4LFCI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfcI00
4DR2E 4DR3E 3LPSA 4NXNI 4R1FA 4DR1E 1PKPA 4GKJE 4JI1I 4JG4A 3ZKBA 1IBKE 4DUZE 4DV0E 4DV6I 3T1HE 4OX9E 1N0VC 4B3RI 1ZXNA 4DU7A 1I94E 4B3MI 1KKHA 1FWKA 4JV5E 1D6TA 3B82A 2UXCI 1FJGI 4GKKI 4LF6I 1UEKA 4X62E 2UXDE 2J7KA 1OJ4A 2Q2EB 2UUBI 1ZM9A 5LMNE 4USKA 4DV5I 1IBLI 2HK3A 4URLA 1XMQI 3ZKDA 4B3TE 3B8HA 4K0KE 3M6AA 4HYMA 5IWAE 4DR7I 1VISA 1XMOI 4JI0E 2XEXA 4DV4I 2HHHE 3ZZUA 1HNXI 1KTVA 4JI3E 1NZ0A 4X64E 4LF9I 4LF4E 1Z5CA 2F4VE 5A2QQ 4WUBA 2HFSA 4DV2E 4DR4E 1Z0WA 3J80Q 4JI6E 3WU4A 3J7AM 2E5LE 4DV7E 1FI4A 1ZM3A 2ZBKB 4JI7E 2DEJA 4KHPE 1N34I 2BM0A 5LL6R 4JYAI 3WU5A 2R3VA 4B3SI 3LTOA 4LF8E 1Z0BA 4RPFA 5FLXC 4USMA 4YY3I 1PVGA 4DR5I 3K1JA 1ZM4A 3QT8A 1Z59A 3HULA 4KQVA 4DUYE 4Z7CA 4AQYE 4PU9A 4LF7E 1DARA 2ZM6I 4DR6I 1H72C 4FW9A 4NXNE 3PYEA 3JAMC 5IT9C 4DPXA 2UUAI 3J81Q 1J5EI 4DV6E 1A6FA 4B3RE 4LF5I 4ZVIA 2BV3A 2V34A 3T1YE 4B3ME 2UU9I 1N32I 4DR3I 4UTGA 2UXCE 1FJGE 4GKKE 4JI5E 4LFAE 1N33E 3PYDA 4DR1I 1N0UA 4GKJI 4JI8E 1HNWI 4PRXA 1IBKI 4DV1I 4DUZI 4DV0I 3T1HI 1EI1A 4OX9I 2EFGA 1I94I 1Z0VA 1Z0CA 1Z5BA 1XMQE 4FWDA 4DXLA 3OTOE 4JI2I 1NHHA 4MYUA 4JV5I 2V2VA 1HR0I 4EMDA 1HNZI 1Z0GA 2HFUA 1HNXE 3WU3A 1H73A 2DEIA 2UXBI 4NXME 3PYFA 4YHHI 2HK2A 1BKNA 4DV3E 4B3TI 1QZRA 1ZM2A 2VF3A 5LMUI 4DU8A 2A2CA 2R42A 5IWAI 1NHJA 2NPFA 4WUDA 4JI0I 2X7IA 1H74A 2OI2A 1XNRE 2GS8A 4X65I 4WUCA 4X64I 1IBME 1N36I 4LF4I 4LFCI 4DV2I 4DR4I 2VQFI 2UUCI 2VQEE 3V2UC 3K17A 4X66I 2E5LI 1XNQE 5GMDA 4DR6E 4Z7YA 4LFBI 3QT7A 4MYTA 4FWGA 4DPTA 4HXZA 4LF8I 5BR8I 4JI1E 4LF5E 2A2DA 4JI4I 3J7AG 1Z5AA 1Z0EA 4DUYI 4FWHA 4P7AA 4AQYI 2UU9E 1PIEA 4LF7I 1N32E 2V2ZA 4FN5A 1Z0TA 1MU5A 1B63A 3H4LA 2V8PA 4DR2I 4DPWA 5A2QC 2E1RA 4I3HA 1B62A 3J80C 3D4JA 1ZXMA 4LF6E 1HNWE 4DV1E 3ZM7A 3GONA 2UUBE 3PYGA 1ELOA 2ZITA 1MG7A 4DV5E 3T1YI 1K47A 1FNMA 1IBLE 2X36A 4JI2E 3Q1QA 1HR0E 3LNUA 1HNZE 5FLXQ 4HACB 4JI5I 4LFAI 3V5RA 1N33I 3F0NA 4PRVA 4DR7E 4JI8I 2LJPA 4HACA 4UT4A 4X62I 1XMOE 2UXDI 1KVKA 2HKJA 3CWVA 2WW4A 4DV4E 4ED4A 2UXBE 1KIJA 5LMNI 4YHHE 4LF9E 1RREA 4P52A 4XTJA 3OTOI 5IT9Q 3JAMQ 3J81C 5LMUE 1U2RA 2V2QA 4K0KI 3QT5A 4DPUA 1H7SA 1NHIA 2AJ4A 1N34E 1XHKA 4JYAE 4X65E 2HHHI 1FWLA 1N36E 4NXMI 4HY1A 4JI3I 4B3SE 2CZ9A 5L3JA 4LFCE 2VQFE 2UUCE 5GMEA 4M1KA 1EA6A 4DV3I 2F4VI 4YY3E 4DR5E 4X66E 4JI6I 1S4EA 4DV7I 3QT6A 4JI7I 2ZM6E 4LFBE 1H7UA 4KHPI 2BM1A 1XNRI 1IBMI 5BR8E 4DPYA 1S16A 3WU6A 2HKEA 2UUAE 2VQEI 3ZZTA 1J5EE 1MX0A 4JI4E 3ZZ0A 1FKAE 1WUUA 1XNQI 1RR9A 3B78A
chains in the Genus database with same CATH superfamily
