4LG3A

Crystal structure of a duf487 family protein (despig_00776) from desulfovibrio piger atcc 29098 at 2.49 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
179
structure length
179
Chain Sequence
SEAQFFAPTKESPYEGIPGRLRYNVRIVLVEQDKQGNYIARRDSSTVSKRQLAATVIAAARYYAQEKRAAVVSITLDSQPGPAFGKTVLATATYAPDGKGVSGSDDWTWNTLQATPRGLTAQELKIQCLWGEMRGKFQVDGSTDERRLKAAIAKKLKIPAEKVMLNPVFPEPFPQEWTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (DESPIG_00776) from Desulfovibrio piger ATCC 29098 at 2.49 A resolution
rcsb
source organism Desulfovibrio piger
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 49
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16175 DUF4875 Domain of unknown function (DUF4875)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2610 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4lg3A02
3.10.310.90 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4lg3A01
4LG3A
chains in the Genus database with same CATH superfamily
1UAAA 4LLGF 2L2OA 4XM3A 5EEHA 1HKSA 1TBXA 1B8IA 2EIJH 2MYSA 1VQ9I 2EQRA 1GLNA 2ID6A 4P9UA 4JBDA 2X1CA 5K5OA 1HSJA 2HOTA 3F8NA 1ERDA 4XOPA 2MH9A 2E7WA 3L2CA 1TW2A 2E19A 2XVCA 3CJTB 2YU9J 5K5QA 4HF1A 2GLOA 3BC8A 4L5IA 4F93B 1UMQA 1UELB 1BJAA 2HXOA 5ED4A 2VN2A 1QBJA 3PM1A 3KEQA 2DK8A 2GOXB 3A4CA 2EZHA 2P8TA 4F7ZA 4KMUX 2VB6A 4Y15A 2R92J 2Y9ZA 1RNLA 1OYYA 3RPUA 1X3WB 2CQQA 4HSRA 1H9TA 2WAQA 4BY7J 5IY5H 5KNLA 1WJCA 3LSHA 1Z67A 2L9VA 3FXMA 3G71I 2R93J 4M9ZA 4LJZF 1IV8A 4XKBA 3BCBA 2VQHA 4PCQA 3HOTA 4CDGA 5FRMA 2ZMEA 5CQEA 2COMA 1HW2A 2PMZA 3S1NJ 2E2JJ 3D5RC 2ZB9A 1T98A 4DZPA 2CGPA 1FTTA 2OD5A 4I76A 1T6KA 1ZTRA 2HYJA 4KT6A 3H9QA 4Q4ZF 3ZQLA 1V4RA 4LB6B 5M5WJ 3TEDA 4KMFA 1HF0A 4YIRX 2M4GA 3DLAA 2IW5A 1XC5A 2K9SA 4BUPA 1ETXA 1P92A 2R4GA 2BZTA 2BW3A 2PMUA 5ILVA 1ODDA 5LGUA 2CYYA 4LK0F 3F8BA 4B3AA 2JK3A 3OYIA 2AXLA 4KIBA 2IS2A 3NEUA 3PQKA 2E1CA 2XGEA 2MW8A 2MA3A 4Q48A 1X58A 2MG4A 4PK4A 3LSPA 1KU3A 4CCJA 2MBFA 3CMMA 2NOJB 2WAFA 2ENXA 2X6OA 1TT5B 2JUGA 1XMKA 2A6TA 3FBIB 3G3ZA 2RN7A 4EVIA 4OA3A 5D5UB 2V79A 2DMQA 2VI6A 3E7LA 4RB2C 2P6SA 2VBZA 3LSRA 3C3WA 4NQWA 1T95A 2DT7B 4BQOA 4CXFA 3I56I 1XPXA 3OYHA 4IRHA 3B02A 3RZOJ 4A0ZA 2CUZA 3JAMK 3OYJA 4GGGA 2O0YA 1K6YA 2OPTA 3CJRB 2GQQA 2K9LA 3GEZA 2E60A 9ANTA 3SDGA 1RETA 3K6GA 3TP0A 4ENKA 3F9KA 4EJOA 2FBHA 4HG2A 3H0GJ 3ICJA 4LG0A 4E7IA 2DJIA 2QQ9A 4A3IJ 4BE1A 2P4WA 2ZMEC 3CF2A 2W84A 1U0JA 2K3FA 5EGOB 3L2RA 4L0ZB 4A3GJ 4A6EA 3ESWB 4BQAA 4LIVA 2OA4A 1OJLA 1MMAA 1Y0UA 1MD0A 1TWGJ 1UG0A 2OQGA 4Q60A 2F48A 2ZSIB 4U7DA 3MZ8A 4LGWA 4RAZA 1P7IA 3N4MA 4KICA 5DM7F 3S1RJ 4MQVA 1YO5C 2HAWA 1A36A 1BI3A 5DS9A 1MDMA 4ETSA 3SXYA 1X3ZB 1S5LC 1WVRA 2V4JC 4A3MJ 3FXRA 3BR3A 4XRFA 4CA0A 2IT0A 3CESA 4HLYA 1FOYA 3I4NJ 3WGGA 5AIQA 1P4WA 1D3YA 2Y0MA 2E2IJ 2JRMA 4ENMA 1GV2A 2ZSHB 3KZYA 2OTLI 4Y13A 5HS8A 2H27A 4MIMA 3EKMA 1YITI 3MZHA 1BWZA 1TQPA 3QPHA 1FIPA 1UCRA 3HOUJ 3CDLA 2IGOA 1R71A 5LRRA 3ABUA 4I98B 1QA6A 1G8XA 2VT2A 1ZRFA 3NARA 1FC3A 1QGPA 3W2WA 2TRTA 2DOEA 5F04A 2D1VA 3R61A 3MN2A 5HLIA 5LHIA 4ESBA 3HKZN 3AG4H 5D5WB 1D0ZA 4D5CA 2NAZA 5L3GA 2R3SA 2IGNA 3ERMA 4IVNA 5GP9A 3PL8A 3SZGA 5F1RA 3MVPA 2PG4A 1DU6A 5E8IA 1D8KA 1JGGA 2Z1DA 2CH0A 1AA7A 2L02A 1N25A 2MSYA 3M4OJ 4AC0A 5IYCJ 3SFZA 2XV4S 5DUIA 2P81A 5LEJA 3VFZA 3GLXA 5FRNA 3S2HJ 2W85A 4M3BA 2XKOA 1ORKA 3EDPA 1Z6TA 5EEAA 1XGMA 2JMWA 1S9HA 3H9GA 4ITVA 2MLGA 1OCRH 1BR1A 4AYBN 3OYLA 1X1BA 3L2UA 1BIAA 2JVHA 2R7TA 3I58A 3KP7A 2HDDA 1FMVA 5B5EC 3IH4A 3KYDB 5D8KB 2K4BA 3JREA 1APLC 3HOWJ 4LB0A 1ZLJA 3SZPA 2L9RA 2DT5A 4XLAA 2DTZA 1UJ8A 1ZGJA 1M1EB 2GIVA 1YI2I 2CFOA 1W62A 3GZ6A 4MEYF 2ELHA 3FXJA 1LJ9A 3R4KA 4MO7A 4BDYA 5HLHA 3X2QH 4JYKA 1YS6A 3QYFA 4ANJA 3MKLA 3NWTA 3KX2A 4I99C 1U8RA 1W4MA 2KQRA 3BR0A 5EZGA 4PJMA 4UY8I 4KIFA 3VYUB 1XMAA 1ON2A 3F8FA 5D4RA 1FX7A 4PJJA 2YSRA 3EYYA 2EFOA 2LFBA 2M8EA 2KFDA 2M5WA 5EYRA 3TOBA 4EJUA 4KN7X 3OYCA 3M3YJ 2ZKZA 3J81Z 4HX7A 4XORA 5HLGA 2HVRA 2EA2A 2QSGX 2XAQA 2EV6A 3EUHC 3NQOA 4W1UA 2Y0SA 3VYRB 4KDPA 4RPAA 1U9NA 2L3DA 1NG6A 1BI2A 1W7PD 1PVEA 4BBRJ 3VB2A 3D5LA 3E6BA 3SQNA 2HQRA 1H9GA 1S29A 1OYWA 3H9JA 4IF4A 4QTRA 1K83J 1B8IB 4NB5A 1G6NA 4X6AJ 2X4HA 4L0YB 1D8JA 2EZKA 2VQLA 2ZXRA 2XF6A 2JJ7A 4PFPA 5TGTA 1USSA 1PDNC 1R58A 1HA8A 1KYZA 4E70A 4OIRF 2IAIA 2EIMH 4H4KC 4PSXA 4D7NA 3K1NA 2KRFA 4C3IJ 1B4AA 3AKZA 4HQEA 3G6EI 3EYIA 2R7DA 4DQ2A 3IKVA 2KIFA 4Y4RA 3ZCOA 2BY1A 3NWSA 3OS1A 3RKXA 2ZNZA 1E3PA 4PFOA 4AIDA 3QOPA 5HS9A 4C2TA 4B3XA 1ZYRF 5D5XB 2XPWA 3GMEA 4HX4A 1MNMC 2KJBA 3FM5A 1R4NB 1RI7A 1PUFA 1V54H 4JOMA 4ZTFA 1R36A 5E3LA 2CWEA 3FDYA 1FOKA 4OMZA 2W24A 2KRCA 1QHHD 1IRXA 1Z1DA 1SFKA 2PX9A 3BLYA 4G94A 2QEXI 4RLFA 3C18A 3L2WA 5EZHA 1JJ8C 5IT9Z 1WWXA 2ZNYA 1VF9A 4IQ4A 1XSDA 3DPLC 2H09A 1IZ1A 3DTKA 2JA7J 1Y6IA 5GTHC 2BW3B 3BR5A 3DXJF 1JE8A 4G6QA 5H20A 2BXYA 1XUBA 3KFWX 2FUG2 2DODA 4EJTA 3M8FA 4AIJA 3LA2A 3LSJA 3WTUC 2F6CA 2KIQA 1MNEA 4Q47A 1YRNB 1OCOH 3KP6A 2JRTA 3BJOA 4AIHA 4E7HA 4HV5A 2QBYA 1JI8A 3HSFA 1AU7A 4ASNA 2DFFA 2X6YA 2AQEA 2ZJPF 3Q0UA 3GTPJ 2DA1A 2L4MA 2HTJA 3ZMUA 4DOZA 3HPGA 1R22A 2OU2A 2LDUA 2XB5A 4BJ6C 3R0JA 4N0BA 3EETA 4DUNA 1QPMA 1Z6RA 5EDNA 4DJAA 1IV6A 2L54A 4OOIA 3WTWC 4EGZA 2R7UA 2Y48A 3A0BC 3HL2A 2EBIA 2FRHA 3E3VA 1IN8A 4EJWA 4F91B 3LNQA 3O3KA 5D6FA 1IN5A 2HYFA 2XSJC 4XOTA 4ZDLA 5KAIC 3ZQCA 5FO5A 3O6BB 4MTDA 4HLXA 4HAMA 4ZJZA 1XS9A 4XKCA 4LG0B 2OBPA 2Y0SN 1REPC 2IGKA 1QZYA 3O2PE 2MD0A 1SMTA 2E1NA 3DPUA 2KMUA 3Q3SA 4A2UA 2F5EA 5DUKA 2RREA 4AUXA 1JT6A 4CHUA 2VJ4A 2XASA 1T38A 1D1AA 5KVRA 2AQFA 5TRDA 2DCEA 3H5NA 1ON1A 2EFQA 1LVAA 5CVRA 1NK3P 3BG6A 2IA2A 3K4MA 2GKJA 4GYGA 2QWWA 1KQ0A 2K5CA 2A6HF 2QZ8A 1TT0A 4YFNF 2X85A 1DPRA 4F92B 2O03A 3BDDA 2B9SA 1U5TA 2IS6A 3FXUA 4A3EJ 4A3DJ 4XL9A 3QU6A 4WXHA 3QOEA 2HXIA 2JN6A 1YJNI 4B4CA 3GXOA 2IEKA 4NUBA 3K7AJ 5DDGA 4ZYGA 3JRAA 4FT8A 2XROA 5HOOA 3KETA 4UUTA 3B6CA 4K2EA 5F27A 2FX0A 3M07A 2RKHA 4BDZA 2ME6A 2XPUA 3FXOA 1MZBA 1O4XA 1Z7LA 1X3UA 4J19A 3IGHX 3FX3A 5EEGA 2KZGA 4F55A 3JAMZ 2OUMA 2L5QA 2IA1A 1YFHA 2JWTA 3OWTA 4IXAA 4FISA 3J7ZI 4N4OB 4BS9A 2WY7Q 2EFWA 1YHQI 5J40A 2QSHX 2BXZA 5J6XA 1HDDC 2QCOA 2KISA 4OINF 3V7SA 5CVVA 4C3HJ 4O5VA 4OIOF 3KPHA 1LNWA 1R1TA 2NVUB 1F4KA 3HHGA 3CUQC 2EFNA 3K4BA 1QZEA 3E97A 1J09A 2X6WA 1ULYA 4OU0A 2RGVA 5LLQA 1HSTA 3LQQA 4J00A 3A01B 5HODA 3CQZJ 2HVSA 4P96A 3K0LA 1SVMA 4XK4A 4BU2A 3I3LA 2NYXA 2W57A 2FOKA 3E6DA 3COAC 3DLLF 5EF6A 2BHZA 2E35A 3LSMA 2ISYA 1FMWA 4HF2A 2FOWA 2V6EA 3PNVA 4EV0A 2VLAA 2ZXPA 2ZBKA 1C0WA 1YW7A 2FQ4A 1UHWA 3FXLA 3LSIA 2O9LA 2GM4A 3KYCB 1TNSA 4I7HA 4CZCA 3MKWB 2H94A 4UV8A 3HIFA 4F3QA 1TLHB 2XF7A 1O7FA 3MFKA 3L7WA 3ZMTA 2WWYA 1I6HJ 4M3DA 3BG3A 4ZTJA 1U1VA 3CC7I 2DA3A 4V2GA 1CQTA 1HBXG 3GF2A 3EUHA 1JXSA 4FTHA 2MGQA 5H6QA 5LEKA 1F9NA 3VODA 3KEOA 4PZJA 3BOQA 2PLYA 2VOPA 4M72A 4EGYA 4ZDOA 4V19K 4Y17A 4K7XA 3V42A 4PSWA 4RAFA 4DIQA 2O8KA 3HXLA 3P7NA 2M2EA 2PMZN 3ZQGA 4U87A 4ESFA 4WX9A 1JKOC 3V7CA 2JA8J 3Q9VA 1OFCX 1Z77A 3K4JA 4L9TA 4XLEA 4II2A 3LA7A 3TW6A 3PIOF 1ETKA 4M9XA 1TP4A 2W00A 4S0HB 5TISC 1ETQA 1X4OA 2LMDA 2QUFA 4IHVA 2GXAA 4RM2A 1X1PA 4WXDA 1IF1A 2K7LA 1OCCH 2VBWA 3FXKA 1MJBA 1WPKA 1G59A 1VQ4I 2DXIA 2WV1A 1WJ5A 2L9SA 2EILH 2OZUA 1F36A 2RNJA 4R79A 5ICEA 3WTXC 4G7ZF 3DPTA 5L3CA 2OCCH 1BR4A 3CC4I 1PP8F 2PFBA 1DP3A 1W5SA 4XRMA 1FNNA 2YPRA 5M47A 2YX7A 4JQFA 1EJ9A 2R7QA 1F1ZA 1G3TA 2BY3A 3PQJA 3DTEA 2MC4A 2KKOA 2XDVA 2DI3A 5F0FA 2ESNA 4G7HF 2PVZA 2B63J 1W61A 2VKHA 2CJJA 5JHFA 2V1NA 2ISZA 4IRGA 1PUFB 4BHPA 1BI1A 4DW6A 2QB8A 1YW9A 1YX3A 1B9MA 1KA8A 4G6TB 1CF7B 4ZYHA 3OYDA 2G9WA 1TQIA 4ENJA 2Z5UA 5F6FA 1IJWC 1G3YA 2XAHA 2DA6A 5GADJ 2RC4A 3IUOA 4Q2HA 2R7WA 1EKEA 1WHUA 2EH3A 2Z3YA 4HNVA 4EM2A 2K86A 1IC8A 4PJNA 3I5UA 4LOCA 3I0TA 3Q5FA 1FOWA 3WGHA 1YOVB 1TNTA 5CKTA 1TM0A 3VYTB 1N77A 4NC6A 1HKQA 3V8LA 1SD6A 1CGPA 5K5RA 3B73A 2FMLA 3TDUC 1YRNA 1Z05A 4II3A 