4LFCI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfcI00
1MG7A 3J7AM 4P52A 4DPWA 1FJGE 1XHKA 1WUUA 1H7SA 4LFCE 4FN5A 1ZXNA 5GMDA 2NPFA 4PRXA 1DARA 5LMNI 4NXNI 3WU3A 3CWVA 3PYEA 4K0KI 2HK2A 5IT9C 1Z5BA 3QT8A 5LMNE 4XTJA 3WU4A 4I3HA 2VF3A 3J81C 4GKJI 1H7UA 2UUCI 1KKHA 3HULA 1FKAE 1UEKA 3B82A 3QT5A 4FWDA 1S4EA 3PYGA 4USKA 1Z5CA 1H74A 2VQEE 4Z7CA 1FWKA 1B62A 2A2DA 1Z0TA 3JAMQ 1XMQE 1IBMI 1ZM9A 2X36A 4JYAE 1I94I 1HR0I 4NXMI 4UT4A 4MYTA 1XNRI 1I94E 3QT6A 2DEJA 4NXME 1RREA 1N32E 4RPFA 4JV5I 4AQYE 1Z0CA 2UU9I 3V2UC 4DU7A 4JI0I 5FLXQ 4Z7YA 4DPTA 3K1JA 1N0UA 4DV6E 1HNXI 5IWAE 3GONA 4PRVA 4DR2I 1D6TA 1Z0WA 1HNXE 3B78A 2OI2A 4DR2E 2A2CA 4DV0I 4JI6I 4DV5I 4P7AA 4ED4A 3D4JA 1PKPA 4DUYE 4X64I 2BM0A 1VISA 4LF5I 1OJ4A 4DV0E 4WUCA 4JI6E 3F0NA 1PVGA 4JI4I 4X64E 1XMOI 2EFGA 4DV1E 2Q2EB 1PIEA 4LF5E 2R3VA 1MU5A 2HFSA 2V2ZA 1N33I 1B63A 1J5EE 1N0VC 3Q1QA 1XNQI 2AJ4A 3OTOE 5LL6R 3QT7A 4FW9A 1ZXMA 4JI7I 3M6AA 2WW4A 2UUAI 3WU5A 4DXLA 4X62I 4JI7E 3ZKDA 4X66I 2ZM6I 2UUAE 3JAMC 3H4LA 2VQFI 4DR3I 4GKKI 4JG4A 4LF7I 4NXNE 4KQVA 4DR4I 4LF4I 4K0KE 2CZ9A 4R1FA 5LMUI 4DUZI 2VQFE 4DR3E 4DR1I 2UXCI 4DR7I 4HY1A 1Z5AA 4DUZE 1FNMA 4DR7E 1EA6A 1N36I 4GKJE 1HNZI 2UUCE 2E1RA 4DV2I 3J80Q 3LTOA 4JI3I 5FLXC 4B3MI 3K17A 1IBKI 4B3TI 1IBKE 4DR6I 4HACA 4DR5I 1IBME 4FWHA 1HR0E 4LF8I 4FWGA 2V2VA 2HK3A 2UXBI 1XNRE 1FWLA 3V5RA 3ZZUA 2HKEA 4JV5E 5BR8I 4JI2I 1N34I 2UU9E 5GMEA 3J81Q 4JI0E 4LF6I 4X65I 4OX9I 1N34E 4WUBA 1FI4A 4JI5I 4DV3I 4LF6E 1KTVA 1Z0VA 1EI1A 2F4VI 2E5LI 4B3RI 1NHHA 1NHJA 4JI5E 4HYMA 4B3RE 2UXDI 2UUBI 2DEIA 4DV5E 2BM1A 4LFBI 5L3JA 2V34A 2UUBE 4KHPI 4HACB 4JI4E 1XMOE 4YY3I 1N33E 1NHIA 4USMA 4LFAI 2R42A 1XNQE 4JI1I 1KVKA 1ELOA 4YY3E 1IBLI 4LFAE 4JI1E 4DPXA 1FJGI 1IBLE 3J7AG 5A2QQ 3T1YI 1ZM2A 3LPSA 4LFCI 4X62E 2ZBKB 2GS8A 3PYDA 4X66E 2ZM6E 3T1YE 4GKKE 4LF7E 4DR4E 4LF4E 3ZZTA 4WUDA 5LMUE 4DR1E 2UXCE 1ZM3A 1ZM4A 1U2RA 1S16A 1N36E 1HNZE 4DV2E 4JI3E 2V8PA 4B3ME 1K47A 3PYFA 4URLA 4B3SI 1H73A 2HKJA 2VQEI 4DV4I 4DPYA 4ZVIA 4JI8I 4B3SE 1KIJA 4B3TE 1XMQI 4DR6E 1Z59A 4DV4E 4JYAI 4DR5E 4JI8E 1Z0GA 4LF8E 2HHHI 3ZKBA 5IT9Q 4LF9I 3B8HA 1BKNA 2UXBE 1A6FA 2HFUA 2HHHE 4M1KA 4LF9E 1HNWI 4DU8A 1N32I 1H72C 4AQYI 5BR8E 4JI2E 2ZITA 3ZM7A 1HNWE 4UTGA 1RR9A 4X65E 4OX9E 2LJPA 1MX0A 4DV7I 3ZZ0A 4DV3E 4DV6I 5IWAI 1QZRA 2XEXA 4PU9A 1Z0BA 4DV7E 2E5LE 2F4VE 4DPUA 2X7IA 2J7KA 1NZ0A 5A2QC 4EMDA 2UXDE 4HXZA 4DUYI 4LFBE 3WU6A 1Z0EA 2V2QA 3LNUA 4KHPE 4DV1I 3T1HI 4YHHI 2BV3A 3J80C 1J5EI 4MYUA 3T1HE 4YHHE 3OTOI
chains in the Genus database with same CATH superfamily