4DR2E 3GMEA 4DR3E 3LPSA 4IFDE 4IFDF 4IZKB 1OYRA 4NXNI 4R1FA 4DR1E 1PKPA 4GKJE 4JI1I 1YHCA 4IZKA 4JG4A 3ZKBA 4AIMA 1IBKE 4DUZE 4DV0E 4DV6I 3T1HE 4FW3A 4OX9E 1Y4UA 1N0VC 2O1UA 4B3RI 1ZXNA 4DU7A 1I94E 4B3MI 5DROA 5C0XF 5C0XE 2GO3A 1KKHA 1FWKA 4JV5E 3P06A 1D6TA 4BA2B 3B82A 2UXCI 1FJGI 4GKKI 5K36B 4LF6I 1UEKA 2Z5CB 4X62E 2UXDE 2J7KA 4BA2A 1OJ4A 2Q2EB 3UHMA 5K36A 2UUBI 2O1VA 1ZM9A 2Z5CA 5LMNE 4USKA 4DV5I 1E3PA 1IBLI 2C38B 2HK3A 4URLA 1XMQI 1R6MA 3ZKDA 4B3TE 2C38A 3B8HA 4K0KE 3M6AA 4FW6A 4HYMA 5IWAE 2IOQA 4DR7I 1P42A 1VISA 1XMOI 4JI0E 2GO4A 2GQ0A 2XEXA 4DV4I 2F1DA 5K36C 2HHHE 3ZZUA 1HNXI 1KTVA 4JI3E 1NZ0A 2PNLA 4X64E 4LF9I 4OKGA 4LF4E 1Z5CA 2F4VE 4LOMA 5A2QQ 4WUBA 5FWKA 2HFSA 4DV2E 4DR4E 3Q6NA 2O1TA 1Z0WA 3J80Q 4JI6E 3WU4A 3J7AM 3CDJA 2E5LE 2BA0D 4DV7E 1FI4A 1ZM3A 2ZBKB 4JI7E 2DEJA 1E3HA 2IERA 2BA1G 4GQUA 4KHPE 1N34I 3PS3A 3M7NG 2BM0A 5LL6R 4JYAI 3WU5A 2R3VA 1YH8A 4B3SI 3LTOA 4LF8E 1Z0BA 4RPFA 5FLXC 4ISAA 4USMA 5DNLA 4YY3I 5EL9A 1PVGA 4DR5I 3K1JA 1ZM4A 3QT8A 1Z59A 3HULA 3NZKA 4KQVA 4DUYE 4Z7CA 4AQYE 4FW4A 4PU9A 4LF7E 1DARA 1R6LA 2ZM6I 4OO1B 4DR6I 1H72C 2JE6B 4FW9A 4OO1A 2PO2B 4NXNE 3PYEA 3JAMC 5IT9C 4DPXA 3PS1A 4AM3A 4AIDA 2UUAI 2JE6A 2C37B 4LCHA 3J81Q 3M85D 1J5EI 2PO2A 4DV6E 3P76A 1A6FA 4B3RE 4LF5I 2VESA 4ZVIA 1Y60A 2C37A 2BV3A 2V34A 4FW5A 3T1YE 4B3ME 2UU9I 4OO1D 5K36E 2PO0B 1N32I 1Y6ZA 2BR2B 4DR3I 4UTGA 2UXCE 2AE8A 1FJGE 2PO0A 4GKKE 4OO1C 4JI5E 2PNMA 2BR2A 4LFAE 1N33E 3PYDA 2O3ZA 4DR1I 1N0UA 4GKJI 2PO1B 3GLLA 2WNRB 2Z5EA 4JI8E 1HNWI 4PRXA 1IBKI 4DV1I 4IFDB 4DUZI 4DV0I 3T1HI 1EI1A 4OX9I 2EFGA 2PO1A 2WNRA 1I94I 1Z0VA 4IFDA 1Z0CA 1Z5BA 1XMQE 4MDTA 1USVA 4FWDA 4DXLA 3OTOE 4JI2I 1NHHA 4MQYA 4MYUA 4JV5I 2V2VA 1HR0I 4EMDA 1HNZI 5C0XB 1HK7A 3HKMA 3PS2A 5K36D 5EKWA 1Z0GA 4MU1A 3DD6A 2HFUA 1UDQA 5C0XA 4LPFA 1HNXE 2Z5BB 2JEAB 3WU3A 1H73A 2DEIA 2UXBI 4NXME 3CDIA 3L7ZB 3PYFA 4LCGA 4YHHI 2Z5BA 2JEAA 2HK2A 1BKNA 1XXEA 2C39B 4DV3E 4B3TI 1QZRA 3L7ZA 5DRRA 3U1YA 1ZM2A 2NN6B 2VF3A 3P3GA 4J3DA 3PRYA 5JEAB 5LMUI 4DU8A 2A2CA 2C39A 2R42A 5IWAI 1NHJA 2NN6A 2NPFA 5JEAA 4WUDA 4JI0I 4BA1B 5C0XC 2X7IA 1H74A 2OI2A 4FW7A 2JT2A 1XNRE 2GS8A 4X65I 4WUCA 4X64I 1IBME 1N36I 4BA1A 4LF4I 4LFCI 4DV2I 4DR4I 2VQFI 2UUCI 2VQEE 4OO1E 4OO1F 2NN6D 5DRPA 3V2UC 5JEAD 3K17A 4X66I 2E5LI 1XNQE 4N3OA 5ELWA 3P3CA 5GMDA 4DR6E 4Z7YA 2NN6C 5JEAC 3B4TA 4LFBI 3QT7A 4MYTA 4FWGA 4DPTA 4HXZA 2BA0G 4LF8I 5BR8I 3HJCA 4JI1E 4QNKA 4LF5E 2A2DA 4JI4I 1USUA 3J7AG 1Z5AA 1Z0EA 4OZEA 4DUYI 4FWHA 4P7AA 4AQYI 2UU9E 1PIEA 4LF7I 1N32E 4MU3A 2V2ZA 4FN5A 1Z0TA 1MU5A 1B63A 3H4LA 2V8PA 5K36F 4DR2I 4DPWA 5A2QC 2E1RA 4I3HA 1B62A 2WP8B 3J80C 3D4JA 1ZXMA 4LF6E 1UDOA 4QNJA 1HNWE 4DV1E 3ZM7A 1OYPA 3GONA 2WP8A 2PNZB 2UUBE 3PYGA 1ELOA 2ZITA 1MG7A 4DV5E 3T1YI 1K47A 3P3EA 1FNMA 5DNXA 1IBLE 4NBQA 2PNZA 2X36A 5DRQA 4JI2E 3Q1QA 3M85G 1HR0E 3LNUA 1HNZE 5FLXQ 4HACB 4JI5I 4LFAI 3V5RA 1N33I 3F0NA 4MU4A 4PRVA 4DR7E 4JI8I 2LJPA 4HACA 4UT4A 4X62I 1XMOE 2UXDI 1KVKA 4IFDD 2HKJA 3CWVA 2WW4A 4DV4E 1OYSA 4ED4A 2UXBE 2CG9A 1KIJA 5LMNI 2NN6F 