5E E;  1S4E A;  2ZIT A;  2NN6 D;  3HUL A;  4OO1 F;  4YHH E;  1HNZ I;  5K36 D;  2JE6 A;  1K47 A;  3WU5 A;  1XMO I;  2E5L I;  4NXN E;  4JI8 I;  2DEJ A;  2OI2 A;  1Z5A A;  1YH8 A;  5ELW A;  1NHH A;  3P3E A;  1N33 I;  4DPX A;  1P42 A;  3CDJ A;  4DU7 A;  4HAC A;  4JV5 I;  3P76 A;  3M85 D;  4LF4 E;  5DNL A;  4LF5 I;  4AM3 A;  4LFC E;  4X62 E;  4P7A A;  3PRY A;  3ZKD A;  3HJC A;  3NZK A;  3PYF A;  2UUB I;  1Z0V A;  4JYA E;  1OJ4 A;  4K0K I;  1HNX I;  1EI1 A;  1QZR A;  4DR3 I;  2Z5B B;  3Q6N A;  5C0X A;  2HKJ A;  3K1J A;  2VQF I;  4B3R E;  2UXB E;  4KHP E;  4USM A;  4X62 I;  5A2Q C;  2PO1 B;  1H72 C;  4LPF A;  3J80 Q;  1UEK A;  1E3H A;  4GKJ I;  3PYG A;  5LMN I;  4JI2 E;  5IWA I;  3GCM A;  2UUA E;  4GQU A;  1RRE A;  4JI3 E;  2BM0 A;  4OO1 C;  4XTJ A;  2IOQ A;  2O3Z A;  4WUC A;  4DR5 I;  4MU3 A;  3U1Y A;  4ED4 A;  4B3M E;  2HK2 A;  4DPU A;  1BKN A;  4J3D A;  4DV3 E;  4JI3 I;  4OKG A;  4URL A;  4DPT A;  1Z5B A;  4JI5 E;  4JI2 I;  3J7A M;  4LF9 E;  2UXD E;  1E3P A;  5K36 A;  3CWV A;  2EFG A;  1N32 I;  4DV4 I;  2X36 A;  1USU A;  3PYD A;  5JEA C;  4DR6 E;  4UT4 A;  5BR8 I;  2VQF E;  2WW4 A;  2BA1 G;  1IBL I;  4USK A;  5DRR A;  1XMO E;  2GQ0 A;  4BA1 B;  1Z0C A;  4LCH A;  1UDS A;  1IBK E;  3U1K A;  4DV6 E;  4DUZ E;  2WP8 A;  5L3J A;  2J7K A;  3QT5 A;  2Q2E B;  1XMQ E;  3OTO E;  4DUY E;  2PO2 B;  2UU9 E;  3JAM C;  4DXL A;  4LFA E;  4MU4 A;  5JEA A;  2BR2 A;  1HNW E;  5EL9 A;  1XXE A;  4IFD A;  2V34 A;  5JEA F;  1H74 A;  4LF7 E;  4DV5 E;  4DR4 E;  2IOP A;  4IFD B;  4B3T I;  2C38 B;  2VQE I;  4DR6 I;  5IT9 C;  3GME A;  4JI7 I;  1B62 A;  2C38 A;  4DV1 I;  5C0X E;  2J65 A;  1Z0T A;  4LFA I;  3L7Z A;  4JYA I;  4IS9 A;  4DUZ I;  2O1V A;  2E1R A;  4DV2 I;  3T1Y E;  2C37 B;  4DR7 I;  2JEB B;  4FWH A;  1VI7 A;  4LF5 E;  1IBL E;  4X65 I;  1DAR A;  2V2V A;  3Q6M A;  2WP8 B;  1R6L A;  4MYU A;  4JI4 E;  2R42 A;  1RR9 A;  4IZJ B;  4LCG A;  4FW5 A;  5JEA B;  1IBM I;  2BR2 B;  2A2C A;  1H73 A;  2JEA B;  3M7N G;  4FW9 A;  4KHP I;  1HNZ E;  2AJ4 A;  4LF9 I;  3PS1 A;  4BA2 A;  4X64 I;  3P3C A;  4KQV A;  2UXC E;  2XEX A;  4DV3 I;  4GKK E;  4QNK A;  4RPF A;  2Z5E A;  4FWD A;  4IFD D;  4LF8 E;  5JEA D;  4OZE A;  3K85 A;  4JI6 E;  2JE6 B;  1KTV A;  2WNR B;  2JEB A;  4OX9 E;  2Z5C B;  4NXM E;  5LMN E;  2PO0 B;  2WNR A;  2F4V E;  2PNZ A;  1HNW I;  2Z5C A;  4FW3 A;  1HR0 E;  4JI6 I;  3P06 A;  4OO1 E;  3PS2 A;  2UXD I;  3B8H A;  4LF8 I;  5FWK A;  1U2R