4LG3A

Crystal structure of a duf487 family protein (despig_00776) from desulfovibrio piger atcc 29098 at 2.49 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
179
structure length
179
Chain Sequence
b'SEAQFFAPTKESPYEGIPGRLRYNVRIVLVEQDKQGNYIARRDSSTVSKRQLAATVIAAARYYAQEKRAAVVSITLDSQPGPAFGKTVLATATYAPDGKGVSGSDDWTWNTLQATPRGLTAQELKIQCLWGEMRGKFQVDGSTDERRLKAAIAKKLKIPAEKVMLNPVFPEPFPQEWTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (DESPIG_00776) from Desulfovibrio piger ATCC 29098 at 2.49 A resolution
rcsb
source organism Desulfovibrio piger
molecule tags Structural genomics, unknown function
total genus 49
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16175 DUF4875 Domain of unknown function (DUF4875)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2610 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4lg3A02
3.10.310.90 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4lg3A01
4LG3A
chains in the Genus database with same CATH superfamily
2PJRB 4IHWA 5E1XA 1WSUA 4CHUA 4UY8I 3SFZA 1IUYA 1ZQ3P 3TW7A 2IGMA 4HLXA 5CPRB 1JHHA 1OCCH 3NWSA 1FOKA 1GXQA 3OR1C 1BC8C 3PTJA 1QA6A 1WVRA 1YJWI 2QUFA 2KT0A 1GV2A 1ETQA 1MH3A 5LBQA 1IGNA 3ROUA 2L7ZA 3HOSA 2XRLA 3S32A 4AIKA 1Z21A 2ZSIB 2ZJPF 1HKQA 2B7EA 4RAZA 1MIJA 5TRDA 4HDUA 1W36D 1VQ7I 3ZN1A 1IN4A 2A5WA 1XMAA 4XKCA 5FKNA 5K1YA 2V26A 3CCQI 4JQFA 3LSIA 2H6CA 3CDHA 2EA4A 5M5YJ 2ZFWA 1WWXA 4K2EA 2DA1A 1SFOJ 2CUZA 2CQNA 2UUZA 1MNEA 2XPVA 1TL8A 1JXSA 1Z0XA 2O7OA 4G6QA 2H1KA 1TP4A 1QQIA 1ENHA 1OMIA 2ELHA 4EGZA 2HDDA 2DK5A 1BJAA 4HX8A 1P9QC 1CQTA 3I71A 3DEVA 3U9GA 5D5XB 4MQ9F 4M6VA 4LK0F 1YM5A 1MDMA 1D5YA 2OZUA 4DNCA 4FX4A 2CYYA 2GOXB 3ZQFA 3IL2A 4FCYA 2HVQA 2QB8A 1TW3A 2F5CA 3FHZA 2K27A 2G7UA 2L9SA 2QSGX 4M9SA 1BBYA 5ICGA 2H6BA 1VQ4I 3K6GA 5HVQC 3C3WA 3GF2A 2ZMEB 4BXXJ 4C30A 3CCSI 2ECBA 2DPUA 4BS9A 2NYXA 3I4PA 2BVLA 5J1UA 2QSFX 1B1BA 1BI3A 2XV4S 3V4GA 1LEAA 1WRJA 2NS7A 3PUBA 2V79A 2ZVFA 3KLNA 3I64A 3K7AJ 2MD0A 1T38A 2X1DA 1A6IA 2W7NA 5J8CA 2PMUA 1K79A 2OBPA 3BG9A 3CC2I 1D5VA 1R58A 2DOAA 5TGTA 2VKEA 2VBWA 4XN0A 3U21A 2BY3A 4ZYEA 4BJ5C 1LPQA 3QRFF 1LFPA 4IPAA 1XUAA 2M3AA 1XC5A 1ETVA 3ESWB 3GBGA 2ENXA 4XLHA 4L9VA 4FISA 2DMTA 2YX4A 5A2QK 1ETKA 1W0UA 3IKVA 1Y8QB 5HLGA 2Y2ZA 2OJED 1W7PD 4U0YA 3CUQC 2P6SA 1DP3A 4HV6A 3CCJI 2JJ7A 4FE4A 1USTA 1CGPA 3FK7A 4U7DA 1T2KA 3ECHA 3BG6A 1WKMA 4LK1F 4BE0A 4Z2YA 3PSIA 1VQKI 1R5HA 3HHGA 2R7ZJ 3GWZA 4BQOA 1XX5A 4HV5A 1PUEE 1VTNC 3I5UA 2P5VA 3CLOA 4EJUA 1BIBA 1W5CC 1ZG1A 4PGGA 4AVPA 2VQGA 4PSWA 1DUXC 3VB2A 5FO5A 3ZCOA 4C3HJ 1A31A 1R6RA 2F5DA 2WV0A 4FQGA 3P7NA 1MMNA 3KETA 3G73A 1TQIA 4XIDA 5DDGA 4E7JA 2PG4A 3LAPA 4UVCA 3H0DA 2RNJA 3FIWA 5LEKA 3LA3A 5ICCA 3IRQA 3MZYA 2QB7A 4C2MJ 2GZWA 1XDSA 2IW4A 3WU1B 1LJ9A 1NTCA 4LIVA 1JUSA 1W5TA 3FXOA 5FRMA 2WB1N 2J5OA 4GDFA 2KISA 2R3SA 5JHFA 2VONA 2HTSA 2M34A 2MLKA 2VKHA 4FE7A 2Y30A 3EUAA 4N9IA 1OCRH 4WXDA 3LFUA 3M4OJ 1H9TA 1S7JA 3CUOA 1MBGA 4G6TB 2R5ZB 3HTSB 4I01A 1UZCA 3KFWX 2VQCA 3DKXA 4D7MA 3CLQA 2NRAC 1YIJI 4IKFA 4NB5A 3QU3A 2LREA 2F4IA 1HLVA 1T56A 1YS7A 3LSTA 1D8KA 2ZSHB 2HYGD 1BN5A 2R7OA 3OOPA 4HNTA 3GYHX 2JVHA 3BC8A 4ZZDA 4RGUA 3ULQB 3H9GA 3F6VA 1BR1A 4HAMA 2HYJA 5CVUA 3LSKA 5DCMB 3VFZA 1IC8A 5FFXA 5FKOA 1JT0A 5D5VB 2LH9A 1EA3A 4PFOA 3QP5A 3WGIA 4IQJA 1TBXA 5LGUA 3CP8A 2A6TA 1MJ9A 2P0WA 3OIPA 1ZHFA 1IRXA 2Y0SA 4M6YA 2BY0A 4PDKA 2R7WA 1GHCA 2KRFA 3KP6A 3TW6A 2KLOA 2A6HF 3LA2A 2VJ4A 4KDPA 1SVLA 4QSHA 1K7AA 2DLLA 2XGCA 2L54A 1FP2A 2PJPA 2EFOA 2IA2A 1R36A 3VYUB 1RR7A 2P6TA 3H0GJ 4A69C 3RZDJ 4M6XA 3CC7I 5LEJA 2XF5A 1T0FC 1FY7A 2JUGA 3CESA 4A0ZA 3H5AA 1F4KA 2NVTJ 1VQNI 3ZOBA 2O0YA 3E1SA 2RQPA 1X19A 3SZTA 1JTYA 1P2FA 4KICA 5K5QA 4R1HA 2OPTA 1X1BA 5IY5H 5KAIC 2DCEA 2ZC2A 3AL0B 1YYVA 2KFDA 1EH7A 4IX7A 2ETHA 4I2OA 2DOFA 4MGRA 1ZLJA 3DKWA 3A02A 4B3XA 1TQPA 4R8HA 2OCCH 1LDJA 1WGXA 5J8FA 3CCMI 3T8RA 2A05A 3W3CA 1O3RA 1AU7A 4KN7X 2KJCA 3OL4A 3LWFA 3IWFA 2BE5F 1ZYRF 3IUOA 2ECCA 4ABZA 3EUHC 3HPGA 1SANA 2ZJQF 2FMLA 1QPMA 2H9FA 1WPPA 3BWGA 3K10A 5B3SH 2DA6A 1KA8A 2PN6A 5HLHA 4A3EJ 1Q1HA 2DA5A 3D5LA 3HM5A 1SD4A 1YIOA 3WG7H 1Y6IA 2ACJA 5JHUA 5EYRA 1K78A 1APLC 3VDXA 4HEA2 4JD7A 1W1WE 1LKXA 5D5UB 1FSHA 1T6KA 5CVRA 3Q9SA 1MBJA 4YELA 1DP7P 1OCOH 2PEXA 4IEJA 4OINF 4CGZA 2HKOA 2ZB9A 1YI2I 2QKMB 3ABKH 3WU0A 4MIMA 2X1CA 4F52A 1FIAA 5HLTA 4HDVA 5HDNA 3E3VA 2QZ8A 3GFLA 3CCRI 4EM1A 5ICEA 1Y0UA 4EJTA 3JRBA 3PFIA 2XF6A 4RS8A 2XVCA 4JBAA 1NG6A 3FXKA 4LB5A 4XLEA 5DUIA 4BXUA 4RDUA 1NHAA 2CMPA 1Z1DA 1P7IA 1R49A 5J47A 4F91B 3FXUA 2NNNA 3JRFA 4A3IJ 1IRZA 1KYZA 2ESNA 1MSFC 1U5TA 2K3FA 1UHWA 2X9DA 2D5VA 4PY9A 4XKWA 1BC7C 2M1BA 2MBFA 2DFHA 4GXOA 3HHHA 3HYIA 1FEXA 4AU7A 1ZR4A 4NBQA 2DQRA 1D1AA 3DCFA 1EKEA 3M9AA 3HOWJ 2RN7A 1XPXA 3KPHA 3J80K 3SZPA 3RKWA 2DBBA 1KQ8A 3SJMA 1MKMA 1LFUP 1TQMA 2BZTA 2CH0A 4CYCA 4IZZA 5IT9K 4D5CA 3E5UA 3LQRA 4CCOA 1QHGA 4J00A 5HDGA 1ZR2A 2VBYA 3ZMSA 1ZN2A 2IGOA 3HSRA 4CXFA 4A5NA 1L0OC 2FBHA 1TW2A 1YTYA 1MNDA 1OLTA 2K40A 2E19A 3HRSA 5KVRA 3HB9A 1SMYF 2GXBA 4H4KC 1X3ZB 2HFHA 2R7QA 1XGMA 2JN6A 4LB0A 1X4PA 2BHYA 5HOOA 4G94A 3L2WA 5D5WB 1J9IA 4B44A 4BDYA 4F92B 4RB3C 2VE9A 1PUFA 3KIOA 1XDUA 2KIUA 3RPUD 3FX3A 1P7JA 4PCQA 4Q48A 1A35A 5DYMA 5L3DA 3J80Z 1G3YA 1D1CA 4RBOA 5F64A 4M3EA 4KYWA 5BNGA 3K1PA 4EM2A 2PMZA 