4LFCI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfcI00
2BV3A 1KTVA 2HK3A 4LF9I 2UUAE 4HACA 2X7IA 1IBLE 1QZRA 4DUYI 4GKKE 1PKPA 4OX9I 1FI4A 1N36E 3T1YE 2UUAI 4DR4I 4WUDA 4DV4E 1KKHA 1Z5AA 4KQVA 1N32E 1Z0EA 1KIJA 1IBLI 1HR0E 2UXDI 3ZZ0A 4DV7E 1D6TA 4DV1E 2UUBI 4URLA 4X65I 4JI7E 1I94I 3PYDA 3J80C 1N0UA 1ZM4A 3Q1QA 1N34I 4NXNI 4AQYE 1Z59A 1XHKA 4GKJI 1Z0WA 4DUYE 2ZM6I 1Z5CA 4JI6E 4DV7I 3K1JA 2Q2EB 4DR1I 2LJPA 4NXME 4YY3I 2CZ9A 2V2ZA 4DPTA 3JAMQ 4B3TE 1FJGI 4X62I 1NHJA 3H4LA 2VF3A 2VQFE 2UU9I 5IT9Q 1MX0A 4YHHI 4PU9A 3F0NA 1H7UA 1ELOA 4DPUA 3ZZTA 4EMDA 2WW4A 2UU9E 4JI8I 5LMNE 1ZM2A 2R3VA 3B78A 4LF7E 3JAMC 1A6FA 2HKEA 1FKAE 4X66E 4MYUA 4ED4A 4P7AA 4AQYI 1KVKA 1VISA 3B82A 3HULA 4JI8E 5LMNI 2X36A 2A2DA 2ZM6E 4I3HA 4DV6E 4X65E 2HHHI 4JI2E 4DR7E 1XMOE 5LMUE 4LF4E 1RR9A 1IBMI 2A2CA 4HYMA 2UXCE 4X64E 1WUUA 4DPWA 4UTGA 4LF4I 2VQEE 5A2QC 4JI6I 1N36I 3J7AM 4Z7YA 4DR6I 3J7AG 5BR8I 3LPSA 1HNXI 2F4VE 3PYGA 5A2QQ 3OTOI 1J5EI 2UXDE 1NHHA 4JI4I 3ZKDA 2E5LI 1PIEA 1U2RA 3WU4A 4JYAE 1I94E 4R1FA 4LF5E 2VQFI 1XNRI 2EFGA 2OI2A 3M6AA 4DR2I 3LTOA 3B8HA 1PVGA 1MG7A 4JI2I 4DR7I 4JI1I 4JV5E 5L3JA 2VQEI 3QT6A 3J80Q 1H7SA 4JI5E 3D4JA 2AJ4A 2DEJA 5GMDA 2V8PA 5LMUI 1IBKI 2UXBI 4HY1A 1HNZI 2E1RA 1FNMA 4ZVIA 1Z0CA 4DR5E 1IBKE 1Z0GA 2HFSA 1MU5A 1ZXMA 4DPXA 4B3RI 4X66I 1H72C 3T1HI 3WU3A 2V34A 4OX9E 2ZITA 3WU6A 4DV5E 4DPYA 4DV2E 4LFAI 1FWLA 4JYAI 4DR6E 1N33I 4DUZE 4FWGA 4DR5I 4DV0E 2V2VA 4DV5I 2XEXA 1EA6A 1K47A 1Z0VA 4K0KI 2E5LE 1RREA 1EI1A 2R42A 4LF9E 4RPFA 4PRXA 1UEKA 4LFBI 4HACB 4DU7A 1HR0I 3OTOE 2ZBKB 4JI0E 1H74A 5GMEA 4JI3I 2BM0A 1ZM3A 4LF6I 4GKJE 3T1YI 1IBME 4DR4E 4WUBA 4JV5I 4JI0I 3ZM7A 4LF7I 4M1KA 3QT5A 1N0VC 3J81Q 4LF6E 4XTJA 4DV0I 4DR3I 5FLXQ 1Z5BA 2UUCI 4DV6I 1XMOI 1BKNA 4FW9A 4B3SI 2J7KA 1S4EA 4FWDA 4UT4A 4DR3E 4B3RE 2GS8A 3T1HE 4YY3E 4KHPE 2V2QA 4DV2I 4LFAE 3WU5A 5IT9C 4B3TI 1FJGE 4FN5A 3ZZUA 2F4VI 4GKKI 1HNZE 4B3ME 4DV3I 1XNQE 1DARA 4DXLA 4JI7I 4YHHE 4USKA 4JG4A 4MYTA 4LFCI 3GONA 1FWKA 5IWAE 1N34E 2HHHE 4LF5I 1ZM9A 3LNUA 4B3MI 2HK2A 3QT8A 3K17A 4PRVA 1OJ4A 2BM1A 1N32I 4LFBE 2UUBE 3PYEA 4DV1I 1N33E 4LFCE 1B63A 3QT7A 4JI3E 4LF8I 4USMA 4DV3E 4FWHA 4Z7CA 4JI1E 5FLXC 3CWVA 1XNRE 2UUCE 4DU8A 1XMQI 3PYFA 4P52A 3ZKBA 4X64I 2UXCI 4DUZI 4B3SE 4NXMI 1NHIA 1XNQI 2UXBE 1S16A 1Z0BA 1HNXE 5BR8E 4KHPI 4X62E 5LL6R 2DEIA 1J5EE 1NZ0A 4NXNE 2NPFA 4JI4E 3V2UC 1B62A 1Z0TA 4WUCA 2HFUA 4DR1E 4HXZA 4LF8E 5IWAI 4JI5I 1H73A 1ZXNA 2HKJA 1HNWE 4DR2E 3V5RA 3J81C 4K0KE 4DV4I 1XMQE 1HNWI
chains in the Genus database with same CATH superfamily