1WGXA 2QBYB 4NBQA 1IUYA 2Z9OA 1LQ1A 2HOEA 1WKMA 1X19A 4YIFA 2M8GX 2O7OA 2VE8A 2F5FA 5E1ZB 3TW7A 5BS6A 4CCMA 2DOAA 1ZLKA 2CFXA 4JD7A 3A03A 3RSNA 4E6KG 3WODF 4UXNA 3V4GA 2EK5A 1GVDA 3ZR8X 5DCFA 1T08B 1W36D 4PGHA 1BBYA 3D1NI 4EM0B 4W97A 3E5UA 3FHZA 1WH7A 1PJRA 3GFLA 3OYAA 1W5TA 2DFEA 3Q0WA 3S2DJ 1EA3A 4ZYEA 4P1WA 5DD8A 3S15J 3GO5A 3MMYB 1G2HA 4WXCA 2QM3A 2L7ZA 2WADA 1MIJA 2X1EA 4FCYA 2ECBA 2GA1A 4U0YA 1TZLA 4IEJA 1G3SA 3OIPA 2HZTA 3ZQIA 3ZMVA 1MBEA 4LS9A 3FKIJ 3W5WA 2CW7A 3CMEI 1B59A 4N9HA 3OL4A 1TWHJ 4CYDA 3TOAA 2VOOA 3PW9A 5B1AH 1U5TB 2DK5A 4XBFA 3K4CA 1NHAA 3E5XA 2DT6A 3HJEA 1R5ID 1QZZA 2M87A 2IS4A 5E3NA 5J1YA 4HRIA 2KPMA 3K4LA 2IRFG 2MABA 4DBQA 2VJIA 2JTVA 1SFUA 2JA5J 4CO8A 4GRIA 4NC7A 3TDZC 1ZQ3P 4RB0A 3VWBA 3DV8A 5LFAA 1W0TA 5D5VB 3GTOJ 3MAJA 2I8DA 3OR2C 4UB8C 3GYHX 2ESHA 2K40A 4RB1A 1K4TA 1DDNA 3EDNA 2ZC2A 3IV5A 1FBSA 1S7OA 5J8CA 1IR6A 2LC2A 1H88C 1OYIA 4KUMA 1MW7A 2FXAA 3C2HA 1E17A 5IP9J 5KCMA 3W3CA 3H3ZA 2NVQJ 2DBBA 3K69A 3ZMZA 4A69C 3HGYA 5DYMA 1VQMI 1FYMA 1UHSA 2VL8A 3KP4A 3HC7A 3CC2I 4FE7A 4DYRA 4M6XA 3LWFA 2UUZA 2ZJRF 3A01A 1W36C 4EJVA 1S8NA 3VSLA 1Q1HA 1IRFA 1BJZA 2MD5A 3ABMH 2QB7A 2E34A 1T33A 2ID3A 3QWLA 1OKRA 4LIUA 4LK1F 5FKOA 3GTJJ 3DP7A 5LBQA 2VPLA 2VT3A 3A0HC 3ZQFA 1Y39A 4J9XA 4ZYDA 3GWZA 3KLNA 3SFIA 1F43A 2EV5A 5E17F 5CVJA 4Y33A 2EINH 4XMYA 3SJMA 1W7PA 4E7KA 5FLXZ 1FYKA 1IG7A 3BTCA 1A31A 1D5VA 2EV0A 2PW0A 1B6AA 3FHNA 4L18B 1IDYA 4ON0A 5DM6F 5BMZA 2KP6A 1SD5A 5F1JA 2LVSA 2KW7A 2BV6A 1S6LA 1MMSA 3PJRA 1OR7C 1RPWA 5FD5A 4I01A 3EPZA 1QVUA 1YE9A 2M30A 2V6CA 1X2MA 2NNNA 4FQGA 1GQZA 2H8WA 5ICCA 3WG9A 2KIUA 4QIWN 3JRDA 1ZR2A 1N78A 3I53A 2BEOA 2HVQA 2QSFX 3LA3A 5IPAA 5L3DA 1DGWY 3QP5A 4YFKF 4GXOA 3BG7A 2BVMA 4HNTA 3GTQJ 1WPMA 1DPUA 4FHTA 3HB9A 2PMHA 3DEUA 2IP2A 2KT0A 1KU9A 3IRRA 4AIKA 1K6OA 3PSIA 3FBNB 3R60A 4DNCA 1DGRM 2J5OA 5J4VA 1K7AA 4BEHB 3JSOA 3PTJA 4XRSG 3CCEI 2O61A 1OCTC 1ZREA 2ZCWA 2HU9A 3EUKL 1IDZA 2VXDA 3FM3A 3K2ZA 1I50J 3JSPA 2Q0OA 2XKPA 4IHWA 3ABLH 5H2GA 3OOUA 1G3WA 1BL0A 3RKWA 2P5KA 3GFIA 1QY9A 2VODA 1IXCA 4LFUA 3OYKA 5K7HA 5K7ZA 3HTUA 2G7HA 2M34A 2ZXIA 2Q2EB 4YRVA 2QKLB 1XSVA 2Y69H 3HGGA 3Q9SA 4Y7NJ 5C4JJ 2QQAA 1SD7A 4HZFA 2QKMB 4YFXF 2EFPA 3H3UA 1VQOI 1YQAA 4OIPF 1KU2A 4I02A 4PJ0C 1DP7P 4GO1A 3KCCA 2Y2ZA 3OYFA 4MLOA 3GW2A 3T8TA 4D5FA 5M5XJ 1WJBA 3JRBA 4YIIA 2XAUA 3EQLF 4L5EA 3H5RA 3CP8A 2LOOA 3BPXA 4JX6A 3S1QJ 3HEFA 3RQIA 3JRGA 1CF7A 4CCKA 1P4XA 2JA2A 3LFKA 2FBKA 3ABKH 3U21A 5DD4A 5CPRB 2JSCA 1QU3A 1E0EA 1HOMA 3HBLA 2CRGA 1ZK8A 2LTPA 5CVIA 1D0XA 3ROUA 2EJRA 1KZHA 4D1QA 2D1HA 2K9MA 4JX4A 2ETHA 1ZAOA 1UHMA 2F4IA 3BT9A 3PUFA 3DBLB 2HS5A 3BJAA 2BY2A 1IW7F 4B48A 2F5CA 1HDPA 2LRDA 5CYVA 1YIJI 1OPCA 5HDGA 3H5AA 4AVPA 4P9FA 2WAEA 4G12A 3RKYA 3TGNA 3DEWA 4MEXF 1LKXA 2LKXA 4IRIA 3M1CA 4X1EA 1D5YA 3AG1H 5LHHA 3K4NA 2XC7A 1SANA 4UVBA 2X48A 3ECHA 2FNPA 3N05A 1TC3C 2XAJA 3L9FA 5KHDA 1OCZH 2JVGA 4UHTA 2FJ1A 3VYSB 3WTVC 3OYNA 2BOLA 1MSEC 3KE2A 3CCQI 2ZFWA 3HRSA 1XGOA 2DN0A 5IYDJ 1FBQA 1SDJA 5GAGJ 3OYEA 3G4SI 2VKEA 3LSKA 3CCSI 2Y30A 3RQ4A 3F72A 1WJDA 1ZH5A 1I39A 1TTYA 3IAS2 5ICGA 2HZDA 5LGTA 3WE2A 1RC9A 2F4MB 3HOYJ 4OWRB 1QRYA 3VSKA 1T8IA 4AWXB 1GUUA 3K1PA 2NXNB 1NK2P 4GCVA 1VFCA 2HR3A 3FMSA 4KFCA 1ZR4A 1MBJA 1R4MB 2PN6A 4XRSA 1ETOA 4V2FA 1FSEA 3WHCA 3T5XA 3AFHA 3G73A 2QYOA 2J5PA 1IN4A 4M6VA 4F52A 3NAUA 3U2RA 2GKEA 3A1YA 4KT5C 2AXTC 4XICA 1T0FA 3WTSC 1X1AA 4HSTA 4ZZDA 1UB9A 3RKQA 2W82A 5CVUA 2YU3A 2CG4A 1VTNC 1FT9A 2OC6A 1H0MA 2QENA 1D0YA 2M7BA 3GTLJ 2I5UA 3JCUC 2DPUA 3CUQB 3VDXA 3HG9A 1MNDA 1XGNA 2A07F 1SFOJ 2CUJA 1JTYA 4DGWB 5FKLA 4YELA 4FX0A 1B1BA 2ICWG 3VEPA 2M1BA 4QPOA 2V1UA 2WB1N 3RTRA 3J80K 3QRFF 3G1OA 3MKYB 1ZN2A 3IH2A 4NNJA 3ML6A 1GV5A 2RAEA 1BIBA 3JTHA 1UZCA 2LD5A 3HRMA 1Q1VA 1O57A 2G0EA 2BBYA 3HKZA 3OIOA 1FWZA 1GHCA 3WTZA 3TQNA 2WY8Q 5K7FA 4RA2A 3CMYA 2PBIA 2FD5A 3H36A 3H3VK 4IK0A 1Z9CA 1AOYA 2P5VA 3WHBA 4LLNA 4ENNA 5JHUA 4MNUA 5HNHA 2ZJ2A 5GAEJ 2RVCA 3QAHA 3AL0B 1A6IA 2GWRA 1ZGAA 4HW0A 4U0WA 3ZMSA 2XF5A 3L00A 3SYTA 1FPQA 4JP0A 1ZG5A 5JLXA 3BQZA 1ITYA 1ACIA 1D1CA 4K8LA 1ZARA 3FZVA 3L2VA 2HI3A 1LPQA 1W7PB 2XSDC 4YEJA 2V26A 3I54A 4HDVA 3BR6A 4N9IA 1E3HA 1POGA 4NDLA 1TWCJ 2QLZA 4EATA 1J7KA 3IP4B 5AONA 4WK8F 1X1DA 4C30A 2CMPA 5JLWA 2IXSA 4IOAF 1VQKI 1U6GA 4RMNA 2H8RA 3MWMA 1XMXA 2DDAA 2VPRA 5F64A 3U9GA 1DU0A 3OIQA 3IH3A 2DA4A 3CCRI 2NS0A 3ZP5A 1BW5A 4AVZA 2D5VA 1DQUA 1S7AA 1Z7UA 1VQ6I 3GZ5A 2IPQX 3RCOA 1FJLA 1LEBA 1ETVA 1YS7A 3PO3J 1SFEA 5FROA 1JT0A 1JUSA 4D9JA 1PUEE 3DU6A 2AO9A 3GFJA 4JK1X 2ZO4A 4LB5A 2GIZA 1R1UA 5IP6A 1KGSA 1X4PA 2FNAA 2HFHA 3FXQA 3HHHA 3GLLA 4BEHA 4IQJA 1K23A 2KPTA 3HM5A 1RR7A 2WC2A 2LP0A 4UNOA 3QU3A 2OTJI 4D7MA 2LY1A 1FBUA 2GZWA 4A3JJ 1K20A 3CCYA 3ISPA 2UZKA 2VQGA 4BQQA 2M7AA 2DMUA 1WH5A 2COBA 2N8GA 2Q2EA 1IRZA 4MQ9F 2O5RA 3KEYA 4RGRA 4QWQA 3G98A 4CICA 2TCTA 2UWMA 1I1SA 2A3SA 1DUXC 4I6ZA 4BBSJ 4XLCA 2V9KA 3CLQA 2K02A 2HNHA 1SAXA 1KONA 1VNDA 4WF2A 1LEAA 1O3QA 1HCRA 2EB7A 2Y9YA 3BY6A 3T0YA 2ACJA 1FP2A 2XRLA 2BY0A 1H89C 2H1KA 2X6XA 4HEA2 4C2UA 3HTSB 5KK1A 1BA5A 2D45A 3CDHA 2DMTA 2CW8A 2GOMA 3OYGA 1ENHA 5H2YA 1S7JA 2KDOA 2MFZA 2XIGA 5FKMA 4RS8A 5ICFA 4HA8A 4G9YA 1YTYA 5C44J 4JUUA 4B43A 3I4PA 2WAQN 1KQ8A 4CGZA 2CSOA 1QO0D 4M71A 2DYRH 4BJTA 3GVAA 5JR3A 4M74A 5H2FC 3CP2A 4TV7A 2DPDA 3MD2A 1E3OC 3R6SA 2LKPA 2L01A 4BH9A 1U9OA 2DFIA 2LBFB 2FE3A 2HTSA 2YMAA 3TO6A 1I5ZA 2VONA 4HQMA 4GDFA 3S93A 4IKFA 3ZQ7A 2W1OA 3ZPLA 2MPBA 5EG0A 1Y1VJ 4XSXF 5KAFC 3IAM2 5IYBJ 1HKTA 5IOYA 4BYYA 1I6XA 3ULQB 2DLLA 2ADUA 3SDBA 5HDNA 1HC8A 3EJXA 4IJAA 2CV0A 2OV7A 3LOCA 3I64A 5FLVA 5D4SA 3AG3H 4DYCA 4E7JA 2V9PA 4CUGA 1LE8B 4BQNA 1YYVA 1SVLA 2Z2SB 3W6JB 1AKHA 3M1EA 4L9VA 1MBKA 1MSFC 1JKRC 1U1XA 1JUMA 4A5NA 4XONA 1O7LA 4EEFG 4I2OA 4ABZA 3BZCA 1O3TA 2HPMA 4NC8A 2WA0A 1R00A 4CSWA 4IPAA 3H1CA 3CO7C 1SEUA 1KQ9A 4AU7A 1LDJA 2WV0A 1STZA 1IN7A 3KZIC 3B6AA 5FKNA 2A5YB 3TMOA 2EPFA 5M3FJ 1GVJA 2IVMA 2VQCA 2OF7A 2X51A 3HYIA 3J80Z 2AZPA 1RESA 2ELJA 3H35A 3KP5A 2R7XA 1U1WA 1T0FC 2LY2A 3O8GA 3FWEA 4IHSA 1WSUA 1WI9A 3C2BA 4L5JA 1WI3A 3JTGA 3KP3A 4U88A 3WU1B 4IX7A 1P2FA 4RGSA 1TW3A 3W2AA 1GXPA 1ETYA 5L3EA 1U3EM 2O8XA 2NVXJ 4ZC3A 4Y3OA 2DA2A 4UVCA 1MBFA 5CJ9A 2FF4A 3GZNB 3FK6A 3CF5F 3HOSA 2IW4A 2V9VA 3GTGJ 1RIOH 3LSTA 3K70C 1K61A 5J3LA 2M3AA 2QQBA 4BACA 5E18F 3RPQA 2RQQA 3BQYA 2UXXA 3C2GA 3PFIA 4B44A 3GX4X 3CUQA 2KLOA 3E0JB 3I4MJ 4MTEA 4LG3A 3ELKA 5E79C 2Z33A 3I71A 2BYVE 1JGSA 5E1XA 3ZMDA 3S8PA 3N97A 3DBHB 1V5GA 2VC0A 1YJ9I 1WJEA 4NHJA 3K10A 3PSFA 3U1DA 2H1LA 1TQMA 2PQ8A 3QPSA 2HKOA 1J5YA 2EIKH 4E7SA 1P4AA 2LF7A 1K78B 5CQGA 3A02A 4C9YA 1FYLA 1VQ8I 5HDKA 4RGXA 5JI6A 5E1WA 2GXGA 3O8HA 3OY9A 5BOXA 1OMIA 2AHQA 1I3QJ 2GA2A 4WWCA 1FLIA 2VBYA 4IJZA 1RUOA 3BJ6A 3VOEA 1SVOA 3P5JA 2UV1A 3LMMA 5J47A 2OQRA 1YM5A 1MGTA 2ECCA 2O6GE 1VQLI 3PUBA 2JPCA 1A6QA 1IXRC 3WE3A 4RLQA 3DKYA 5J1RA 5IOZA 1XCVA 1I74A 5F08A 1A35A 1I3AA 2DMNA 3ECOA 2R0QC 4CCLA 4A3CJ 2F5DA 1K79A 3BTLA 5A2QZ 5H6RA 1MH3A 3OMYA 2R7FA 2KDZA 1R49A 4AYBA 1LFBA 4HOBA 3ZRGA 1EH6A 1XUAA 4E4HA 3HUGB 5CLSA 1U5TC 5ERIA 2ZXWH 2HQ5A 4PDKA 2NS8A 3DFGA 5FFZA 6PAXA 4BY1J 1LFPA 4BGDA 3DEVA 4OAYA 2JUCA 1B9NA 1WQ2A 4A0XA 3AG2H 2RQPA 3BTIA 1Y8QB 3K4KA 3AAFA 4A3KJ 5IP7J 1B72A 2R7VA 2VE9A 2QB6A 2F5VA 4HPQA 1Y1WJ 2FEZA 3K2AA 4B8XA 4CZZA 4EQQA 4AD9A 2HWVA 1Z3XA 3KP2A 4M3GA 5FFXA 1IO2A 4O6JA 2PI0A 3RJPA 1FTZA 2M0MA 4BE0A 4IO9F 1HW1A 3RIRA 3S3MA 3FIWA 3JW4A 3DCFA 3G1MA 1EF4A 4CYCB 2V7FA 3M9AA 3P9KA 2JPBA 1BN5A 4B47A 1WCMJ 3REOA 4S05A 3BP8A 4QPQA 2DQLA 3L2QA 2WTEA 2VASA 4RAGA 1KU7A 3AL0C 5A2QK 4WCGA 2HOSA 1I27A 2W7NA 4HV6A 2LYCA 3W6KB 4RM3A 1BOBA 1YW8A 5HA4A 1S72I 3BG5A 2QQ8A 2W4SA 3E6MA 1WFXA 3CDIA 2E5NA 2DYSH 2NOGA 3K70D 2ZVFA 2UXNA 2CO5A 2RDPA 3UKGA 2A68F 3M7GA 3J7AY 3CJQB 4J01A 3CD6I 5ANPA 1HLVA 2ZXHA 3MEXA 2LY9A 1Y8RB 1LDDA 4C3JJ 3GFMA 1MJAA 5L3BA 