4GO1A 3FF5A 3RI4A 4ZTJA 5ED4A 5IT9Z 4KIFA 3HOYJ 1V5FA 3K70D 4BJTA 4FTHA 3VYSB 2RC4A 3OYLA 1B9MA 2O8KA 4UNOA 2MG4A 2DA7A 3KP5A 2V9VA 3PNYA 2O8XA 2NVUB 5FJ8J 2ZJ2A 4LG0A 2G7HA 2M87A 3M8EA 4JP0A 2HKXA 5H2FC 2BV6A 4IO9F 2PLYA 3SYTA 4CCKA 4ON0A 3C1DA 4MTEA 2P8TA 2VXZA 2HDWA 2XSJC 4EJVA 3RZOJ 3KP2A 2WTEA 3OR2C 5EEGA 1VI0A 2CW0F 5J4YA 4ENJA 4L5JA 4BNCA 4M72A 3PSFA 4X0GA 1JKRC 2ZNZA 4PSXA 1GUUA 2DAOA 2LOOA 2V7FA 5FD5A 2KZVA 1KONA 2COMA 2LTPA 5D8KB 1O3QA 1K4TA 4HX7A 2DA2A 4I02A 3D0SA 2FA5A 2V9PA 2ZXWH 5DV5A 3RIRA 3F22A 3H3VK 5M3MJ 2H27A 4A3DJ 5JLXA 2Z3YA 2RGVA 2Y75A 4A12A 2KRCA 2KIFA 1S7OA 1Y0NA 2FXAA 3JTHA 2LKSA 3S1RJ 2GKEA 1JHFA 4XQFA 3WODF 4XKVA 1G4DA 3ZP5A 3CCUI 2C6YA 2UXNA 2R93J 3PVHA 2QQAA 3A4CA 2L7MP 4OAYA 3KEYA 2OV7A 1B6AA 2L01A 3Q3SA 2VI6A 2P4WA 1RPWA 4C3IJ 1WHUA 1LFBA 1OR7A 2P5KA 4YFXF 2XIGA 2EFWA 3I58A 3A0BC 3S1QJ 2HYFA 2BXZA 5E18F 1NK3P 1FC3A 1QO0D 2NOJB 1EH6A 1SVOA 1HKSA 1ZARA 4XONA 3G6EI 3DEWA 1Z6TA 5IOYA 3E6MA 1WH5A 1J2XA 5H20A 1XSXA 4G6DA 3HGYA 1C0WA 3W2AA 2Q2EB 1OJLA 1OYWA 1YRNA 4F3QA 4K7XA 2E1NA 2GIVA 1K83J 1U8BA 1WQ2A 2JUCA 5HNHA 4BE1A 4U0VA 3AFHA 3OY9A 2ZXJA 3QP6A 2Z33A 3N4MA 2QF7A 3QPLA 4M9ZA 3KYCB 2EZKA 5LGTA 3L1PA 4OIOF 4ZYHA 2HOEA 2HI3A 2M4KA 2STTA 1W7PA 3DLAA 3M7GA 2A69F 3HRUA 2M4GA 1M1EB 2JA5J 2LKXA 2QLZA 1HOMA 3N05A 4M3GA 4XN3A 5ILVA 1QHHD 2Y48A 5JVTA 3G71I 2GWRA 2ME0A 3H3UA 3LSMA 4BAYA 3CD6I 3E5QA 1K6YA 1WPKA 3O8GA 1DQUA 1G6NA 3A03A 1Z3YA 2XF7A 3HEFA 4RGRA 2IA1A 2HQ5A 2LVSA 3G1MA 5DM7F 3IRRA 1HCRA 2KQRA 2Y0MA 3CF5F 2CGPA 1VQPI 2Y0SN 4A6EA 4OAZA 1U0JA 3L9FA 4ETSA 1FNNA 3PL8A 3TO9A 3G98A 3OYAA 5FLVA 1WJDA 2A61A 2ICWG 1JT6A 3DU5A 1HDDC 2K9MA 2FQ3A 4MEYF 2DFFA 4GGGA 3F8NA 1I1GA 2KKOA 2XPUA 3S17J 1ACIA 1MMGA 3JRCA 1MMAA 1R5ID 4NUBA 2K4BA 4GRIA 1BR4A 1KQ9A 4LOCA 3FMQA 4I0AA 2DODA 3DU6A 3J7YJ 4RM2A 4LLNA 4G7HF 2E36A 4AWXB 1A04A 1V55H 2FX0A 5LGNA 1W0TA 1MBFA 3AG1H 1KU7A 1T0FA 3GW2A 1IV6A 1XGOA 3GZ6A 2XC7A 2XPWA 2JTVA 2O61A 4XRMA 1J59A 3J81Z 2WWYA 1UB9A 2EFPA 3OYBA 3HIFA 4I76A 2PX9A 4G9YA 3ZMUA 1U1WA 4HRIA 2CQ7A 4XICA 1U5TC 3GFMA 3BJ6A 3FHNA 3BDDA 3IKTA 2CFXA 1KU2A 3GTPJ 4A5MA 2X6XA 1RR8C 4G12A 3P5JA 1SD6A 1IDYA 2W48A 3LSJA 3S16J 3C2BA 4YRVA 1IUFA 2L9NA 1V54H 3E6BA 2VC0A 3CCEI 3H3ZA 3KP7A 3RTRA 1RNLA 1YJ9I 4A3GJ 3EUHA 3T8TA 2YPRA 2AXTC 1H8AC 1BR2A 2DQLA 1IXCA 3OS2A 3MEXA 2F4OB 2Z9OA 1MSEC 2IP2A 4M3BA 3FBIB 2QBYB 1N75A 2WADA 2A07F 2QYOA 6PAXA 1IRFA 2JQ7A 1B59A 1D8JA 4O5VA 2K02A 5M47A 4M3FA 4RPAA 4PK4A 3S2WA 3ZQQA 4ZYGA 3OYDA 1JGGA 1YFHA 1I1SA 4XLAA 4E7IA 1K20A 3QYFA 2KZGA 1ZK8A 3H36A 5ILUA 1JUMA 2LSOA 2OQGA 4XLCA 3HUGB 3LQQA 1P6RA 5IYBJ 3UKGA 2FSWA 4JBDA 1JUPA 1HC8A 1IO2A 4AIDA 1BJZA 3PO2J 3VSKA 1K23A 3BG7A 5GP9A 4B43A 2UXXA 1SD7A 3C7JA 4A3JJ 4CDGA 5HNFA 4NHJA 4AYBA 3BR3A 3ZQHA 3KCCA 3CJQB 1KZHA 2CFOA 1X3WB 4DGWB 2JPCA 1U3EM 1ETYA 2VXDA 3QYEA 4NQWA 4B8XA 1TNSA 3TP0A 2L5QA 2GA2A 2EV5A 2MH9A 5E3LA 4PZJA 5BPDA 2QB6A 4DOZA 2R4GA 4BUPA 5HS9A 3W2VA 1B72B 4OIRF 1W36C 1P4XA 3SXYA 3V7CA 5CQGA 3F9KA 2Z1DA 2IJLA 3X2QH 4E7KA 3KLOA 1SDJA 1V3FA 4DYRA 3ZQCA 1IRGA 3HG9A 3TDZC 3G1LA 5E8IA 1JKOC 4OWRB 4Q47A 4X1EA 3JRIA 2R7DA 1BIAA 2GAUA 2WC2A 1BM9A 3CP2A 2CRGA 4B4CA 1A36A 1IV8A 3A2KA 1VQ8I 3EDPA 4W1UA 2JK3A 2X6YA 4CCLA 1NH3A 3JSPA 2KJBA 2XKOA 1K6OA 4K7GB 2VN2A 1WI3A 4EGYA 4WX9A 3NEUA 2QCOA 4KMFA 3MKZA 2HXIA 2PMZN 3R60A 3T1BA 2A3SA 2LFBA 1I27A 2XB0X 4V2GA 2VB6A 2LBFA 1X1PA 3AAFA 1Z7LA 2E2JJ 2DYSH 4ENKA 5FKLA 2BXYA 2D1VA 1OR7C 1X4OA 3JRHA 2GBYA 1Y1VJ 4ENMA 2MH2A 1X1DA 3BLYA 3ZQ7A 3GTGJ 3I55I 1CF7B 1U1XA 4XOTA 2B0LA 2YSRA 4XSXF 3VYRB 2EINH 4E6KG 2R7VA 4MFEA 3HJEA 4JX4A 4CICA 4HQEA 2A6EF 3NARA 4GFBA 5FLXK 3BG3A 3LNQA 1OYYA 4FT8A 1GT0C 4NC8A 3FWEA 1R23A 2OZ6A 1WJCA 4J9WA 2OD5A 2EH3A 3HGGA 1D0ZA 4U0WA 4XLFA 4G7ZF 1Z91A 3KYDB 2F5FA 3S3MA 3C18A 1GXPA 1I74A 2CW7A 4MHGA 1S3JA 3QQAA 2FD5A 4I09A 5HS8A 3CTAA 3FKIJ 3L2QA 2PVZA 3MKLA 4CCMA 3RDIA 5DEQA 3CO7C 5KCMA 4BL0B 5L3CA 2CV2A 1R4NB 5F08A 1AHDP 1QBJA 2DMQA 1N25A 2Z2SB 4Y17A 3EJXA 5A2QZ 1SEUA 2K5CA 2FOWA 3WTWC 4EATA 3S2DJ 3OL3A 2DN0A 4HW0A 3WTZA 4JX6A 2DYRH 4P5OA 3TBIA 1LUJB 2XKPA 3ABUA 3I0TA 3K2ZA 5HLIA 4LFUA 1S29A 2NVXJ 4MTDA 2CS3A 5C44J 4II2A 4BE2A 4UUVA 1BA5A 2AO9A 4Q60A 4KNYA 2E1MB 4S05A 3SDGA 3QOEA 2IS1A 5IP9J 2XAFA 2Y69H 1O3TA 1KGSA 2V1NA 3DKYA 2BHZA 2XAHA 2LRDA 4HZFA 5DD4A 3ASNH 5K7HA 1E17A 2CQXA 2AS5F 3BQZA 4LJZF 4DBRA 1B8IB 4OOIA 3WTXC 5IYDJ 2R7UA 1XB4A 3IP4B 4IJAA 4B48A 1UAAA 5DTDA 3GX4X 3S14J 3EYIA 1SMTA 1FYKA 4QTRA 1JJ6C 4CZZA 3H1CA 2M9HA 2HVSA 2DTZA 4HBLA 3G1OA 3EETA 1SC7A 3RYPA 2R7RA 1P4WA 2ISYA 2JRMA 3P9CA 2PJRA 1ZGWA 1TT5B 4PGHA 1FJLA 1H9GA 4UXNA 1DGRM 2GLOA 1MBEA 1YX3A 3FBNB 4YEJA 1AKHB 1E3HA 2HVRA 2O9LA 1XGSA 1ETWA 4Q5SF 2IEKA 3WHCA 3ELKA 3RKYA 3FM3A 4V2FA 1QY9A 2PFBA 5E3MA 1PDNC 2GXGA 2DTRA 2RREA 2RVCA 3BP8A 4BHCA 2M7BA 1MJAA 4E4HA 2F5EA 2DT6A 2MYSA 4D5FA 3KP3A 1HW2A 3BT9A 2MC4A 3F8CA 2QQBA 3MQ0A 2L7FP 4LB6B 1T39A 2JWTA 3K4CA 4PJMA 2NVYJ 2XB5A 3JAMK 1UCRA 3Q0UA 1UHMA 1ZLKA 1OKRA 1TLHB 4XKBA 3JSOA 4RAYA 3MZ8A 5GPCA 4AD9A 1JGSA 2GIZA 2WAQA 3VSLA 2XAJA 3HOTA 3K9TA 1DU0A 4IRGA 4PJJA 3LMMA 2BGCA 2V1XA 3K4LA 4C3JJ 3IH3A 5LRSA 5E3NA 3EPZA 2EILH 4BU2A 3CUQB 3BPXA 2VJ5A 3DFGA 2DT7B 2R5YB 4NC7A 1UG0A 1G3SA 1RKWA 1PJRA 3ABLH 2K9SA 3F8BA 2K9NA 2QKLB 3E7LA 4PJNA 2L9VA 2EIMH 