2BV3A 2PNLA 4MU4A 5K36A 1KTVA 2HK3A 4LF9I 2UUAE 4HACA 2PO1A 4LOMA 2X7IA 1IBLE 1QZRA 4DUYI 5DRRA 3L7ZB 2C37A 4IZJD 4GKKE 1PKPA 4BA2B 2C38A 4OX9I 3GMEA 4AIMA 1FI4A 1N36E 3T1YE 1UDQA 1UDSA 2UUAI 4LCGA 4DR4I 2J65A 4WUDA 4IS9A 4DV4E 1KKHA 1Z5AA 2WNRB 4KQVA 1N32E 2JEBA 1Z0EA 1KIJA 2C38B 5DNLA 1IBLI 1HR0E 2UXDI 3ZZ0A 4DV7E 1D6TA 4DV1E 2UUBI 3Q6MA 2O1TA 4URLA 4X65I 5DRPA 4JI7E 5JEAC 4OO1B 1I94I 1UDNA 3PYDA 4FW6A 3J80C 1N0UA 3CDIA 1ZM4A 3Q1QA 1N34I 4NXNI 4AQYE 1Z59A 1XHKA 4GKJI 1Z0WA 3P06A 4DUYE 2ZM6I 1Z5CA 4MQYA 4JI6E 4DV7I 3K1JA 2BR2A 2Q2EB 4DR1I 2LJPA 4NXME 4YY3I 2NN6D 2CZ9A 2V2ZA 4DPTA 2PO0A 3JAMQ 4B3TE 1FJGI 4X62I 1NHJA 1Y5YA 3H4LA 2VF3A 4J3DA 2VQFE 2UU9I 5IT9Q 1MX0A 5JEAA 2WP8A 4YHHI 4PU9A 3F0NA 1H7UA 2JE6B 1ELOA 2VESA 4DPUA 3L7ZA 4AM3A 3ZZTA 4EMDA 2WW4A 2UU9E 4JI8I 5LMNE 4OO1C 1ZM2A 2R3VA 3B78A 4LF7E 3JAMC 1A6FA 2HKEA 1FKAE 2BR2B 4X66E 4MYUA 1YHCA 4OO1D 4IFDA 4ED4A 4P7AA 1KVKA 1VISA 4AQYI 3B82A 3HULA 5K36E 2Z5BB 4JI8E 5LMNI 4FW4A 2X36A 2A2DA 2ZM6E 4I3HA 4DV6E 4X65E 2HHHI 5K36D 4JI2E 4DR7E 1XMOE 5LMUE 4FW3A 4LF4E 1Y4SA 1RR9A 2AE8A 1IBMI 5ELWA 2C39B 2A2CA 4QNJA 4HYMA 4IZKA 2UXCE 4X64E 1WUUA 5EKWA 4DPWA 4UTGA 4LF4I 2VQEE 5A2QC 4JI6I 3H1CA 1N36I 3J7AM 4Z7YA 1E3PA 4DR6I 3J7AG 5BR8I 1R6MA 3LPSA 1HNXI 2F4VE 3PYGA 5A2QQ 3OTOI 3K85A 4IZKB 4LCFA 5C0XA 3UHMA 3GLLA 3P3EA 3M85G 1J5EI 2UXDE 1NHHA 4JI4I 3ZKDA 2E5LI 1PIEA 1U2RA 3WU4A 4JYAE 1I94E 4R1FA 4MU1A 4LF5E 2VQFI 4MU3A 1XNRI 4IZJA 4LPFA 2EFGA 2WP8B 2OI2A 3M6AA 4DR2I 3LTOA 1R6LA 3B8HA 1PVGA 1MG7A 2PO0B 4JI2I 5C0XC 4DR7I 3P3GA 4JI1I 4JV5E 2WNRA 1Y60A 3GCMA 5L3JA 2NN6A 3P76A 2JE6A 2NN6B 2GO3A 2VQEI 2GQ0A 3QT6A 3J80Q 2C39A 1H7SA 4JI5E 3D4JA 2AJ4A 2Z5CA 2DEJA 4U3DA 5GMDA 3M7NG 2V8PA 4IFDC 5LMUI 1IBKI 4FW7A 2UXBI 5K36B 1XXEA 4HY1A 2Z5BA 1HNZI 1YH8A 2E1RA 1FNMA 2BA1D 2JEAA 3DD6A 4ZVIA 3CDJA 1Z0CA 4DR5E 1IBKE 2O1VA 1Z0GA 2HFSA 4IFDD 1MU5A 1ZXMA 4DPXA 4B3RI 4X66I 1H72C 3T1HI 3WU3A 2V34A 4OX9E 2ZITA 2IESA 3WU6A 2O1UA 4DV5E 1USUA 4DPYA 4DV2E 4LFAI 1FWLA 4JYAI 2JEBB 1VI7A 3NZKA 4DR6E 4MU0A 1N33I 4DUZE 2C37B 2PNMA 4QNKA 4FWGA 4DR5I 2Z5CB 4DV0E 2V2VA 4DV5I 2XEXA 1EA6A 1K47A 2BA0G 1Z0VA 5JEAF 4K0KI 4IZJB 2E5LE 1RREA 1EI1A 2R42A 4LF9E 4RPFA 4PRXA 1UEKA 4LFBI 4HACB 4DU7A 1HR0I 4OKGA 4OO1A 3OTOE 2ZBKB 4JI0E 1H74A 5GMEA 2GO4A 3Q6NA 2BM0A 4JI3I 1ZM3A 5C0XB 4LF6I 4GKJE 3T1YI 1IBME 4OZEA 4DR4E 4WUBA 4JV5I 2CG9A 4JI0I 2JT2A 3ZM7A 4LF7I 4M1KA 1UDOA 3QT5A 1N0VC 3J81Q 4ISAA 2O3ZA 3PRYA 4U3BA 4LF6E 4XTJA 1E3HA 5JEAD 4DV0I 1OYPA 4DR3I 5FLXQ 2IOPA 1Z5BA 2UUCI 4DV6I 1XMOI 1BKNA 4FW9A 4B3SI 3PS2A 2PNZB 2J7KA 5EL9A 1S4EA 4FWDA 4UT4A 5C0XF 1Y4UA 4DR3E 4GQUA 4BA1B 1OYSA 5DNXA 4B3RE 2GS8A 2NN6E 3T1HE 2Z5EA 5DROA 1HK7A 3PS1A 5C0XE 4IFDF 4YY3E 4KHPE 2V2QA 4DV2I 4LFAE 3WU5A 5IT9C 4IFDE 4B3TI 1FJGE 4FN5A 3ZZUA 4BA1A 2F4VI 4AIDA 3M7ND 3KRNA 1HNZE 4GKKI 4B3ME 4DV3I 1XNQE 1P42A 1DARA 4DXLA 2IOQA 4JI7I 3U1KA 4YHHE 1USVA 4MDTA 4USKA 4JG4A 4MYTA 4LFCI 3GONA 1FWKA 5IWAE 1N34E 2HHHE 4LF5I 1ZM9A 2CGEA 3LNUA 4B3MI 2HK2A 3QT8A 3K17A 4PRVA 1OJ4A 