3OS0A 3IRQA 2R7OA 2P6TA 3RZDJ 2VBXA 3C7JA 4M9SA 3IWFA 2LKSA 1YLFA 2ZFUA 1S7EA 4JBAA 2NS7A 4G8XA 3MZYA 4PUSA 1MMNA 1I1GA 2FSWA 1OLTA 2DAOA 3OR1C 3S3OA 5HVQC 2PJRA 3W6VA 3CJNA 3QYBA 4CCOA 2EZLA 2XB0X 4UB6C 4Z2YA 1KYWA 3ONQA 2XHKA 1ZELA 2LH9A 3OSFA 3DWLE 4C2MJ 1Z21A 2CQKA 2FMYA 3HRTA 4XNFA 1R7JA 3RDIA 1W0UA 1JKPC 4R1HA 1SAUA 4RGUA 1W1WE 1XB4A 4EMSA 3CCMI 2B7EA 1U78A 1R23A 3G1LA 3PNTA 4BJ5C 3BROA 2V1DA 3F6OA 3RI4A 2LBFA 3DQVC 2NRAC 2OAZA 3PO2J 3F8MA 2HQAA 1OCPA 2Y75A 1R5HA 2FA5A 1QHGA 4A6DA 3OL3A 2EWNA 4CCNA 2EB0A 1YX5A 5M3MJ 4XQFA 5EG0B 5BQTA 5L3FA 3WQZA 4A12A 2E7XA 4MFDA 3S32A 3J81K 3HSRA 3R0AA 3HOVJ 1JJ6C 3CCLI 3Q0VA 4IOCF 3SHFA 3FVEA 3P9IA 1WPPA 3J7AO 3F23A 1AWCA 4KYWA 1FP1D 4JX5A 1RR8C 2RNGA 3S16J 1QVTA 3ZQQA 4FX4A 4P5OA 1LE8A 2ME0A 2LSOA 3T1BA 4HF0A 2KRHA 4U7BA 3ZGKA 1AKHB 2P5LC 1J59A 4BXXJ 4LITA 2NNYA 3BCAA 1BC8C 1J2XA 4PGGA 2I10A 3M8JA 3BR2A 3MQ0A 5LRSA 1XDUA 2QF7A 1L0OC 3KLOA 1WZ2A 4ZZLA 1NG7A 4EM1A 5FD6A 1FOXA 5HS7A 4ZDPA 1FZPB 4A5MA 2G7UA 2XGCA 1V55H 2YX4A 3HSEA 2OZ6A 4MGRA 4DBRA 1O3SA 4XLHA 1IN6A 4E7LA 2MLKA 4KIGA 2VIXA 4A93J 3L1PA 3E6CC 3JRFA 2HKXA 2M9HA 4B09A 3ASNH 5FGMA 1ZG3A 4I09A 1V5EA 5D6EA 4HBLA 5B3SH 4KITB 1VQNI 3BWGA 3F8CA 1V5FA 3PVHA 5DCMB 3WG7H 3BZ6A 3DF8A 3S1MJ 5FB2A 4XKVA 4XR6A 4DYQA 5LHGA 2XAGA 4YG2F 3ASOH 4GYIA 4BE2A 4L9NA 4KA4A 3I59A 2HYGD 2CS3A 2E1MC 1VQ7I 3DKWA 2L7KA 1SMYF 2CW0F 3HOXJ 1XG1A 2Z99A 3FKJA 3PNYA 4RB3C 2X9DA 3QPTA 3JRHA 3NRVA 5F0HA 1RRJA 2ZXJA 4KN4X 2PJPA 5DV5A 5LD2C 1QYAA 1RKWA 3OYMA 3HDDA 1VI0A 4LD5A 5JVTA 2DOFA 5GAHJ 2XUBA 3FMQA 4FASD 4CH7A 2HQNA 3LQRA 2MC3A 3FK7A 1T39A 5IT3A 2KL4A 1SD4A 3TO7A 1IGNA 2EZIA 1P6RA 2DDBA 4O3MA 1MBGA 3OSGA 4G6DA 1A04A 2YR2A 3LSGA 3DKXA 3T8RA 3GUDA 1BI0A 2E36A 5LGNA 1K78A 5FKKA 3G7KA 3IL2A 3V8JA 5D8LB 4UV9A 4BHCA 5K1YA 1ZHFA 2V1XA 1FEXA 2R5YA 3GCMA 2A5WA 2M0CA 2W25A 4Y52J 1QPIA 2HDCA 4A3LJ 2K27A 4IZZA 4M73A 3WGIA 3CUOA 4OMYA 3CCVI 2XGDA 3D0SA 3ZN1A 4Q5SF 5FJ8J 4ZH4F 3S2WA 2R5ZA 3UR3C 1XSXA 4IHYA 1HXDA 3J7YJ 2K85A 2CU7A 1G4DA 4XLFA 1OR7A 4XN3A 1T56A 3K9TA 3RPUD 2OJED 4D0PA 4IHTA 2L7MP 1R5GA 3ZOBA 5J4YA 2VC1A 2BE5F 3HUGA 2Y31A 2DQRA 2F2EA 5JFRA 2R7RA 1IUFA 2IGMA 1BR2A 1VQPI 1LUJB 3DBRB 1D1BA 1PYVA 1Z0XA 2LR8A 1U0KA 1YIOA 4UUSB 5E3MA 3SEZA 5J8FA 1B72B 2FU4A 1T6SA 2O3FA 3SEQA 3EUAA 2BVLA 3LL7A 2C6YA 2P0WA 1U2WA 1GT0C 3IWZA 4N4NB 1JKQC 3QYEA 3WTTC 1JHHA 2Q1ZB 1YG2A 4AM3A 1T2KA 3RYPA 2IS1A 2K4JA 3HOZJ 3W2VA 2QA4I 1IAWA 1TWFJ 2M45A 4CYCA 1IXSB 1EV7A 3OOPA 5F0CA 5BNGA 1XD7A 1OISA 2VXZA 5B1BH 3TP3A 2HPIA 3KIOA 1MMDA 1J75A 3BZKA 1AHDP 2IBDA 2DO7A 3TKYA 2CUFA 2IA0A 3TBIA 2E2HJ 4OIQF 1XDSA 3GTKJ 2LT2A 4LMYA 3CMAI 1FY7A 5ILSA 1ZGWA 3QP6A 1ONVA 2LK2A 2YUSA 5DEQA 5C3EJ 2GBYA 1NH3A 2L4AA 2P7CB 2L0KA 4OAZA 2QVOA 3OYBA 2ZMEB 3PIPF 4M6YA 2STWA 2DJNA 3IHUA 4KNYA 2VJ5A 1A5JA 1W5CC 3V7RA 2R7SA 1LB2A 3L09A 2JSPA 4P55A 5HLTA 4HYEA 1E2XA 3ABTA 4XN0A 1X1CA 5ILUA 4ESJA 4G7OF 3E1SA 2DA5A 1ZKGA 1X2NA 2E71A 2KIMA 2M4KA 2RV8A 3LFUA 1J0RA 2K3PA 4XLNF 1XCBA 4U0VA 5GTIC 3F3XA 2KZVA 1NTCA 1O3RA 2P7VB 1GDTA 3CCJI 4MHGA 2OTNA 1XTAA 2DU9A 3IKTA 2PJRB 2JQ7A 4RDUA 1N75A 4QSHA 2H6BA 1LDKB 2LF8A 2DTRA 1MMGA 3M8EA 1K4SA 2FBIA 2HOAA 2LLKA 3ZXSA 3F6VA 1ZRCA 5BPDA 4S04A 5FLMJ 3BG9A 2HEOA 4IHXA 4BKXA 1EH8A 4BNCA 2H6CA 3HZJA 1Y56A 2VKDA 3D5SC 2MH2A 4QLCU 4X0GA 4FETA 3I55I 1ZRDA 4PJLA 4NQWB 5FLXK 2CQXA 3I9V2 4FE4A 2ELKA 2KHMA 2WBMA 4ZYAA 3FMRA 4KJZA 3F0CA 1TWAJ 1ZG1A 2KJCA 3F22A 5HNFA 1RZ4A 2A61A 1WRJA 3DTIA 3UNGC 2LNBA 4R8HA 2VKVA 3MCZA 4RBOA 3FF5A 2CQ7A 2LREA 1XGSA 1Z91A 2HGCA 2JT1A 5EGOA 5GPCA 1EH7A 1LVKA 2VUMJ 3S3NA 1FSHA 5BPIA 3G2BA 1LFUP 1H8AC 1BM9A 4DZJA 1R1VA 1MBHA 2E5ZA 2TDXA 3E5QA 3QODA 3QPLA 4BXUA 1Z3YA 1MDMB 1WJAA 2DW4A 3C1DA 3BTJA 2A69F 1SC7A 5E20A 3RYRA 3FISA 4BAYA 5M5YJ 3KYLA 2STTA 4E7ZA 3IC7A 3JRIA 2CQNA 4RAYA 3H0DA 4IL6C 3ZQHA 1HQCA 1OQYA 1Y0NA 3CO6C 3TL4X 4XSZF 4UVAA 5AIPA 3V8KA 4M3FA 3PFYA 2DA7A 4XIDA 3CCUI 4XLPF 2X1DA 1MJ9A 2GXBA 1R6RA 2IJLA 4MFEA 5DCMA 3WU2C 5TJJA 1RKTA 3DEEA 4HX8A 3JRCA 2ZJQF 3OV8A 5JVGF 3CTAA 4A0YA 2XPVA 4Z6YA 1J9IA 3I59B 3S14J 1MH4A 2JA6J 2CUEA 2K9NA 3QQAA 2A05A 1P9QC 1UG2A 2PEXA 1R9TJ 2YS9A 3HPHA 3WTYC 4K7GB 2LG4A 3LAJA 1ETWA 5IWEA 3WU0A 4HNUA 3P9CA 2XRNA 4BXFA 1BC7C 4L9JA 1P7JA 2E1OA 3ZN0A 2H9FA 2ZXOA 4I0BA 5B66C 3JR9A 1USTA 2Z16A 2XGXA 1FIAA 2NVTJ 3TO9A 2Q9JA 1HW5A 5DTDA 2BGCA 2QGUA 5GPAA 3SZTA 3U1KA 4JCIA 1JTXA 5E3OA 3MKZA 2FQ3A 3DU5A 1VZ0A 2A6EF 2HDWA 4B1RA 1YJWI 3A2KA 2L7FP 1V3FA 2K9QA 2WB1A 3S17J 2VJJA 4XKWA 1JHFA 3GBGA 3H92A 3OS2A 2AS5F 1MKMA 2R5YB 4UUVA 3GTMJ 5EJCA 2L9NA 1U8BA 2GAUA 1BW6A 1IRGA 3BPVA 5IT9K 2NVYJ 1F5TA 4HDUA 1JUPA 2DFHA 3CLOA 4J9WA 4BL0B 2Q8KA 3HRUA 2CV2A 1XX5A 2JZYA 3K1MA 4H0EA 4KISA 2X0LA 2R5ZB 3KZZA 5E8GA 4PY9A 3F21A 1UFMA 5J1UA 2XAFA 1VQ5I 2DMPA 4A3BJ 2W48A 3CZ6A 3LAPA 2Q9HA 2CV1A 4M3EA 2E1MB 4I0AA 4BHBA 2EA4A 3VPRA 3ERED 1XN7A 4LLLA 1L3LA 1PP7U 1GXQA 3BR1A 2R7ZJ 4GL6A 1QNTA 1SFXA 1WJFA 2BHYA 2D2WA 2F4OB 2OCEA 4GFBA 4A3FJ 5C4XJ 1QQIA 1TL8A 4UUSA 1S3JA 1RUNA 2B0LA 1BOAA
chains in the Genus database with same CATH topology
1UAAA 4J00A 2L2OA 4XM3A 2HVSA 3ONQA 4BU2A 3IAS2 3I3LA 1ZELA 2HZDA 2LH9A 2MYSA 4OWRB 3VSKA 1GLNA 3DWLE 1Z21A 4JBDA 2X1CA 4XNFA 3LSMA 1ERDA 1FMWA 4XOPA 1SAUA 2V6EA 3PNVA 2VLAA 2ZXPA 4BJ5C 3PNTA 3LSIA 3BC8A 4F93B 1UELB 2LBFA 3DQVC 4CZCA 3MKWB 3AFHA 2HQAA 2GOXB 2XF7A 3A4CA 4F52A 1QHGA 4F3QA 3OL3A 2GKEA 3A1YA 2VB6A 4CCNA 2EB0A 1YX5A 4XQFA 4ZTJA 1X1AA 4HSRA 4HSTA 2WAQA 1U1VA 5KNLA 3WQZA 1WJCA 3LSHA 3S32A 2W82A 2OC6A 3FVEA 1D0YA 4XKBA 3BCBA 2M7BA 2VQHA 3HOTA 1WPPA 5FRMA 3VDXA 2RNGA 3HG9A 5CQEA 1MNDA 3ZQQA 2CUJA 4P5OA 4ZDOA 4DGWB 2PMZA 4YELA 2KRHA 4U7BA 3V42A 4K7XA 3D5RC 3ZGKA 4PSWA 4QPOA 4LITA 4DIQA 3RTRA 1T6KA 3BCAA 3HXLA 3H9QA 4KT6A 3MKYB 4NNJA 4U87A 3M8JA 3K4JA 2M4GA 3DLAA 4XLEA 4II2A 4BUPA 2W00A 3HKZA 2R4GA 1NG7A 2BW3A 2WY8Q 1X4OA 4ZDPA 3OYIA 4RM2A 4IK0A 2IS2A 4DBRA 4XLHA 5HNHA 4E7LA 4PK4A 1G59A 3AL0B 4CCJA 2VIXA 3CMMA 1WJDA 2DXIA 2NOJB 2WAFA 2XF5A 1WJ5A 2L9SA 2JUGA 3SYTA 2ENXA 3FBIB 2A6TA 4OA3A 4R79A 1V5EA 3DPTA 1D1CA 4KITB 4K8LA 1V5FA 3L2VA 3PVHA 1BR4A 4YEJA 1DP3A 2V26A 1T95A 2DT7B 4BQOA 4XKVA 4XR6A 3OYHA 5M47A 4JQFA 2R7QA 4BE2A 3OYJA 2CUZA 2MC4A 3DTEA 2CS3A 2E1MC 2XDVA 1K6YA 3CJRB 2L7KA 4EATA 2K9LA 2E60A 3FKJA 3PNYA 3IP4B 2PVZA 3K6GA 1W61A 2VKHA 3F9KA 1X1DA 4C30A 2CMPA 4HG2A 5JHFA 2IXSA 3ICJA 5LD2C 2V1NA 4E7IA 1QYAA 2DJIA 4BE1A 2QB8A 3OYMA 1YX3A 4RMNA 4G6TB 3CF2A 1U0JA 3L2RA 4FASD 3OYDA 4CH7A 4LIVA 3OIQA 1MMAA 2KL4A 1UG0A 3IUOA 4Q60A 4Q2HA 4AVZA 2R7WA 2ZSIB 1DQUA 3RCOA 3LSGA 2HAWA 4PJNA 3DKXA 5FROA 2V4JC 4D9JA 3DU6A 4CA0A 3CESA 5CKTA 1TM0A 3G7KA 3VYTB 1N77A 1X4PA 4BEHA 4IQJA 1K23A 2KPTA 2ZSHB 4II3A 3EKMA 2A5WA 1BWZA 1X19A 2LY1A 2IGOA 4IZZA 1K20A 1G8XA 2VQGA 4CCMA 2DOAA 3UR3C 3W2WA 2M7AA 4BQQA 4JD7A 3RSNA 4XLFA 4E6KG 2O5RA 4XN3A 3KEYA 3RPUD 1D0ZA 3G98A 2IGNA 3ZR8X 2UWMA 3PL8A 3SZGA 4XLCA 1W36D 2V9KA 2R7RA 2Z1DA 2HNHA 2CH0A 1KONA 1AA7A 2IGMA 1BR2A 1D1BA 1PJRA 1PYVA 3OYAA 1U0KA 1EA3A 5FRNA 4P1WA 3SEZA 2X6XA 3MMYB 4HEA2 2WADA 4C2UA 3SEQA 3EUAA 2BVLA 1S9HA 2X1EA 3LL7A 3H9GA 2CW8A 2GOMA 4ITVA 1BR1A 2P0WA 3OYLA 1X1BA 3OYGA 3L2UA 2JVHA 2R7TA 1S7JA 5H2YA 2KDOA 2MFZA 4N4NB 3QYEA 1TZLA 3OIPA 4JUUA 4B43A 2Q1ZB 4LS9A 1FMVA 3W5WA 2CW7A 4BJTA 4LB0A 2IS1A 3CP2A 3W2VA 3MD2A 3OL4A 4XLAA 3PW9A 2CFOA 3K4CA 2LBFB 1W62A 2DT6A 2YMAA 4BDYA 4IKFA 3S93A 2IS4A 2VXZA 2HPIA 1MMDA 2W1OA 2KPMA 3K4LA 3QYFA 3NWTA 4ANJA 4HRIA 2MPBA 2MABA 4DBQA 2VJIA 3KX2A 3TBIA 3IAM2 2KQRA 4GRIA 2LT2A 4NC7A 3SDBA 3VWBA 5LFAA 4PJMA 3EJXA 4OAZA 2CV0A 2OV7A 2I8DA 3VYUB 3OR2C 3OYBA 4PJJA 4E7JA 3EDNA 2VJ5A 4CUGA 3OYCA 2R7SA 4BQNA 2Z2SB 2JSPA 5HLTA 1IR6A 2LC2A 4XN0A 1X1CA 3E1SA 1MW7A 4XORA 2M4KA 3C2HA 2HVRA 3LFUA 1U1XA 2K3PA 5KCMA 3W3CA 3EUHC 4XONA 3VYRB 2Y0SA 4RPAA 2KZVA 1NG6A 2HPMA 2VL8A 4NC8A 2WA0A 4CSWA 3D5LA 