1SD5A 2W4SA 4M9XA 4DQ2A 3CDLA 4FASD 3GVAA 2W00A 3Q9VA 3K0LA 2R7XA 4MEXF 2JSPA 5F6FA 2DU9A 4HSRA 1E0EA 1I5ZA 2EZHA 5B1BH 3LAJA 1JKPC 2VBXA 4U7BA 3ABTA 4ZDPA 3ZPLA 4RLQA 4GYGA 2ZMEA 3W6VA 1RC9A 3JAMZ 2ELJA 2G9WA 1XMXA 4KIBA 1HBXG 1X2MA 2YU9J 4ENNA 2BEOA 2LDUA 4A2UA 3RQ4A 3U1DA 4X6AJ 3IV5A 1T98A 4RAFA 3I4MJ 3K4MA 1MNMC 2X0LA 3U1KA 3OS1A 3B6AA 1HSJA 4XRSA 2PBIA 3N97A 1N77A 3KYLA 2H8RA 5E1WA 3J7AO 4XSZF 1QVUA 1OYIA 1XTAA 4G8XA 3CZ6A 4E7ZA 1DPRA 3EKMA 2QVOA 1VF9A 4BQNA 1ZH5A 2XGDA 2QENA 5J1RA 3M3YJ 5EGOB 2GQQA 4A3LJ 3M8JA 3ZMDA 2B63J 2CUFA 3T5XA 3I59B 3KEOA 1FTZA 3BG5A 1ZREA 2M30A 4ITVA 3VYTB 2VOPA 2K86A 2W84A 3PNTA 4UVAA 5K5OA 3DXJF 2H1LA 3ZN0A 1O3SA 3M8FA 3KZYA 3PNVA 1O57A 5HODA 1LE8B 4HLYA 1USSA 5KNLA 3HPHA 3VOEA 2VC1A 5GADJ 3ZRGA 3WGGA 4ZDLA 2FEZA 2LMDA 3DEUA 4IJZA 4GYIA 2HTJA 3CQZJ 4I6ZA 4FHTA 2XSDC 4HF1A 4UUSB 4AYBN 2ID3A 3R6SA 1OCTC 3Q0WA 3GXOA 2CJJA 2ELKA 3K1MA 2JT1A 3ISPA 3RJPA 5K5RA 3G4SI 2G0EA 4B09A 2VT3A 2CV0A 2ZXPA 3VPRA 4ZDOA 2TRTA 3S3OA 1Q1VA 1J0RA 3REOA 2GM4A 1EJ9A 1ETOA 4YFKF 3P9KA 4DBQA 5E3OA 1ZRFA 4F7ZA 1PP7U 2Y31A 1ZGJA 5BOXA 1P92A 1JJ8C 5CKTA 2RNGA 4HSTA 1IJWC 5GAGJ 2DA4A 4MO7A 3I3LA 5EJCA 2YX7A 3CJRB 1PP8F 3DQVC 1BOAA 2R5ZA 1ODDA 2K3PA 4L9JA 3KZZA 1YG2A 3MCZA 2IS6A 2HDCA 1IXSB 3OS0A 4IVNA 2HXOA 4ASNA 1UELB 3D5RC 4C9YA 3ZR8X 1G3WA 3DTKA 5DCMA 2K9QA 2XAUA 1QZYA 3S8PA 3OSGA 2LY2A 3WHBA 4BACA 4ZZLA 2DA3A 1X1AA 3TMOA 4ZJZA 5HA4A 2DW4A 3S93A 2HZDA 4JX5A 2V1UA 5D4RA 1U6GA 3I9V2 3BZ6A 4A3FJ 1FYMA 2L7KA 2CG4A 1XCVA 4LLGF 3A01B 4QPOA 1HDPA 1I50J 3P9IA 2O03A 3PFYA 4WF2A 4IHTA 1W4MA 4B1RA 3I53A 2VASA 2FE3A 1AKHA 5L3FA 1F9NA 2HR3A 2KPMA 4MQVA 3KE2A 4HOBA 4XNFA 3JR9A 2OC6A 1WZ2A 2LR8A 4BJ6C 2DXIA 5EZHA 5EZGA 3D5SC 3E5XA 4HYEA 1AOYA 1TZLA 3F21A 1D0XA 2HNHA 2AQEA 2WBMA 1U8RA 5JLWA 4WCGA 3G7KA 4IHSA 4RA2A 3E6CC 3O8HA 2UZKA 4FETA 4CO8A 1R1UA 2HAWA 3MD2A 4IL6C 5ICFA 4M3DA 5M3FJ 4IHXA 2ZXRA 2LNBA 2PI0A 3Q0VA 1ON1A 1DU6A 1MDMB 2D1HA 2Z5UA 4EJOA 2KW7A 2X1EA 3U2RA 2EB7A 4A3KJ 2AZPA 2YU3A 1OCPA 4LD5A 4XR6A 4M71A 4L9TA 2HQNA 3ECOA 5FRNA 2FNAA 5K7FA 3FMSA 3CJNA 1UG2A 4L9NA 5IPAA 5LLQA 4YIFA 5AIPA 1QZEA 1EH8A 4I99C 4E7LA 2IS2A 4QWQA 4MLOA 1FWZA 3GLLA 1F36A 5E1ZB 3B73A 3F6OA 4LMYA 1XUBA 4HA8A 1OQYA 1YJNI 4L5EA 1FT9A 2FF4A 4NC6A 1XSVA 1MW7A 1Z67A 1FMWA 3BCAA 3ICJA 3BQYA 2WY7Q 2GOMA 4N9HA 3W6KB 2NNYA 4KJZA 4UV8A 5EEHA 3TEDA 3JRGA 1YX5A 2ZKZA 1VQLI 3TP3A 2KMUA 1RI7A 1E3OC 1RUOA 3MKYB 1T08B 3W2WA 2IAIA 5C4JJ 1X1CA 2XDVA 1U9NA 2JSCA 2L3DA 4BY1J 2F2EA 3GTMJ 1ITYA 1YLFA 5M5XJ 4XBFA 2RV8A 3CMYA 2K85A 2E2HJ 4KISA 2AHQA 3OYFA 2HPMA 2EV6A 2F5VA 4IOAF 2AXLA 3QAHA 3GTQJ 2AQFA 2E5NA 1P4AA 4P1WA 4Y33A 4Y3OA 4JOMA 3NWTA 4HF0A 1Z9CA 2ID6A 5TJJA 4DZPA 5CQEA 2UV1A 1GLNA 2IGKA 3A1YA 3QOPA 2EA2A 2EBIA 3OYKA 3RPQA 2ZXHA 1QZZA 2WY8Q 5JI6A 4EM0B 4ESJA 1LQ1A 3MN2A 2R7TA 4B47A 1QGPA 3ZQGA 2ZMEC 3MMYB 4BGDA 3HKZA 1SAXA 3R61A 2L4MA 2Q0OA 3SHFA 3NAUA 2TCTA 1IDZA 2BBYA 1FIPA 1KU3A 2D2WA 4XLNF 2EZIA 3K1NA 4DYQA 3OSFA 3BCBA 5BQTA 4FX0A 5FD6A 1W61A 3PQKA 3V8KA 4DYCA 5AIQA 3GZNB 1F1ZA 1LDDA 3ONQA 1BI0A 1ETXA 2KHMA 3RCOA 3TGNA 4ZYDA 2WAQN 2LF7A 4EVIA 3L2VA 3E97A 1B4AA 2OAZA 3H92A 3K4KA 2ZJRF 4O6JA 1MMSA 4BQQA 5LRRA 2XAGA 1S8NA 2YUSA 3LA7A 1SAUA 3NRVA 1GV5A 4E7HA 5FKMA 3H5NA 2MLGA 4DJAA 4P96A 3UNGC 3S2HJ 3PJRA 1I3AA 3OYEA 4BHBA 3HDDA 1TTYA 3OYMA 1FBUA 1FX7A 3ZMZA 3LSRA 3TQNA 2EFNA 4KT5C 1H0MA 2V6CA 3SDBA 1YHQI 4KMUX 4DZJA 3R0JA 2BOLA 4K8LA 4CYDA 1HSTA 2JVGA 2DMPA 4XLPF 3GO5A 3BPVA 2I5UA 4P9FA 2VKVA 4II3A 1Z6RA 4N4NB 2OTLI 3HZJA 5D6FA 4XMYA 1ZTRA 1UMQA 3GZ5A 3C2HA 3JREA 4PJLA 2L0KA 3KZIC 2RKHA 1V5EA 1Y56A 2HQRA 3IGHX 2LD5A 2UWMA 2M8GX 3L7WA 2JA7J 1HA8A 1H88C 4MFDA 4HNUA 3J7ZI 4O3MA 2MSYA 3FK6A 1TC3C 4JK1X 2N8GA 1JE8A 4A3CJ 3CCYA 1RESA 4BHPA 3A01A 5GTIC 1LNWA 2ZO4A 1FP1D 2MABA 4RB1A 1IAWA 1TM0A 2EPFA 1WJAA 3JRAA 1FZPB 2A5YB 4IRHA 1U9OA 1SFEA 2CO5A 1YITI 1TWHJ 1XCBA 4A3BJ 4UV9A 1KYWA 3HOVJ 3FISA 2MW8A 2HS5A 4BEHB 3QPSA 2E1MC 2IXSA 4CUGA 5ANPA 1DGWY 2L9RA 4KN4X 1TWGJ 1QVTA 3GCMA 3LL7A 3WTUC 3MKWB 4AVZA 2BYVE 2OTJI 2IT0A 1R9TJ 1R71A 1YQAA 1WH7A 1Z77A 3DTEA 2D45A 2OQRA 2E7WA 4OMZA 4V19K 3ZMTA 2W24A 3GFIA 1S6LA 2Z99A 1H89C 4HG2A 1K78B 4P55A 2MC3A 1S5LC 3HOXJ 3V8LA 1MMDA 3QODA 4NNJA 5C3EJ 1ZRDA 4Z6YA 1K4SA 4C2TA 3BZKA 2GXAA 1TNTA 2LG4A 3QPHA 4ZTFA 1OPCA 2Q2EA 5DUKA 1FOXA 2VKDA 2IGNA 1VZ0A 5KK1A 2OF7A 1A5JA 2Q9JA 2I10A 3H35A 1Y39A 2HPIA 3MWMA 4U87A 5E8GA 1WJ5A 2K9LA 1T33A 3ASOH 3BJAA 2DI3A 2H8WA 1RIOH 2MFZA 1R00A 2DMNA 3ML6A 3SFIA 2F6CA 5L3EA 3AL0C 4J19A 3LSGA 2QEXI 2OUMA 2VQLA 2B9SA 1XS9A 1U0KA 4BDZA 5IWEA 3PQJA 2BVMA 1X58A 5HS7A 1Z05A 4L0ZB 1OFCX 2IBDA 5JVGF 1U5TB 3BY6A 4H0EA 1R7JA 3EUKL 2DFEA 2FOKA 1TWAJ 2IW5A 2Y9YA 4R79A 1IG7A 1ORKA 3F72A 3I56I 3CCVI 5CVJA 3WTVC 3CO6C 5H6QA 2W57A 2NS8A 3ERMA 3TDUC 1G59A 4A3MJ 1LEBA 1ZAOA 2CW8A 1BL0A 3RKXA 1YW8A 4IXAA 1Y8RB 4CYCB 3CMEI 2KP6A 4A93J 4IHVA 4GL6A 4KUMA 2OA4A 3S1MJ 3SQNA 1ZG5A 2EIKH 1TT0A 2ZCWA 2M0MA 1L3LA 5GPAA 4D7NA 2LLKA 4OMYA 3RPUA 3R4KA 1REPC 3HXLA 1EF4A 3RSNA 2KL4A 2ZXOA 4L5IA 1YS6A 3FDYA 3FMRA 5H2YA 4CSWA 2BW3B 3IWZA 5EG0B 5D8LB 2V4JC 2M8EA 3B02A 3DPTA 1K61A 2KIQA 2NXNB 4UHTA 2F48A 5FROA 3OYHA 2HOAA 3L2UA 2VQHA 3GTOJ 2ISZA 4XK4A 2CUEA 4D9JA 4RLFA 5LFAA 1U78A 5B1AH 2EB0A 2CUJA 4OU0A 1RZ4A 3K69A 3EQLF 4QIWN 1VQ9I 