2BM1A 1N32I 4OO1E 4LFBE 3PYEA 4DV1I 2PO2B 2UUBE 2O1WA 1N33E 4LFCE 5K36F 1B63A 3QT7A 5FWKA 4JI3E 4LF8I 4USMA 4DV3E 4FWHA 4Z7CA 3PS3A 2JEAB 4JI1E 3B4TA 2IERA 4OO1F 2PO1B 5K36C 5FLXC 1Y6ZA 3CWVA 5DRQA 4IFDB 1XNRE 2UUCE 4NBQA 4DU8A 1XMQI 3PYFA 2CVEA 4P52A 3ZKBA 4X64I 2UXCI 4DUZI 5JEAE 4FW5A 2PO2A 4B3SE 2NN6C 4NXMI 1NHIA 1XNQI 2UXBE 1S16A 2BA0D 3HJCA 1Z0BA 1HNXE 4N3OA 5BR8E 4LCHA 5JEAB 4KHPI 4X62E 1OYRA 5LL6R 2NN6F 2DEIA 2PNZA 1J5EE 3V2UC 1NZ0A 2NPFA 4JI4E 4NXNE 1B62A 1Z0TA 4WUCA 2HFUA 4DR1E 1RHYA 4HXZA 4LF8E 5IWAI 3HKMA 4JI5I 1H73A 1ZXNA 2HKJA 1HNWE 3P3CA 2F1DA 3U1YA 4DR2E 3V5RA 2BA1G 5C0XD 4BA2A 3J81C 4K0KE 3M85D 4DV4I 1XMQE 1HNWI
chains in the Genus database with same CATH topology
2BV3A 2PNLA 1KTVA 2HK3A 4LF9I 2UUAE 4HACA 2X7IA 1IBLE 1QZRA 4DUYI 4IZJD 4GKKE 1PKPA 4OX9I 1FI4A 1N36E 3T1YE 2UUAI 4DR4I 4WUDA 4DV4E 1KKHA 1Z5AA 4KQVA 1N32E 1Z0EA 1KIJA 1IBLI 1HR0E 2UXDI 3ZZ0A 4DV7E 1D6TA 4DV1E 2UUBI 3Q6MA 2O1TA 4URLA 4X65I 4JI7E 1I94I 3PYDA 3J80C 1N0UA 1ZM4A 3Q1QA 1N34I 4NXNI 4AQYE 1Z59A 1XHKA 4GKJI 1Z0WA 3P06A 4DUYE 2ZM6I 1Z5CA 4JI6E 4DV7I 3K1JA 2Q2EB 4DR1I 2LJPA 4NXME 4YY3I 2CZ9A 2V2ZA 4DPTA 3JAMQ 4B3TE 1FJGI 4X62I 1NHJA 3H4LA 2VF3A 2VQFE 2UU9I 5IT9Q 1MX0A 4YHHI 4PU9A 3F0NA 1H7UA 1ELOA 4DPUA 3ZZTA 4EMDA 2WW4A 2UU9E 4JI8I 5LMNE 1ZM2A 2R3VA 3B78A 4LF7E 3JAMC 1A6FA 2HKEA 1FKAE 4X66E 4MYUA 4ED4A 4P7AA 4AQYI 1KVKA 1VISA 3B82A 3HULA 2Z5BB 4JI8E 5LMNI 2X36A 2A2DA 2ZM6E 4I3HA 4DV6E 4X65E 2HHHI 4JI2E 4DR7E 1XMOE 5LMUE 4LF4E 1Y4SA 1RR9A 1IBMI 2A2CA 4HYMA 4IZKA 2UXCE 4X64E 1WUUA 4DPWA 4UTGA 4LF4I 2VQEE 5A2QC 4JI6I 1N36I 3J7AM 4Z7YA 4DR6I 3J7AG 5BR8I 3LPSA 1HNXI 2F4VE 3PYGA 5A2QQ 3OTOI 3K85A 4IZKB 1J5EI 2UXDE 1NHHA 4JI4I 3ZKDA 2E5LI 1PIEA 1U2RA 3WU4A 4JYAE 1I94E 4R1FA 4LF5E 2VQFI 1XNRI 4IZJA 2EFGA 2OI2A 3M6AA 4DR2I 3LTOA 3B8HA 1PVGA 1MG7A 4JI2I 4DR7I 4JI1I 4JV5E 5L3JA 2VQEI 2GQ0A 3QT6A 3J80Q 1H7SA 4JI5E 3D4JA 2AJ4A 2Z5CA 2DEJA 5GMDA 2V8PA 5LMUI 1IBKI 2UXBI 4HY1A 2Z5BA 1HNZI 2E1RA 1FNMA 4ZVIA 1Z0CA 4DR5E 1IBKE 2O1VA 1Z0GA 2HFSA 1MU5A 1ZXMA 4DPXA 4B3RI 4X66I 1H72C 3T1HI 3WU3A 2V34A 4OX9E 2ZITA 3WU6A 2O1UA 4DV5E 1USUA 4DPYA 4DV2E 4LFAI 1FWLA 4JYAI 4DR6E 1N33I 4DUZE 2PNMA 4FWGA 4DR5I 2Z5CB 4DV0E 2V2VA 4DV5I 2XEXA 1EA6A 1K47A 1Z0VA 4K0KI 4IZJB 2E5LE 1RREA 1EI1A 2R42A 4LF9E 4RPFA 4PRXA 1UEKA 4LFBI 4HACB 4DU7A 1HR0I 3OTOE 2ZBKB 4JI0E 1H74A 5GMEA 3Q6NA 4JI3I 2BM0A 1ZM3A 4LF6I 4GKJE 3T1YI 1IBME 4DR4E 4WUBA 4JV5I 2CG9A 4JI0I 3ZM7A 4LF7I 4M1KA 3QT5A 1N0VC 3J81Q 3PRYA 4LF6E 4XTJA 4DV0I 4DR3I 5FLXQ 2IOPA 1Z5BA 2UUCI 4DV6I 1XMOI 1BKNA 4FW9A 4B3SI 2J7KA 1S4EA 4FWDA 4UT4A 1Y4UA 4DR3E 4B3RE 2GS8A 3T1HE 2Z5EA 1HK7A 4YY3E 4KHPE 2V2QA 4DV2I 4LFAE 3WU5A 5IT9C 4B3TI 1FJGE 4FN5A 3ZZUA 2F4VI 4GKKI 1HNZE 4B3ME 4DV3I 1XNQE 1DARA 4DXLA 2IOQA 4JI7I 4YHHE 1USVA 