3HC7A 2OTNA 4AU7A 2PJRB 1N75A 1LDKB 2UUZA 3H9JA 3TMOA 1W36C 1MMGA 2VQCA 2X51A 3VSLA 2AZPA 2ELJA 3H35A 2QB7A 2R7XA 1U1WA 2VQLA 3ZXSA 1T0FC 2XF6A 2ZXRA 2LY2A 4PFPA 5TGTA 4LIUA 1HA8A 2VPLA 4J9XA 4H4KC 4PSXA 3AKZA 4IX7A 1Y56A 2VKDA 3D5SC 4Y33A 3W2AA 4XMYA 4FETA 4X0GA 4E7KA 4Y4RA 4PJLA 4NQWB 3ZCOA 3I9V2 2PW0A 2KHMA 2WBMA 3NWSA 4ZYAA 4KJZA 3FHNA 3OS1A 4ZC3A 4Y3OA 4PFOA 4C2TA 4B3XA 2KP6A 3HOSA 2IW4A 2KW7A 5HNFA 3K70C 3DTIA 3UNGC 2M3AA 4BACA 3PJRA 1OR7C 2RQQA 3EPZA 3C2GA 1YE9A 4B44A 4JOMA 2KLOA 2LREA 3E0JB 4ZTFA 1GQZA 4LG3A 1LVKA 3FDYA 1N78A 2HVQA 3S8PA 2KRCA 3S3NA 1QHHD 1DGWY 1V5GA 1IRXA 3G2BA 3BG7A 1SFKA 1WJEA 2BVMA 3BLYA 4HNTA 2E5ZA 3K10A 3PSFA 4RLFA 1WPMA 3L2WA 3QODA 1Z3YA 4IQ4A 4E7SA 1WJAA 3DPLC 3DTKA 1Y6IA 5CQGA 2BW3B 4C9YA 3PSIA 3KYLA 1XUBA 3OY9A 3FBNB 2FUG2 4E7ZA 4IJZA 1DGRM 4BEHB 3H0DA 3PTJA 2F6CA 1MNEA 2UV1A 3LMMA 4E7HA 1YM5A 1JI8A 2HU9A 3EUKL 2VXDA 3TL4X 2X6YA 3PFYA 2AQEA 3PUBA 5H2GA 2X1DA 3OOUA 1R6RA 4RLQA 4DOZA 3DKYA 3HPGA 1QY9A 3OYKA 1I74A 4BJ6C 2ZXIA 3DEEA 4CCLA 2Q2EB 4YRVA 2QKLB 4DUNA 4DJAA 2R7UA 2QKMB 3OMYA 3HL2A 4AYBA 3ZRGA 4F91B 1P9QC 1XUAA 4E4HA 2XSJC 3HUGB 4XOTA 4ZDLA 3OYFA 4MLOA 3HPHA 1WJBA 4ZJZA 2XAUA 4XKCA 1LFPA 3H5RA 4BGDA 3DEVA 3CP8A 2LOOA 4OAYA 4K7GB 2LG4A 2IGKA 5IWEA 2MD0A 3DPUA 4HNUA 2KMUA 3K4KA 2R7VA 4CCKA 4BXFA 2JA2A 2QB6A 2RREA 2F5VA 4HPQA 3U21A 2H9FA 5CPRB 2ZXOA 1QU3A 1E0EA 2VJ4A 1D1AA 2Z16A 2AQFA 2DCEA 3H5NA 1Z3XA 2Q9JA 1D0XA 2M0MA 4BE0A 4D1QA 2K9MA 3BG6A 3K4MA 2GKJA 4JCIA 2K5CA 2F4IA 3MKZA 1TT0A 1VZ0A 2X85A 2HDWA 3DU5A 3S3MA 4F92B 3A2KA 2WB1A 2V7FA 2VJJA 4XKWA 2IS6A 3GBGA 4B48A 3OS2A 4XL9A 2LRDA 4B47A 3QOEA 3L2QA 4QPQA 2VASA 3H5AA 2L9NA 4NUBA 3AL0C 2WAEA 2W7NA 5HOOA 4J9WA 2LYCA 4BL0B 1LKXA 4RM3A 1BOBA 2CV2A 5HA4A 3M1CA 2W4SA 1WFXA 4KISA 2E5NA 3K4NA 4BDZA 2XC7A 3K70D 2ZVFA 3J7AY 4PY9A 1Z7LA 3CJQB 4J01A 5ANPA 2ZXHA 3IGHX 3N05A 4F55A 3CZ6A 2OUMA 2L5QA 3OS0A 2Q9HA 5KHDA 2CV1A 2R7OA 2E1MB 2JVGA 3OWTA 3VYSB 3OYNA 2BOLA 4N4OB 4BS9A 2ZFUA 2WY7Q 4GL6A 1SDJA 1WJFA 3OYEA 4PUSA 1MMNA 3LSKA 1OLTA 3OR1C 3S3OA 3K4BA 5HVQC 2PJRA 3QYBA 4CCOA 1J09A 3RQ4A 2X6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG3 A; 
#chains in the Genus database with same CATH topology
 1UAA A;  4LLG F;  2L2O A;  4XM3 A;  5EEH A;  1HKS A;  1TBX A;  1B8I A;  2EIJ H;  2MYS A;  1VQ9 I;  2EQR A;  1GLN A;  2ID6 A;  4P9U A;  4JBD A;  2X1C A;  5K5O A;  1HSJ A;  2HOT A;  3F8N A;  1ERD A;  4XOP A;  2MH9 A;  2E7W A;  3L2C A;  1TW2 A;  2E19 A;  2XVC A;  3CJT B;  2YU9 J;  5K5Q A;  4HF1 A;  2GLO A;  3BC8 A;  4L5I A;  4F93 B;  1UMQ A;  1UEL B;  1BJA A;  2HXO A;  5ED4 A;  2VN2 A;  1QBJ A;  3PM1 A;  3KEQ A;  2DK8 A;  2GOX B;  3A4C A;  2EZH A;  2P8T A;  4F7Z A;  4KMU X;  2VB6 A;  4Y15 A;  2R92 J;  2Y9Z A;  1RNL A;  1OYY A;  3RPU A;  1X3W B;  2CQQ A;  4HSR A;  1H9T A;  2WAQ A;  4BY7 J;  5IY5 H;  5KNL A;  1WJC A;  3LSH A;  1Z67 A;  2L9V A;  3FXM A;  3G71 I;  2R93 J;  4M9Z A;  4LJZ F;  1IV8 A;  4XKB A;  3BCB A;  2VQH A;  4PCQ A;  3HOT A;  4CDG A;  5FRM A;  2ZME A;  5CQE A;  2COM A;  1HW2 A;  2PMZ A;  3S1N J;  2E2J J;  3D5R C;  2ZB9 A;  1T98 A;  4DZP A;  2CGP A;  1FTT A;  2OD5 A;  4I76 A;  1T6K A;  1ZTR A;  2HYJ A;  4KT6 A;  3H9Q A;  4Q4Z F;  3ZQL A;  1V4R A;  4LB6 B;  5M5W J;  3TED A;  4KMF A;  1HF0 A;  4YIR X;  2M4G A;  3DLA A;  2IW5 A;  1XC5 A;  2K9S A;  4BUP A;  1ETX A;  1P92 A;  2R4G A;  2BZT A;  2BW3 A;  2PMU A;  5ILV A;  1ODD A;  5LGU A;  2CYY A;  4LK0 F;  3F8B A;  4B3A A;  2JK3 A;  3OYI A;  2AXL A;  4KIB A;  2IS2 A;  3NEU A;  3PQK A;  2E1C A;  2XGE A;  2MW8 A;  2MA3 A;  4Q48 A;  1X58 A;  2MG4 A;  4PK4 A;  3LSP A;  1KU3 A;  4CCJ A;  2MBF A;  3CMM A;  2NOJ B;  2WAF A;  2ENX A;  2X6O A;  1TT5 B;  2JUG A;  1XMK A;  2A6T A;  3FBI B;  3G3Z A;  2RN7 A;  4EVI A;  4OA3 A;  5D5U B;  2V79 A;  2DMQ A;  2VI6 A;  3E7L A;  4RB2 C;  2P6S A;  2VBZ A;  3LSR A;  3C3W A;  4NQW A;  1T95 A;  2DT7 B;  4BQO A;  4CXF A;  3I56 I;  1XPX A;  3OYH A;  4IRH A;  3B02 A;  3RZO J;  4A0Z A;  2CUZ A;  3JAM K;  3OYJ A;  4GGG A;  2O0Y A;  1K6Y A;  2OPT A;  3CJR B;  2GQQ A;  2K9L A;  3GEZ A;  2E60 A;  9ANT A;  3SDG A;  1RET A;  3K6G A;  3TP0 A;  4ENK A;  3F9K A;  4EJO A;  2FBH A;  4HG2 A;  3H0G J;  3ICJ A;  4LG0 A;  4E7I A;  2DJI A;  2QQ9 A;  4A3I J;  4BE1 A;  2P4W A;  2ZME C;  3CF2 A;  2W84 A;  1U0J A;  2K3F A;  5EGO B;  3L2R A;  4L0Z B;  4A3G J;  4A6E A;  3ESW B;  4BQA A;  4LIV A;  2OA4 A;  1OJL A;  1MMA A;  1Y0U A;  1MD0 A;  1TWG J;  1UG0 A;  2OQG A;  4Q60 A;  2F48 A;  2ZSI B;  4U7D A;  3MZ8 A;  4LGW A;  4RAZ A;  1P7I A;  3N4M A;  4KIC A;  5DM7 F;  3S1R J;  4MQV A;  1YO5 C;  2HAW A;  1A36 A;  1BI3 A;  5DS9 A;  1MDM A;  4ETS A;  3SXY A;  1X3Z B;  1S5L C;  1WVR A;  2V4J C;  4A3M J;  3FXR A;  3BR3 A;  4XRF A;  4CA0 A;  2IT0 A;  3CES A;  4HLY A;  1FOY A;  3I4N J;  3WGG A;  5AIQ A;  1P4W A;  1D3Y A;  2Y0M A;  2E2I J;  2JRM A;  4ENM A;  1GV2 A;  2ZSH B;  3KZY A;  2OTL I;  4Y13 A;  5HS8 A;  2H27 A;  4MIM A;  3EKM A;  1YIT I;  3MZH A;  1BWZ A;  1TQP A;  3QPH A;  1FIP A;  1UCR A;  3HOU J;  3CDL A;  2IGO A;  1R71 A;  5LRR A;  3ABU A;  4I98 B;  1QA6 A;  1G8X A;  2VT2 A;  1ZRF A;  3NAR A;  1FC3 A;  1QGP A;  3W2W A;  2TRT A;  2DOE A;  5F04 A;  2D1V A;  3R61 A;  3MN2 A;  5HLI A;  5LHI A;  4ESB A;  3HKZ N;  3AG4 H;  5D5W B;  1D0Z A;  4D5C A;  2NAZ A;  5L3G A;  2R3S A;  2IGN A;  3ERM A;  4IVN A;  5GP9 A;  3PL8 A;  3SZG A;  5F1R A;  3MVP A;  2PG4 A;  1DU6 A;  5E8I A;  1D8K A;  1JGG A;  2Z1D A;  2CH0 A;  1AA7 A;  2L02 A;  1N25 A;  2MSY A;  3M4O J;  4AC0 A;  5IYC J;  3SFZ A;  2XV4 S;  5DUI A;  2P81 A;  5LEJ A;  3VFZ A;  3GLX A;  5FRN A;  3S2H J;  2W85 A;  4M3B A;  2XKO A;  1ORK A;  3EDP A;  1Z6T A;  5EEA A;  1XGM A;  2JMW A;  1S9H A;  3H9G A;  4ITV A;  2MLG A;  1OCR H;  1BR1 A;  4AYB N;  3OYL A;  1X1B A;  3L2U A;  1BIA A;  2JVH A;  2R7T A;  3I58 A;  3KP7 A;  2HDD A;  1FMV A;  5B5E C;  3IH4 A;  3KYD B;  5D8K B;  2K4B A;  3JRE A;  1APL C;  3HOW J;  4LB0 A;  1ZLJ A;  3SZP A;  2L9R A;  2DT5 A;  4XLA A;  2DTZ A;  1UJ8 A;  1ZGJ A;  1M1E B;  2GIV A;  1YI2 I;  2CFO A;  1W62 A;  3GZ6 A;  4MEY F;  2ELH A;  3FXJ A;  1LJ9 A;  3R4K A;  4MO7 A;  4BDY A;  5HLH A;  3X2Q H;  4JYK A;  1YS6 A;  3QYF A;  4ANJ A;  3MKL A;  3NWT A;  3KX2 A;  4I99 C;  1U8R A;  1W4M A;  2KQR A;  3BR0 A;  5EZG A;  4PJM A;  4UY8 I;  4KIF A;  3VYU B;  1XMA A;  1ON2 A;  3F8F A;  5D4R A;  1FX7 A;  4PJJ A;  2YSR A;  3EYY A;  2EFO A;  2LFB A;  2M8E A;  2KFD A;  2M5W A;  5EYR A;  3TOB A;  4EJU A;  4KN7 X;  3OYC A;  3M3Y J;  2ZKZ A;  3J81 Z;  4HX7 A;  4XOR A;  5HLG A;  2HVR A;  2EA2 A;  2QSG X;  2XAQ A;  2EV6 A;  3EUH C;  3NQO A;  4W1U A;  2Y0S A;  3VYR B;  4KDP A;  4RPA A;  1U9N A;  2L3D A;  1NG6 A;  1BI2 A;  1W7P D;  1PVE A;  4BBR J;  3VB2 A;  3D5L A;  3E6B A;  3SQN A;  2HQR A;  1H9G A;  1S29 A;  1OYW A;  3H9J A;  4IF4 A;  4QTR A;  1K83 J;  1B8I B;  4NB5 A;  1G6N A;  4X6A J;  2X4H A;  4L0Y B;  1D8J A;  2EZK A;  2VQL A;  2ZXR A;  2XF6 A;  2JJ7 A;  4PFP A;  5TGT A;  1USS A;  1PDN C;  1R58 A;  1HA8 A;  1KYZ A;  4E70 A;  4OIR F;  2IAI A;  2EIM H;  4H4K C;  4PSX A;  4D7N A;  3K1N A;  2KRF A;  4C3I J;  1B4A A;  3AKZ A;  4HQE A;  3G6E I;  3EYI A;  2R7D A;  4DQ2 A;  3IKV A;  2KIF A;  4Y4R A;  3ZCO A;  2BY1 A;  3NWS A;  3OS1 A;  3RKX A;  2ZNZ A;  1E3P A;  4PFO A;  4AID A;  3QOP A;  5HS9 A;  4C2T A;  4B3X A;  1ZYR F;  5D5X B;  2XPW A;  3GME A;  4HX4 A;  1MNM C;  2KJB A;  3FM5 A;  1R4N B;  1RI7 A;  1PUF A;  1V54 H;  4JOM A;  4ZTF A;  1R36 A;  5E3L A;  2CWE A;  3FDY A;  1FOK A;  4OMZ A;  2W24 A;  2KRC A;  1QHH D;  1IRX A;  1Z1D A;  1SFK A;  2PX9 A;  3BLY A;  4G94 A;  2QEX I;  4RLF A;  3C18 A;  3L2W A;  5EZH A;  1JJ8 C;  5IT9 Z;  1WWX A;  2ZNY A;  1VF9 A;  4IQ4 A;  1XSD A;  3DPL C;  2H09 A;  1IZ1 