1PUFB 5FLXZ 4DIQA 3IH2A 5J4VA 5C4XJ 2JA6J 2FNPA 5CYVA 3SZGA 2JA8J 3K4JA 4ZH4F 1FYLA 3Q5FA 3W5WA 2EIJH 3A0HC 4DW6A 1WCMJ 3CDIA 2ADUA 1T6SA 4F93B 3V8JA 2VPRA 2X51A 2XAQA 5E17F 3FXRA 5H2GA 4YIIA 1QU3A 1WJEA 3JCUC 5F0HA 5J1YA 3TOAA 2VLAA 4IQ4A 4XM3A 1UHSA 3DV8A 4KIGA 3SEZA 4J01A 3G3ZA 1E3PA 2PW0A 4LLLA 2O5RA 4LG0B 3WTSC 4BH9A 4MNUA 3W6JB 3L00A 1I3QJ 3BR5A 1SVMA 5LD2C 3WE3A 1D3YA 1T8IA 3OYJA 3OYNA 4BXFA 3BROA 4L0YB 4S04A 1BOBA 1JKQC 4EMSA 2VUMJ 4RAGA 1SFXA 1T95A 5JR3A 2QBYA 2WV1A 1XG1A 1S7EA 1VNDA 3OIOA 4RB0A 3RKQA 4ZYAA 1ZELA 4ESFA 2FRHA 3WTTC 5IOZA 3BTCA 3IHUA 1QNTA 2HOSA 2H94A 3OWTA 2CV1A 3LSHA 5IT3A 1F5TA 1PYVA 2WAFA 3BOQA 3UR3C 3HUGA 1QPIA 2L02A 1RUNA 2CU7A 5FKKA 2VJIA 3JRDA 1U2WA 4AIJA 2VJJA 3QYBA 5B5EC 3KX2A 4DUNA 2VIXA 2GA1A 2OU2A 1JI8A 4WXCA 3AG2H 2NOGA 1IW7F 2RAEA 2E1CA 4GCVA 3GEZA 4N0BA 2Y9ZA 3V42A 3I4NJ 1KQ0A 2PMHA 4Y52J 2YMAA 2FMYA 5FGMA 3ZXSA 2DJNA 1FSEA 1LVKA 5J6XA 2A68F 1G2HA 3R0AA 5IYCJ 3ERED 2P7VB 2Q8KA 1MH4A 2DFIA 2E34A 3OMYA 4Y7NJ 4HF2A 2WA0A 5F0FA 4BEHA 4IHYA 3HKZN 1BW6A 2QWWA 2RQQA 4HQMA 3BZCA 1I39A 4BBRJ 3QWLA 2X85A 3DBRB 1B72A 3F8MA 2Z16A 1ONVA 3MZHA 1DDNA 1W62A 3CMMA 1YRNB 3S15J 5GAEJ 4HNVA 3F0CA 5JFRA 4IK0A 2XGEA 1HQCA 3BJOA 3V7RA 1J75A 4RB2C 3TKYA 3GTKJ 3CMAI 2DK8A 4YFNF 1LVAA 2LKPA 1WPMA 2XHKA 3IC7A 3HSFA 5J40A 5FLMJ 4BYYA 1YW9A 1HKTA 2K4JA 1RRJA 2X6WA 2DMUA 1X2NA 2ZNYA 2JA2A 1W7PB 1FMVA 3LSPA 4ZC3A 4AUXA 4JCIA 2NS0A 4AC0A 5L3BA 3HOZJ 2X4HA 2LT2A 2HZTA 2CQKA 5BS6A 4ANJA 3DTIA 3DWLE 1ZGAA 5J3LA 3C2GA 4UVBA 2VPLA 1OISA 2E35A 5AONA 1YOVB 2KIMA 5F27A 3M1EA 1MD0A 5B66C 1S7AA 1IN6A 1GVJA 2J5PA 2EV0A 2M45A 2QQ9A 1XGNA 2COBA 3OYCA 5CLSA 3VWBA 1LB2A 5CVVA 2XROA 2MGQA 4KFCA 1ON2A 3RQIA 2ZBKA 4UB8C 4D0PA 5LHGA 2IS4A 3PUFA 4YG2F 1FOYA 3HRMA 1EV7A 2O3FA 1CF7A 4XL9A 1R4MB 5TISC 3COAC 2M7AA 4LGWA 3MFKA 2L2OA 2I8DA 1NK2P 4RM3A 5F0CA 2IRFG 3JTGA 3F3XA 3CCLI 2E1OA 3VODA 4C2UA 1QRYA 2FBIA 4S0HB 5DD8A 1J7KA 3K4NA 1IZ1A 3GMEA 1O7LA 5ERIA 1IXRC 3TL4X 3AKZA 2M2EA 3HL2A 5D4SA 1D1BA 2P81A 1MGTA 4W97A 2LC2A 3S3NA 3AG3H 2H09A 5LHHA 3K2AA 2HWVA 3HSEA 4I0BA 4F55A 4UB6C 5E79C 3FM5A 1VQOI 2LYCA 2R92J 1BWZA 2W25A 4OIQF 2MPBA 2JRTA 2E2IJ 1IN7A 1AA7A 3BR6A 2BW3A 4G7OF 1RETA 3FKJA 5DM6F 5EG0A 1G3TA 3F23A 3CJTB 2OTNA 4TV7A 1MBHA 3PO3J 2LY9A 3PM1A 3GFJA 3OYGA 4JUUA 5FFZA 5F1JA 1I6XA 3MAJA 3FXMA 1GDTA 1R5GA 2E5ZA 1FTTA 4XRFA 4Q2HA 4Y4RA 2W85A 3H9QA 1NG7A 2FUG2 1AWCA 1GQZA 2M5WA 1TWCJ 3HC7A 1R1VA 1ULYA 1YE9A 4OA3A 3BTJA 4YIRX 3OYIA 3KEQA 4JYKA 2NAZA 3AG4H 3FVEA 4RGSA 2TDXA 2KDZA 2O6GE 1S9HA 1KU9A 2E71A 2W82A 1B8IA 3IAM2 2L4AA 3J7AY 3BTLA 4LS9A 4BY7J 3V7SA 1VQ5I 5L3GA 1IN8A 5FB2A 2QSHX 4L18B 3EDNA 1VFCA 1N78A 1G8XA 2M0CA 3CF2A 1F43A 3D1NI 3DBHB 4J9XA 4LIUA 2QQ8A 3QPTA 3OOUA 4WWCA 5HDKA 5GAHJ 1OCZH 2ZFUA 2HEOA 5K7ZA 1D0YA 3JW4A 4RMNA 3K70C 1U1VA 1Z3XA 1YW7A 3WU2C 5DS9A 1FBSA 2YR2A 1FOWA 3SEQA 3DP7A 3ABMH 2E7XA 4HX4A 1BW5A 1ZKGA 2JZYA 2LF8A 5EF6A 2QGUA 1PVEA 1WJBA 4PUSA 1FPQA 3L09A 4XORA 3GUDA 2MA3A 3OIQA 4CCNA 2HGCA 4EJWA 4RGXA 2CWEA 1ZRCA 3M1CA 3FXQA 4AIHA 4NDLA 4LG3A 5F1RA 3GTLJ 4NQWB 4Q4ZF 1X3UA 3DPUA 3DBLB 3HBLA 3RYRA 3QU6A 2P7CB 3IH4A 1STZA 1LDKB 2XASA 2EJRA 3IAS2 2VODA 4CCJA 5EEAA 4CH7A 3TOBA 3WG9A 2R7FA 2P5LC 2WB1A 1V5GA 2IPQX 2KRHA 4CA0A 3ZQLA 1IR6A 3E0JB 4EQQA 3DF8A 1FBQA 3CC4I 5H6RA 2HQAA 2DDAA 2DJIA 2VL8A 5E20A 4WXHA 1ZG3A 2W1OA 3FXLA 4M73A 3DEEA 5GTHC 3BTIA 3CUQA 2HOTA 2R5YA 1JTXA 3H9JA 4M74A 1Z7UA 4KT6A 2ESHA 2X48A 1XN7A 5CVIA 3OV8A 4UUTA 2V6EA 1IN5A 4HPQA 2OCEA 3ZMVA 4A0YA 2LP0A 4A6DA 3K4BA 2JPBA 1GVDA 2EFQA 3EYYA 1MZBA 5KHDA 4I98B 4WK8F 1VQ6I 1WFXA 2WAEA 1RKTA 3GTJJ 2Q1ZB 4P9UA 5CJ9A 1POGA 5IP6A 1B9NA 2CQQA 3MVPA 4BKXA 3G2BA 2LBFB 2QM3A 4PFPA 1YO5C 1V4RA 4EV0A 3DLLF 1SFUA 3BR1A 4E7SA 2E60A 2NVQJ 3O6BB 2GKJA 4LITA 4BQAA 1HW5A 2EK5A 2V1DA 2IA0A 4PJ0C 3PW9A 4EEFG 2MD5A 1HXDA 2VBZA 3TO6A 4Y13A 1BI2A 4QPQA 3WE2A 4XRSG 4KITB 4BBSJ 1QYAA 4D1QA 3BR2A 3TO7A 2EWNA 1ERDA 1UJ8A 2LY1A 5EGOA 1I6HJ 2FJ1A 4I7HA 2VE8A 2X6OA 3I54A 3I59A 3FXJA 3M07A 3HTUA 5DCFA 3J81K 1S72I 2Q9HA 1IF1A 1FLIA 5IP7J 2XUBA 2ME6A 3L2RA 2JMWA 4AM3A 2HU9A 2FU4A 4U88A 4OIPF 3H5RA 1J5YA 1HW1A 2RDPA 5F04A 4KA4A 1LE8A 5BMZA 4IRIA 2FQ4A 3O2PE 1DPUA 2V9KA 4XOPA 1VQMI 1TWFJ 2K7LA 3LOCA 3WQZA 2FBKA 2KDOA 3FZVA 5KAFC 3F8FA 4E70A 2F4MB 2XRNA 2STWA 1E2XA 2VOOA 2ZXIA 1W5SA 3DPLC 4N4OB 2QA4I 4Y15A 3HRTA 1A6QA 5EDNA 5M5WJ 2DDBA 3S1NJ 4UUSA 2PQ8A 3ZQIA 3GLXA 4CZCA 1XSDA 1MJBA 2R0QC 1SFKA 1R1TA 2YS9A 2LK2A 2DOEA 2IVMA 3KP4A 1XD7A 4B3AA 5LHIA 3E6DA 3NQOA 2VT2A 4IOCF 9ANTA 2DPDA 3ZGKA 4IF4A 3O3KA 3WGHA 3B6CA 3VEPA 1J09A 3T0YA 1R22A 2EZLA 2DO7A 1O7FA 2DT5A 1BI1A 5ILSA 4ESBA 2KPTA 3PIOF 3HOUJ 1MBKA 2BY2A 3WTYC 1UFMA 3LFKA 4QLCU 2R7SA 1XMKA 3PIPF 3BR0A 5D6EA 2XGXA 1WJFA 4A0XA 1Y1WJ 1HF0A 2EQRA 1O4XA 3L2CA 2BY1A 2CSOA 5BPIA 1WI9A
chains in the Genus database with same CATH topology