2NN6E 5JEAF 5JEAE 4YHHE 4LF9E 1RREA 2BA1D 4P52A 2CGEA 4IFDC 3M7ND 4XTJA 3OTOI 2IOPA 3K85A 4IZJB 3JAMQ 5IT9Q 3GCMA 3J81C 1U2RA 5LMUE 2V2QA 3H1CA 2CVEA 4K0KI 5C0XD 3QT5A 4IZJA 4DPUA 3Q6MA 1H7SA 1NHIA 2AJ4A 1UDSA 1N34E 1XHKA 3KRNA 4JYAE 4X65E 2HHHI 1FWLA 1N36E 4NXMI 4HY1A 4JI3I 4B3SE 2CZ9A 5L3JA 4LFCE 2VQFE 2UUCE 5GMEA 4M1KA 1EA6A 4DV3I 2F4VI 2J65A 1UDNA 2O1WA 1VI7A 4YY3E 4IZJD 4DR5E 4X66E 4JI6I 1Y4SA 1S4EA 4DV7I 3QT6A 3U1KA 4U3DA 4JI7I 2ZM6E 2IESA 1H7UA 4LFBE 4KHPI 2BM1A 1XNRI 1RHYA 1IBMI 4MU0A 5BR8E 4DPYA 1S16A 3WU6A 2HKEA 2UUAE 2VQEI 3ZZTA 1J5EE 1MX0A 4LCFA 4JI4E 3ZZ0A 1FKAE 4U3BA 1WUUA 2JEBB 1XNQI 1RR9A 3B78A 4IS9A 1Y5YA 2JEBA
chains in the Genus database with same CATH topology
4DR2E 4DR3E 3LPSA 4IZKB 4NXNI 4R1FA 4DR1E 1PKPA 4GKJE 4JI1I 4IZKA 4JG4A 3ZKBA 1IBKE 4DUZE 4DV0E 4DV6I 3T1HE 4OX9E 1Y4UA 1N0VC 2O1UA 4B3RI 1ZXNA 4DU7A 1I94E 4B3MI 1KKHA 1FWKA 4JV5E 3P06A 1D6TA 3B82A 2UXCI 1FJGI 4GKKI 4LF6I 1UEKA 2Z5CB 4X62E 2UXDE 2J7KA 1OJ4A 2Q2EB 2UUBI 2O1VA 1ZM9A 2Z5CA 5LMNE 4USKA 4DV5I 1IBLI 2HK3A 4URLA 1XMQI 3ZKDA 4B3TE 3B8HA 4K0KE 3M6AA 4HYMA 5IWAE 2IOQA 4DR7I 1VISA 1XMOI 4JI0E 2GQ0A 2XEXA 4DV4I 2HHHE 3ZZUA 1HNXI 1KTVA 4JI3E 1NZ0A 2PNLA 4X64E 4LF9I 4LF4E 1Z5CA 2F4VE 5A2QQ 4WUBA 5FWKA 2HFSA 4DV2E 4DR4E 3Q6NA 2O1TA 1Z0WA 3J80Q 4JI6E 3WU4A 3J7AM 2E5LE 4DV7E 1FI4A 1ZM3A 2ZBKB 4JI7E 2DEJA 4KHPE 1N34I 2BM0A 5LL6R 4JYAI 3WU5A 2R3VA 4B3SI 3LTOA 4LF8E 1Z0BA 4RPFA 5FLXC 4USMA 4YY3I 1PVGA 4DR5I 3K1JA 1ZM4A 3QT8A 1Z59A 3HULA 4KQVA 4DUYE 4Z7CA 4AQYE 4PU9A 4LF7E 1DARA 2ZM6I 4DR6I 1H72C 4FW9A 4NXNE 3PYEA 3JAMC 5IT9C 4DPXA 2UUAI 3J81Q 1J5EI 4DV6E 1A6FA 4B3RE 4LF5I 4ZVIA 2BV3A 2V34A 3T1YE 4B3ME 2UU9I 1N32I 1Y6ZA 4DR3I 4UTGA 2UXCE 1FJGE 4GKKE 4JI5E 2PNMA 4LFAE 1N33E 3PYDA 4DR1I 1N0UA 4GKJI 4JI8E 2Z5EA 1HNWI 4PRXA 1IBKI 4DV1I 4DUZI 4DV0I 3T1HI 1EI1A 4OX9I 2EFGA 1I94I 1Z0VA 1Z0CA 1Z5BA 1XMQE 1USVA 4FWDA 4DXLA 3OTOE 4JI2I 1NHHA 4MYUA 4JV5I 2V2VA 1HR0I 4EMDA 1HNZI 1HK7A 1Z0GA 2HFUA 1HNXE 2Z5BB 3WU3A 1H73A 2DEIA 2UXBI 4NXME 3PYFA 4YHHI 2Z5BA 2HK2A 1BKNA 4DV3E 4B3TI 1QZRA 1ZM2A 2VF3A 3PRYA 5LMUI 4DU8A 2A2CA 2R42A 5IWAI 1NHJA 2NPFA 4WUDA 4JI0I 2X7IA 1H74A 2OI2A 1XNRE 2GS8A 4X65I 4WUCA 4X64I 1IBME 1N36I 4LF4I 4LFCI 4DV2I 4DR4I 2VQFI 2UUCI 2VQEE 3V2UC 3K17A 4X66I 2E5LI 1XNQE 4N3OA 5GMDA 4DR6E 4Z7YA 4LFBI 3QT7A 4MYTA 4FWGA 4DPTA 4HXZA 4LF8I 5BR8I 3HJCA 4JI1E 4LF5E 2A2DA 4JI4I 1USUA 3J7AG 1Z5AA 1Z0EA 4DUYI 4FWHA 4P7AA 4AQYI 2UU9E 1PIEA 4LF7I 1N32E 2V2ZA 4FN5A 1Z0TA 1MU5A 1B63A 3H4LA 2V8PA 4DR2I 4DPWA 5A2QC 2E1RA 4I3HA 1B62A 3J80C 3D4JA 1ZXMA 4LF6E 1HNWE 4DV1E 3ZM7A 3GONA 2UUBE 3PYGA 1ELOA 2ZITA 1MG7A 4DV5E 3T1YI 1K47A 1FNMA 1IBLE 2X36A 4JI2E 3Q1QA 1HR0E 3LNUA 1HNZE 5FLXQ 4HACB 4JI5I 4LFAI 3V5RA 1N33I 3F0NA 4PRVA 4DR7E 4JI8I 2LJPA 4HACA 4UT4A 4X62I 