A;  2BV3 A;  4DR3 E;  1RHY A;  4DV7 I;  4DR2 E;  1FWK A;  4YHH I;  1Y4U A;  4GKK I;  1KKH A;  4MU0 A;  1VIS A;  1UDQ A;  2X7I A;  4YY3 E;  4MQY A;  4OO1 D;  3KRN A;  2BM1 A;  5C0X B;  4OO1 A;  1D6T A;  1IBM E;  1H7U A;  2F1D A;  2ZM6 I;  4ISA A;  4UTG A;  5C0X F;  4LF4 I;  1B63 A;  1MX0 A;  3PS3 A;  5A2Q Q;  3H4L A;  1N33 E;  4EMD A;  2O1W A;  4AQY E;  3ZM7 A;  4LOM A;  2PNZ B;  4HAC B;  1OYP A;  2IER A;  1J5E I;  1Z0E A;  3T1H I;  4LFB I;  3GLL A;  2UUC I;  1N0V C;  4U3B A;  4JI7 E;  1XNR I;  5DNX A;  1N36 I;  1FJG I;  1ZXM A;  5K36 B;  4X66 I;  2HHH E;  5K36 C;  3J81 C;  4AIM A;  2NN6 E;  1XNR E;  2V2Q A;  1UDO A;  4X65 E;  3CDI A;  4FW4 A;  2PO1 A;  1HNX E;  4DUY I;  4AID A;  1HK7 A;  3J81 Q;  3T1Y I;  2HK3 A;  1USV A;  2UUB E;  2LJP A;  4WUB A;  4PU9 A;  4FN5 A;  4MU1 A;  4MDT A;  5LMU E; 
#chains in the Genus database with same CATH homology
 4LFC I;  4JI0 I;  1ZM2 A;  1NHJ A;  1ZXN A;  4AQY I;  1WUU A;  4DR1 I;  4DV1 E;  3LTO A;  3B78 A;  4PRX A;  3M6A A;  1FJG E;  2VQE E;  4B3T E;  4ZVI A;  4HXZ A;  2CG9 A;  3ZZU A;  4B3S I;  4DR7 E;  4DPW A;  4Z7C A;  1XMQ I;  3OTO I;  3K17 A;  5LL6 R;  1FNM A;  4DV0 I;  1XNQ E;  4DV2 E;  4IZK A;  5GME A;  1A6F A;  3WU6 A;  1ZM9 A;  3WU3 A;  4IZK B;  1FKA E;  1PIE A;  5IWA E;  2CZ9 A;  2HHH I;  4X66 E;  5BR8 E;  3ZZ0 A;  1N34 E;  3V2U C;  4GKJ E;  2UUC E;  4DV4 E;  1N34 I;  1Y6Z A;  2O1U A;  2NPF A;  4PRV A;  4LFB E;  1MU5 A;  1FI4 A;  1IBK I;  4LF6 E;  4DV6 I;  2UXC I;  1NZ0 A;  2VF3 A;  5FLX Q;  1Z0G A;  4WUD A;  1EA6 A;  4FWG A;  3QT7 A;  4JG4 A;  4N3O A;  3ZKB A;  1N36 E;  4NXM I;  1PVG A;  1Z0W A;  4JI4 I;  1PKP A;  1NHI A;  1Z0B A;  2PNL A;  3J7A G;  4YY3 I;  1FWL A;  1ZM4 A;  4JI5 I;  4JI0 E;  4R1F A;  2DEI A;  2HFS A;  4B3M I;  4DR5 E;  2A2D A;  4I3H A;  4LF6 I;  4K0K E;  4DR2 I;  3WU4 A;  1I94 I;  1XHK A;  3Q1Q A;  4HYM A;  1MG7 A;  2UUA I;  4JV5 E;  1Z59 A;  4DU8 A;  4OX9 I;  1HR0 I;  4P52 A;  4HY1 A;  2ZM6 E;  3PYE A;  3B82 A;  3QT6 A;  2UXB I;  4DPY A;  2HKE A;  4B3R I;  4DV5 I;  4DR4 I;  2PNM A;  4Z7Y A;  2E5L E;  5GMD A;  4DR1 E;  4M1K A;  4DV7 E;  2UU9 I;  5IT9 Q;  2O1T A;  3V5R A;  5FLX C;  1XNQ I;  4DV0 E;  4X64 E;  3ZZT A;  3LPS A;  1Y4S A;  4IZJ D;  3D4J A;  1H7S A;  3LNU A;  4JI1 E;  4B3S E;  2HFU A;  3JAM Q;  2F4V I;  1Z5C A;  4IZJ A;  4MYT A;  1ELO A;  3F0N A;  2V2Z A;  2R3V A;  3QT8 A;  4LF7 I;  2GS8 A;  2ZBK B;  1N32 E;  4JI8 E;  4NXN I;  2V8P