3OS1A 3OYHA 1N77A 3L2UA 2PJRB 2VQHA 3KYLA 4D9JA 4RLFA 5LFAA 2EB0A 2CUJA 3CZ6A 4E7ZA 2IGMA 5CPRB 3EKMA 3NWSA 2NOJB 4BQNA 4XONA 3OR1C 3PTJA 3M8JA 4DIQA 3SZGA 3W2AA 2Q2EB 3K4JA 4ITVA 3VYTB 4F3QA 3HOSA 3PNTA 4K7XA 3W5WA 3S32A 1Z21A 2ZSIB 4F93B 2X51A 3PNVA 1W36D 5H2GA 1QU3A 5HNHA 4BE1A 1WJEA 2A5WA 3AFHA 5KNLA 3HPHA 3OY9A 4XKCA 3ZRGA 4ZDLA 2V26A 2VLAA 4IQ4A 4IJZA 4XM3A 4JQFA 3LSIA 3SEZA 4J01A 2PW0A 2O5RA 2M4KA 2CUZA 2UUZA 1MNEA 3DLAA 2M4GA 5LD2C 3OYJA 3OYNA 4BXFA 1BOBA 1P9QC 3N05A 1T95A 4XN3A 3DEVA 1QHHD 2CV0A 2ZXPA 4ZDOA 3LSMA 3S3OA 1YM5A 4ZYAA 1K6YA 1ZELA 1DQUA 1Z3YA 2XF7A 4DBQA 2GOXB 2QB8A 2HVQA 2KQRA 3OWTA 2CV1A 4OAZA 5CKTA 2RNGA 1U0JA 3LSHA 4HSTA 2L9SA 1PYVA 2WAFA 3UR3C 3PL8A 3G98A 3OYAA 2VJIA 3I3LA 3CJRB 3K6GA 5HVQC 1WJDA 2VJJA 3DQVC 3QYBA 3KX2A 4DUNA 4C30A 3DU5A 2VIXA 2K9MA 2K3PA 4BS9A 1JI8A 2BVLA 2IS6A 3OS0A 3V42A 3PUBA 1UELB 3D5RC 4C9YA 2YMAA 2ZVFA 3ZR8X 3ZXSA 3DTKA 2MD0A 1MMGA 2X1DA 1MMAA 1LVKA 4NUBA 2W7NA 2XAUA 1BR4A 4GRIA 3S8PA 2LY2A 4BACA 2DOAA 5TGTA 1X1AA 3TMOA 3DU6A 4ZJZA 4RM2A 3OMYA 4XN0A 3U21A 5HA4A 3S93A 2WA0A 4BEHA 2HZDA 4BJ5C 2RQQA 1LFPA 1XUAA 2M3AA 3I9V2 3GBGA 2L7KA 4XLHA 2XC7A 2ENXA 2X85A 2Z16A 4QPOA 1W62A 3CMMA 3OYBA 3PFYA 1U1WA 4HRIA 4IK0A 3FHNA 1DP3A 2X6XA 2VASA 4BE0A 3BG6A 1WPMA 2KPMA 3PSIA 4BQOA 2X6WA 4XNFA 2OC6A 4BJ6C 2DXIA 2JA2A 4YRVA 3D5SC 1FMVA 2L9NA 1TZLA 4ZC3A 3RTRA 4JCIA 2VQGA 4PSWA 1D0XA 2HNHA 2AQEA 2WBMA 3ZCOA 2LT2A 1BR2A 1R6RA 3OS2A 4ANJA 1MMNA 3DTIA 3DWLE 3G7KA 4E7JA 3C2GA 2VPLA 3H0DA 3FBIB 4FETA 1N75A 2WADA 3MD2A 2HAWA 2ZXRA 2QB7A 2IW4A 2X1EA 3OYCA 3VWBA 2KW7A 5M47A 4RPAA 4LIVA 4PK4A 3ZQQA 5FRMA 3OYDA 2AZPA 4XLAA 4XR6A 5JHFA 4E7IA 2IS4A 1K20A 3QYFA 2VKHA 5FRNA 3EUAA 3HUGB 4XLCA 3LFUA 4XL9A 4JBDA 1S7JA 4G6TB 2M7AA 2L2OA 2I8DA 3VSKA 4RM3A 2VQCA 3DKXA 3BG7A 4B43A 1K23A 4E7LA 4C2UA 4IKFA 2IS2A 4MLOA 5HNFA 2LREA 2F4IA 4AYBA 2ZSHB 3CJQB 2R7OA 1XUBA 4HNTA 2CFOA 2JVHA 3BC8A 3K4NA 4DGWB 3H9GA 3TL4X 1BR1A 2VXDA 3HL2A 1MW7A 3LSKA 3QYEA 1D1BA 1FMWA 3BCAA 2LC2A 3ICJA 3S3NA 2L5QA 2WY7Q 2GOMA 4F55A 2LYCA 4KJZA 2LH9A 1EA3A 4PFOA 1BWZA 1YX5A 2QB6A 4DOZA 2R4GA 4BUPA 4IQJA 2KMUA 2MPBA 3CP8A 3MKYB 3W2WA 2A6TA 2P0WA 3AKZA 1AA7A 2Y0SA 1IRXA 3OIPA 3W2VA 2R7WA 1X1CA 2XDVA 2BW3A 1W36C 3FKJA 2KLOA 2VJ4A 2OTNA 5CQGA 3F9KA 2Z1DA 4E7KA 3OYGA 4JUUA 3VYUB 1SDJA 3HG9A 4KISA 2E5ZA 4OWRB 2XF5A 1T0FC 3OYFA 2HPMA 2F5VA 4Q2HA 2JUGA 3CESA 4Y4RA 3H5AA 3H9QA 2FUG2 1NG7A 2AQFA 2E5NA 3E1SA 1GQZA 3CP2A 4P1WA 3HC7A 1X19A 1YE9A 4Y33A 4OA3A 4Y3OA 4JOMA 3OYIA 3A2KA 3NWTA 1X1BA 5CQEA 2UV1A 2X6YA 1GLNA 2IGKA 3A1YA 4CCLA 3FVEA 2DCEA 3AL0B 3OYKA 4K7GB 4IX7A 1S9HA 2WY8Q 2ZXHA 2W82A 2R7TA 4B47A 3IAM2 3MMYB 4B3XA 3HKZA 4BGDA 3MKZA 3J7AY 4LS9A 2VB6A 3EDNA 2LBFA 3W3CA 3BCBA 1Z7LA 1G8XA 3CF2A 3OL4A 1N78A 4J9XA 1W61A 4LIUA 3IUOA 3OOUA 3ONQA 3RCOA 2KHMA 3EUHC 3HPGA 2ZFUA 1OR7C 1U1VA 1D0YA 1X4OA 4RMNA 3K70C 1Z3XA 1WPPA 2H9FA 3K10A 3L2VA 3BLYA 1X1DA 1U1XA 4XOTA 3VYRB 4E6KG 3D5LA 3K4KA 3SEQA 2R7VA 1Y6IA 3VDXA 4HEA2 4BQQA 4JD7A 1SAUA 1LKXA 4NC8A 4E7HA 1T6KA 3H5NA 1WJBA 4DJAA 1WJCA 4PUSA 4XORA 4YELA 3UNGC 4J9WA 3PJRA 3OIQA 4CCNA 1D0ZA 3OYEA 4XLFA 3OYMA 3M1CA 2QKMB 4LG3A 3S3MA 1I74A 4NQWB 2CW7A 2X1CA 3DPUA 4F52A 5HLTA 3SDBA 1LDKB 2BOLA 4K8LA 3L2QA 3IAS2 4CCJA 2PVZA 4CH7A 2XF6A 2JVGA 4CCMA 1NG6A 2WB1A 1V5GA 2KRHA 4XLEA 5KCMA 4BL0B 4CA0A 2CV2A 3E0JB 1IR6A 4II3A 2CMPA 2Z2SB 4N4NB 3EJXA 2HQAA 2DJIA 2VL8A 2K5CA 4XMYA 4F91B 3C2HA 4EATA 4PJLA 3OL3A 2W1OA 1V5EA 1Y56A 3DEEA 4P5OA 3IGHX 3TBIA 2UWMA 4PY9A 3H9JA 4XKWA 1HA8A 4KT6A 4HNUA 2CS3A 4II2A 4BE2A 4AU7A 4Q60A 2E1MB 1D1AA 3QOEA 2IS1A 2V6EA 4HPQA 2MABA 2V1NA 3DKYA 1TM0A 2LRDA 3K4BA 1WJAA 2CH0A 4IZZA 5KHDA 4DBRA 1WFXA 2WAEA 4CCOA 1QHGA 4J00A 2Q1ZB 2R7UA 3IP4B 2IGOA 4B48A 1UAAA 4BEHB 3G2BA 1MNDA 2LBFB 2E1MC 2IXSA 4PFPA 4CUGA 1OLTA 5ANPA 1DGWY 4E7SA 2GKJA 2E60A 4H4KC 3LL7A 4LITA 3MKWB 2HVSA 4AVZA 2R7QA 3PW9A 4LB0A 1X4PA 4KITB 4QPQA 5HOOA 2R7RA 2PJRA 1QYAA 3DTEA 4D1QA 1DGRM 3L2WA 4B44A 1YX3A 1ERDA 4BDYA 4F92B 3FBNB 4HG2A 4YEJA 2HVRA 2LY1A 1MMDA 3RPUD 3QODA 4NNJA 4C2TA 2LG4A 4ZTFA 1QY9A 2Q9HA 1D1CA 2VKDA 3L2RA 2IGNA 2RREA 1VZ0A 2HU9A 2PMZA 2M7BA 2Q9JA 3H35A 4ZTJA 4E4HA 2DT6A 2MYSA 3H5RA 2HPIA 4U87A 1WJ5A 1V5FA 2K9LA 2MC4A 4BJTA 3K70D 3K4CA 4PJMA 2V9KA 3VYSB 4XOPA 3OYLA 3WQZA 2KDOA 4XKBA 2MFZA 2ZXIA 3DPLC 3PNYA 2WAQA 4N4OB 3VSLA 3HOTA 2F6CA 3AL0C 4PJJA 3LMMA 3LSGA 3K4LA 2OUMA 2VQLA 1U0KA 3SYTA 4CCKA 4CZCA 4BDZA 5IWEA 2VXZA 1SFKA 2BVMA 2HDWA 2XSJC 3EPZA 4BU2A 3OR2C 2VJ5A 3EUKL 2DT7B 4NC7A 1UG0A 4R79A 3PSFA 4X0GA 4PSXA 1PJRA 2LOOA 2V7FA 3ZGKA 2KZVA 1KONA 2QKLB 4PJNA 2W4SA 1J09A 4FASD 1G59A 2W00A 2R7XA 2CW8A 2JSPA 4HSRA 1E0EA 2KPTA 2KP6A 4GL6A 2KRCA 4U7BA 4ZDPA 1TT0A 2M0MA 4RLQA 2R7SA 2GKEA 4XQFA 4XKVA 3HXLA 2ELJA 3RSNA 3PVHA 2KL4A 2ZXOA 1WJFA 3A4CA 4OAYA 3KEYA 2OV7A 3FDYA 5H2YA 4CSWA 3RQ4A 2BW3B 2V4JC 3DPTA 3K4MA 5FROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG3 A; 
#chains in the Genus database with same CATH topology