2PO2B 2NN6E 1MG7A 4BA2B 3J7AM 2VESA 4P52A 4DPWA 1FJGE 1XHKA 1WUUA 2JEBA 2BA0G 5DRRA 1H7SA 4LFCE 4IFDB 4FN5A 4OKGA 1ZXNA 5GMDA 2NPFA 4PRXA 1DARA 5LMNI 4IZKA 4NXNI 3WU3A 3CWVA 3PYEA 4K0KI 2NN6F 2HK2A 5IT9C 1Z5BA 3QT8A 5LMNE 5C0XB 4XTJA 2BA1D 3WU4A 4I3HA 2VF3A 1P42A 3J81C 4GKJI 4AIMA 1H7UA 2UUCI 5JEAF 2C38B 1KKHA 4FW7A 3HULA 1FKAE 1UEKA 3B82A 3QT5A 4FWDA 1S4EA 3PYGA 4USKA 1Z5CA 4IZJB 1H74A 2VQEE 4Z7CA 1FWKA 1B62A 2C39B 2A2DA 1Z0TA 3JAMQ 3M7ND 1XMQE 4AIDA 1IBMI 1ZM9A 5EKWA 2X36A 4JYAE 1I94I 2O3ZA 1HR0I 4MQYA 2C37B 1R6LA 4NXMI 1OYRA 2NN6A 4UT4A 4MYTA 1XNRI 1I94E 3QT6A 2DEJA 4NXME 2JEBB 1RREA 5DROA 1N32E 4RPFA 4JV5I 4AQYE 1Z0CA 2UU9I 4U3DA 5JEAA 2CGEA 4IZKB 3V2UC 4DU7A 4JI0I 5JEAC 5FLXQ 4AM3A 3PS3A 4Z7YA 4DPTA 4OO1E 3K1JA 1N0UA 2IOQA 2PNLA 2J65A 4DV6E 1HNXI 5K36E 5IWAE 3GONA 1Y4SA 4PRVA 4DR2I 1D6TA 1Z0WA 2WNRA 1HNXE 1OYPA 2IESA 3B78A 1E3HA 2WP8A 2PNZB 4IFDD 2OI2A 2BA1G 4DR2E 2A2CA 4DV0I 4JI6I 4DV5I 3Q6NA 4P7AA 4ED4A 3D4JA 1PKPA 2BR2B 4DUYE 4X64I 2AE8A 1UDSA 1Y60A 1VISA 2BM0A 2JEAB 4LF5I 1OJ4A 4DV0E 4WUCA 4JI6E 3F0NA 4FW6A 2PO1A 1PVGA 4JI4I 4X64E 1XMOI 2EFGA 4DV1E 2Q2EB 1PIEA 4LF5E 2R3VA 1MU5A 2HFSA 2V2ZA 1N33I 1Y6ZA 1B63A 1J5EE 1E3PA 1N0VC 3Q1QA 3GLLA 1XNQI 2AJ4A 3M7NG 3OTOE 5LL6R 3QT7A 4FW9A 1ZXMA 3P76A 4JI7I 1XXEA 3M6AA 2CG9A 2WW4A 3H1CA 2JT2A 4FW4A 2UUAI 3WU5A 4DXLA 4X62I 4JI7E 3ZKDA 4X66I 2ZM6I 2UUAE 3JAMC 3H4LA 2VQFI 4DR3I 4GKKI 4JG4A 4LF7I 4NXNE 4KQVA 4DR4I 4LF4I 4K0KE 2CZ9A 4R1FA 5LMUI 4DUZI 2VQFE 4DR3E 4DR1I 2UXCI 4GQUA 4DR7I 4OO1D 4HY1A 4IFDE 5K36D 4IS9A 2WNRB 3P3GA 1Z5AA 4LPFA 4DUZE 3NZKA 1FNMA 3PS1A 4DR7E 1EA6A 1N36I 5DNXA 4GKJE 1HNZI 2UUCE 2E1RA 4DV2I 3Q6MA 2PNMA 3J80Q 2F1DA 3LTOA 4FW3A 4JI3I 5C0XE 5FLXC 2PO0A 4ISAA 4B3MI 3L7ZB 3K17A 2PO1B 1IBKI 4IFDF 2JE6A 5FWKA 4B3TI 1IBKE 4DR6I 4HACA 4DR5I 1IBME 4FWHA 2NN6C 1HR0E 4LF8I 4FWGA 2V2VA 3K85A 2HK3A 2UXBI 1XNRE 1FWLA 3V5RA 2IOPA 3ZZUA 2HKEA 4BA1A 2Z5EA 4JV5E 5BR8I 4JI2I 1N34I 2PO2A 2UU9E 4BA2A 5GMEA 3J81Q 4JI0E 4LF6I 4X65I 3P3CA 4OX9I 1N34E 1OYSA 4WUBA 3U1YA 1FI4A 4N3OA 4JI5I 4DV3I 4IFDA 4LF6E 1KTVA 1Z0VA 4IFDC 1R6MA 1EI1A 2F4VI 2E5LI 4B3RI 1NHHA 1NHJA 4JI5E 4FW5A 3DD6A 4OO1F 4HYMA 4B3RE 2UXDI 3CDIA 2PO0B 5K36F 1USUA 2UUBI 2Z5BA 2DEIA 4DV5E 5C0XD 2BM1A 4LFBI 4MU4A 5L3JA 2V34A 2UUBE 4KHPI 5DRQA 2NN6B 4HACB 3KRNA 4JI4E 1XMOE 4YY3I 1N33E 1NHIA 4USMA 5EL9A 4LFAI 2R42A 3P3EA 1XNQE 1YH8A 4JI1I 3UHMA 1KVKA 1ELOA 4YY3E 1IBLI 4IZJD 5JEAB 1UDQA 4J3DA 3M85D 4LFAE 4MDTA 3B4TA 4JI1E 4DPXA 1FJGI 2C37A 1IBLE 3J7AG 4LCGA 5A2QQ 3T1YI 1ZM2A 3LPSA 4QNKA 3CDJA 4LFCI 4X62E 2ZBKB 2GS8A 2CVEA 4OO1A 5K36A 3PYDA 4X66E 2ZM6E 4OO1C 3T1YE 1HK7A 3GMEA 4GKKE 5K36C 4LF7E 4DR4E 4LF4E 3ZZTA 3U1KA 5ELWA 5JEAE 4WUDA 5LMUE 4DR1E 2WP8B 2UXCE 4NBQA 1ZM3A 4OZEA 1ZM4A 1U2RA 5DNLA 1S16A 1Y4UA 1N36E 2Z5BB 1HNZE 1YHCA 4DV2E 4JI3E 2V8PA 4B3ME 1K47A 3PYFA 4LOMA 4URLA 4B3SI 1H73A 2HKJA 2PNZA 2VQEI 5DRPA 4DV4I 4DPYA 3P06A 4ZVIA 2GO3A 4JI8I 1UDNA 1VI7A 4B3SE 1KIJA 5C0XF 4B3TE 2BR2A 1XMQI 4DR6E 1Z59A 1UDOA 2IERA 4DV4E 2JEAA 4JYAI 