A;  4JI1 I;  2Z5B A;  3J80 C;  2CGE A;  1KVK A;  5LMU I;  1I94 E;  1KIJ A;  1ZM3 A;  1N0U A;  3T1H E;  3GON A;  1S16 A;  1J5E E;  1S4E A;  2ZIT A;  3HUL A;  4YHH E;  1HNZ I;  1K47 A;  3WU5 A;  1XMO I;  2E5L I;  4NXN E;  4JI8 I;  2DEJ A;  2OI2 A;  1Z5A A;  1NHH A;  1N33 I;  4DPX A;  4DU7 A;  4HAC A;  4JV5 I;  4LF4 E;  4LF5 I;  4LFC E;  4X62 E;  4P7A A;  3PRY A;  3ZKD A;  3HJC A;  3PYF A;  2UUB I;  1Z0V A;  4JYA E;  1OJ4 A;  4K0K I;  1HNX I;  1EI1 A;  1QZR A;  4DR3 I;  2Z5B B;  3Q6N A;  2VQF I;  2HKJ A;  3K1J A;  4B3R E;  2UXB E;  4KHP E;  4USM A;  4X62 I;  5A2Q C;  1H72 C;  3J80 Q;  1UEK A;  4GKJ I;  3PYG A;  5LMN I;  4JI2 E;  5IWA I;  2UUA E;  1RRE A;  4JI3 E;  2BM0 A;  4XTJ A;  2IOQ A;  4WUC A;  4DR5 I;  4B3M E;  4ED4 A;  2HK2 A;  4DPU A;  1BKN A;  4DV3 E;  4JI3 I;  4URL A;  4DPT A;  1Z5B A;  4JI5 E;  4JI2 I;  3J7A M;  4LF9 E;  2UXD E;  3CWV A;  2EFG A;  1N32 I;  4DV4 I;  2X36 A;  1USU A;  3PYD A;  4DR6 E;  4UT4 A;  5BR8 I;  2VQF E;  2WW4 A;  1IBL I;  4USK A;  1XMO E;  2GQ0 A;  1Z0C A;  1IBK E;  4DV6 E;  4DUZ E;  5L3J A;  2J7K A;  3QT5 A;  2Q2E B;  1XMQ E;  3OTO E;  4DUY E;  2UU9 E;  3JAM C;  4DXL A;  4LFA E;  1HNW E;  2V34 A;  1H74 A;  4LF7 E;  4DV5 E;  4DR4 E;  2IOP A;  4B3T I;  2VQE I;  4DR6 I;  5IT9 C;  4JI7 I;  1B62 A;  4DV1 I;  1Z0T A;  4LFA I;  4JYA I;  4DUZ I;  2O1V A;  2E1R A;  4DV2 I;  3T1Y E;  4DR7 I;  4FWH A;  4LF5 E;  1IBL E;  4X65 I;  1DAR A;  2V2V A;  3Q6M A;  4MYU A;  4JI4 E;  2R42 A;  1RR9 A;  4IZJ B;  1IBM I;  2A2C A;  1H73 A;  4FW9 A;  4KHP I;  1HNZ E;  2AJ4 A;  4LF9 I;  4X64 I;  4KQV A;  2UXC E;  2XEX A;  4DV3 I;  4GKK E;  4RPF A;  2Z5E A;  4FWD A;  4LF8 E;  3K85 A;  4JI6 E;  1KTV A;  4OX9 E;  2Z5C B;  4NXM E;  5LMN E;  2F4V E;  1HNW I;  2Z5C A;  1HR0 E;  4JI6 I;  3P06 A;  2UXD I;  3B8H A;  4LF8 I;  5FWK A;  1U2R A;  2BV3 A;  4DR3 E;  4DV7 I;  4DR2 E;  1FWK A;  4YHH I;  1Y4U A;  4GKK I;  1KKH A;  1VIS A;  2X7I A;  4YY3 E;  2BM1 A;  1D6T A;  1IBM E;  1H7U A;  2ZM6 I;  4UTG A;  4LF4 I;  1B63 A;  1MX0 A;  5A2Q Q;  3H4L A;  1N33 E;  4EMD A;  2O1W A;  4AQY E;  3ZM7 A;  4HAC B;  1J5E I;  1Z0E A;  3T1H I;  4LFB I;  2UUC I;  1N0V C;  4JI7 E;  1XNR I;  1N36 I;  1FJG I;  1ZXM A;  4X66 I;  2HHH E;  3J81 C;  1XNR E;  2V2Q A;  4X65 E;  1HNX E;  4DUY I;  1HK7 A;  3J81 Q;  3T1Y I;  2HK3 A;  1USV A;  2UUB E;  2LJP A;  4WUB A;  4PU9 A;  4FN5 A;  5LMU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...