 2PJR B;  4IHW A;  5E1X A;  1WSU A;  4CHU A;  4UY8 I;  3SFZ A;  1IUY A;  1ZQ3 P;  3TW7 A;  2IGM A;  4HLX A;  5CPR B;  1JHH A;  1OCC H;  3NWS A;  1FOK A;  1GXQ A;  3OR1 C;  1BC8 C;  3PTJ A;  1QA6 A;  1WVR A;  1YJW I;  2QUF A;  2KT0 A;  1GV2 A;  1ETQ A;  1MH3 A;  5LBQ A;  1IGN A;  3ROU A;  2L7Z A;  3HOS A;  2XRL A;  3S32 A;  4AIK A;  1Z21 A;  2ZSI B;  2ZJP F;  1HKQ A;  2B7E A;  4RAZ A;  1MIJ A;  5TRD A;  4HDU A;  1W36 D;  1VQ7 I;  3ZN1 A;  1IN4 A;  2A5W A;  1XMA A;  4XKC A;  5FKN A;  5K1Y A;  2V26 A;  3CCQ I;  4JQF A;  3LSI A;  2H6C A;  3CDH A;  2EA4 A;  5M5Y J;  2ZFW A;  1WWX A;  4K2E A;  2DA1 A;  1SFO J;  2CUZ A;  2CQN A;  2UUZ A;  1MNE A;  2XPV A;  1TL8 A;  1JXS A;  1Z0X A;  2O7O A;  4G6Q A;  2H1K A;  1TP4 A;  1QQI A;  1ENH A;  1OMI A;  2ELH A;  4EGZ A;  2HDD A;  2DK5 A;  1BJA A;  4HX8 A;  1P9Q C;  1CQT A;  3I71 A;  3DEV A;  3U9G A;  5D5X B;  4MQ9 F;  4M6V A;  4LK0 F;  1YM5 A;  1MDM A;  1D5Y A;  2OZU A;  4DNC A;  4FX4 A;  2CYY A;  2GOX B;  3ZQF A;  3IL2 A;  4FCY A;  2HVQ A;  2QB8 A;  1TW3 A;  2F5C A;  3FHZ A;  2K27 A;  2G7U A;  2L9S A;  2QSG X;  4M9S A;  1BBY A;  5ICG A;  2H6B A;  1VQ4 I;  3K6G A;  5HVQ C;  3C3W A;  3GF2 A;  2ZME B;  4BXX J;  4C30 A;  3CCS I;  2ECB A;  2DPU A;  4BS9 A;  2NYX A;  3I4P A;  2BVL A;  5J1U A;  2QSF X;  1B1B A;  1BI3 A;  2XV4 S;  3V4G A;  1LEA A;  1WRJ A;  2NS7 A;  3PUB A;  2V79 A;  2ZVF A;  3KLN A;  3I64 A;  3K7A J;  2MD0 A;  1T38 A;  2X1D A;  1A6I A;  2W7N A;  5J8C A;  2PMU A;  1K79 A;  2OBP A;  3BG9 A;  3CC2 I;  1D5V A;  1R58 A;  2DOA A;  5TGT A;  2VKE A;  2VBW A;  4XN0 A;  3U21 A;  2BY3 A;  4ZYE A;  4BJ5 C;  1LPQ A;  3QRF F;  1LFP A;  4IPA A;  1XUA A;  2M3A A;  1XC5 A;  1ETV A;  3ESW B;  3GBG A;  2ENX A;  4XLH A;  4L9V A;  4FIS A;  2DMT A;  2YX4 A;  5A2Q K;  1ETK A;  1W0U A;  3IKV A;  1Y8Q B;  5HLG A;  2Y2Z A;  2OJE D;  1W7P D;  4U0Y A;  3CUQ C;  2P6S A;  1DP3 A;  4HV6 A;  3CCJ I;  2JJ7 A;  4FE4 A;  1UST A;  1CGP A;  3FK7 A;  4U7D A;  1T2K A;  3ECH A;  3BG6 A;  1WKM A;  4LK1 F;  4BE0 A;  4Z2Y A;  3PSI A;  1VQK I;  1R5H A;  3HHG A;  2R7Z J;  3GWZ A;  4BQO A;  1XX5 A;  4HV5 A;  1PUE E;  1VTN C;  3I5U A;  2P5V A;  3CLO A;  4EJU A;  1BIB A;  1W5C C;  1ZG1 A;  4PGG A;  4AVP A;  2VQG A;  4PSW A;  1DUX C;  3VB2 A;  5FO5 A;  3ZCO A;  4C3H J;  1A31 A;  1R6R A;  2F5D A;  2WV0 A;  4FQG A;  3P7N A;  1MMN A;  3KET A;  3G73 A;  1TQI A;  4XID A;  5DDG A;  4E7J A;  2PG4 A;  3LAP A;  4UVC A;  3H0D A;  2RNJ A;  3FIW A;  5LEK A;  3LA3 A;  5ICC A;  3IRQ A;  3MZY A;  2QB7 A;  4C2M J;  2GZW A;  1XDS A;  2IW4 A;  3WU1 B;  1LJ9 A;  1NTC A;  4LIV A;  1JUS A;  1W5T A;  3FXO A;  5FRM A;  2WB1 N;  2J5O A;  4GDF A;  2KIS A;  2R3S A;  5JHF A;  2VON A;  2HTS A;  2M34 A;  2MLK A;  2VKH A;  4FE7 A;  2Y30 A;  3EUA A;  4N9I A;  1OCR H;  4WXD A;  3LFU A;  3M4O J;  1H9T A;  1S7J A;  3CUO A;  1MBG A;  4G6T B;  2R5Z B;  3HTS B;  4I01 A;  1UZC A;  3KFW X;  2VQC A;  3DKX A;  4D7M A;  3CLQ A;  2NRA C;  1YIJ I;  4IKF A;  4NB5 A;  3QU3 A;  2LRE A;  2F4I A;  1HLV A;  1T56 A;  1YS7 A;  3LST A;  1D8K A;  2ZSH B;  2HYG D;  1BN5 A;  2R7O A;  3OOP A;  4HNT A;  3GYH X;  2JVH A;  3BC8 A;  4ZZD A;  4RGU A;  3ULQ B;  3H9G A;  3F6V A;  1BR1 A;  4HAM A;  2HYJ A;  5CVU A;  3LSK A;  5DCM B;  3VFZ A;  1IC8 A;  5FFX A;  5FKO A;  1JT0 A;  5D5V B;  2LH9 A;  1EA3 A;  4PFO A;  3QP5 A;  3WGI A;  4IQJ A;  1TBX A;  5LGU A;  3CP8 A;  2A6T A;  1MJ9 A;  2P0W A;  3OIP A;  1ZHF A;  1IRX A;  2Y0S A;  4M6Y A;  2BY0 A;  4PDK A;  2R7W A;  1GHC A;  2KRF A;  3KP6 A;  3TW6 A;  2KLO A;  2A6H F;  3LA2 A;  2VJ4 A;  4KDP A;  1SVL A;  4QSH A;  1K7A A;  2DLL A;  2XGC A;  2L54 A;  1FP2 A;  2PJP A;  2EFO A;  2IA2 A;  1R36 A;  3VYU B;  1RR7 A;  2P6T A;  3H0G J;  4A69 C;  3RZD J;  4M6X A;  3CC7 I;  5LEJ A;  2XF5 A;  1T0F C;  1FY7 A;  2JUG A;  3CES A;  4A0Z A;  3H5A A;  1F4K A;  2NVT J;  1VQN I;  3ZOB A;  2O0Y A;  3E1S A;  2RQP A;  1X19 A;  3SZT A;  1JTY A;  1P2F A;  4KIC A;  5K5Q A;  4R1H A;  2OPT A;  1X1B A;  5IY5 H;  5KAI C;  2DCE A;  2ZC2 A;  3AL0 B;  1YYV A;  2KFD A;  1EH7 A;  4IX7 A;  2ETH A;  4I2O A;  2DOF A;  4MGR A;  1ZLJ A;  3DKW A;  3A02 A;  4B3X A;  1TQP A;  4R8H A;  2OCC H;  1LDJ A;  1WGX A;  5J8F A;  3CCM I;  3T8R A;  2A05 A;  3W3C A;  1O3R A;  1AU7 A;  4KN7 X;  2KJC A;  3OL4 A;  3LWF A;  3IWF A;  2BE5 F;  1ZYR F;  3IUO A;  2ECC A;  4ABZ A;  3EUH C;  3HPG A;  1SAN A;  2ZJQ F;  2FML A;  1QPM A;  2H9F A;  1WPP A;  3BWG A;  3K10 A;  5B3S H;  2DA6 A;  1KA8 A;  2PN6 A;  5HLH A;  4A3E J;  1Q1H A;  2DA5 A;  3D5L A;  3HM5 A;  1SD4 A;  1YIO A;  3WG7 H;  1Y6I A;  2ACJ A;  5JHU A;  5EYR A;  1K78 A;  1APL C;  3VDX A;  4HEA 2;  4JD7 A;  1W1W E;  1LKX A;  5D5U B;  1FSH A;  1T6K A;  5CVR A;  3Q9S A;  1MBJ A;  4YEL A;  1DP7 P;  1OCO H;  2PEX A;  4IEJ A;  4OIN F;  4CGZ A;  2HKO A;  2ZB9 A;  1YI2 I;  2QKM B;  3ABK H;  3WU0 A;  4MIM A;  2X1C A;  4F52 A;  1FIA A;  5HLT A;  4HDV A;  5HDN A;  3E3V A;  2QZ8 A;  3GFL A;  3CCR I;  4EM1 A;  5ICE A;  1Y0U A;  4EJT A;  3JRB A;  3PFI A;  2XF6 A;  4RS8 A;  2XVC A;  4JBA A;  1NG6 A;  3FXK A;  4LB5 A;  4XLE A;  5DUI A;  4BXU A;  4RDU A;  1NHA A;  2CMP A;  1Z1D A;  1P7I A;  1R49 A;  5J47 A;  4F91 B;  3FXU A;  2NNN A;  3JRF A;  4A3I J;  1IRZ A;  1KYZ A;  2ESN A;  1MSF C;  1U5T A;  2K3F A;  1UHW A;  2X9D A;  2D5V A;  4PY9 A;  4XKW A;  1BC7 C;  2M1B A;  2MBF A;  2DFH A;  4GXO A;  3HHH A;  3HYI A;  1FEX A;  4AU7 A;  1ZR4 A;  4NBQ A;  2DQR A;  1D1A A;  3DCF A;  1EKE A;  3M9A A;  3HOW J;  2RN7 A;  1XPX A;  3KPH A;  3J80 K;  3SZP A;  3RKW A;  2DBB A;  1KQ8 A;  3SJM A;  1MKM A;  1LFU P;  1TQM A;  2BZT A;  2CH0 A;  4CYC A;  4IZZ A;  5IT9 K;  4D5C A;  3E5U A;  3LQR A;  4CCO A;  1QHG A;  4J00 A;  5HDG A;  1ZR2 A;  2VBY A;  3ZMS A;  1ZN2 A;  2IGO A;  3HSR A;  4CXF A;  4A5N A;  1L0O C;  2FBH A;  1TW2 A;  1YTY A;  1MND A;  1OLT A;  2K40 A;  2E19 A;  3HRS A;  5KVR A;  3HB9 A;  1SMY F;  2GXB A;  4H4K C;  1X3Z B;  2HFH