A;  3DTK A;  2JA7 J;  1Y6I A;  5GTH C;  2BW3 B;  3BR5 A;  3DXJ F;  1JE8 A;  4G6Q A;  5H20 A;  2BXY A;  1XUB A;  3KFW X;  2FUG 2;  2DOD A;  4EJT A;  3M8F A;  4AIJ A;  3LA2 A;  3LSJ A;  3WTU C;  2F6C A;  2KIQ A;  1MNE A;  4Q47 A;  1YRN B;  1OCO H;  3KP6 A;  2JRT A;  3BJO A;  4AIH A;  4E7H A;  4HV5 A;  2QBY A;  1JI8 A;  3HSF A;  1AU7 A;  4ASN A;  2DFF A;  2X6Y A;  2AQE A;  2ZJP F;  3Q0U A;  3GTP J;  2DA1 A;  2L4M A;  2HTJ A;  3ZMU A;  4DOZ A;  3HPG A;  1R22 A;  2OU2 A;  2LDU A;  2XB5 A;  4BJ6 C;  3R0J A;  4N0B A;  3EET A;  4DUN A;  1QPM A;  1Z6R A;  5EDN A;  4DJA A;  1IV6 A;  2L54 A;  4OOI A;  3WTW C;  4EGZ A;  2R7U A;  2Y48 A;  3A0B C;  3HL2 A;  2EBI A;  2FRH A;  3E3V A;  1IN8 A;  4EJW A;  4F91 B;  3LNQ A;  3O3K A;  5D6F A;  1IN5 A;  2HYF A;  2XSJ C;  4XOT A;  4ZDL A;  5KAI C;  3ZQC A;  5FO5 A;  3O6B B;  4MTD A;  4HLX A;  4HAM A;  4ZJZ A;  1XS9 A;  4XKC A;  4LG0 B;  2OBP A;  2Y0S N;  1REP C;  2IGK A;  1QZY A;  3O2P E;  2MD0 A;  1SMT A;  2E1N A;  3DPU A;  2KMU A;  3Q3S A;  4A2U A;  2F5E A;  5DUK A;  2RRE A;  4AUX A;  1JT6 A;  4CHU A;  2VJ4 A;  2XAS A;  1T38 A;  1D1A A;  5KVR A;  2AQF A;  5TRD A;  2DCE A;  3H5N A;  1ON1 A;  2EFQ A;  1LVA A;  5CVR A;  1NK3 P;  3BG6 A;  2IA2 A;  3K4M A;  2GKJ A;  4GYG A;  2QWW A;  1KQ0 A;  2K5C A;  2A6H F;  2QZ8 A;  1TT0 A;  4YFN F;  2X85 A;  1DPR A;  4F92 B;  2O03 A;  3BDD A;  2B9S A;  1U5T A;  2IS6 A;  3FXU A;  4A3E J;  4A3D J;  4XL9 A;  3QU6 A;  4WXH A;  3QOE A;  2HXI A;  2JN6 A;  1YJN I;  4B4C A;  3GXO A;  2IEK A;  4NUB A;  3K7A J;  5DDG A;  4ZYG A;  3JRA A;  4FT8 A;  2XRO A;  5HOO A;  3KET A;  4UUT A;  3B6C A;  4K2E A;  5F27 A;  2FX0 A;  3M07 A;  2RKH A;  4BDZ A;  2ME6 A;  2XPU A;  3FXO A;  1MZB A;  1O4X A;  1Z7L A;  1X3U A;  4J19 A;  3IGH X;  3FX3 A;  5EEG A;  2KZG A;  4F55 A;  3JAM Z;  2OUM A;  2L5Q A;  2IA1 A;  1YFH A;  2JWT A;  3OWT A;  4IXA A;  4FIS A;  3J7Z I;  4N4O B;  4BS9 A;  2WY7 Q;  2EFW A;  1YHQ I;  5J40 A;  2QSH X;  2BXZ A;  5J6X A;  1HDD C;  2QCO A;  2KIS A;  4OIN F;  3V7S A;  5CVV A;  4C3H J;  4O5V A;  4OIO F;  3KPH A;  1LNW A;  1R1T A;  2NVU B;  1F4K A;  3HHG A;  3CUQ C;  2EFN A;  3K4B A;  1QZE A;  3E97 A;  1J09 A;  2X6W A;  1ULY A;  4OU0 A;  2RGV A;  5LLQ A;  1HST A;  3LQQ A;  4J00 A;  3A01 B;  5HOD A;  3CQZ J;  2HVS A;  4P96 A;  3K0L A;  1SVM A;  4XK4 A;  4BU2 A;  3I3L A;  2NYX A;  2W57 A;  2FOK A;  3E6D A;  3COA C;  3DLL F;  5EF6 A;  2BHZ A;  2E35 A;  3LSM A;  2ISY A;  1FMW A;  4HF2 A;  2FOW A;  2V6E A;  3PNV A;  4EV0 A;  2VLA A;  2ZXP A;  2ZBK A;  1C0W A;  1YW7 A;  2FQ4 A;  1UHW A;  3FXL A;  3LSI A;  2O9L A;  2GM4 A;  3KYC B;  1TNS A;  4I7H A;  4CZC A;  3MKW B;  2H94 A;  4UV8 A;  3HIF A;  4F3Q A;  1TLH B;  2XF7 A;  1O7F A;  3MFK A;  3L7W A;  3ZMT A;  2WWY A;  1I6H J;  4M3D A;  3BG3 A;  4ZTJ A;  1U1V A;  3CC7 I;  2DA3 A;  4V2G A;  1CQT A;  1HBX G;  3GF2 A;  3EUH A;  1JXS A;  4FTH A;  2MGQ A;  5H6Q A;  5LEK A;  1F9N A;  3VOD A;  3KEO A;  4PZJ A;  3BOQ A;  2PLY A;  2VOP A;  4M72 A;  4EGY A;  4ZDO A;  4V19 K;  4Y17 A;  4K7X A;  3V42 A;  4PSW A;  4RAF A;  4DIQ A;  2O8K A;  3HXL A;  3P7N A;  2M2E A;  2PMZ N;  3ZQG A;  4U87 A;  4ESF A;  4WX9 A;  1JKO C;  3V7C A;  2JA8 J;  3Q9V A;  1OFC X;  1Z77 A;  3K4J A;  4L9T A;  4XLE A;  4II2 A;  3LA7 A;  3TW6 A;  3PIO F;  1ETK A;  4M9X A;  1TP4 A;  2W00 A;  4S0H B;  5TIS C;  1ETQ A;  1X4O A;  2LMD A;  2QUF A;  4IHV A;  2GXA A;  4RM2 A;  1X1P A;  4WXD A;  1IF1 A;  2K7L A;  1OCC H;  2VBW A;  3FXK A;  1MJB A;  1WPK A;  1G59 A;  1VQ4 I;  2DXI A;  2WV1 A;  1WJ5 A;  2L9S A;  2EIL H;  2OZU A;  1F36 A;  2RNJ A;  4R79 A;  5ICE A;  3WTX C;  4G7Z F;  3DPT A;  5L3C A;  2OCC H;  1BR4 A;  3CC4 I;  1PP8 F;  2PFB A;  1DP3 A;  1W5S A;  4XRM A;  1FNN A;  2YPR A;  5M47 A;  2YX7 A;  4JQF A;  1EJ9 A;  2R7Q A;  1F1Z A;  1G3T A;  2BY3 A;  3PQJ A;  3DTE A;  2MC4 A;  2KKO A;  2XDV A;  2DI3 A;  5F0F A;  2ESN A;  4G7H F;  2PVZ A;  2B63 J;  1W61 A;  2VKH A;  2CJJ A;  5JHF A;  2V1N A;  2ISZ A;  4IRG A;  1PUF B;  4BHP A;  1BI1 A;  4DW6 A;  2QB8 A;  1YW9 A;  1YX3 A;  1B9M A;  1KA8 A;  4G6T B;  1CF7 B;  4ZYH A;  3OYD A;  2G9W A;  1TQI A;  4ENJ A;  2Z5U A;  5F6F A;  1IJW C;  1G3Y A;  2XAH A;  2DA6 A;  5GAD J;  2RC4 A;  3IUO A;  4Q2H A;  2R7W A;  1EKE A;  1WHU A;  2EH3 A;  2Z3Y A;  4HNV A;  4EM2 A;  2K86 A;  1IC8 A;  4PJN A;  3I5U A;  4LOC A;  3I0T A;  3Q5F A;  1FOW A;  3WGH A;  1YOV B;  1TNT A;  5CKT A;  1TM0 A;  3VYT B;  1N77 A;  4NC6 A;  1HKQ A;  3V8L A;  1SD6 A;  1CGP A;  5K5R A;  3B73 A;  2FML A;  3TDU C;  1YRN A;  1Z05 A;  4II3 A;  1WGX A;  2QBY B;  4NBQ A;  1IUY A;  2Z9O A;  1LQ1 A;  2HOE A;  1WKM A;  1X19 A;  4YIF A;  2M8G X;  2O7O A;  2VE8 A;  2F5F A;  5E1Z B;  3TW7 A;  5BS6 A;  4CCM A;  2DOA A;  1ZLK A;  2CFX A;  4JD7 A;  3A03 A;  3RSN A;  4E6K G;  3WOD F;  4UXN A;  3V4G A;  2EK5 A;  1GVD A;  3ZR8 X;  5DCF A;  1T08 B;  1W36 D;  4PGH A;  1BBY A;  3D1N I;  4EM0 B;  4W97 A;  3E5U A;  3FHZ A;  1WH7 A;  1PJR A;  3GFL A;  3OYA A;  1W5T A;  2DFE A;  3Q0W A;  3S2D J;  1EA3 A;  4ZYE A;  4P1W A;  5DD8 A;  3S15 J;  3GO5 A;  3MMY B;  1G2H A;  4WXC A;  2QM3 A;  2L7Z A;  2WAD A;  1MIJ A;  2X1E A;  4FCY A;  2ECB A;  2GA1 A;  4U0Y A;  1TZL A;  4IEJ A;  1G3S A;  3OIP A;  2HZT A;  3ZQI A;  3ZMV A;  1MBE A;  4LS9 A;  3FKI J;  3W5W A;  2CW7 A;  3CME I;  1B59 A;  4N9H A;  3OL4 A;  1TWH J;  4CYD A;  3TOA A;  2VOO A;  3PW9 A;  5B1A H;  1U5T B;  2DK5 A;  4XBF A;  3K4C A;  1NHA A;  3E5X A;  2DT6 A;  3HJE A;  1R5I D;  1QZZ A;  2M87 A;  2IS4 A;  5E3N A;  5J1Y A;  4HRI A;  2KPM A;  3K4L A;  2IRF G;  2MAB A;  4DBQ A;  2VJI A;  2JTV A;  1SFU A;  2JA5 J;  4CO8 A;  4GRI A;  4NC7 A;  3TDZ C;  1ZQ3 P;  4RB0 A;  3VWB A;  3DV8 A;  5LFA A;  1W0T A;  5D5V B;  3GTO J;  3MAJ A;  2I8D A;  3OR2 C;  4UB8 C;  3GYH X;  2ESH A;  2K40 A;  4RB1 A;  1K4T A;  1DDN A;  3EDN A;  2ZC2 A;  3IV5 A;  1FBS A;  1S7O A;  5J8C A;  1IR6 A;  2LC2 A;  1H88 C;  1OYI A;  4KUM A;  1MW7 A;  2FXA A;  3C2H A;  1E17 A;  5IP9 J;  5KCM A;  3W3C A;  3H3Z A;  2NVQ J;  2DBB A;  3K69 A;  3ZMZ A;  4A69 C;  3HGY A;  5DYM A;  1VQM I;  1FYM A;  1UHS A;  2VL8 A;  3KP4 A;  3HC7 A;  3CC2 I;  4FE7 A;  4DYR A;  4M6X A;  3LWF A;  2UUZ A;  2ZJR F;  3A01 A;  1W36 C;  4EJV A;  1S8N A;  3VSL A;  1Q1H A;  1IRF A;  1BJZ A;  2MD5 A;  3ABM H;  2QB7 A;  2E34 A;  1T33 A;  2ID3 A;  3QWL A;  1OKR A;  4LIU A;  4LK1 F;  5FKO A;  3GTJ J;  3DP7 A;  5LBQ A;  2VPL A;  2VT3 A;  3A0H C;  3ZQF A;  1Y39 A;  4J9X A;  4ZYD A;  3GWZ A;  3KLN A;  3SFI A;  1F43 A;  2EV5 A;  5E17 F;  5CVJ A;  4Y33 A;  2EIN H;  4XMY A;  3SJM A;  1W7P A;  4E7K A;  5FLX Z;  1FYK A;  1IG7 A;  3BTC A;  1A31 A;  1D5V A;  2EV0 A;  2PW0 A;  1B6A A;  3FHN A;  4L18 B;  1IDY A;  4ON0 A;  5DM6 F;  5BMZ A;  2KP6 A;  1SD5 A;  5F1J A;  2LVS A;  2KW7 A;  2BV6 A;  1S6L A;  1MMS A;  3PJR A;  1OR7 C;  1RPW A;  5FD5 A;  4I01 A;  3EPZ A;  1QVU A;  1YE9 A;  2M30 A;  2V6C A;  1X2M A;  2NNN A;  4FQG A;  1GQZ A;  2H8W A;  5ICC A;  3WG9 A;  2KIU A;  4QIW N;  3JRD A;  1ZR2 A;  1N78 A;  3I53 A;  2BEO A;  2HVQ A;  2QSF X;  3LA3 A;  5IPA A;  5L3D A;  1DGW Y;  3QP5 A;  4YFK F;  4GXO A;  3BG7 A;  2BVM A;  4HNT A;  3GTQ J;  1WPM A;  1DPU A;  4FHT A;  3HB9 A;  2PMH A;  3DEU A;  2IP2 A;  2KT0 A;  1KU9 A;  3IRR A;  4AIK A;  1K6O A;  3PSI A;  3FBN B;  3R60 A;  4DNC A;  1DGR M;  2J5O A;  5J4V A;  1K7A A;  4BEH B;  3JSO A;  3PTJ A;  4XRS G;  3CCE I;  2O61 A;  1OCT C;  1ZRE A;  2ZCW A;  2HU9 A;  3EUK L;  1IDZ A;  2VXD A;  3FM3 A;  3K2Z A;  1I50 J;  3JSP A;  2Q0O A;  2XKP A;  4IHW A;  3ABL H;  5H2G A;  3OOU A;  1G3W A;  1BL0 A;  3RKW A;  2P5K A;  3GFI A;  1QY9 A;  2VOD A;  1IXC A;  4LFU A;  3OYK A;  5K7H A;  5K7Z A;  3HTU A;  2G7H A;  2M34 A;  2ZXI A;  2Q2E B;  4YRV