4USKA 4JG4A 4MYTA 4LFCI 3GONA 1FWKA 5IWAE 1N34E 2HHHE 4LF5I 1ZM9A 2CGEA 3LNUA 4B3MI 2HK2A 3QT8A 3K17A 4PRVA 1OJ4A 2BM1A 1N32I 4LFBE 2UUBE 3PYEA 4DV1I 2O1WA 1N33E 4LFCE 1B63A 3QT7A 5FWKA 4JI3E 4LF8I 4USMA 4DV3E 4FWHA 4Z7CA 4JI1E 5FLXC 1Y6ZA 3CWVA 1XNRE 2UUCE 4DU8A 1XMQI 3PYFA 4P52A 3ZKBA 4X64I 2UXCI 4DUZI 4B3SE 4NXMI 1NHIA 1XNQI 2UXBE 1S16A 3HJCA 1Z0BA 1HNXE 4N3OA 5BR8E 4KHPI 4X62E 5LL6R 2DEIA 1J5EE 1NZ0A 2NPFA 3V2UC 4JI4E 4NXNE 1B62A 1Z0TA 4WUCA 2HFUA 4DR1E 4HXZA 4LF8E 5IWAI 4JI5I 1H73A 1ZXNA 2HKJA 1HNWE 4DR2E 3V5RA 3J81C 4K0KE 4DV4I 1XMQE 1HNWI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BV3 A;  1KTV A;  2HK3 A;  4LF9 I;  2UUA E;  4HAC A;  2X7I A;  1IBL E;  1QZR A;  4DUY I;  4GKK E;  1PKP A;  4OX9 I;  1FI4 A;  1N36 E;  3T1Y E;  2UUA I;  4DR4 I;  4WUD A;  4DV4 E;  1KKH A;  1Z5A A;  4KQV A;  1N32 E;  1Z0E A;  1KIJ A;  1IBL I;  1HR0 E;  2UXD I;  3ZZ0 A;  4DV7 E;  1D6T A;  4DV1 E;  2UUB I;  4URL A;  4X65 I;  4JI7 E;  1I94 I;  3PYD A;  3J80 C;  1N0U A;  1ZM4 A;  3Q1Q A;  1N34 I;  4NXN I;  4AQY E;  1Z59 A;  1XHK A;  4GKJ I;  1Z0W A;  4DUY E;  2ZM6 I;  1Z5C A;  4JI6 E;  4DV7 I;  3K1J A;  2Q2E B;  4DR1 I;  2LJP A;  4NXM E;  4YY3 I;  2CZ9 A;  2V2Z A;  4DPT A;  3JAM Q;  4B3T E;  1FJG I;  4X62 I;  1NHJ A;  3H4L A;  2VF3 A;  2VQF E;  2UU9 I;  5IT9 Q;  1MX0 A;  4YHH I;  4PU9 A;  3F0N A;  1H7U A;  1ELO A;  4DPU A;  3ZZT A;  4EMD A;  2WW4 A;  2UU9 E;  4JI8 I;  5LMN E;  1ZM2 A;  2R3V A;  3B78 A;  4LF7 E;  3JAM C;  1A6F A;  2HKE A;  1FKA E;  4X66 E;  4MYU A;  4ED4 A;  4P7A A;  4AQY I;  1KVK A;  1VIS A;  3B82 A;  3HUL A;  4JI8 E;  5LMN I;  2X36 A;  2A2D A;  2ZM6 E;  4I3H A;  4DV6 E;  4X65 E;  2HHH I;  4JI2 E;  4DR7 E;  1XMO E;  5LMU E;  4LF4 E;  1RR9 A;  1IBM I;  2A2C A;  4HYM A;  2UXC E;  4X64 E;  1WUU A;  4DPW A;  4UTG A;  4LF4 I;  2VQE E;  5A2Q C;  4JI6 I;  1N36 I;  3J7A M;  4Z7Y A;  4DR6 I;  3J7A G;  5BR8 I;  3LPS A;  1HNX I;  2F4V E;  3PYG A;  5A2Q Q;  3OTO I;  1J5E I;  2UXD E;  1NHH A;  4JI4 I;  3ZKD A;  2E5L I;  1PIE A;  1U2R A;  3WU4 A;  4JYA E;  1I94 E;  4R1F A;  4LF5 E;  2VQF I;  1XNR I;  2EFG A;  2OI2 A;  3M6A A;  4DR2 I;  3LTO A;  3B8H A;  1PVG A;  1MG7 A;  4JI2 I;  4DR7 I;  4JI1 I;  4JV5 E;  5L3J A;  2VQE I;  3QT6 A;  3J80 Q;  1H7S A;  4JI5 E;  3D4J A;  2AJ4 A;  2DEJ A;  5GMD A;  2V8P A;  5LMU I;  1IBK I;  2UXB I;  4HY1 A;  1HNZ I;  2E1R A;  1FNM A;  4ZVI A;  1Z0C A;  4DR5 E;  1IBK E;  1Z0G A;  2HFS A;  1MU5 A;  1ZXM A;  4DPX A;  4B3R I;  4X66 I;  1H72 C;  3T1H I;  3WU3 A;  2V34 A;  4OX9 E;  2ZIT A;  3WU6 A;  4DV5 E;  4DPY A;  4DV2 E;  4LFA I;  1FWL A;  4JYA I;  4DR6 E;  1N33 I;  4DUZ E;  4FWG A;  4DR5 I;  4DV0 E;  2V2V A;  4DV5 I;  2XEX A;  1EA6 A;  1K47 A;  1Z0V A;  4K0K I;  2E5L E;  1RRE A;  1EI1 A;  2R42 A;  