A;  2R7Q A;  1XGM A;  2JN6 A;  4LB0 A;  1X4P A;  2BHY A;  5HOO A;  4G94 A;  3L2W A;  5D5W B;  1J9I A;  4B44 A;  4BDY A;  4F92 B;  4RB3 C;  2VE9 A;  1PUF A;  3KIO A;  1XDU A;  2KIU A;  3RPU D;  3FX3 A;  1P7J A;  4PCQ A;  4Q48 A;  1A35 A;  5DYM A;  5L3D A;  3J80 Z;  1G3Y A;  1D1C A;  4RBO A;  5F64 A;  4M3E A;  4KYW A;  5BNG A;  3K1P A;  4EM2 A;  2PMZ A;  4GO1 A;  3FF5 A;  3RI4 A;  4ZTJ A;  5ED4 A;  5IT9 Z;  4KIF A;  3HOY J;  1V5F A;  3K70 D;  4BJT A;  4FTH A;  3VYS B;  2RC4 A;  3OYL A;  1B9M A;  2O8K A;  4UNO A;  2MG4 A;  2DA7 A;  3KP5 A;  2V9V A;  3PNY A;  2O8X A;  2NVU B;  5FJ8 J;  2ZJ2 A;  4LG0 A;  2G7H A;  2M87 A;  3M8E A;  4JP0 A;  2HKX A;  5H2F C;  2BV6 A;  4IO9 F;  2PLY A;  3SYT A;  4CCK A;  4ON0 A;  3C1D A;  4MTE A;  2P8T A;  2VXZ A;  2HDW A;  2XSJ C;  4EJV A;  3RZO J;  3KP2 A;  2WTE A;  3OR2 C;  5EEG A;  1VI0 A;  2CW0 F;  5J4Y A;  4ENJ A;  4L5J A;  4BNC A;  4M72 A;  3PSF A;  4X0G A;  1JKR C;  2ZNZ A;  4PSX A;  1GUU A;  2DAO A;  2LOO A;  2V7F A;  5FD5 A;  2KZV A;  1KON A;  2COM A;  2LTP A;  5D8K B;  1O3Q A;  1K4T A;  4HX7 A;  2DA2 A;  4I02 A;  3D0S A;  2FA5 A;  2V9P A;  2ZXW H;  5DV5 A;  3RIR A;  3F22 A;  3H3V K;  5M3M J;  2H27 A;  4A3D J;  5JLX A;  2Z3Y A;  2RGV A;  2Y75 A;  4A12 A;  2KRC A;  2KIF A;  1S7O A;  1Y0N A;  2FXA A;  3JTH A;  2LKS A;  3S1R J;  2GKE A;  1JHF A;  4XQF A;  3WOD F;  4XKV A;  1G4D A;  3ZP5 A;  3CCU I;  2C6Y A;  2UXN A;  2R93 J;  3PVH A;  2QQA A;  3A4C A;  2L7M P;  4OAY A;  3KEY A;  2OV7 A;  1B6A A;  2L01 A;  3Q3S A;  2VI6 A;  2P4W A;  1RPW A;  4C3I J;  1WHU A;  1LFB A;  1OR7 A;  2P5K A;  4YFX F;  2XIG A;  2EFW A;  3I58 A;  3A0B C;  3S1Q J;  2HYF A;  2BXZ A;  5E18 F;  1NK3 P;  1FC3 A;  1QO0 D;  2NOJ B;  1EH6 A;  1SVO A;  1HKS A;  1ZAR A;  4XON A;  3G6E I;  3DEW A;  1Z6T A;  5IOY A;  3E6M A;  1WH5 A;  1J2X A;  5H20 A;  1XSX A;  4G6D A;  3HGY A;  1C0W A;  3W2A A;  2Q2E B;  1OJL A;  1OYW A;  1YRN A;  4F3Q A;  4K7X A;  2E1N A;  2GIV A;  1K83 J;  1U8B A;  1WQ2 A;  2JUC A;  5HNH A;  4BE1 A;  4U0V A;  3AFH A;  3OY9 A;  2ZXJ A;  3QP6 A;  2Z33 A;  3N4M A;  2QF7 A;  3QPL A;  4M9Z A;  3KYC B;  2EZK A;  5LGT A;  3L1P A;  4OIO F;  4ZYH A;  2HOE A;  2HI3 A;  2M4K A;  2STT A;  1W7P A;  3DLA A;  3M7G A;  2A69 F;  3HRU A;  2M4G A;  1M1E B;  2JA5 J;  2LKX A;  2QLZ A;  1HOM A;  3N05 A;  4M3G A;  4XN3 A;  5ILV A;  1QHH D;  2Y48 A;  5JVT A;  3G71 I;  2GWR A;  2ME0 A;  3H3U A;  3LSM A;  4BAY A;  3CD6 I;  3E5Q A;  1K6Y A;  1WPK A;  3O8G A;  1DQU A;  1G6N A;  3A03 A;  1Z3Y A;  2XF7 A;  3HEF A;  4RGR A;  2IA1 A;  2HQ5 A;  2LVS A;  3G1M A;  5DM7 F;  3IRR A;  1HCR A;  2KQR A;  2Y0M A;  3CF5 F;  2CGP A;  1VQP I;  2Y0S N;  4A6E A;  4OAZ A;  1U0J A;  3L9F A;  4ETS A;  1FNN A;  3PL8 A;  3TO9 A;  3G98 A;  3OYA A;  5FLV A;  1WJD A;  2A61 A;  2ICW G;  1JT6 A;  3DU5 A;  1HDD C;  2K9M A;  2FQ3 A;  4MEY F;  2DFF A;  4GGG A;  3F8N A;  1I1G A;  2KKO A;  2XPU A;  3S17 J;  1ACI A;  1MMG A;  3JRC A;  1MMA A;  1R5I D;  4NUB A;  2K4B A;  4GRI A;  1BR4 A;  1KQ9 A;  4LOC A;  3FMQ A;  4I0A A;  2DOD A;  3DU6 A;  3J7Y J;  4RM2 A;  4LLN A;  4G7H F;  2E36 A;  4AWX B;  1A04 A;  1V55 H;  2FX0 A;  5LGN A;  1W0T A;  1MBF A;  3AG1 H;  1KU7 A;  1T0F A;  3GW2 A;  1IV6 A;  1XGO A;  3GZ6 A;  2XC7 A;  2XPW A;  2JTV A;  2O61 A;  4XRM A;  1J59 A;  3J81 Z;  2WWY A;  1UB9 A;  2EFP A;  3OYB A;  3HIF A;  4I76 A;  2PX9 A;  4G9Y A;  3ZMU A;  1U1W A;  4HRI A;  2CQ7 A;  4XIC A;  1U5T C;  3GFM A;  3BJ6 A;  3FHN A;  3BDD A;  3IKT A;  2CFX A;  1KU2 A;  3GTP J;  4A5M A;  2X6X A;  1RR8 C;  4G12 A;  3P5J A;  1SD6 A;  1IDY A;  2W48 A;  3LSJ A;  3S16 J;  3C2B A;  4YRV A;  1IUF A;  2L9N A;  1V54 H;  3E6B A;  2VC0 A;  3CCE I;  3H3Z A;  3KP7 A;  3RTR A;  1RNL A;  1YJ9 I;  4A3G J;  3EUH A;  3T8T A;  2YPR A;  2AXT C;  1H8A C;  1BR2 A;  2DQL A;  1IXC A;  3OS2 A;  3MEX A;  2F4O B;  2Z9O A;  1MSE C;  2IP2 A;  4M3B A;  3FBI B;  2QBY B;  1N75 A;  2WAD A;  2A07 F;  2QYO A;  6PAX A;  1IRF A;  2JQ7 A;  1B59 A;  1D8J A;  4O5V A;  2K02 A;  5M47 A;  4M3F A;  4RPA A;  4PK4 A;  3S2W A;  3ZQQ A;  4ZYG A;  3OYD A;  1JGG A;  1YFH A;  1I1S A;  4XLA A;  4E7I A;  1K20 A;  3QYF A;  2KZG A;  1ZK8 A;  3H36 A;  5ILU A;  1JUM A;  2LSO A;  2OQG A;  4XLC A;  3HUG B;  3LQQ A;  1P6R A;  5IYB J;  3UKG A;  2FSW A;  4JBD A;  1JUP A;  1HC8 A;  1IO2 A;  4AID A;  1BJZ A;  3PO2 J;  3VSK A;  1K23 A;  3BG7 A;  5GP9 A;  4B43 A;  2UXX A;  1SD7 A;  3C7J A;  4A3J J;  4CDG A;  5HNF A;  4NHJ A;  4AYB A;  3BR3 A;  3ZQH A;  3KCC A;  3CJQ B;  1KZH A;  2CFO A;  1X3W B;  4DGW B;  2JPC A;  1U3E M;  1ETY A;  2VXD A;  3QYE A;  4NQW A;  4B8X A;  1TNS A;  3TP0 A;  2L5Q A;  2GA2 A;  2EV5 A;  2MH9 A;  5E3L A;  4PZJ A;  5BPD A;  2QB6 A;  4DOZ A;  2R4G A;  4BUP A;  5HS9 A;  3W2V A;  1B72 B;  4OIR F;  1W36 C;  1P4X A;  3SXY A;  3V7C A;  5CQG A;  3F9K A;  2Z1D A;  2IJL A;  3X2Q H;  4E7K A;  3KLO A;  1SDJ A;  1V3F A;  4DYR A;  3ZQC A;  1IRG A;  3HG9 A;  3TDZ C;  3G1L A;  5E8I A;  1JKO C;  4OWR B;  4Q47 A;  4X1E A;  3JRI A;  2R7D A;  1BIA A;  2GAU A;  2WC2 A;  1BM9 A;  3CP2 A;  2CRG A;  4B4C A;  1A36 A;  1IV8 A;  3A2K A;  1VQ8 I;  3EDP A;  4W1U A;  2JK3 A;  2X6Y A;  4CCL A;  1NH3 A;  3JSP A;  2KJB A;  2XKO A;  1K6O A;  