1XMOE 2UXDI 1KVKA 2HKJA 3CWVA 2WW4A 4DV4E 4ED4A 2UXBE 2CG9A 1KIJA 5LMNI 4YHHE 4LF9E 1RREA 4P52A 2CGEA 4XTJA 3OTOI 2IOPA 3K85A 4IZJB 3JAMQ 5IT9Q 3J81C 5LMUE 1U2RA 2V2QA 4K0KI 3QT5A 4IZJA 4DPUA 3Q6MA 1H7SA 1NHIA 2AJ4A 1N34E 1XHKA 4JYAE 4X65E 2HHHI 1FWLA 1N36E 4NXMI 4HY1A 4JI3I 4B3SE 2CZ9A 5L3JA 4LFCE 2VQFE 2UUCE 5GMEA 4M1KA 1EA6A 4DV3I 2F4VI 2O1WA 4YY3E 4IZJD 4DR5E 4X66E 4JI6I 1Y4SA 1S4EA 4DV7I 3QT6A 4JI7I 2ZM6E 4LFBE 1H7UA 4KHPI 2BM1A 1XNRI 1IBMI 5BR8E 4DPYA 1S16A 3WU6A 2HKEA 2UUAE 2VQEI 3ZZTA 1J5EE 1MX0A 4JI4E 3ZZ0A 1FKAE 1WUUA 1XNQI 1RR9A 3B78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 E;  4DR3 E;  3LPS A;  4NXN I;  4R1F A;  4DR1 E;  1PKP A;  4GKJ E;  4JI1 I;  4JG4 A;  3ZKB A;  1IBK E;  4DUZ E;  4DV0 E;  4DV6 I;  3T1H E;  4OX9 E;  1N0V C;  4B3R I;  1ZXN A;  4DU7 A;  1I94 E;  4B3M I;  1KKH A;  1FWK A;  4JV5 E;  1D6T A;  3B82 A;  2UXC I;  1FJG I;  4GKK I;  4LF6 I;  1UEK A;  4X62 E;  2UXD E;  2J7K A;  1OJ4 A;  2Q2E B;  2UUB I;  1ZM9 A;  5LMN E;  4USK A;  4DV5 I;  1IBL I;  2HK3 A;  4URL A;  1XMQ I;  3ZKD A;  4B3T E;  3B8H A;  4K0K E;  3M6A A;  4HYM A;  5IWA E;  4DR7 I;  1VIS A;  1XMO I;  4JI0 E;  2XEX A;  4DV4 I;  2HHH E;  3ZZU A;  1HNX I;  1KTV A;  4JI3 E;  1NZ0 A;  4X64 E;  4LF9 I;  4LF4 E;  1Z5C A;  2F4V E;  5A2Q Q;  4WUB A;  2HFS A;  4DV2 E;  4DR4 E;  1Z0W A;  3J80 Q;  4JI6 E;  3WU4 A;  3J7A M;  2E5L E;  4DV7 E;  1FI4 A;  1ZM3 A;  2ZBK B;  4JI7 E;  2DEJ A;  4KHP E;  1N34 I;  2BM0 A;  5LL6 R;  4JYA I;  3WU5 A;  2R3V A;  4B3S I;  3LTO A;  4LF8 E;  1Z0B A;  4RPF A;  5FLX C;  4USM A;  4YY3 I;  1PVG A;  4DR5 I;  3K1J A;  1ZM4 A;  3QT8 A;  1Z59 A;  3HUL A;  4KQV A;  4DUY E;  4Z7C A;  4AQY E;  4PU9 A;  4LF7 E;  1DAR A;  2ZM6 I;  4DR6 I;  1H72 C;  4FW9 A;  4NXN E;  3PYE A;  3JAM C;  5IT9 C;  4DPX A;  2UUA I;  3J81 Q;  1J5E I;  4DV6 E;  1A6F A;  4B3R E;  4LF5 I;  4ZVI A;  2BV3 A;  2V34 A;  3T1Y E;  4B3M E;  2UU9 I;  1N32 I;  4DR3 I;  4UTG A;  2UXC E;  1FJG E;  4GKK E;  4JI5 E;  4LFA E;  1N33 E;  3PYD A;  4DR1 I;  1N0U A;  4GKJ I;  4JI8 E;  1HNW I;  4PRX A;  1IBK I;  4DV1 I;  4DUZ I;  4DV0 I;  3T1H I;  1EI1 A;  4OX9 I;  2EFG A;  1I94 I;  1Z0V A;  1Z0C A;  1Z5B A;  1XMQ E;  4FWD A;  4DXL A;  3OTO E;  4JI2 I;  1NHH A;  4MYU A;  4JV5 I;  2V2V A;  1HR0 I;  4EMD A;  1HNZ I;  1Z0G A;  2HFU A;  1HNX E;  3WU3 A;  1H73 A;  2DEI A;  2UXB I;  4NXM E;  3PYF A;  4YHH I;  2HK2 A;  1BKN A;  4DV3 E;  4B3T I;  1QZR A;  1ZM2 A;  2VF3 A;  5LMU I;  4DU8 A;  2A2C A;  2R42 A;  5IWA I;  1NHJ A;  2NPF A;  4WUD A;  4JI0 I;  2X7I A;  1H74 A;  2OI2 A;  1XNR E;  2GS8 A;  4X65 I;  4WUC A;  4X64 I;  1IBM E;  1N36 I;  4LF4 I;  4LFC I;  4DV2 I;  4DR4 I;  2VQF I;  2UUC I;  2VQE E;  3V2U C;  3K17 A;  4X66 I;  2E5L I;  1XNQ E;  5GMD A;  4DR6 E;  