4DR5E 4JI8E 1Z0GA 4LF8E 2HHHI 3ZKBA 5IT9Q 4LF9I 2Z5CA 3B8HA 2BA0D 1BKNA 2UXBE 1A6FA 2HFUA 2HHHE 4M1KA 4LF9E 1RHYA 1HNWI 4DU8A 4OO1B 1N32I 1H72C 4AQYI 5K36B 2NN6D 5BR8E 4JI2E 2ZITA 3ZM7A 4LCHA 1HNWE 3M85G 4UTGA 1RR9A 3HJCA 4LCFA 4X65E 4OX9E 2LJPA 1MX0A 4DV7I 3ZZ0A 4DV3E 4DV6I 4MU0A 5IWAI 5JEAD 1QZRA 2XEXA 4PU9A 1Z0BA 4DV7E 2GQ0A 4MU1A 4DPUA 2X7IA 2J7KA 5C0XA 2E5LE 2F4VE 1NZ0A 3HKMA 5C0XC 5A2QC 4U3BA 3GCMA 4EMDA 2JE6B 2UXDE 4QNJA 4HXZA 2O1VA 2C38A 2O1WA 1USVA 4DUYI 3PS2A 3PRYA 4LFBE 2O1UA 3WU6A 1Z0EA 2GO4A 2V2QA 3LNUA 4KHPE 4DV1I 4IZJA 4MU3A 3T1HI 4YHHI 3L7ZA 2O1TA 2BV3A 2C39A 2Z5CB 3J80C 1J5EI 4MYUA 4BA1B 1Y5YA 3T1HE 4YHHE 3OTOI
chains in the Genus database with same CATH topology
1MG7A 3J7AM 4P52A 4DPWA 1FJGE 1XHKA 1WUUA 1H7SA 4LFCE 4FN5A 1ZXNA 5GMDA 2NPFA 4PRXA 1DARA 5LMNI 4IZKA 4NXNI 3WU3A 3CWVA 3PYEA 4K0KI 2HK2A 5IT9C 1Z5BA 3QT8A 5LMNE 4XTJA 3WU4A 4I3HA 2VF3A 3J81C 4GKJI 1H7UA 2UUCI 1KKHA 3HULA 1FKAE 1UEKA 3B82A 3QT5A 4FWDA 1S4EA 3PYGA 4USKA 1Z5CA 4IZJB 1H74A 2VQEE 4Z7CA 1FWKA 1B62A 2A2DA 1Z0TA 3JAMQ 1XMQE 1IBMI 1ZM9A 2X36A 4JYAE 1I94I 1HR0I 4NXMI 4UT4A 4MYTA 1XNRI 1I94E 3QT6A 2DEJA 4NXME 1RREA 1N32E 4RPFA 4JV5I 4AQYE 1Z0CA 2UU9I 2CGEA 4IZKB 3V2UC 4DU7A 4JI0I 5FLXQ 4Z7YA 4DPTA 3K1JA 1N0UA 2IOQA 2PNLA 4DV6E 1HNXI 5IWAE 3GONA 1Y4SA 4PRVA 4DR2I 1D6TA 1Z0WA 1HNXE 3B78A 2OI2A 4DR2E 2A2CA 4DV0I 4JI6I 4DV5I 3Q6NA 4P7AA 4ED4A 3D4JA 1PKPA 4DUYE 4X64I 2BM0A 1VISA 4LF5I 1OJ4A 4DV0E 4WUCA 4JI6E 3F0NA 1PVGA 4JI4I 4X64E 1XMOI 2EFGA 4DV1E 2Q2EB 1PIEA 4LF5E 2R3VA 1MU5A 2HFSA 2V2ZA 1N33I 1Y6ZA 1B63A 1J5EE 1N0VC 3Q1QA 1XNQI 2AJ4A 3OTOE 5LL6R 3QT7A 4FW9A 1ZXMA 4JI7I 3M6AA 2CG9A 2WW4A 2UUAI 3WU5A 4DXLA 4X62I 4JI7E 3ZKDA 4X66I 2ZM6I 2UUAE 3JAMC 3H4LA 2VQFI 4DR3I 4GKKI 4JG4A 4LF7I 4NXNE 4KQVA 4DR4I 4LF4I 4K0KE 2CZ9A 4R1FA 5LMUI 4DUZI 2VQFE 4DR3E 4DR1I 2UXCI 4DR7I 4HY1A 1Z5AA 4DUZE 1FNMA 4DR7E 1EA6A 1N36I 4GKJE 1HNZI 2UUCE 2E1RA 4DV2I 3Q6MA 2PNMA 3J80Q 3LTOA 4JI3I 5FLXC 4B3MI 3K17A 1IBKI 5FWKA 4B3TI 1IBKE 4DR6I 4HACA 4DR5I 1IBME 4FWHA 1HR0E 4LF8I 4FWGA 2V2VA 3K85A 2HK3A 2UXBI 1XNRE 1FWLA 3V5RA 2IOPA 3ZZUA 2HKEA 2Z5EA 4JV5E 5BR8I 4JI2I 1N34I 2UU9E 5GMEA 3J81Q 4JI0E 4LF6I 4X65I 4OX9I 1N34E 4WUBA 1FI4A 4N3OA 4JI5I 4DV3I 4LF6E 1KTVA 1Z0VA 1EI1A 2F4VI 2E5LI 4B3RI 1NHHA 1NHJA 4JI5E 4HYMA 4B3RE 2UXDI 1USUA 2UUBI 2Z5BA 2DEIA 4DV5E 2BM1A 4LFBI 5L3JA 2V34A 2UUBE 4KHPI 4HACB 4JI4E 1XMOE 4YY3I 1N33E 1NHIA 4USMA 4LFAI 2R42A 1XNQE 4JI1I 1KVKA 1ELOA 4YY3E 1IBLI 4IZJD 4LFAE 4JI1E 4DPXA 1FJGI 1IBLE 3J7AG 5A2QQ 3T1YI 1ZM2A 3LPSA 4LFCI 4X62E 2ZBKB 2GS8A 3PYDA 4X66E 2ZM6E 3T1YE 1HK7A 4GKKE 4LF7E 4DR4E 4LF4E 3ZZTA 4WUDA 5LMUE 4DR1E 2UXCE 1ZM3A 1ZM4A 1U2RA 1S16A 1Y4UA 1N36E 2Z5BB 1HNZE 4DV2E 4JI3E 2V8PA 4B3ME 1K47A 3PYFA 4URLA 4B3SI 1H73A 2HKJA 2VQEI 4DV4I 4DPYA 3P06A 4ZVIA 4JI8I 4B3SE 1KIJA 4B3TE 1XMQI 4DR6E 1Z59A 4DV4E 4JYAI 4DR5E 4JI8E 1Z0GA 4LF8E 2HHHI 3ZKBA 5IT9Q 4LF9I 2Z5CA 3B8HA 1BKNA 2UXBE 1A6FA 2HFUA 2HHHE 4M1KA 4LF9E 1HNWI 4DU8A 1N32I 1H72C 4AQYI 5BR8E 4JI2E 2ZITA 3ZM7A 1HNWE 4UTGA 1RR9A 3HJCA 4X65E 4OX9E 2LJPA 1MX0A 4DV7I 3ZZ0A 4DV3E 4DV6I 5IWAI 1QZRA 2XEXA 4PU9A 1Z0BA 4DV7E 2GQ0A 2E5LE 4DPUA 2X7IA 2J7KA 2F4VE 1NZ0A 5A2QC 4EMDA 2UXDE 4HXZA 2O1VA 2O1WA 1USVA 4DUYI 3PRYA 4LFBE 2O1UA 3WU6A 1Z0EA 2V2QA 3LNUA 4KHPE 4DV1I 4IZJA 3T1HI 4YHHI 2O1TA 2BV3A 2Z5CB 3J80C 1J5EI 4MYUA 3T1HE 4YHHE 3OTOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG7 A;  3J7A M;  4P52 A;  4DPW A;  1FJG E;  1XHK A;  1WUU A;  1H7S A;  4LFC E;  4FN5 A;  1ZXN A;  5GMD A;  2NPF A;  4PRX A;  1DAR A;  5LMN I;  4NXN I;  3WU3 A;  3CWV A;  3PYE A;  4K0K I;  2HK2 A;  5IT9 C;  1Z5B A;  3QT8 A;  5LMN E;  4XTJ A;  3WU4 A;  4I3H A;  2VF3 A;  3J81 C;  4GKJ I;  1H7U A;  2UUC I;  1KKH A;  3HUL A;  1FKA E;  1UEK A;  3B82 A;  3QT5 A;  4FWD A;  1S4E A;  3PYG A;  4USK A;  1Z5C A;  1H74 A;  2VQE E;  4Z7C A;  1FWK A;  1B62 A;  2A2D A;  1Z0T A;  3JAM Q;  1XMQ E;  1IBM I;  1ZM9 A;  2X36 A;  4JYA E;  1I94 I;  1HR0 I;  4NXM I;  4UT4 A;  4MYT A;  1XNR I;  1I94 E;  3QT6 A;  2DEJ A;  4NXM E;  1RRE A;  1N32 E;  4RPF A;  4JV5 I;  4AQY E;  1Z0C A;  2UU9 I;  3V2U C;  4DU7 A;  4JI0 I;  5FLX Q;  4Z7Y A;  4DPT A;  3K1J A;  1N0U A;  4DV6 E;  1HNX I;  5IWA E;  3GON A;  4PRV A;  4DR2 I;  1D6T A;  1Z0W A;  1HNX E;  3B78 A;  2OI2 A;  4DR2 E;  2A2C A;  4DV0 I;  4JI6 I;  4DV5 I;  4P7A A;  4ED4 A;  3D4J A;  1PKP A;  4DUY E;  4X64 I;  2BM0 A;  1VIS A;  4LF5 I;  1OJ4 A;  4DV0 E;  4WUC A;  4JI6 E;  3F0N A;  1PVG A;  4JI4 I;  4X64 E;  1XMO I;  2EFG A;  4DV1 E;  2Q2E B;  1PIE A;  4LF5 E;  2R3V A;  1MU5 A;  2HFS A;  2V2Z A;  1N33 I;  1B63 A;  1J5E E;  1N0V C;  3Q1Q A;  1XNQ I;  2AJ4 A;  3OTO E;  5LL6 R;  3QT7 A;  4FW9 A;  1ZXM A;  4JI7 I;  3M6A A;  2WW4 A;  2UUA I;  3WU5 A;  4DXL A;  4X62 I;  4JI7 E;  3ZKD A;  4X66 I;  2ZM6 I;  2UUA E;  3JAM C;  3H4L A;  2VQF I;  4DR3 I;  4GKK I;  4JG4 A;  4LF7 I;  4NXN E;  4KQV A;  4DR4 I;  4LF4 I;  4K0K E;  2CZ9 A;  4R1F A;  5LMU I;  4DUZ I;  2VQF E;  4DR3 E;  4DR1 I;  2UXC I;  4DR7 I;  4HY1 A;  1Z5A A;  4DUZ E;  1FNM A;  4DR7 E;  1EA6 A;  1N36 I;  4GKJ E;  1HNZ I;  2UUC E;  2E1R A;  4DV2 I;  3J80 Q;  3LTO A;  4JI3 I;  5FLX C;  4B3M I;  3K17 A;  1IBK I;  4B3T I;  1IBK E;  4DR6 I;  4HAC A;  4DR5 I;  1IBM E;  4FWH A;  1HR0 E;  4LF8 I;  4FWG A;  2V2V A;  2HK3 A;  2UXB I;  1XNR E;  1FWL A;  3V5R A;  3ZZU A;  2HKE A;  4JV5 E;  5BR8 I;  4JI2 I;  1N34 I;  2UU9 E;  5GME A;  3J81 Q;  4JI0 E;  4LF6 I;  4X65 I;  4OX9 I;  1N34 E;  4WUB A;  1FI4 A;  4JI5 I;  4DV3 I;  4LF6 E;  1KTV A;  1Z0V A;  1EI1 A;  2F4V I;  