4LF9 E;  4RPF A;  4PRX A;  1UEK A;  4LFB I;  4HAC B;  4DU7 A;  1HR0 I;  3OTO E;  2ZBK B;  4JI0 E;  1H74 A;  5GME A;  4JI3 I;  2BM0 A;  1ZM3 A;  4LF6 I;  4GKJ E;  3T1Y I;  1IBM E;  4DR4 E;  4WUB A;  4JV5 I;  4JI0 I;  3ZM7 A;  4LF7 I;  4M1K A;  3QT5 A;  1N0V C;  3J81 Q;  4LF6 E;  4XTJ A;  4DV0 I;  4DR3 I;  5FLX Q;  1Z5B A;  2UUC I;  4DV6 I;  1XMO I;  1BKN A;  4FW9 A;  4B3S I;  2J7K A;  1S4E A;  4FWD A;  4UT4 A;  4DR3 E;  4B3R E;  2GS8 A;  3T1H E;  4YY3 E;  4KHP E;  2V2Q A;  4DV2 I;  4LFA E;  3WU5 A;  5IT9 C;  4B3T I;  1FJG E;  4FN5 A;  3ZZU A;  2F4V I;  4GKK I;  1HNZ E;  4B3M E;  4DV3 I;  1XNQ E;  1DAR A;  4DXL A;  4JI7 I;  4YHH E;  4USK A;  4JG4 A;  4MYT A;  4LFC I;  3GON A;  1FWK A;  5IWA E;  1N34 E;  2HHH E;  4LF5 I;  1ZM9 A;  3LNU A;  4B3M I;  2HK2 A;  3QT8 A;  3K17 A;  4PRV A;  1OJ4 A;  2BM1 A;  1N32 I;  4LFB E;  2UUB E;  3PYE A;  4DV1 I;  1N33 E;  4LFC E;  1B63 A;  3QT7 A;  4JI3 E;  4LF8 I;  4USM A;  4DV3 E;  4FWH A;  4Z7C A;  4JI1 E;  5FLX C;  3CWV A;  1XNR E;  2UUC E;  4DU8 A;  1XMQ I;  3PYF A;  4P52 A;  3ZKB A;  4X64 I;  2UXC I;  4DUZ I;  4B3S E;  4NXM I;  1NHI A;  1XNQ I;  2UXB E;  1S16 A;  1Z0B A;  1HNX E;  5BR8 E;  4KHP I;  4X62 E;  5LL6 R;  2DEI A;  1J5E E;  1NZ0 A;  4NXN E;  2NPF A;  4JI4 E;  3V2U C;  1B62 A;  1Z0T A;  4WUC A;  2HFU A;  4DR1 E;  4HXZ A;  4LF8 E;  5IWA I;  4JI5 I;  1H73 A;  1ZXN A;  2HKJ A;  1HNW E;  4DR2 E;  3V5R A;  3J81 C;  4K0K E;  4DV4 I;  1XMQ E;  1HNW I; 
#chains in the Genus database with same CATH topology
 2BV3 A;  2PNL A;  4MU4 A;  5K36 A;  1KTV A;  2HK3 A;  4LF9 I;  2UUA E;  4HAC A;  2PO1 A;  4LOM A;  2X7I A;  1IBL E;  1QZR A;  4DUY I;  5DRR A;  3L7Z B;  2C37 A;  4IZJ D;  4GKK E;  1PKP A;  4BA2 B;  2C38 A;  4OX9 I;  3GME A;  4AIM A;  1FI4 A;  1N36 E;  3T1Y E;  1UDQ A;  1UDS A;  2UUA I;  4LCG A;  4DR4 I;  2J65 A;  4WUD A;  4IS9 A;  4DV4 E;  1KKH A;  1Z5A A;  2WNR B;  4KQV A;  1N32 E;  2JEB A;  1Z0E A;  1KIJ A;  2C38 B;  5DNL A;  1IBL I;  1HR0 E;  2UXD I;  3ZZ0 A;  4DV7 E;  1D6T A;  4DV1 E;  2UUB I;  3Q6M A;  2O1T A;  4URL A;  4X65 I;  5DRP A;  4JI7 E;  5JEA C;  4OO1 B;  1I94 I;  1UDN A;  3PYD A;  4FW6 A;  3J80 C;  1N0U A;  3CDI A;  1ZM4 A;  3Q1Q A;  1N34 I;  4NXN I;  4AQY E;  1Z59 A;  1XHK A;  4GKJ I;  1Z0W A;  3P06 A;  4DUY E;  2ZM6 I;  1Z5C A;  4MQY A;  4JI6 E;  4DV7 I;  3K1J A;  2BR2 A;  2Q2E B;  4DR1 I;  2LJP A;  4NXM E;  4YY3 I;  2NN6 D;  2CZ9 A;  2V2Z A;  4DPT A;  2PO0 A;  3JAM Q;  4B3T E;  1FJG I;  4X62 I;  1NHJ A;  1Y5Y A;  3H4L A;  2VF3 A;  4J3D A;  2VQF E;  2UU9 I;  5IT9 Q;  1MX0 A;  5JEA A;  2WP8 A;  4YHH I;  4PU9 A;  3F0N A;  1H7U A;  2JE6 B;  1ELO A;  2VES A;  4DPU A;  3L7Z A;  4AM3 A;  3ZZT A;  4EMD A;  2WW4 A;  2UU9 E;  4JI8 I;  5LMN E;  4OO1 C;  1ZM2 A;  2R3V