4Z7Y A;  4LFB I;  3QT7 A;  4MYT A;  4FWG A;  4DPT A;  4HXZ A;  4LF8 I;  5BR8 I;  4JI1 E;  4LF5 E;  2A2D A;  4JI4 I;  3J7A G;  1Z5A A;  1Z0E A;  4DUY I;  4FWH A;  4P7A A;  4AQY I;  2UU9 E;  1PIE A;  4LF7 I;  1N32 E;  2V2Z A;  4FN5 A;  1Z0T A;  1MU5 A;  1B63 A;  3H4L A;  2V8P A;  4DR2 I;  4DPW A;  5A2Q C;  2E1R A;  4I3H A;  1B62 A;  3J80 C;  3D4J A;  1ZXM A;  4LF6 E;  1HNW E;  4DV1 E;  3ZM7 A;  3GON A;  2UUB E;  3PYG A;  1ELO A;  2ZIT A;  1MG7 A;  4DV5 E;  3T1Y I;  1K47 A;  1FNM A;  1IBL E;  2X36 A;  4JI2 E;  3Q1Q A;  1HR0 E;  3LNU A;  1HNZ E;  5FLX Q;  4HAC B;  4JI5 I;  4LFA I;  3V5R A;  1N33 I;  3F0N A;  4PRV A;  4DR7 E;  4JI8 I;  2LJP A;  4HAC A;  4UT4 A;  4X62 I;  1XMO E;  2UXD I;  1KVK A;  2HKJ A;  3CWV A;  2WW4 A;  4DV4 E;  4ED4 A;  2UXB E;  1KIJ A;  5LMN I;  4YHH E;  4LF9 E;  1RRE A;  4P52 A;  4XTJ A;  3OTO I;  5IT9 Q;  3JAM Q;  3J81 C;  5LMU E;  1U2R A;  2V2Q A;  4K0K I;  3QT5 A;  4DPU A;  1H7S A;  1NHI A;  2AJ4 A;  1N34 E;  1XHK A;  4JYA E;  4X65 E;  2HHH I;  1FWL A;  1N36 E;  4NXM I;  4HY1 A;  4JI3 I;  4B3S E;  2CZ9 A;  5L3J A;  4LFC E;  2VQF E;  2UUC E;  5GME A;  4M1K A;  1EA6 A;  4DV3 I;  2F4V I;  4YY3 E;  4DR5 E;  4X66 E;  4JI6 I;  1S4E A;  4DV7 I;  3QT6 A;  4JI7 I;  2ZM6 E;  4LFB E;  1H7U A;  4KHP I;  2BM1 A;  1XNR I;  1IBM I;  5BR8 E;  4DPY A;  1S16 A;  3WU6 A;  2HKE A;  2UUA E;  2VQE I;  3ZZT A;  1J5E E;  1MX0 A;  4JI4 E;  3ZZ0 A;  1FKA E;  1WUU A;  1XNQ I;  1RR9 A;  3B78 A; 
#chains in the Genus database with same CATH topology
 4DR2 E;  3GME A;  4DR3 E;  3LPS A;  4IFD E;  4IFD F;  4IZK B;  1OYR A;  4NXN I;  4R1F A;  4DR1 E;  1PKP A;  4GKJ E;  4JI1 I;  1YHC A;  4IZK A;  4JG4 A;  3ZKB A;  4AIM A;  1IBK E;  4DUZ E;  4DV0 E;  4DV6 I;  3T1H E;  4FW3 A;  4OX9 E;  1Y4U A;  1N0V C;  2O1U A;  4B3R I;  1ZXN A;  4DU7 A;  1I94 E;  4B3M I;  5DRO A;  5C0X F;  5C0X E;  2GO3 A;  1KKH A;  1FWK A;  4JV5 E;  3P06 A;  1D6T A;  4BA2 B;  3B82 A;  2UXC I;  1FJG I;  4GKK I;  5K36 B;  4LF6 I;  1UEK A;  2Z5C B;  4X62 E;  2UXD E;  2J7K A;  4BA2 A;  1OJ4 A;  2Q2E B;  3UHM A;  5K36 A;  2UUB I;  2O1V A;  1ZM9 A;  2Z5C A;  5LMN E;  4USK A;  4DV5 I;  1E3P A;  1IBL I;  2C38 B;  2HK3 A;  4URL A;  1XMQ I;  1R6M A;  3ZKD A;  4B3T E;  2C38 A;  3B8H A;  4K0K E;  3M6A A;  4FW6 A;  4HYM A;  5IWA E;  2IOQ A;  4DR7 I;  1P42 A;  1VIS A;  1XMO I;  4JI0 E;  2GO4 A;  2GQ0 A;  2XEX A;  4DV4 I;  2F1D A;  5K36 C;  2HHH E;  3ZZU A;  1HNX I;  1KTV A;  4JI3 E;  1NZ0 A;  2PNL A;  4X64 E;  4LF9 I;  4OKG A;  4LF4 E;  1Z5C A;  2F4V E;  4LOM A;  5A2Q Q;  4WUB A;  5FWK A;  2HFS A;  4DV2 E;  4DR4 E;  3Q6N A;  2O1T A;  1Z0W A;  3J80 Q;  4JI6 E;  3WU4 A;  3J7A M;  3CDJ A;  2E5L E;  2BA0 D;  4DV7 E;  1FI4 A;  1ZM3 A;  2ZBK B;  4JI7 E;  2DEJ A;  1E3H A;  2IER