2E5L I;  4B3R I;  1NHH A;  1NHJ A;  4JI5 E;  4HYM A;  4B3R E;  2UXD I;  2UUB I;  2DEI A;  4DV5 E;  2BM1 A;  4LFB I;  5L3J A;  2V34 A;  2UUB E;  4KHP I;  4HAC B;  4JI4 E;  1XMO E;  4YY3 I;  1N33 E;  1NHI A;  4USM A;  4LFA I;  2R42 A;  1XNQ E;  4JI1 I;  1KVK A;  1ELO A;  4YY3 E;  1IBL I;  4LFA E;  4JI1 E;  4DPX A;  1FJG I;  1IBL E;  3J7A G;  5A2Q Q;  3T1Y I;  1ZM2 A;  3LPS A;  4LFC I;  4X62 E;  2ZBK B;  2GS8 A;  3PYD A;  4X66 E;  2ZM6 E;  3T1Y E;  4GKK E;  4LF7 E;  4DR4 E;  4LF4 E;  3ZZT A;  4WUD A;  5LMU E;  4DR1 E;  2UXC E;  1ZM3 A;  1ZM4 A;  1U2R A;  1S16 A;  1N36 E;  1HNZ E;  4DV2 E;  4JI3 E;  2V8P A;  4B3M E;  1K47 A;  3PYF A;  4URL A;  4B3S I;  1H73 A;  2HKJ A;  2VQE I;  4DV4 I;  4DPY A;  4ZVI A;  4JI8 I;  4B3S E;  1KIJ A;  4B3T E;  1XMQ I;  4DR6 E;  1Z59 A;  4DV4 E;  4JYA I;  4DR5 E;  4JI8 E;  1Z0G A;  4LF8 E;  2HHH I;  3ZKB A;  5IT9 Q;  4LF9 I;  3B8H A;  1BKN A;  2UXB E;  1A6F A;  2HFU A;  2HHH E;  4M1K A;  4LF9 E;  1HNW I;  4DU8 A;  1N32 I;  1H72 C;  4AQY I;  5BR8 E;  4JI2 E;  2ZIT A;  3ZM7 A;  1HNW E;  4UTG A;  1RR9 A;  4X65 E;  4OX9 E;  2LJP A;  1MX0 A;  4DV7 I;  3ZZ0 A;  4DV3 E;  4DV6 I;  5IWA I;  1QZR A;  2XEX A;  4PU9 A;  1Z0B A;  4DV7 E;  2E5L E;  2F4V E;  4DPU A;  2X7I A;  2J7K A;  1NZ0 A;  5A2Q C;  4EMD A;  2UXD E;  4HXZ A;  4DUY I;  4LFB E;  3WU6 A;  1Z0E A;  2V2Q A;  3LNU A;  4KHP E;  4DV1 I;  3T1H I;  4YHH I;  2BV3 A;  3J80 C;  1J5E I;  4MYU A;  3T1H E;  4YHH E;  3OTO I; 
#chains in the Genus database with same CATH topology
 2PO2 B;  2NN6 E;  1MG7 A;  4BA2 B;  3J7A M;  2VES A;  4P52 A;  4DPW A;  1FJG E;  1XHK A;  1WUU A;  2JEB A;  2BA0 G;  5DRR A;  1H7S A;  4LFC E;  4IFD B;  4FN5 A;  4OKG A;  1ZXN A;  5GMD A;  2NPF A;  4PRX A;  1DAR A;  5LMN I;  4IZK A;  4NXN I;  3WU3 A;  3CWV A;  3PYE A;  4K0K I;  2NN6 F;  2HK2 A;  5IT9 C;  1Z5B A;  3QT8 A;  5LMN E;  5C0X B;  4XTJ A;  2BA1 D;  3WU4 A;  4I3H A;  2VF3 A;  1P42 A;  3J81 C;  4GKJ I;  4AIM A;  1H7U A;  2UUC I;  5JEA F;  2C38 B;  1KKH A;  4FW7 A;  3HUL A;  1FKA E;  1UEK A;  3B82 A;  3QT5 A;  4FWD A;  1S4E A;  3PYG A;  4USK A;  1Z5C A;  4IZJ B;  1H74 A;  2VQE E;  4Z7C A;  1FWK A;  1B62 A;  2C39 B;  2A2D A;  1Z0T A;  3JAM Q;  3M7N D;  1XMQ E;  4AID A;  1IBM I;  1ZM9 A;  5EKW A;  2X36 A;  4JYA E;  1I94 I;  2O3Z A;  1HR0 I;  4MQY A;  2C37 B;  1R6L A;  4NXM I;  1OYR A;  2NN6 A;  4UT4 A;  4MYT A;  1XNR I;  1I94 E;  3QT6 A;  2DEJ A;  4NXM E;  2JEB B;  1RRE A;  5DRO A;  1N32 E;  4RPF A;  4JV5 I;  4AQY E;  1Z0C A;  2UU9 I;  4U3D A;  5JEA A;  2CGE A;  4IZK B;  3V2U C;  4DU7 A;  4JI0 I;  5JEA C;  5FLX Q;  4AM3 A;  3PS3 A;  4Z7Y A;  4DPT A;  4OO1 E;  3K1J A;  1N0U A;  2IOQ A;  2PNL A;  2J65 A;  4DV6 E;  1HNX I;  5K36 E;  5IWA E;  3GON A;  1Y4S A;  4PRV A;  4DR2 