A;  3B78 A;  4LF7 E;  3JAM C;  1A6F A;  2HKE A;  1FKA E;  2BR2 B;  4X66 E;  4MYU A;  1YHC A;  4OO1 D;  4IFD A;  4ED4 A;  4P7A A;  1KVK A;  1VIS A;  4AQY I;  3B82 A;  3HUL A;  5K36 E;  2Z5B B;  4JI8 E;  5LMN I;  4FW4 A;  2X36 A;  2A2D A;  2ZM6 E;  4I3H A;  4DV6 E;  4X65 E;  2HHH I;  5K36 D;  4JI2 E;  4DR7 E;  1XMO E;  5LMU E;  4FW3 A;  4LF4 E;  1Y4S A;  1RR9 A;  2AE8 A;  1IBM I;  5ELW A;  2C39 B;  2A2C A;  4QNJ A;  4HYM A;  4IZK A;  2UXC E;  4X64 E;  1WUU A;  5EKW A;  4DPW A;  4UTG A;  4LF4 I;  2VQE E;  5A2Q C;  4JI6 I;  3H1C A;  1N36 I;  3J7A M;  4Z7Y A;  1E3P A;  4DR6 I;  3J7A G;  5BR8 I;  1R6M A;  3LPS A;  1HNX I;  2F4V E;  3PYG A;  5A2Q Q;  3OTO I;  3K85 A;  4IZK B;  4LCF A;  5C0X A;  3UHM A;  3GLL A;  3P3E A;  3M85 G;  1J5E I;  2UXD E;  1NHH A;  4JI4 I;  3ZKD A;  2E5L I;  1PIE A;  1U2R A;  3WU4 A;  4JYA E;  1I94 E;  4R1F A;  4MU1 A;  4LF5 E;  2VQF I;  4MU3 A;  1XNR I;  4IZJ A;  4LPF A;  2EFG A;  2WP8 B;  2OI2 A;  3M6A A;  4DR2 I;  3LTO A;  1R6L A;  3B8H A;  1PVG A;  1MG7 A;  2PO0 B;  4JI2 I;  5C0X C;  4DR7 I;  3P3G A;  4JI1 I;  4JV5 E;  2WNR A;  1Y60 A;  3GCM A;  5L3J A;  2NN6 A;  3P76 A;  2JE6 A;  2NN6 B;  2GO3 A;  2VQE I;  2GQ0 A;  3QT6 A;  3J80 Q;  2C39 A;  1H7S A;  4JI5 E;  3D4J A;  2AJ4 A;  2Z5C A;  2DEJ A;  4U3D A;  5GMD A;  3M7N G;  2V8P A;  4IFD C;  5LMU I;  1IBK I;  4FW7 A;  2UXB I;  5K36 B;  1XXE A;  4HY1 A;  2Z5B A;  1HNZ I;  1YH8 A;  2E1R A;  1FNM A;  2BA1 D;  2JEA A;  3DD6 A;  4ZVI A;  3CDJ A;  1Z0C A;  4DR5 E;  1IBK E;  2O1V A;  1Z0G A;  2HFS A;  4IFD D;  1MU5 A;  1ZXM A;  4DPX A;  4B3R I;  4X66 I;  1H72 C;  3T1H I;  3WU3 A;  2V34 A;  4OX9 E;  2ZIT A;  2IES A;  3WU6 A;  2O1U A;  4DV5 E;  1USU A;  4DPY A;  4DV2 E;  4LFA I;  1FWL A;  4JYA I;  2JEB B;  1VI7 A;  3NZK A;  4DR6 E;  4MU0 A;  1N33 I;  4DUZ E;  2C37 B;  2PNM A;  4QNK A;  4FWG A;  4DR5 I;  2Z5C B;  4DV0 E;  2V2V A;  4DV5 I;  2XEX A;  1EA6 A;  1K47 A;  2BA0 G;  1Z0V A;  5JEA F;  4K0K I;  4IZJ B;  2E5L E;  1RRE A;  1EI1 A;  2R42 A;  4LF9 E;  4RPF A;  4PRX A;  1UEK A;  4LFB I;  4HAC B;  4DU7 A;  1HR0 I;  4OKG A;  4OO1 A;  3OTO E;  2ZBK B;  4JI0 E;  1H74 A;  5GME A;  2GO4 A;  3Q6N A;  2BM0 A;  4JI3 I;  1ZM3 A;  5C0X B;  4LF6 I;  4GKJ E;  3T1Y I;  1IBM E;  4OZE A;  4DR4 E;  4WUB A;  4JV5 I;  2CG9 A;  4JI0 I;  2JT2 A;  3ZM7 A;  4LF7 I;  4M1K A;  1UDO A;  3QT5 A;  1N0V C;  3J81 Q;  4ISA A;  2O3Z A;  3PRY A;  4U3B A;  4LF6 E;  4XTJ A;  1E3H A;  5JEA D;  4DV0 I;  1OYP A;  4DR3 I;  5FLX Q;  2IOP A;  1Z5B A;  2UUC I;  4DV6 I;  1XMO I;  1BKN A;  4FW9 A;  4B3S I;  3PS2 A;  2PNZ B;  2J7K A;  5EL9 A;  1S4E A;  4FWD A;  4UT4 A;  5C0X F;  1Y4U A;  4DR3 E;  4GQU A;  4BA1 B;  1OYS A;  5DNX A;  4B3R E;  2GS8 A;  2NN6 E;  3T1H E;  2Z5E A;  5DRO A;  1HK7 A;  3PS1 