A;  2BA1 G;  4GQU A;  4KHP E;  1N34 I;  3PS3 A;  3M7N G;  2BM0 A;  5LL6 R;  4JYA I;  3WU5 A;  2R3V A;  1YH8 A;  4B3S I;  3LTO A;  4LF8 E;  1Z0B A;  4RPF A;  5FLX C;  4ISA A;  4USM A;  5DNL A;  4YY3 I;  5EL9 A;  1PVG A;  4DR5 I;  3K1J A;  1ZM4 A;  3QT8 A;  1Z59 A;  3HUL A;  3NZK A;  4KQV A;  4DUY E;  4Z7C A;  4AQY E;  4FW4 A;  4PU9 A;  4LF7 E;  1DAR A;  1R6L A;  2ZM6 I;  4OO1 B;  4DR6 I;  1H72 C;  2JE6 B;  4FW9 A;  4OO1 A;  2PO2 B;  4NXN E;  3PYE A;  3JAM C;  5IT9 C;  4DPX A;  3PS1 A;  4AM3 A;  4AID A;  2UUA I;  2JE6 A;  2C37 B;  4LCH A;  3J81 Q;  3M85 D;  1J5E I;  2PO2 A;  4DV6 E;  3P76 A;  1A6F A;  4B3R E;  4LF5 I;  2VES A;  4ZVI A;  1Y60 A;  2C37 A;  2BV3 A;  2V34 A;  4FW5 A;  3T1Y E;  4B3M E;  2UU9 I;  4OO1 D;  5K36 E;  2PO0 B;  1N32 I;  1Y6Z A;  2BR2 B;  4DR3 I;  4UTG A;  2UXC E;  2AE8 A;  1FJG E;  2PO0 A;  4GKK E;  4OO1 C;  4JI5 E;  2PNM A;  2BR2 A;  4LFA E;  1N33 E;  3PYD A;  2O3Z A;  4DR1 I;  1N0U A;  4GKJ I;  2PO1 B;  3GLL A;  2WNR B;  2Z5E A;  4JI8 E;  1HNW I;  4PRX A;  1IBK I;  4DV1 I;  4IFD B;  4DUZ I;  4DV0 I;  3T1H I;  1EI1 A;  4OX9 I;  2EFG A;  2PO1 A;  2WNR A;  1I94 I;  1Z0V A;  4IFD A;  1Z0C A;  1Z5B A;  1XMQ E;  4MDT A;  1USV A;  4FWD A;  4DXL A;  3OTO E;  4JI2 I;  1NHH A;  4MQY A;  4MYU A;  4JV5 I;  2V2V A;  1HR0 I;  4EMD A;  1HNZ I;  5C0X B;  1HK7 A;  3HKM A;  3PS2 A;  5K36 D;  5EKW A;  1Z0G A;  4MU1 A;  3DD6 A;  2HFU A;  1UDQ A;  5C0X A;  4LPF A;  1HNX E;  2Z5B B;  2JEA B;  3WU3 A;  1H73 A;  2DEI A;  2UXB I;  4NXM E;  3CDI A;  3L7Z B;  3PYF A;  4LCG A;  4YHH I;  2Z5B A;  2JEA A;  2HK2 A;  1BKN A;  1XXE A;  2C39 B;  4DV3 E;  4B3T I;  1QZR A;  3L7Z A;  5DRR A;  3U1Y A;  1ZM2 A;  2NN6 B;  2VF3 A;  3P3G A;  4J3D A;  3PRY A;  5JEA B;  5LMU I;  4DU8 A;  2A2C A;  2C39 A;  2R42 A;  5IWA I;  1NHJ A;  2NN6 A;  2NPF A;  5JEA A;  4WUD A;  4JI0 I;  4BA1 B;  5C0X C;  2X7I A;  1H74 A;  2OI2 A;  4FW7 A;  2JT2 A;  1XNR E;  2GS8 A;  4X65 I;  4WUC A;  4X64 I;  1IBM E;  1N36 I;  4BA1 A;  4LF4 I;  4LFC I;  4DV2 I;  4DR4 I;  2VQF I;  2UUC I;  2VQE E;  4OO1 E;  4OO1 F;  2NN6 D;  5DRP A;  3V2U C;  5JEA D;  3K17 A;  4X66 I;  2E5L I;  1XNQ E;  4N3O A;  5ELW A;  3P3C A;  5GMD A;  4DR6 E;  4Z7Y A;  2NN6 C;  5JEA C;  3B4T A;  4LFB I;  3QT7 A;  4MYT A;  4FWG A;  4DPT A;  4HXZ A;  2BA0 G;  4LF8 I;  5BR8 I;  3HJC A;  4JI1 E;  4QNK A;  4LF5 E;  2A2D A;  4JI4 I;  1USU A;  3J7A G;  1Z5A A;  1Z0E A;  4OZE A;  4DUY I;  4FWH A;  4P7A A;  4AQY I;  2UU9 E;  1PIE A;  4LF7 I;  1N32 E;  4MU3 A;  2V2Z A;  4FN5 A;  1Z0T A;  1MU5 A;  1B63 A;  3H4L A;  2V8P A;  5K36 F;  4DR2 I;  4DPW A;  5A2Q C;  2E1R A;  4I3H A;  1B62 A;  2WP8 B;  3J80 C;  3D4J A;  1ZXM A;  4LF6 E;  1UDO A;  4QNJ A;  1HNW E;  4DV1 E;  3ZM7 A;  1OYP A;  3GON A;  2WP8 A;  2PNZ B;  2UUB E;  3PYG A;  1ELO A;  2ZIT A;  1MG7 A;  4DV5 E;  3T1Y I;  1K47 A;  3P3E A;  1FNM A;  5DNX A;  1IBL E;  4NBQ A;  2PNZ A;  2X36 A;  5DRQ A;  4JI2 E;  3Q1Q A;  3M85 G;  1HR0 E;  3LNU A;  1HNZ E;  5FLX Q;  4HAC B;  4JI5 I;  4LFA I;  3V5R A;  1N33 I;  3F0N A;  4MU4 A;  4PRV A;  4DR7 E;  4JI8 I;  2LJP A;  4HAC A;  4UT4 A;  4X62 I;  1XMO E;  2UXD I;  1KVK A;  4IFD D;  2HKJ A;  3CWV A;  2WW4 A;  4DV4 E;  1OYS A;  4ED4 A;  2UXB E;  2CG9 A;  1KIJ A;  5LMN I;  2NN6 F;  2NN6 E;  5JEA F;  5JEA E;  4YHH E;  4LF9 E;  1RRE A;  2BA1 D;  4P52 A;  2CGE A;  4IFD C;  3M7N D;  4XTJ A;  3OTO I;  2IOP A;  3K85 A;  4IZJ B;  3JAM Q;  5IT9 Q;  3GCM A;  3J81 C;  1U2R A;  5LMU E;  2V2Q A;  3H1C A;  2CVE A;  4K0K I;  5C0X D;  3QT5 A;  4IZJ A;  4DPU A;  3Q6M A;  1H7S A;  1NHI A;  2AJ4 A;  1UDS A;  1N34 E;  1XHK A;  3KRN A;  4JYA E;  4X65 E;  2HHH I;  1FWL A;  1N36 E;  4NXM I;  4HY1 A;  4JI3 I;  4B3S E;  2CZ9 A;  5L3J A;  4LFC E;  2VQF E;  2UUC E;  5GME A;  4M1K A;  1EA6 A;  4DV3 I;  2F4V I;  2J65 A;  1UDN A;  2O1W A;  1VI7 A;  4YY3 E;  4IZJ D;  4DR5 E;  4X66 E;  4JI6 I;  1Y4S A;  1S4E A;  4DV7 I;  3QT6 A;  3U1K A;  4U3D A;  4JI7 I;  2ZM6 E;  2IES A;  1H7U A;  4LFB E;  4KHP I;  2BM1 A;  1XNR I;  1RHY A;  1IBM I;  4MU0 A;  5BR8 E;  4DPY A;  1S16 A;  3WU6 A;  2HKE A;  2UUA E;  2VQE I;  3ZZT A;  1J5E E;  1MX0 A;  4LCF A;  4JI4 E;  3ZZ0 A;  1FKA E;  4U3B A;  1WUU A;  2JEB B;  1XNQ I;  1RR9 A;  3B78 A;  4IS9 A;  1Y5Y A;  2JEB A; 
#chains in the Genus database with same CATH homology
 4DR2 E;  4DR3 E;  3LPS A;  4IZK B;  4NXN I;  4R1F A;  4DR1 E;  1PKP A;  4GKJ E;  4JI1 I;  4IZK A;  4JG4 A;  3ZKB A;  1IBK E;  4DUZ E;  4DV0 E;  4DV6 I;  3T1H E;  4OX9 E;  1Y4U A;  1N0V C;  2O1U A;  4B3R I;  1ZXN A;  4DU7 A;  1I94 E;  4B3M I;  1KKH A;  1FWK A;  4JV5 E;  3P06 A;  1D6T A;  3B82 A;  2UXC I;  1FJG I;  4GKK I;  4LF6 I;  1UEK A;  2Z5C B;  4X62 E;  2UXD E;  2J7K A;  1OJ4 A;  2Q2E B;  2UUB I;  2O1V A;  1ZM9 A;  2Z5C A;  5LMN E;  4USK A;  4DV5 I;  1IBL I;  2HK3 A;  4URL A;  1XMQ I;  3ZKD A;  4B3T E;  3B8H A;  4K0K E;  3M6A A;  4HYM A;  5IWA E;  2IOQ A;  4DR7 I;  1VIS A;  1XMO I;  4JI0 E;  2GQ0 A;  2XEX A;  4DV4 I;  2HHH E;  3ZZU A;  1HNX I;  1KTV A;  4JI3 E;  1NZ0 A;  2PNL A;  4X64 E;  4LF9 I;  4LF4 E;  1Z5C A;  2F4V E;  5A2Q Q;  4WUB A;  5FWK A;  2HFS A;  4DV2 E;  4DR4 E;  3Q6N A;  2O1T A;  1Z0W A;  3J80 Q;  4JI6 E;  3WU4 A;  3J7A M;  2E5L E;  4DV7 E;  1FI4 A;  1ZM3 A;  2ZBK B;  4JI7 E;  2DEJ A;  4KHP E;  1N34 I;  2BM0 A;  5LL6 R;  4JYA I;  3WU5 A;  2R3V A;  4B3S I;  3LTO A;  4LF8 E;  1Z0B A;  4RPF A;  5FLX C;  4USM A;  4YY3 I;  1PVG A;  4DR5 I;  3K1J A;  1ZM4 A;  3QT8 A;  1Z59 A;  3HUL A;  4KQV A;  4DUY E;  4Z7C A;  4AQY E;  4PU9 A;  4LF7 E;  1DAR A;  