A;  2QKL B;  1XSV A;  2Y69 H;  3HGG A;  3Q9S A;  4Y7N J;  5C4J J;  2QQA A;  1SD7 A;  4HZF A;  2QKM B;  4YFX F;  2EFP A;  3H3U A;  1VQO I;  1YQA A;  4OIP F;  1KU2 A;  4I02 A;  4PJ0 C;  1DP7 P;  4GO1 A;  3KCC A;  2Y2Z A;  3OYF A;  4MLO A;  3GW2 A;  3T8T A;  4D5F A;  5M5X J;  1WJB A;  3JRB A;  4YII A;  2XAU A;  3EQL F;  4L5E A;  3H5R A;  3CP8 A;  2LOO A;  3BPX A;  4JX6 A;  3S1Q J;  3HEF A;  3RQI A;  3JRG A;  1CF7 A;  4CCK A;  1P4X A;  2JA2 A;  3LFK A;  2FBK A;  3ABK H;  3U21 A;  5DD4 A;  5CPR B;  2JSC A;  1QU3 A;  1E0E A;  1HOM A;  3HBL A;  2CRG A;  1ZK8 A;  2LTP A;  5CVI A;  1D0X A;  3ROU A;  2EJR A;  1KZH A;  4D1Q A;  2D1H A;  2K9M A;  4JX4 A;  2ETH A;  1ZAO A;  1UHM A;  2F4I A;  3BT9 A;  3PUF A;  3DBL B;  2HS5 A;  3BJA A;  2BY2 A;  1IW7 F;  4B48 A;  2F5C A;  1HDP A;  2LRD A;  5CYV A;  1YIJ I;  1OPC A;  5HDG A;  3H5A A;  4AVP A;  4P9F A;  2WAE A;  4G12 A;  3RKY A;  3TGN A;  3DEW A;  4MEX F;  1LKX A;  2LKX A;  4IRI A;  3M1C A;  4X1E A;  1D5Y A;  3AG1 H;  5LHH A;  3K4N A;  2XC7 A;  1SAN A;  4UVB A;  2X48 A;  3ECH A;  2FNP A;  3N05 A;  1TC3 C;  2XAJ A;  3L9F A;  5KHD A;  1OCZ H;  2JVG A;  4UHT A;  2FJ1 A;  3VYS B;  3WTV C;  3OYN A;  2BOL A;  1MSE C;  3KE2 A;  3CCQ I;  2ZFW A;  3HRS A;  1XGO A;  2DN0 A;  5IYD J;  1FBQ A;  1SDJ A;  5GAG J;  3OYE A;  3G4S I;  2VKE A;  3LSK A;  3CCS I;  2Y30 A;  3RQ4 A;  3F72 A;  1WJD A;  1ZH5 A;  1I39 A;  1TTY A;  3IAS 2;  5ICG A;  2HZD A;  5LGT A;  3WE2 A;  1RC9 A;  2F4M B;  3HOY J;  4OWR B;  1QRY A;  3VSK A;  1T8I A;  4AWX B;  1GUU A;  3K1P A;  2NXN B;  1NK2 P;  4GCV A;  1VFC A;  2HR3 A;  3FMS A;  4KFC A;  1ZR4 A;  1MBJ A;  1R4M B;  2PN6 A;  4XRS A;  1ETO A;  4V2F A;  1FSE A;  3WHC A;  3T5X A;  3AFH A;  3G73 A;  2QYO A;  2J5P A;  1IN4 A;  4M6V A;  4F52 A;  3NAU A;  3U2R A;  2GKE A;  3A1Y A;  4KT5 C;  2AXT C;  4XIC A;  1T0F A;  3WTS C;  1X1A A;  4HST A;  4ZZD A;  1UB9 A;  3RKQ A;  2W82 A;  5CVU A;  2YU3 A;  2CG4 A;  1VTN C;  1FT9 A;  2OC6 A;  1H0M A;  2QEN A;  1D0Y A;  2M7B A;  3GTL J;  2I5U A;  3JCU C;  2DPU A;  3CUQ B;  3VDX A;  3HG9 A;  1MND A;  1XGN A;  2A07 F;  1SFO J;  2CUJ A;  1JTY A;  4DGW B;  5FKL A;  4YEL A;  4FX0 A;  1B1B A;  2ICW G;  3VEP A;  2M1B A;  4QPO A;  2V1U A;  2WB1 N;  3RTR A;  3J80 K;  3QRF F;  3G1O A;  3MKY B;  1ZN2 A;  3IH2 A;  4NNJ A;  3ML6 A;  1GV5 A;  2RAE A;  1BIB A;  3JTH A;  1UZC A;  2LD5 A;  3HRM A;  1Q1V A;  1O57 A;  2G0E A;  2BBY A;  3HKZ A;  3OIO A;  1FWZ A;  1GHC A;  3WTZ A;  3TQN A;  2WY8 Q;  5K7F A;  4RA2 A;  3CMY A;  2PBI A;  2FD5 A;  3H36 A;  3H3V K;  4IK0 A;  1Z9C A;  1AOY A;  2P5V A;  3WHB A;  4LLN A;  4ENN A;  5JHU A;  4MNU A;  5HNH A;  2ZJ2 A;  5GAE J;  2RVC A;  3QAH A;  3AL0 B;  1A6I A;  2GWR A;  1ZGA A;  4HW0 A;  4U0W A;  3ZMS A;  2XF5 A;  3L00 A;  3SYT A;  1FPQ A;  4JP0 A;  1ZG5 A;  5JLX A;  3BQZ A;  1ITY A;  1ACI A;  1D1C A;  4K8L A;  1ZAR A;  3FZV A;  3L2V A;  2HI3 A;  1LPQ A;  1W7P B;  2XSD C;  4YEJ A;  2V26 A;  3I54 A;  4HDV A;  3BR6 A;  4N9I A;  1E3H A;  1POG A;  4NDL A;  1TWC J;  2QLZ A;  4EAT A;  1J7K A;  3IP4 B;  5AON A;  4WK8 F;  1X1D A;  4C30 A;  2CMP A;  5JLW A;  2IXS A;  4IOA F;  1VQK I;  1U6G A;  4RMN A;  2H8R A;  3MWM A;  1XMX A;  2DDA A;  2VPR A;  5F64 A;  3U9G A;  1DU0 A;  3OIQ A;  3IH3 A;  2DA4 A;  3CCR I;  2NS0 A;  3ZP5 A;  1BW5 A;  4AVZ A;  2D5V A;  1DQU A;  1S7A A;  1Z7U A;  1VQ6 I;  3GZ5 A;  2IPQ X;  3RCO A;  1FJL A;  1LEB A;  1ETV A;  1YS7 A;  3PO3 J;  1SFE A;  5FRO A;  1JT0 A;  1JUS A;  4D9J A;  1PUE E;  3DU6 A;  2AO9 A;  3GFJ A;  4JK1 X;  2ZO4 A;  4LB5 A;  2GIZ A;  1R1U A;  5IP6 A;  1KGS A;  1X4P A;  2FNA A;  2HFH A;  3FXQ A;  3HHH A;  3GLL A;  4BEH A;  4IQJ A;  1K23 A;  2KPT A;  3HM5 A;  1RR7 A;  2WC2 A;  2LP0 A;  4UNO A;  3QU3 A;  2OTJ I;  4D7M A;  2LY1 A;  1FBU A;  2GZW A;  4A3J J;  1K20 A;  3CCY A;  3ISP A;  2UZK A;  2VQG A;  4BQQ A;  2M7A A;  2DMU A;  1WH5 A;  2COB A;  2N8G A;  2Q2E A;  1IRZ A;  4MQ9 F;  2O5R A;  3KEY A;  4RGR A;  4QWQ A;  3G98 A;  4CIC A;  2TCT A;  2UWM A;  1I1S A;  2A3S A;  1DUX C;  4I6Z A;  4BBS J;  4XLC A;  2V9K A;  3CLQ A;  2K02 A;  2HNH A;  1SAX A;  1KON A;  1VND A;  4WF2 A;  1LEA A;  1O3Q A;  1HCR A;  2EB7 A;  2Y9Y A;  3BY6 A;  3T0Y A;  2ACJ A;  1FP2 A;  2XRL A;  2BY0 A;  1H89 C;  2H1K A;  2X6X A;  4HEA 2;  4C2U A;  3HTS B;  5KK1 A;  1BA5 A;  2D45 A;  3CDH A;  2DMT A;  2CW8 A;  2GOM A;  3OYG A;  1ENH A;  5H2Y A;  1S7J A;  2KDO A;  2MFZ A;  2XIG A;  5FKM A;  4RS8 A;  5ICF A;  4HA8 A;  4G9Y A;  1YTY A;  5C44 J;  4JUU A;  4B43 A;  3I4P A;  2WAQ N;  1KQ8 A;  4CGZ A;  2CSO A;  1QO0 D;  4M71 A;  2DYR H;  4BJT A;  3GVA A;  5JR3 A;  4M74 A;  5H2F C;  3CP2 A;  4TV7 A;  2DPD A;  3MD2 A;  1E3O C;  3R6S A;  2LKP A;  2L01 A;  4BH9 A;  1U9O A;  2DFI A;  2LBF B;  2FE3 A;  2HTS A;  2YMA A;  3TO6 A;  1I5Z A;  2VON A;  4HQM A;  4GDF A;  3S93 A;  4IKF A;  3ZQ7 A;  2W1O A;  3ZPL A;  2MPB A;  5EG0 A;  1Y1V J;  4XSX F;  5KAF C;  3IAM 2;  5IYB J;  1HKT A;  5IOY A;  4BYY A;  1I6X A;  3ULQ B;  2DLL A;  2ADU A;  3SDB A;  5HDN A;  1HC8 A;  3EJX A;  4IJA A;  2CV0 A;  2OV7 A;  3LOC A;  3I64 A;  5FLV A;  5D4S A;  3AG3 H;  4DYC A;  4E7J A;  2V9P A;  4CUG A;  1LE8 B;  4BQN A;  1YYV A;  1SVL A;  2Z2S B;  3W6J B;  1AKH A;  3M1E A;  4L9V A;  1MBK A;  1MSF C;  1JKR C;  1U1X A;  1JUM A;  4A5N A;  4XON A;  1O7L A;  4EEF G;  4I2O A;  4ABZ A;  3BZC A;  1O3T A;  2HPM A;  4NC8 A;  2WA0 A;  1R00 A;  4CSW A;  4IPA A;  3H1C A;  3CO7 C;  1SEU A;  1KQ9 A;  4AU7 A;  1LDJ A;  2WV0 A;  1STZ A;  1IN7 A;  3KZI C;  3B6A A;  5FKN A;  2A5Y B;  3TMO A;  2EPF A;  5M3F J;  1GVJ A;  2IVM A;  2VQC A;  2OF7 A;  2X51 A;  3HYI A;  3J80 Z;  2AZP A;  1RES A;  2ELJ A;  3H35 A;  3KP5 A;  2R7X A;  1U1W A;  1T0F C;  2LY2 A;  3O8G A;  3FWE A;  4IHS A;  1WSU A;  1WI9 A;  3C2B A;  4L5J A;  1WI3 A;  3JTG A;  3KP3 A;  4U88 A;  3WU1 B;  4IX7 A;  1P2F A;  4RGS A;  1TW3 A;  3W2A A;  1GXP A;  1ETY A;  5L3E A;  1U3E M;  2O8X A;  2NVX J;  4ZC3 A;  4Y3O A;  2DA2 A;  4UVC A;  1MBF A;  5CJ9 A;  2FF4 A;  3GZN B;  3FK6 A;  3CF5 F;  3HOS A;  2IW4 A;  2V9V A;  3GTG J;  1RIO H;  3LST A;  3K70 C;  1K61 A;  5J3L A;  2M3A A;  2QQB A;  4BAC A;  5E18 F;  3RPQ A;  2RQQ A;  3BQY A;  2UXX A;  3C2G A;  3PFI A;  4B44 A;  3GX4 X;  3CUQ A;  2KLO A;  3E0J B;  3I4M J;  4MTE A;  4LG3 A;  3ELK A;  5E79 C;  2Z33 A;  3I71 A;  2BYV E;  1JGS A;  5E1X A;  3ZMD A;  3S8P A;  3N97 A;  3DBH B;  1V5G A;  2VC0 A;  1YJ9 I;  1WJE A;  4NHJ A;  3K10 A;  3PSF A;  3U1D A;  2H1L A;  1TQM A;  2PQ8 A;  3QPS A;  2HKO A;  1J5Y A;  2EIK H;  4E7S A;  1P4A A;  2LF7 A;  1K78 B;  5CQG A;  3A02 A;  4C9Y A;  1FYL A;  1VQ8 I;  5HDK A;  4RGX A;  5JI6 A;  5E1W A;  2GXG A;  3O8H A;  3OY9 A;  5BOX A;  1OMI A;  2AHQ A;  1I3Q J;  2GA2 A;  4WWC A;  1FLI A;  2VBY A;  4IJZ A;  1RUO A;  3BJ6 A;  3VOE A;  1SVO A;  3P5J A;  2UV1 A;  3LMM A;  5J47 A;  2OQR A;  1YM5 A;  1MGT A;  2ECC A;  2O6G E;  1VQL I;  3PUB A;  2JPC A;  1A6Q A;  1IXR C;  3WE3 A;  4RLQ A;  3DKY A;  5J1R A;  5IOZ A;  1XCV A;  1I74 A;  5F08 A;  1A35 A;  1I3A A;  2DMN A;  3ECO A;  2R0Q C;  4CCL A;  4A3C J;  2F5D A;  1K79 A;  3BTL A;  5A2Q Z;  5H6R A;  1MH3 A;  3OMY A;  2R7F A;  2KDZ A;  1R49 A;  4AYB A;  1LFB A;  4HOB A;  3ZRG A;  1EH6 A;  1XUA A;  4E4H A;  3HUG B;  5CLS A;  1U5T C;  5ERI A;  2ZXW H;  2HQ5 A;  4PDK A;  2NS8 A;  3DFG A;  5FFZ A;  6PAX A;  4BY1 J;  1LFP A;  4BGD A;  3DEV A;  4OAY A;  2JUC A;  1B9N A;  1WQ2 A;  4A0X A;  3AG2 H;  2RQP A;  3BTI A;  1Y8Q B;  3K4K A;  3AAF A;  4A3K J;  5IP7 J;  1B72 A;  2R7V A;  2VE9 A;  2QB6 A;  2F5V A;  4HPQ A;  1Y1W J;  2FEZ A;  3K2A A;  4B8X A;  4CZZ A;  4EQQ A;  4AD9 A;  2HWV A;  1Z3X A;  3KP2 A;  4M3G A;  5FFX A;  1IO2 A;  4O6J A;  2PI0 A;  3RJP A;  1FTZ A;  2M0M A;  