I;  1D6T A;  1Z0W A;  2WNR A;  1HNX E;  1OYP A;  2IES A;  3B78 A;  1E3H A;  2WP8 A;  2PNZ B;  4IFD D;  2OI2 A;  2BA1 G;  4DR2 E;  2A2C A;  4DV0 I;  4JI6 I;  4DV5 I;  3Q6N A;  4P7A A;  4ED4 A;  3D4J A;  1PKP A;  2BR2 B;  4DUY E;  4X64 I;  2AE8 A;  1UDS A;  1Y60 A;  1VIS A;  2BM0 A;  2JEA B;  4LF5 I;  1OJ4 A;  4DV0 E;  4WUC A;  4JI6 E;  3F0N A;  4FW6 A;  2PO1 A;  1PVG A;  4JI4 I;  4X64 E;  1XMO I;  2EFG A;  4DV1 E;  2Q2E B;  1PIE A;  4LF5 E;  2R3V A;  1MU5 A;  2HFS A;  2V2Z A;  1N33 I;  1Y6Z A;  1B63 A;  1J5E E;  1E3P A;  1N0V C;  3Q1Q A;  3GLL A;  1XNQ I;  2AJ4 A;  3M7N G;  3OTO E;  5LL6 R;  3QT7 A;  4FW9 A;  1ZXM A;  3P76 A;  4JI7 I;  1XXE A;  3M6A A;  2CG9 A;  2WW4 A;  3H1C A;  2JT2 A;  4FW4 A;  2UUA I;  3WU5 A;  4DXL A;  4X62 I;  4JI7 E;  3ZKD A;  4X66 I;  2ZM6 I;  2UUA E;  3JAM C;  3H4L A;  2VQF I;  4DR3 I;  4GKK I;  4JG4 A;  4LF7 I;  4NXN E;  4KQV A;  4DR4 I;  4LF4 I;  4K0K E;  2CZ9 A;  4R1F A;  5LMU I;  4DUZ I;  2VQF E;  4DR3 E;  4DR1 I;  2UXC I;  4GQU A;  4DR7 I;  4OO1 D;  4HY1 A;  4IFD E;  5K36 D;  4IS9 A;  2WNR B;  3P3G A;  1Z5A A;  4LPF A;  4DUZ E;  3NZK A;  1FNM A;  3PS1 A;  4DR7 E;  1EA6 A;  1N36 I;  5DNX A;  4GKJ E;  1HNZ I;  2UUC E;  2E1R A;  4DV2 I;  3Q6M A;  2PNM A;  3J80 Q;  2F1D A;  3LTO A;  4FW3 A;  4JI3 I;  5C0X E;  5FLX C;  2PO0 A;  4ISA A;  4B3M I;  3L7Z B;  3K17 A;  2PO1 B;  1IBK I;  4IFD F;  2JE6 A;  5FWK A;  4B3T I;  1IBK E;  4DR6 I;  4HAC A;  4DR5 I;  1IBM E;  4FWH A;  2NN6 C;  1HR0 E;  4LF8 I;  4FWG A;  2V2V A;  3K85 A;  2HK3 A;  2UXB I;  1XNR E;  1FWL A;  3V5R A;  2IOP A;  3ZZU A;  2HKE A;  4BA1 A;  2Z5E A;  4JV5 E;  5BR8 I;  4JI2 I;  1N34 I;  2PO2 A;  2UU9 E;  4BA2 A;  5GME A;  3J81 Q;  4JI0 E;  4LF6 I;  4X65 I;  3P3C A;  4OX9 I;  1N34 E;  1OYS A;  4WUB A;  3U1Y A;  1FI4 A;  4N3O A;  4JI5 I;  4DV3 I;  4IFD A;  4LF6 E;  1KTV A;  1Z0V A;  4IFD C;  1R6M A;  1EI1 A;  2F4V I;  2E5L I;  4B3R I;  1NHH A;  1NHJ A;  4JI5 E;  4FW5 A;  3DD6 A;  4OO1 F;  4HYM A;  4B3R E;  2UXD I;  3CDI A;  2PO0 B;  5K36 F;  1USU A;  2UUB I;  2Z5B A;  2DEI A;  4DV5 E;  5C0X D;  2BM1 A;  4LFB I;  4MU4 A;  5L3J A;  2V34 A;  2UUB E;  4KHP I;  5DRQ A;  2NN6 B;  4HAC B;  3KRN A;  4JI4 E;  1XMO E;  4YY3 I;  1N33 E;  1NHI A;  4USM A;  5EL9 A;  4LFA I;  2R42 A;  3P3E A;  1XNQ E;  1YH8 A;  4JI1 I;  3UHM A;  1KVK A;  1ELO A;  4YY3 E;  1IBL I;  4IZJ D;  5JEA B;  1UDQ A;  4J3D A;  3M85 D;  4LFA E;  4MDT A;  3B4T A;  4JI1 E;  4DPX A;  1FJG I;  2C37 A;  1IBL E;  3J7A G;  4LCG A;  5A2Q Q;  3T1Y I;  1ZM2 A;  3LPS A;  4QNK A;  3CDJ A;  4LFC I;  4X62 E;  2ZBK B;  2GS8 A;  2CVE A;  4OO1 A;  5K36 A;  3PYD A;  4X66 E;  2ZM6 E;  4OO1 C;  3T1Y E;  1HK7 A;  3GME A;  4GKK E;  5K36 C;  4LF7 E;  4DR4 E;  4LF4 E;  3ZZT A;  3U1K A;  5ELW A;  5JEA