2ZM6 I;  4DR6 I;  1H72 C;  4FW9 A;  4NXN E;  3PYE A;  3JAM C;  5IT9 C;  4DPX A;  2UUA I;  3J81 Q;  1J5E I;  4DV6 E;  1A6F A;  4B3R E;  4LF5 I;  4ZVI A;  2BV3 A;  2V34 A;  3T1Y E;  4B3M E;  2UU9 I;  1N32 I;  1Y6Z A;  4DR3 I;  4UTG A;  2UXC E;  1FJG E;  4GKK E;  4JI5 E;  2PNM A;  4LFA E;  1N33 E;  3PYD A;  4DR1 I;  1N0U A;  4GKJ I;  4JI8 E;  2Z5E A;  1HNW I;  4PRX A;  1IBK I;  4DV1 I;  4DUZ I;  4DV0 I;  3T1H I;  1EI1 A;  4OX9 I;  2EFG A;  1I94 I;  1Z0V A;  1Z0C A;  1Z5B A;  1XMQ E;  1USV A;  4FWD A;  4DXL A;  3OTO E;  4JI2 I;  1NHH A;  4MYU A;  4JV5 I;  2V2V A;  1HR0 I;  4EMD A;  1HNZ I;  1HK7 A;  1Z0G A;  2HFU A;  1HNX E;  2Z5B B;  3WU3 A;  1H73 A;  2DEI A;  2UXB I;  4NXM E;  3PYF A;  4YHH I;  2Z5B A;  2HK2 A;  1BKN A;  4DV3 E;  4B3T I;  1QZR A;  1ZM2 A;  2VF3 A;  3PRY A;  5LMU I;  4DU8 A;  2A2C A;  2R42 A;  5IWA I;  1NHJ A;  2NPF A;  4WUD A;  4JI0 I;  2X7I A;  1H74 A;  2OI2 A;  1XNR E;  2GS8 A;  4X65 I;  4WUC A;  4X64 I;  1IBM E;  1N36 I;  4LF4 I;  4LFC I;  4DV2 I;  4DR4 I;  2VQF I;  2UUC I;  2VQE E;  3V2U C;  3K17 A;  4X66 I;  2E5L I;  1XNQ E;  4N3O A;  5GMD A;  4DR6 E;  4Z7Y A;  4LFB I;  3QT7 A;  4MYT A;  4FWG A;  4DPT A;  4HXZ A;  4LF8 I;  5BR8 I;  3HJC A;  4JI1 E;  4LF5 E;  2A2D A;  4JI4 I;  1USU A;  3J7A G;  1Z5A A;  1Z0E A;  4DUY I;  4FWH A;  4P7A A;  4AQY I;  2UU9 E;  1PIE A;  4LF7 I;  1N32 E;  2V2Z A;  4FN5 A;  1Z0T A;  1MU5 A;  1B63 A;  3H4L A;  2V8P A;  4DR2 I;  4DPW A;  5A2Q C;  2E1R A;  4I3H A;  1B62 A;  3J80 C;  3D4J A;  1ZXM A;  4LF6 E;  1HNW E;  4DV1 E;  3ZM7 A;  3GON A;  2UUB E;  3PYG A;  1ELO A;  2ZIT A;  1MG7 A;  4DV5 E;  3T1Y I;  1K47 A;  1FNM A;  1IBL E;  2X36 A;  4JI2 E;  3Q1Q A;  1HR0 E;  3LNU A;  1HNZ E;  5FLX Q;  4HAC B;  4JI5 I;  4LFA I;  3V5R A;  1N33 I;  3F0N A;  4PRV A;  4DR7 E;  4JI8 I;  2LJP A;  4HAC A;  4UT4 A;  4X62 I;  1XMO E;  2UXD I;  1KVK A;  2HKJ A;  3CWV A;  2WW4 A;  4DV4 E;  4ED4 A;  2UXB E;  2CG9 A;  1KIJ A;  5LMN I;  4YHH E;  4LF9 E;  1RRE A;  4P52 A;  2CGE A;  4XTJ A;  3OTO I;  2IOP A;  3K85 A;  4IZJ B;  3JAM Q;  5IT9 Q;  3J81 C;  5LMU E;  1U2R A;  2V2Q A;  4K0K I;  3QT5 A;  4IZJ A;  4DPU A;  3Q6M A;  1H7S A;  1NHI A;  2AJ4 A;  1N34 E;  1XHK A;  4JYA E;  4X65 E;  2HHH I;  1FWL A;  1N36 E;  4NXM I;  4HY1 A;  4JI3 I;  4B3S E;  2CZ9 A;  5L3J A;  4LFC E;  2VQF E;  2UUC E;  5GME A;  4M1K A;  1EA6 A;  4DV3 I;  2F4V I;  2O1W A;  4YY3 E;  4IZJ D;  4DR5 E;  4X66 E;  4JI6 I;  1Y4S A;  1S4E A;  4DV7 I;  3QT6 A;  4JI7 I;  2ZM6 E;  4LFB E;  1H7U A;  4KHP I;  2BM1 A;  1XNR I;  1IBM I;  5BR8 E;  4DPY A;  1S16 A;  3WU6 A;  2HKE A;  2UUA E;  2VQE I;  3ZZT A;  1J5E E;  1MX0 A;  4JI4 E;  3ZZ0 A;  1FKA E;  1WUU A;  1XNQ I;  1RR9 A;  3B78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...