4BE0 A;  4IO9 F;  1HW1 A;  3RIR A;  3S3M A;  3FIW A;  3JW4 A;  3DCF A;  3G1M A;  1EF4 A;  4CYC B;  2V7F A;  3M9A A;  3P9K A;  2JPB A;  1BN5 A;  4B47 A;  1WCM J;  3REO A;  4S05 A;  3BP8 A;  4QPQ A;  2DQL A;  3L2Q A;  2WTE A;  2VAS A;  4RAG A;  1KU7 A;  3AL0 C;  5A2Q K;  4WCG A;  2HOS A;  1I27 A;  2W7N A;  4HV6 A;  2LYC A;  3W6K B;  4RM3 A;  1BOB A;  1YW8 A;  5HA4 A;  1S72 I;  3BG5 A;  2QQ8 A;  2W4S A;  3E6M A;  1WFX A;  3CDI A;  2E5N A;  2DYS H;  2NOG A;  3K70 D;  2ZVF A;  2UXN A;  2CO5 A;  2RDP A;  3UKG A;  2A68 F;  3M7G A;  3J7A Y;  3CJQ B;  4J01 A;  3CD6 I;  5ANP A;  1HLV A;  2ZXH A;  3MEX A;  2LY9 A;  1Y8R B;  1LDD A;  4C3J J;  3GFM A;  1MJA A;  5L3B A;  3OS0 A;  3IRQ A;  2R7O A;  2P6T A;  3RZD J;  2VBX A;  3C7J A;  4M9S A;  3IWF A;  2LKS A;  1YLF A;  2ZFU A;  1S7E A;  4JBA A;  2NS7 A;  4G8X A;  3MZY A;  4PUS A;  1MMN A;  1I1G A;  2FSW A;  1OLT A;  2DAO A;  3OR1 C;  3S3O A;  5HVQ C;  2PJR A;  3W6V A;  3CJN A;  3QYB A;  4CCO A;  2EZL A;  2XB0 X;  4UB6 C;  4Z2Y A;  1KYW A;  3ONQ A;  2XHK A;  1ZEL A;  2LH9 A;  3OSF A;  3DWL E;  4C2M J;  1Z21 A;  2CQK A;  2FMY A;  3HRT A;  4XNF A;  1R7J A;  3RDI A;  1W0U A;  1JKP C;  4R1H A;  1SAU A;  4RGU A;  1W1W E;  1XB4 A;  4EMS A;  3CCM I;  2B7E A;  1U78 A;  1R23 A;  3G1L A;  3PNT A;  4BJ5 C;  3BRO A;  2V1D A;  3F6O A;  3RI4 A;  2LBF A;  3DQV C;  2NRA C;  2OAZ A;  3PO2 J;  3F8M A;  2HQA A;  1OCP A;  2Y75 A;  1R5H A;  2FA5 A;  1QHG A;  4A6D A;  3OL3 A;  2EWN A;  4CCN A;  2EB0 A;  1YX5 A;  5M3M J;  4XQF A;  5EG0 B;  5BQT A;  5L3F A;  3WQZ A;  4A12 A;  2E7X A;  4MFD A;  3S32 A;  3J81 K;  3HSR A;  3R0A A;  3HOV J;  1JJ6 C;  3CCL I;  3Q0V A;  4IOC F;  3SHF A;  3FVE A;  3P9I A;  1WPP A;  3J7A O;  3F23 A;  1AWC A;  4KYW A;  1FP1 D;  4JX5 A;  1RR8 C;  2RNG A;  3S16 J;  1QVT A;  3ZQQ A;  4FX4 A;  4P5O A;  1LE8 A;  2ME0 A;  2LSO A;  3T1B A;  4HF0 A;  2KRH A;  4U7B A;  3ZGK A;  1AKH B;  2P5L C;  1J59 A;  4BXX J;  4LIT A;  2NNY A;  3BCA A;  1BC8 C;  1J2X A;  4PGG A;  2I10 A;  3M8J A;  3BR2 A;  3MQ0 A;  5LRS A;  1XDU A;  2QF7 A;  1L0O C;  3KLO A;  1WZ2 A;  4ZZL A;  1NG7 A;  4EM1 A;  5FD6 A;  1FOX A;  5HS7 A;  4ZDP A;  1FZP B;  4A5M A;  2G7U A;  2XGC A;  1V55 H;  2YX4 A;  3HSE A;  2OZ6 A;  4MGR A;  4DBR A;  1O3S A;  4XLH A;  1IN6 A;  4E7L A;  2MLK A;  4KIG A;  2VIX A;  4A93 J;  3L1P A;  3E6C C;  3JRF A;  2HKX A;  2M9H A;  4B09 A;  3ASN H;  5FGM A;  1ZG3 A;  4I09 A;  1V5E A;  5D6E A;  4HBL A;  5B3S H;  4KIT B;  1VQN I;  3BWG A;  3F8C A;  1V5F A;  3PVH A;  5DCM B;  3WG7 H;  3BZ6 A;  3DF8 A;  3S1M J;  5FB2 A;  4XKV A;  4XR6 A;  4DYQ A;  5LHG A;  2XAG A;  4YG2 F;  3ASO H;  4GYI A;  4BE2 A;  4L9N A;  4KA4 A;  3I59 A;  2HYG D;  2CS3 A;  2E1M C;  1VQ7 I;  3DKW A;  2L7K A;  1SMY F;  2CW0 F;  3HOX J;  1XG1 A;  2Z99 A;  3FKJ A;  3PNY A;  4RB3 C;  2X9D A;  3QPT A;  3JRH A;  3NRV A;  5F0H A;  1RRJ A;  2ZXJ A;  4KN4 X;  2PJP A;  5DV5 A;  5LD2 C;  1QYA A;  1RKW A;  3OYM A;  3HDD A;  1VI0 A;  4LD5 A;  5JVT A;  2DOF A;  5GAH J;  2XUB A;  3FMQ A;  4FAS D;  4CH7 A;  2HQN A;  3LQR A;  2MC3 A;  3FK7 A;  1T39 A;  5IT3 A;  2KL4 A;  1SD4 A;  3TO7 A;  1IGN A;  2EZI A;  1P6R A;  2DDB A;  4O3M A;  1MBG A;  3OSG A;  4G6D A;  1A04 A;  2YR2 A;  3LSG A;  3DKX A;  3T8R A;  3GUD A;  1BI0 A;  2E36 A;  5LGN A;  1K78 A;  5FKK A;  3G7K A;  3IL2 A;  3V8J A;  5D8L B;  4UV9 A;  4BHC A;  5K1Y A;  1ZHF A;  2V1X A;  1FEX A;  2R5Y A;  3GCM A;  2A5W A;  2M0C A;  2W25 A;  4Y52 J;  1QPI A;  2HDC A;  4A3L J;  2K27 A;  4IZZ A;  4M73 A;  3WGI A;  3CUO A;  4OMY A;  3CCV I;  2XGD A;  3D0S A;  3ZN1 A;  4Q5S F;  5FJ8 J;  4ZH4 F;  3S2W A;  2R5Z A;  3UR3 C;  1XSX A;  4IHY A;  1HXD A;  3J7Y J;  2K85 A;  2CU7 A;  1G4D A;  4XLF A;  1OR7 A;  4XN3 A;  1T56 A;  3K9T A;  3RPU D;  2OJE D;  4D0P A;  4IHT A;  2L7M P;  1R5G A;  3ZOB A;  5J4Y A;  2VC1 A;  2BE5 F;  3HUG A;  2Y31 A;  2DQR A;  2F2E A;  5JFR A;  2R7R A;  1IUF A;  2IGM A;  1BR2 A;  1VQP I;  1LUJ B;  3DBR B;  1D1B A;  1PYV A;  1Z0X A;  2LR8 A;  1U0K A;  1YIO A;  4UUS B;  5E3M A;  3SEZ A;  5J8F A;  1B72 B;  2FU4 A;  1T6S A;  2O3F A;  3SEQ A;  3EUA A;  2BVL A;  3LL7 A;  2C6Y A;  2P0W A;  1U2W A;  1GT0 C;  3IWZ A;  4N4N B;  1JKQ C;  3QYE A;  3WTT C;  1JHH A;  2Q1Z B;  1YG2 A;  4AM3 A;  1T2K A;  3RYP A;  2IS1 A;  2K4J A;  3HOZ J;  3W2V A;  2QA4 I;  1IAW A;  1TWF J;  2M45 A;  4CYC A;  1IXS B;  1EV7 A;  3OOP A;  5F0C A;  5BNG A;  1XD7 A;  1OIS A;  2VXZ A;  5B1B H;  3TP3 A;  2HPI A;  3KIO A;  1MMD A;  1J75 A;  3BZK A;  1AHD P;  2IBD A;  2DO7 A;  3TKY A;  2CUF A;  2IA0 A;  3TBI A;  2E2H J;  4OIQ F;  1XDS A;  3GTK J;  2LT2 A;  4LMY A;  3CMA I;  1FY7 A;  5ILS A;  1ZGW A;  3QP6 A;  1ONV A;  2LK2 A;  2YUS A;  5DEQ A;  5C3E J;  2GBY A;  1NH3 A;  2L4A A;  2P7C B;  2L0K A;  4OAZ A;  2QVO A;  3OYB A;  2ZME B;  3PIP F;  4M6Y A;  2STW A;  2DJN A;  3IHU A;  4KNY A;  2VJ5 A;  1A5J A;  1W5C C;  3V7R A;  2R7S A;  1LB2 A;  3L09 A;  2JSP A;  4P55 A;  5HLT A;  4HYE A;  1E2X A;  3ABT A;  4XN0 A;  1X1C A;  5ILU A;  4ESJ A;  4G7O F;  3E1S A;  2DA5 A;  1ZKG A;  1X2N A;  2E71 A;  2KIM A;  2M4K A;  2RV8 A;  3LFU A;  1J0R A;  2K3P A;  4XLN F;  1XCB A;  4U0V A;  5GTI C;  3F3X A;  2KZV A;  1NTC A;  1O3R A;  2P7V B;  1GDT A;  3CCJ I;  4MHG A;  2OTN A;  1XTA A;  2DU9 A;  3IKT A;  2PJR B;  2JQ7 A;  4RDU A;  1N75 A;  4QSH A;  2H6B A;  1LDK B;  2LF8 A;  2DTR A;  1MMG A;  3M8E A;  1K4S A;  2FBI A;  2HOA A;  2LLK A;  3ZXS A;  3F6V A;  1ZRC A;  5BPD A;  4S04 A;  5FLM J;  3BG9 A;  2HEO A;  4IHX A;  4BKX A;  1EH8 A;  4BNC A;  2H6C A;  3HZJ A;  1Y56 A;  2VKD A;  3D5S C;  2MH2 A;  4QLC U;  4X0G A;  4FET A;  3I55 I;  1ZRD A;  4PJL A;  4NQW B;  5FLX K;  2CQX A;  3I9V 2;  4FE4 A;  2ELK A;  2KHM A;  2WBM A;  4ZYA A;  3FMR A;  4KJZ A;  3F0C A;  1TWA J;  1ZG1 A;  2KJC A;  3F22 A;  5HNF A;  1RZ4 A;  2A61 A;  1WRJ A;  3DTI A;  3UNG C;  2LNB A;  4R8H A;  2VKV A;  3MCZ A;  4RBO A;  3FF5 A;  2CQ7 A;  2LRE A;  1XGS A;  1Z91 A;  2HGC A;  2JT1 A;  5EGO A;  5GPC A;  1EH7 A;  1LVK A;  2VUM J;  3S3N A;  1FSH A;  5BPI A;  3G2B A;  1LFU P;  1H8A C;  1BM9 A;  4DZJ A;  1R1V A;  1MBH A;  2E5Z A;  2TDX A;  3E5Q A;  3QOD A;  3QPL A;  4BXU A;  1Z3Y A;  1MDM B;  1WJA A;  2DW4 A;  3C1D A;  3BTJ A;  2A69 F;  1SC7 A;  5E20 A;  3RYR A;  3FIS A;  4BAY A;  5M5Y J;  3KYL A;  2STT A;  4E7Z A;  3IC7 A;  3JRI A;  2CQN A;  4RAY A;  3H0D A;  4IL6 C;  3ZQH A;  1HQC A;  1OQY A;  1Y0N A;  3CO6 C;  3TL4 X;  4XSZ F;  4UVA A;  5AIP A;  3V8K A;  4M3F A;  3PFY A;  2DA7 A;  4XID A;  3CCU I;  4XLP F;  2X1D A;  1MJ9 A;  2GXB A;  1R6R A;  2IJL A;  4MFE A;  5DCM A;  3WU2 C;  5TJJ A;  1RKT A;  3DEE A;  4HX8 A;  3JRC A;  2ZJQ F;  3OV8 A;  5JVG F;  3CTA A;  4A0Y A;  2XPV A;  4Z6Y A;  1J9I A;  3I59 B;  3S14 J;  1MH4 A;  2JA6 J;  2CUE A;  2K9N A;  3QQA A;  2A05 A;  1P9Q C;  1UG2 A;  2PEX A;  1R9T J;  2YS9 A;  3HPH A;  3WTY C;  4K7G B;  2LG4 A;  3LAJ A;  1ETW A;  5IWE A;  3WU0 A;  4HNU A;  3P9C A;  2XRN A;  4BXF A;  1BC7 C;  4L9J A;  1P7J A;  2E1O A;  3ZN0 A;  2H9F A;  2ZXO A;  4I0B A;  5B66 C;  3JR9 A;  1UST A;  2Z16 A;  2XGX A;  1FIA A;  2NVT J;  3TO9 A;  2Q9J A;  1HW5 A;  5DTD A;  2BGC A;  2QGU A;  5GPA A;  3SZT A;  3U1K A;  4JCI A;  1JTX A;  5E3O A;  3MKZ A;  2FQ3 A;  3DU5 A;  1VZ0 A;  2A6E F;  2HDW A;  4B1R A;  1YJW I;  3A2K A;  2L7F P;  1V3F A;  2K9Q A;  2WB1 A;  3S17 J;  2VJJ A;  4XKW A;  1JHF A;  3GBG A;  3H92 A;  3OS2 A;  2AS5 F;  1MKM A;  2R5Y B;  4UUV A;  3GTM J;  5EJC A;  2L9N A;  1U8B A;  2GAU A;  1BW6 A;  1IRG A;  3BPV A;  5IT9 K;  2NVY J;  1F5T A;  4HDU A;  1JUP A;  2DFH A;  3CLO A;  4J9W A;  4BL0 B;  2Q8K A;  3HRU A;  2CV2 A;  1XX5 A;  2JZY A;  3K1M A;  4H0E A;  4KIS A;  2X0L A;  2R5Z B;  3KZZ A;  5E8G A;  4PY9 A;  3F21 A;  1UFM A;  5J1U A;  2XAF A;  1VQ5 I;  2DMP A;  4A3B J;  2W48 A;  3CZ6 A;  3LAP A;  2Q9H A;  2CV1 A;  4M3E A;  2E1M B;  4I0A A;  4BHB A;  2EA4 A;  3VPR A;  3ERE D;  1XN7 A;  4LLL A;  1L3L A;  1PP7 U;  1GXQ A;  3BR1 A;  2R7Z J;  4GL6 A;  1QNT A;  1SFX A;  1WJF A;  2BHY A;  2D2W A;  2F4O B;  2OCE A;  4GFB A;  4A3F J;  5C4X J;  1QQI A;  1TL8 A;  4UUS A;  1S3J A;  1RUN A;  2B0L A;  1BOA A; 