E;  4WUD A;  5LMU E;  4DR1 E;  2WP8 B;  2UXC E;  4NBQ A;  1ZM3 A;  4OZE A;  1ZM4 A;  1U2R A;  5DNL A;  1S16 A;  1Y4U A;  1N36 E;  2Z5B B;  1HNZ E;  1YHC A;  4DV2 E;  4JI3 E;  2V8P A;  4B3M E;  1K47 A;  3PYF A;  4LOM A;  4URL A;  4B3S I;  1H73 A;  2HKJ A;  2PNZ A;  2VQE I;  5DRP A;  4DV4 I;  4DPY A;  3P06 A;  4ZVI A;  2GO3 A;  4JI8 I;  1UDN A;  1VI7 A;  4B3S E;  1KIJ A;  5C0X F;  4B3T E;  2BR2 A;  1XMQ I;  4DR6 E;  1Z59 A;  1UDO A;  2IER A;  4DV4 E;  2JEA A;  4JYA I;  4DR5 E;  4JI8 E;  1Z0G A;  4LF8 E;  2HHH I;  3ZKB A;  5IT9 Q;  4LF9 I;  2Z5C A;  3B8H A;  2BA0 D;  1BKN A;  2UXB E;  1A6F A;  2HFU A;  2HHH E;  4M1K A;  4LF9 E;  1RHY A;  1HNW I;  4DU8 A;  4OO1 B;  1N32 I;  1H72 C;  4AQY I;  5K36 B;  2NN6 D;  5BR8 E;  4JI2 E;  2ZIT A;  3ZM7 A;  4LCH A;  1HNW E;  3M85 G;  4UTG A;  1RR9 A;  3HJC A;  4LCF A;  4X65 E;  4OX9 E;  2LJP A;  1MX0 A;  4DV7 I;  3ZZ0 A;  4DV3 E;  4DV6 I;  4MU0 A;  5IWA I;  5JEA D;  1QZR A;  2XEX A;  4PU9 A;  1Z0B A;  4DV7 E;  2GQ0 A;  4MU1 A;  4DPU A;  2X7I A;  2J7K A;  5C0X A;  2E5L E;  2F4V E;  1NZ0 A;  3HKM A;  5C0X C;  5A2Q C;  4U3B A;  3GCM A;  4EMD A;  2JE6 B;  2UXD E;  4QNJ A;  4HXZ A;  2O1V A;  2C38 A;  2O1W A;  1USV A;  4DUY I;  3PS2 A;  3PRY A;  4LFB E;  2O1U A;  3WU6 A;  1Z0E A;  2GO4 A;  2V2Q A;  3LNU A;  4KHP E;  4DV1 I;  4IZJ A;  4MU3 A;  3T1H I;  4YHH I;  3L7Z A;  2O1T A;  2BV3 A;  2C39 A;  2Z5C B;  3J80 C;  1J5E I;  4MYU A;  4BA1 B;  1Y5Y A;  3T1H E;  4YHH E;  3OTO I; 
#chains in the Genus database with same CATH homology
 1MG7 A;  3J7A M;  4P52 A;  4DPW A;  1FJG E;  1XHK A;  1WUU A;  1H7S A;  4LFC E;  4FN5 A;  1ZXN A;  5GMD A;  2NPF A;  4PRX A;  1DAR A;  5LMN I;  4IZK A;  4NXN I;  3WU3 A;  3CWV A;  3PYE A;  4K0K I;  2HK2 A;  5IT9 C;  1Z5B A;  3QT8 A;  5LMN E;  4XTJ A;  3WU4 A;  4I3H A;  2VF3 A;  3J81 C;  4GKJ I;  1H7U A;  2UUC I;  1KKH A;  3HUL A;  1FKA E;  1UEK A;  3B82 A;  3QT5 A;  4FWD A;  1S4E A;  3PYG A;  4USK A;  1Z5C A;  4IZJ B;  1H74 A;  2VQE E;  4Z7C A;  1FWK A;  1B62 A;  2A2D A;  1Z0T A;  3JAM Q;  1XMQ E;  1IBM I;  1ZM9 A;  2X36 A;  4JYA E;  1I94 I;  1HR0 I;  4NXM I;  4UT4 A;  4MYT A;  1XNR I;  1I94 E;  3QT6 A;  2DEJ A;  4NXM E;  1RRE A;  1N32 E;  4RPF A;  4JV5 I;  4AQY E;  1Z0C A;  2UU9 I;  2CGE A;  4IZK B;  3V2U C;  4DU7 A;  4JI0 I;  5FLX Q;  4Z7Y A;  4DPT A;  3K1J A;  1N0U A;  2IOQ A;  2PNL A;  4DV6 E;  1HNX I;  5IWA E;  3GON A;  1Y4S A;  4PRV A;  4DR2 I;  1D6T A;  1Z0W A;  1HNX E;  3B78 A;  2OI2 A;  4DR2 E;  2A2C A;  4DV0 I;  4JI6 I;  4DV5 I;  3Q6N A;  4P7A A;  4ED4 A;  3D4J A;  1PKP A;  4DUY E;  4X64 I;  2BM0 A;  1VIS A;  4LF5 I;  1OJ4 A;  4DV0 E;  4WUC A;  4JI6 E;  3F0N A;  1PVG A;  4JI4 I;  4X64 E;  1XMO I;  2EFG A;  4DV1 E;  2Q2E B;  1PIE A;  4LF5 E;  2R3V A;  