A;  5C0X E;  4IFD F;  4YY3 E;  4KHP E;  2V2Q A;  4DV2 I;  4LFA E;  3WU5 A;  5IT9 C;  4IFD E;  4B3T I;  1FJG E;  4FN5 A;  3ZZU A;  4BA1 A;  2F4V I;  4AID A;  3M7N D;  3KRN A;  1HNZ E;  4GKK I;  4B3M E;  4DV3 I;  1XNQ E;  1P42 A;  1DAR A;  4DXL A;  2IOQ A;  4JI7 I;  3U1K A;  4YHH E;  1USV A;  4MDT A;  4USK A;  4JG4 A;  4MYT A;  4LFC I;  3GON A;  1FWK A;  5IWA E;  1N34 E;  2HHH E;  4LF5 I;  1ZM9 A;  2CGE A;  3LNU A;  4B3M I;  2HK2 A;  3QT8 A;  3K17 A;  4PRV A;  1OJ4 A;  2BM1 A;  1N32 I;  4OO1 E;  4LFB E;  3PYE A;  4DV1 I;  2PO2 B;  2UUB E;  2O1W A;  1N33 E;  4LFC E;  5K36 F;  1B63 A;  3QT7 A;  5FWK A;  4JI3 E;  4LF8 I;  4USM A;  4DV3 E;  4FWH A;  4Z7C A;  3PS3 A;  2JEA B;  4JI1 E;  3B4T A;  2IER A;  4OO1 F;  2PO1 B;  5K36 C;  5FLX C;  1Y6Z A;  3CWV A;  5DRQ A;  4IFD B;  1XNR E;  2UUC E;  4NBQ A;  4DU8 A;  1XMQ I;  3PYF A;  2CVE A;  4P52 A;  3ZKB A;  4X64 I;  2UXC I;  4DUZ I;  5JEA E;  4FW5 A;  2PO2 A;  4B3S E;  2NN6 C;  4NXM I;  1NHI A;  1XNQ I;  2UXB E;  1S16 A;  2BA0 D;  3HJC A;  1Z0B A;  1HNX E;  4N3O A;  5BR8 E;  4LCH A;  5JEA B;  4KHP I;  4X62 E;  1OYR A;  5LL6 R;  2NN6 F;  2DEI A;  2PNZ A;  1J5E E;  3V2U C;  1NZ0 A;  2NPF A;  4JI4 E;  4NXN E;  1B62 A;  1Z0T A;  4WUC A;  2HFU A;  4DR1 E;  1RHY A;  4HXZ A;  4LF8 E;  5IWA I;  3HKM A;  4JI5 I;  1H73 A;  1ZXN A;  2HKJ A;  1HNW E;  3P3C A;  2F1D A;  3U1Y A;  4DR2 E;  3V5R A;  2BA1 G;  5C0X D;  4BA2 A;  3J81 C;  4K0K E;  3M85 D;  4DV4 I;  1XMQ E;  1HNW I; 
#chains in the Genus database with same CATH homology
 2BV3 A;  2PNL A;  1KTV A;  2HK3 A;  4LF9 I;  2UUA E;  4HAC A;  2X7I A;  1IBL E;  1QZR A;  4DUY I;  4IZJ D;  4GKK E;  1PKP A;  4OX9 I;  1FI4 A;  1N36 E;  3T1Y E;  2UUA I;  4DR4 I;  4WUD A;  4DV4 E;  1KKH A;  1Z5A A;  4KQV A;  1N32 E;  1Z0E A;  1KIJ A;  1IBL I;  1HR0 E;  2UXD I;  3ZZ0 A;  4DV7 E;  1D6T A;  4DV1 E;  2UUB I;  3Q6M A;  2O1T A;  4URL A;  4X65 I;  4JI7 E;  1I94 I;  3PYD A;  3J80 C;  1N0U A;  1ZM4 A;  3Q1Q A;  1N34 I;  4NXN I;  4AQY E;  1Z59 A;  1XHK A;  4GKJ I;  1Z0W A;  3P06 A;  4DUY E;  2ZM6 I;  1Z5C A;  4JI6 E;  4DV7 I;  3K1J A;  2Q2E B;  4DR1 I;  2LJP A;  4NXM E;  4YY3 I;  2CZ9 A;  2V2Z A;  4DPT A;  3JAM Q;  4B3T E;  1FJG I;  4X62 I;  1NHJ A;  3H4L A;  2VF3 A;  2VQF E;  2UU9 I;  5IT9 Q;  1MX0 A;  4YHH I;  4PU9 A;  3F0N A;  1H7U A;  1ELO A;  4DPU A;  3ZZT A;  4EMD A;  2WW4 A;  2UU9 E;  4JI8 I;  5LMN E;  1ZM2 A;  2R3V A;  3B78 A;  4LF7 E;  3JAM C;  1A6F A;  2HKE A;  1FKA E;  4X66 E;  4MYU A;  4ED4 A;  4P7A A;  4AQY I;  1KVK A;  1VIS A;  3B82 A;  3HUL A;  2Z5B B;  4JI8 E;  5LMN I;  2X36 A;  2A2D A;  2ZM6 E;  4I3H A;  4DV6 E;  4X65 E;  2HHH I;  4JI2 E;  4DR7 E;  1XMO E;  5LMU E;  4LF4 E;  1Y4S A;  1RR9 A;  1IBM I;  2A2C A;  4HYM A;  4IZK A;  2UXC E;  