#chains in the Genus database with same CATH homology
 1UAA A;  4J00 A;  2L2O A;  4XM3 A;  2HVS A;  3ONQ A;  4BU2 A;  3IAS 2;  3I3L A;  1ZEL A;  2HZD A;  2LH9 A;  2MYS A;  4OWR B;  3VSK A;  1GLN A;  3DWL E;  1Z21 A;  4JBD A;  2X1C A;  4XNF A;  3LSM A;  1ERD A;  1FMW A;  4XOP A;  1SAU A;  2V6E A;  3PNV A;  2VLA A;  2ZXP A;  4BJ5 C;  3PNT A;  3LSI A;  3BC8 A;  4F93 B;  1UEL B;  2LBF A;  3DQV C;  4CZC A;  3MKW B;  3AFH A;  2HQA A;  2GOX B;  2XF7 A;  3A4C A;  4F52 A;  1QHG A;  4F3Q A;  3OL3 A;  2GKE A;  3A1Y A;  2VB6 A;  4CCN A;  2EB0 A;  1YX5 A;  4XQF A;  4ZTJ A;  1X1A A;  4HSR A;  4HST A;  2WAQ A;  1U1V A;  5KNL A;  3WQZ A;  1WJC A;  3LSH A;  3S32 A;  2W82 A;  2OC6 A;  3FVE A;  1D0Y A;  4XKB A;  3BCB A;  2M7B A;  2VQH A;  3HOT A;  1WPP A;  5FRM A;  3VDX A;  2RNG A;  3HG9 A;  5CQE A;  1MND A;  3ZQQ A;  2CUJ A;  4P5O A;  4ZDO A;  4DGW B;  2PMZ A;  4YEL A;  2KRH A;  4U7B A;  3V42 A;  4K7X A;  3D5R C;  3ZGK A;  4PSW A;  4QPO A;  4LIT A;  4DIQ A;  3RTR A;  1T6K A;  3BCA A;  3HXL A;  3H9Q A;  4KT6 A;  3MKY B;  4NNJ A;  4U87 A;  3M8J A;  3K4J A;  2M4G A;  3DLA A;  4XLE A;  4II2 A;  4BUP A;  2W00 A;  3HKZ A;  2R4G A;  1NG7 A;  2BW3 A;  2WY8 Q;  1X4O A;  4ZDP A;  3OYI A;  4RM2 A;  4IK0 A;  2IS2 A;  4DBR A;  4XLH A;  5HNH A;  4E7L A;  4PK4 A;  1G59 A;  3AL0 B;  4CCJ A;  2VIX A;  3CMM A;  1WJD A;  2DXI A;  2NOJ B;  2WAF A;  2XF5 A;  1WJ5 A;  2L9S A;  2JUG A;  3SYT A;  2ENX A;  3FBI B;  2A6T A;  4OA3 A;  4R79 A;  1V5E A;  3DPT A;  1D1C A;  4KIT B;  4K8L A;  1V5F A;  3L2V A;  3PVH A;  1BR4 A;  4YEJ A;  1DP3 A;  2V26 A;  1T95 A;  2DT7 B;  4BQO A;  4XKV A;  4XR6 A;  3OYH A;  5M47 A;  4JQF A;  2R7Q A;  4BE2 A;  3OYJ A;  2CUZ A;  2MC4 A;  3DTE A;  2CS3 A;  2E1M C;  2XDV A;  1K6Y A;  3CJR B;  2L7K A;  4EAT A;  2K9L A;  2E60 A;  3FKJ A;  3PNY A;  3IP4 B;  2PVZ A;  3K6G A;  1W61 A;  2VKH A;  3F9K A;  1X1D A;  4C30 A;  2CMP A;  4HG2 A;  5JHF A;  2IXS A;  3ICJ A;  5LD2 C;  2V1N A;  4E7I A;  1QYA A;  2DJI A;  4BE1 A;  2QB8 A;  3OYM A;  1YX3 A;  4RMN A;  4G6T B;  3CF2 A;  1U0J A;  3L2R A;  4FAS D;  3OYD A;  4CH7 A;  4LIV A;  3OIQ A;  1MMA A;  2KL4 A;  1UG0 A;  3IUO A;  4Q60 A;  4Q2H A;  4AVZ A;  2R7W A;  2ZSI B;  1DQU A;  3RCO A;  3LSG A;  2HAW A;  4PJN A;  3DKX A;  5FRO A;  2V4J C;  4D9J A;  3DU6 A;  4CA0 A;  3CES A;  5CKT A;  1TM0 A;  3G7K A;  3VYT B;  1N77 A;  1X4P A;  4BEH A;  4IQJ A;  1K23 A;  2KPT A;  2ZSH B;  4II3 A;  3EKM A;  2A5W A;  1BWZ A;  1X19 A;  2LY1 A;  2IGO A;  4IZZ A;  1K20 A;  1G8X A;  2VQG A;  4CCM A;  2DOA A;  3UR3 C;  3W2W A;  2M7A A;  4BQQ A;  4JD7 A;  3RSN A;  4XLF A;  4E6K G;  2O5R A;  4XN3 A;  3KEY A;  3RPU D;  1D0Z A;  3G98 A;  2IGN A;  3ZR8 X;  2UWM A;  3PL8 A;  3SZG A;  4XLC A;  1W36 D;  2V9K A;  2R7R A;  2Z1D A;  2HNH A;  2CH0 A;  1KON A;  1AA7 A;  2IGM A;  1BR2 A;  1D1B A;  1PJR A;  1PYV A;  3OYA A;  1U0K A;  1EA3 A;  5FRN A;  4P1W A;  3SEZ A;  2X6X A;  3MMY B;  4HEA 2;  2WAD A;  4C2U A;  3SEQ A;  3EUA A;  2BVL A;  1S9H A;  2X1E A;  3LL7 A;  3H9G A;  2CW8 A;  2GOM A;  4ITV A;  1BR1 A;  2P0W A;  3OYL A;  1X1B A;  3OYG A;  3L2U A;  2JVH A;  2R7T A;  1S7J A;  5H2Y A;  2KDO A;  2MFZ A;  4N4N B;  3QYE A;  1TZL A;  3OIP A;  4JUU A;  4B43 A;  2Q1Z B;  4LS9 A;  1FMV A;  3W5W A;  2CW7 A;  4BJT A;  4LB0 A;  2IS1 A;  3CP2 A;  3W2V A;  3MD2 A;  3OL4 A;  4XLA A;  3PW9 A;  2CFO A;  3K4C A;  2LBF B;  1W62 A;  2DT6 A;  2YMA A;  4BDY A;  4IKF A;  3S93 A;  2IS4 A;  2VXZ A;  2HPI A;  1MMD A;  2W1O A;  2KPM A;  3K4L A;  3QYF A;  3NWT A;  4ANJ A;  4HRI A;  2MPB A;  2MAB A;  4DBQ A;  2VJI A;  3KX2 A;  3TBI A;  3IAM 2;  2KQR A;  4GRI A;  2LT2 A;  4NC7 A;  3SDB A;  3VWB A;  5LFA A;  4PJM A;  3EJX A;  4OAZ A;  2CV0 A;  2OV7 A;  2I8D A;  3VYU B;  3OR2 C;  3OYB A;  4PJJ A;  4E7J A;  3EDN A;  2VJ5 A;  4CUG A;  3OYC A;  2R7S A;  4BQN A;  2Z2S B;  2JSP A;  5HLT A;  1IR6 A;  2LC2 A;  4XN0 A;  1X1C A;  3E1S A;  1MW7 A;  4XOR A;  2M4K A;  3C2H A;  2HVR A;  3LFU A;  1U1X A;  2K3P A;  5KCM A;  3W3C A;  3EUH C;  4XON A;  3VYR B;  2Y0S A;  4RPA A;  2KZV A;  1NG6 A;  2HPM A;  2VL8 A;  4NC8 A;  2WA0 A;  4CSW A;  3D5L A;  3HC7 A;  2OTN A;  4AU7 A;  2PJR B;  1N75 A;  1LDK B;  2UUZ A;  3H9J A;  3TMO A;  1W36 C;  1MMG A;  2VQC A;  2X51 A;  3VSL A;  2AZP A;  2ELJ A;  3H35 A;  2QB7 A;  2R7X A;  1U1W A;  2VQL A;  3ZXS A;  1T0F C;  2XF6 A;  2ZXR A;  2LY2 A;  4PFP A;  5TGT A;  4LIU A;  1HA8 A;  2VPL A;  4J9X A;  4H4K C;  4PSX A;  3AKZ A;  4IX7 A;  1Y56 A;  2VKD A;  3D5S C;  4Y33 A;  3W2A A;  4XMY A;  4FET A;  4X0G A;  4E7K A;  4Y4R A;  4PJL A;  4NQW B;  3ZCO A;  3I9V 2;  2PW0 A;  2KHM A;  2WBM A;  3NWS A;  4ZYA A;  4KJZ A;  3FHN A;  3OS1 A;  4ZC3 A;  4Y3O A;  4PFO A;  4C2T A;  4B3X A;  2KP6 A;  3HOS A;  2IW4 A;  2KW7 A;  5HNF A;  3K70 C;  3DTI A;  3UNG C;  2M3A A;  4BAC A;  3PJR A;  1OR7 C;  2RQQ A;  3EPZ A;  3C2G A;  1YE9 A;  4B44 A;  4JOM A;  2KLO A;  2LRE A;  3E0J B;  4ZTF A;  1GQZ A;  4LG3 A;  1LVK A;  3FDY A;  1N78 A;  2HVQ A;  3S8P A;  2KRC A;  3S3N A;  1QHH D;  1DGW Y;  1V5G A;  1IRX A;  3G2B A;  3BG7 A;  1SFK A;  1WJE A;  2BVM A;  3BLY A;  4HNT A;  2E5Z A;  3K10 A;  3PSF A;  4RLF A;  1WPM A;  3L2W A;  3QOD A;  1Z3Y A;  4IQ4 A;  4E7S A;  1WJA A;  3DPL C;  3DTK A;  1Y6I A;  5CQG A;  2BW3 B;  4C9Y A;  3PSI A;  3KYL A;  1XUB A;  3OY9 A;  3FBN B;  2FUG 2;  4E7Z A;  4IJZ A;  1DGR M;  4BEH B;  3H0D A;  3PTJ A;  2F6C A;  1MNE A;  2UV1 A;  3LMM A;  4E7H A;  1YM5 A;  1JI8 A;  2HU9 A;  3EUK L;  2VXD A;  3TL4 X;  2X6Y A;  3PFY A;  2AQE A;  3PUB A;  5H2G A;  2X1D A;  3OOU A;  1R6R A;  4RLQ A;  4DOZ A;  3DKY A;  3HPG A;  1QY9 A;  3OYK A;  1I74 A;  4BJ6 C;  2ZXI A;  3DEE A;  4CCL A;  2Q2E B;  4YRV A;  2QKL B;  4DUN A;  4DJA A;  2R7U A;  2QKM B;  3OMY A;  3HL2 A;  4AYB A;  3ZRG A;  4F91 B;  1P9Q C;  1XUA A;  4E4H A;  2XSJ C;  3HUG B;  4XOT A;  4ZDL A;  3OYF A;  4MLO A;  3HPH A;  1WJB A;  4ZJZ A;  2XAU A;  4XKC A;  1LFP A;  3H5R A;  4BGD A;  3DEV A;  3CP8 A;  2LOO A;  4OAY A;  4K7G B;  2LG4 A;  2IGK A;  5IWE A;  2MD0 A;  3DPU A;  4HNU A;  2KMU A;  3K4K A;  2R7V A;  4CCK A;  4BXF A;  2JA2 A;  2QB6 A;  2RRE A;  2F5V A;  4HPQ A;  3U21 A;  2H9F A;  5CPR B;  2ZXO A;  1QU3 A;  1E0E A;  2VJ4 A;  1D1A A;  2Z16 A;  2AQF A;  2DCE A;  3H5N A;  1Z3X A;  2Q9J A;  1D0X A;  2M0M A;  4BE0 A;  4D1Q A;  2K9M A;  3BG6 A;  3K4M A;  2GKJ A;  4JCI A;  2K5C A;  2F4I A;  3MKZ A;  1TT0 A;  1VZ0 A;  2X85 A;  2HDW A;  3DU5 A;  3S3M A;  4F92 B;  3A2K A;  2WB1 A;  2V7F A;  2VJJ A;  4XKW A;  2IS6 A;  3GBG A;  4B48 A;  3OS2 A;  4XL9 A;  2LRD A;  4B47 A;  3QOE A;  3L2Q A;  4QPQ A;  2VAS A;  3H5A A;  2L9N A;  4NUB A;  3AL0 C;  2WAE A;  2W7N A;  5HOO A;  4J9W A;  2LYC A;  4BL0 B;  1LKX A;  4RM3 A;  1BOB A;  2CV2 A;  5HA4 A;  3M1C A;  2W4S A;  1WFX A;  4KIS A;  2E5N A;  3K4N A;  4BDZ A;  2XC7 A;  3K70 D;  2ZVF A;  3J7A Y;  4PY9 A;  1Z7L A;  3CJQ B;  4J01 A;  5ANP A;  2ZXH A;  3IGH X;  3N05 A;  4F55 A;  3CZ6 A;  2OUM A;  2L5Q A;  3OS0 A;  2Q9H A;  5KHD A;  2CV1 A;  2R7O A;  2E1M B;  2JVG A;  3OWT A;  3VYS B;  3OYN A;  2BOL A;  4N4O B;  4BS9 A;  2ZFU A;  2WY7 Q;  4GL6 A;  1SDJ A;  1WJF A;  3OYE A;  4PUS A;  1MMN A;  3LSK A;  1OLT A;  3OR1 C;  3S3O A;  3K4B A;  5HVQ C;  2PJR A;  3QYB A;  4CCO A;  1J09 A;  3RQ4 A;  2X6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...