1MU5 A;  2HFS A;  2V2Z A;  1N33 I;  1Y6Z A;  1B63 A;  1J5E E;  1N0V C;  3Q1Q A;  1XNQ I;  2AJ4 A;  3OTO E;  5LL6 R;  3QT7 A;  4FW9 A;  1ZXM A;  4JI7 I;  3M6A A;  2CG9 A;  2WW4 A;  2UUA I;  3WU5 A;  4DXL A;  4X62 I;  4JI7 E;  3ZKD A;  4X66 I;  2ZM6 I;  2UUA E;  3JAM C;  3H4L A;  2VQF I;  4DR3 I;  4GKK I;  4JG4 A;  4LF7 I;  4NXN E;  4KQV A;  4DR4 I;  4LF4 I;  4K0K E;  2CZ9 A;  4R1F A;  5LMU I;  4DUZ I;  2VQF E;  4DR3 E;  4DR1 I;  2UXC I;  4DR7 I;  4HY1 A;  1Z5A A;  4DUZ E;  1FNM A;  4DR7 E;  1EA6 A;  1N36 I;  4GKJ E;  1HNZ I;  2UUC E;  2E1R A;  4DV2 I;  3Q6M A;  2PNM A;  3J80 Q;  3LTO A;  4JI3 I;  5FLX C;  4B3M I;  3K17 A;  1IBK I;  5FWK A;  4B3T I;  1IBK E;  4DR6 I;  4HAC A;  4DR5 I;  1IBM E;  4FWH A;  1HR0 E;  4LF8 I;  4FWG A;  2V2V A;  3K85 A;  2HK3 A;  2UXB I;  1XNR E;  1FWL A;  3V5R A;  2IOP A;  3ZZU A;  2HKE A;  2Z5E A;  4JV5 E;  5BR8 I;  4JI2 I;  1N34 I;  2UU9 E;  5GME A;  3J81 Q;  4JI0 E;  4LF6 I;  4X65 I;  4OX9 I;  1N34 E;  4WUB A;  1FI4 A;  4N3O A;  4JI5 I;  4DV3 I;  4LF6 E;  1KTV A;  1Z0V A;  1EI1 A;  2F4V I;  2E5L I;  4B3R I;  1NHH A;  1NHJ A;  4JI5 E;  4HYM A;  4B3R E;  2UXD I;  1USU A;  2UUB I;  2Z5B A;  2DEI A;  4DV5 E;  2BM1 A;  4LFB I;  5L3J A;  2V34 A;  2UUB E;  4KHP I;  4HAC B;  4JI4 E;  1XMO E;  4YY3 I;  1N33 E;  1NHI A;  4USM A;  4LFA I;  2R42 A;  1XNQ E;  4JI1 I;  1KVK A;  1ELO A;  4YY3 E;  1IBL I;  4IZJ D;  4LFA E;  4JI1 E;  4DPX A;  1FJG I;  1IBL E;  3J7A G;  5A2Q Q;  3T1Y I;  1ZM2 A;  3LPS A;  4LFC I;  4X62 E;  2ZBK B;  2GS8 A;  3PYD A;  4X66 E;  2ZM6 E;  3T1Y E;  1HK7 A;  4GKK E;  4LF7 E;  4DR4 E;  4LF4 E;  3ZZT A;  4WUD A;  5LMU E;  4DR1 E;  2UXC E;  1ZM3 A;  1ZM4 A;  1U2R A;  1S16 A;  1Y4U A;  1N36 E;  2Z5B B;  1HNZ E;  4DV2 E;  4JI3 E;  2V8P A;  4B3M E;  1K47 A;  3PYF A;  4URL A;  4B3S I;  1H73 A;  2HKJ A;  2VQE I;  4DV4 I;  4DPY A;  3P06 A;  4ZVI A;  4JI8 I;  4B3S E;  1KIJ A;  4B3T E;  1XMQ I;  4DR6 E;  1Z59 A;  4DV4 E;  4JYA I;  4DR5 E;  4JI8 E;  1Z0G A;  4LF8 E;  2HHH I;  3ZKB A;  5IT9 Q;  4LF9 I;  2Z5C A;  3B8H A;  1BKN A;  2UXB E;  1A6F A;  2HFU A;  2HHH E;  4M1K A;  4LF9 E;  1HNW I;  4DU8 A;  1N32 I;  1H72 C;  4AQY I;  5BR8 E;  4JI2 E;  2ZIT A;  3ZM7 A;  1HNW E;  4UTG A;  1RR9 A;  3HJC A;  4X65 E;  4OX9 E;  2LJP A;  1MX0 A;  4DV7 I;  3ZZ0 A;  4DV3 E;  4DV6 I;  5IWA I;  1QZR A;  2XEX A;  4PU9 A;  1Z0B A;  4DV7 E;  2GQ0 A;  2E5L E;  4DPU A;  2X7I A;  2J7K A;  2F4V E;  1NZ0 A;  5A2Q C;  4EMD A;  2UXD E;  4HXZ A;  2O1V A;  2O1W A;  1USV A;  4DUY I;  3PRY A;  4LFB E;  2O1U A;  3WU6 A;  1Z0E A;  2V2Q A;  3LNU A;  4KHP E;  4DV1 I;  4IZJ A;  3T1H I;  4YHH I;  2O1T A;  2BV3 A;  2Z5C B;  3J80 C;  1J5E I;  4MYU A;  3T1H E;  4YHH E;  3OTO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...