4X64 E;  1WUU A;  4DPW A;  4UTG A;  4LF4 I;  2VQE E;  5A2Q C;  4JI6 I;  1N36 I;  3J7A M;  4Z7Y A;  4DR6 I;  3J7A G;  5BR8 I;  3LPS A;  1HNX I;  2F4V E;  3PYG A;  5A2Q Q;  3OTO I;  3K85 A;  4IZK B;  1J5E I;  2UXD E;  1NHH A;  4JI4 I;  3ZKD A;  2E5L I;  1PIE A;  1U2R A;  3WU4 A;  4JYA E;  1I94 E;  4R1F A;  4LF5 E;  2VQF I;  1XNR I;  4IZJ A;  2EFG A;  2OI2 A;  3M6A A;  4DR2 I;  3LTO A;  3B8H A;  1PVG A;  1MG7 A;  4JI2 I;  4DR7 I;  4JI1 I;  4JV5 E;  5L3J A;  2VQE I;  2GQ0 A;  3QT6 A;  3J80 Q;  1H7S A;  4JI5 E;  3D4J A;  2AJ4 A;  2Z5C A;  2DEJ A;  5GMD A;  2V8P A;  5LMU I;  1IBK I;  2UXB I;  4HY1 A;  2Z5B A;  1HNZ I;  2E1R A;  1FNM A;  4ZVI A;  1Z0C A;  4DR5 E;  1IBK E;  2O1V A;  1Z0G A;  2HFS A;  1MU5 A;  1ZXM A;  4DPX A;  4B3R I;  4X66 I;  1H72 C;  3T1H I;  3WU3 A;  2V34 A;  4OX9 E;  2ZIT A;  3WU6 A;  2O1U A;  4DV5 E;  1USU A;  4DPY A;  4DV2 E;  4LFA I;  1FWL A;  4JYA I;  4DR6 E;  1N33 I;  4DUZ E;  2PNM A;  4FWG A;  4DR5 I;  2Z5C B;  4DV0 E;  2V2V A;  4DV5 I;  2XEX A;  1EA6 A;  1K47 A;  1Z0V A;  4K0K I;  4IZJ B;  2E5L E;  1RRE A;  1EI1 A;  2R42 A;  4LF9 E;  4RPF A;  4PRX A;  1UEK A;  4LFB I;  4HAC B;  4DU7 A;  1HR0 I;  3OTO E;  2ZBK B;  4JI0 E;  1H74 A;  5GME A;  3Q6N A;  4JI3 I;  2BM0 A;  1ZM3 A;  4LF6 I;  4GKJ E;  3T1Y I;  1IBM E;  4DR4 E;  4WUB A;  4JV5 I;  2CG9 A;  4JI0 I;  3ZM7 A;  4LF7 I;  4M1K A;  3QT5 A;  1N0V C;  3J81 Q;  3PRY A;  4LF6 E;  4XTJ A;  4DV0 I;  4DR3 I;  5FLX Q;  2IOP A;  1Z5B A;  2UUC I;  4DV6 I;  1XMO I;  1BKN A;  4FW9 A;  4B3S I;  2J7K A;  1S4E A;  4FWD A;  4UT4 A;  1Y4U A;  4DR3 E;  4B3R E;  2GS8 A;  3T1H E;  2Z5E A;  1HK7 A;  4YY3 E;  4KHP E;  2V2Q A;  4DV2 I;  4LFA E;  3WU5 A;  5IT9 C;  4B3T I;  1FJG E;  4FN5 A;  3ZZU A;  2F4V I;  4GKK I;  1HNZ E;  4B3M E;  4DV3 I;  1XNQ E;  1DAR A;  4DXL A;  2IOQ A;  4JI7 I;  4YHH E;  1USV A;  4USK A;  4JG4 A;  4MYT A;  4LFC I;  3GON A;  1FWK A;  5IWA E;  1N34 E;  2HHH E;  4LF5 I;  1ZM9 A;  2CGE A;  3LNU A;  4B3M I;  2HK2 A;  3QT8 A;  3K17 A;  4PRV A;  1OJ4 A;  2BM1 A;  1N32 I;  4LFB E;  2UUB E;  3PYE A;  4DV1 I;  2O1W A;  1N33 E;  4LFC E;  1B63 A;  3QT7 A;  5FWK A;  4JI3 E;  4LF8 I;  4USM A;  4DV3 E;  4FWH A;  4Z7C A;  4JI1 E;  5FLX C;  1Y6Z A;  3CWV A;  1XNR E;  2UUC E;  4DU8 A;  1XMQ I;  3PYF A;  4P52 A;  3ZKB A;  4X64 I;  2UXC I;  4DUZ I;  4B3S E;  4NXM I;  1NHI A;  1XNQ I;  2UXB E;  1S16 A;  3HJC A;  1Z0B A;  1HNX E;  4N3O A;  5BR8 E;  4KHP I;  4X62 E;  5LL6 R;  2DEI A;  1J5E E;  1NZ0 A;  2NPF A;  3V2U C;  4JI4 E;  4NXN E;  1B62 A;  1Z0T A;  4WUC A;  2HFU A;  4DR1 E;  4HXZ A;  4LF8 E;  5IWA I;  4JI5 I;  1H73 A;  1ZXN A;  2HKJ A;  1HNW E;  4DR2 E;  3V5R A;  3J81 C;  4K0K E;  4DV4 I;  1XMQ E;  1HNW I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...