4K7G B;  2VN2 A;  1WI3 A;  4EGY A;  4WX9 A;  3NEU A;  2QCO A;  4KMF A;  3MKZ A;  2HXI A;  2PMZ N;  3R60 A;  3T1B A;  2A3S A;  2LFB A;  1I27 A;  2XB0 X;  4V2G A;  2VB6 A;  2LBF A;  1X1P A;  3AAF A;  1Z7L A;  2E2J J;  2DYS H;  4ENK A;  5FKL A;  2BXY A;  2D1V A;  1OR7 C;  1X4O A;  3JRH A;  2GBY A;  1Y1V J;  4ENM A;  2MH2 A;  1X1D A;  3BLY A;  3ZQ7 A;  3GTG J;  3I55 I;  1CF7 B;  1U1X A;  4XOT A;  2B0L A;  2YSR A;  4XSX F;  3VYR B;  2EIN H;  4E6K G;  2R7V A;  4MFE A;  3HJE A;  4JX4 A;  4CIC A;  4HQE A;  2A6E F;  3NAR A;  4GFB A;  5FLX K;  3BG3 A;  3LNQ A;  1OYY A;  4FT8 A;  1GT0 C;  4NC8 A;  3FWE A;  1R23 A;  2OZ6 A;  1WJC A;  4J9W A;  2OD5 A;  2EH3 A;  3HGG A;  1D0Z A;  4U0W A;  4XLF A;  4G7Z F;  1Z91 A;  3KYD B;  2F5F A;  3S3M A;  3C18 A;  1GXP A;  1I74 A;  2CW7 A;  4MHG A;  1S3J A;  3QQA A;  2FD5 A;  4I09 A;  5HS8 A;  3CTA A;  3FKI J;  3L2Q A;  2PVZ A;  3MKL A;  4CCM A;  3RDI A;  5DEQ A;  3CO7 C;  5KCM A;  4BL0 B;  5L3C A;  2CV2 A;  1R4N B;  5F08 A;  1AHD P;  1QBJ A;  2DMQ A;  1N25 A;  2Z2S B;  4Y17 A;  3EJX A;  5A2Q Z;  1SEU A;  2K5C A;  2FOW A;  3WTW C;  4EAT A;  3S2D J;  3OL3 A;  2DN0 A;  4HW0 A;  3WTZ A;  4JX6 A;  2DYR H;  4P5O A;  3TBI A;  1LUJ B;  2XKP A;  3ABU A;  3I0T A;  3K2Z A;  5HLI A;  4LFU A;  1S29 A;  2NVX J;  4MTD A;  2CS3 A;  5C44 J;  4II2 A;  4BE2 A;  4UUV A;  1BA5 A;  2AO9 A;  4Q60 A;  4KNY A;  2E1M B;  4S05 A;  3SDG A;  3QOE A;  2IS1 A;  5IP9 J;  2XAF A;  2Y69 H;  1O3T A;  1KGS A;  2V1N A;  3DKY A;  2BHZ A;  2XAH A;  2LRD A;  4HZF A;  5DD4 A;  3ASN H;  5K7H A;  1E17 A;  2CQX A;  2AS5 F;  3BQZ A;  4LJZ F;  4DBR A;  1B8I B;  4OOI A;  3WTX C;  5IYD J;  2R7U A;  1XB4 A;  3IP4 B;  4IJA A;  4B48 A;  1UAA A;  5DTD A;  3GX4 X;  3S14 J;  3EYI A;  1SMT A;  1FYK A;  4QTR A;  1JJ6 C;  4CZZ A;  3H1C A;  2M9H A;  2HVS A;  2DTZ A;  4HBL A;  3G1O A;  3EET A;  1SC7 A;  3RYP A;  2R7R A;  1P4W A;  2ISY A;  2JRM A;  3P9C A;  2PJR A;  1ZGW A;  1TT5 B;  4PGH A;  1FJL A;  1H9G A;  4UXN A;  1DGR M;  2GLO A;  1MBE A;  1YX3 A;  3FBN B;  4YEJ A;  1AKH B;  1E3H A;  2HVR A;  2O9L A;  1XGS A;  1ETW A;  4Q5S F;  2IEK A;  3WHC A;  3ELK A;  3RKY A;  3FM3 A;  4V2F A;  1QY9 A;  2PFB A;  5E3M A;  1PDN C;  2GXG A;  2DTR A;  2RRE A;  2RVC A;  3BP8 A;  4BHC A;  2M7B A;  1MJA A;  4E4H A;  2F5E A;  2DT6 A;  2MYS A;  4D5F A;  3KP3 A;  1HW2 A;  3BT9 A;  2MC4 A;  3F8C A;  2QQB A;  3MQ0 A;  2L7F P;  4LB6 B;  1T39 A;  2JWT A;  3K4C A;  4PJM A;  2NVY J;  2XB5 A;  3JAM K;  1UCR A;  3Q0U A;  1UHM A;  1ZLK A;  1OKR A;  1TLH B;  4XKB A;  3JSO A;  4RAY A;  3MZ8 A;  5GPC A;  4AD9 A;  1JGS A;  2GIZ A;  2WAQ A;  3VSL A;  2XAJ A;  3HOT A;  3K9T A;  1DU0 A;  4IRG A;  4PJJ A;  3LMM A;  2BGC A;  2V1X A;  3K4L A;  4C3J J;  3IH3 A;  5LRS A;  5E3N A;  3EPZ A;  2EIL H;  4BU2 A;  3CUQ B;  3BPX A;  2VJ5 A;  3DFG A;  2DT7 B;  2R5Y B;  4NC7 A;  1UG0 A;  1G3S A;  1RKW A;  1PJR A;  3ABL H;  2K9S A;  3F8B A;  2K9N A;  2QKL B;  3E7L A;  4PJN A;  2L9V A;  2EIM H;  1SD5 A;  2W4S A;  4M9X A;  4DQ2 A;  3CDL A;  4FAS D;  3GVA A;  2W00 A;  3Q9V A;  3K0L A;  2R7X A;  4MEX F;  2JSP A;  5F6F A;  2DU9 A;  4HSR A;  1E0E A;  1I5Z A;  2EZH A;  5B1B H;  3LAJ A;  1JKP C;  2VBX A;  4U7B A;  3ABT A;  4ZDP A;  3ZPL A;  4RLQ A;  4GYG A;  2ZME A;  3W6V A;  1RC9 A;  3JAM Z;  2ELJ A;  2G9W A;  1XMX A;  4KIB A;  1HBX G;  1X2M A;  2YU9 J;  4ENN A;  2BEO A;  2LDU A;  4A2U A;  3RQ4 A;  3U1D A;  4X6A J;  3IV5 A;  1T98 A;  4RAF A;  3I4M J;  3K4M A;  1MNM C;  2X0L A;  3U1K A;  3OS1 A;  3B6A A;  1HSJ A;  4XRS A;  2PBI A;  3N97 A;  1N77 A;  3KYL A;  2H8R A;  5E1W A;  3J7A O;  4XSZ F;  1QVU A;  1OYI A;  1XTA A;  4G8X A;  3CZ6 A;  4E7Z A;  1DPR A;  3EKM A;  2QVO A;  1VF9 A;  4BQN A;  1ZH5 A;  2XGD A;  2QEN A;  5J1R A;  3M3Y J;  5EGO B;  2GQQ A;  4A3L J;  3M8J A;  3ZMD A;  2B63 J;  2CUF A;  3T5X A;  3I59 B;  3KEO A;  1FTZ A;  3BG5 A;  1ZRE A;  2M30 A;  4ITV A;  3VYT B;  2VOP A;  2K86 A;  2W84 A;  3PNT A;  4UVA A;  5K5O A;  3DXJ F;  2H1L A;  3ZN0 A;  1O3S A;  3M8F A;  3KZY A;  3PNV A;  1O57 A;  5HOD A;  1LE8 B;  4HLY A;  1USS A;  5KNL A;  3HPH A;  3VOE A;  2VC1 A;  5GAD J;  3ZRG A;  3WGG A;  4ZDL A;  2FEZ A;  2LMD A;  3DEU A;  4IJZ A;  4GYI A;  2HTJ A;  3CQZ J;  4I6Z A;  4FHT A;  2XSD C;  4HF1 A;  4UUS B;  4AYB N;  2ID3 A;  3R6S A;  1OCT C;  3Q0W A;  3GXO A;  2CJJ A;  2ELK A;  3K1M A;  2JT1 A;  3ISP A;  3RJP A;  5K5R A;  3G4S I;  2G0E A;  4B09 A;  2VT3 A;  2CV0 A;  2ZXP A;  3VPR A;  4ZDO A;  2TRT A;  3S3O A;  1Q1V A;  1J0R A;  3REO A;  2GM4 A;  1EJ9 A;  1ETO A;  4YFK F;  3P9K A;  4DBQ A;  5E3O A;  1ZRF A;  4F7Z A;  1PP7 U;  2Y31 A;  1ZGJ A;  5BOX A;  1P92 A;  1JJ8 C;  5CKT A;  2RNG A;  4HST A;  1IJW C;  5GAG J;  2DA4 A;  4MO7 A;  3I3L A;  5EJC A;  2YX7 A;  3CJR B;  1PP8 F;  3DQV C;  1BOA A;  2R5Z A;  1ODD A;  2K3P A;  4L9J A;  3KZZ A;  1YG2 A;  3MCZ A;  2IS6 A;  2HDC A;  1IXS B;  3OS0 A;  4IVN A;  2HXO A;  4ASN A;  1UEL B;  3D5R C;  4C9Y A;  3ZR8 X;  1G3W A;  3DTK A;  5DCM A;  2K9Q A;  2XAU A;  1QZY A;  3S8P A;  3OSG A;  2LY2 A;  3WHB A;  4BAC A;  4ZZL A;  2DA3 A;  1X1A A;  3TMO A;  4ZJZ A;  5HA4 A;  2DW4 A;  3S93 A;  2HZD A;  4JX5 A;  2V1U A;  5D4R A;  1U6G A;  3I9V 2;  3BZ6 A;  4A3F J;  1FYM A;  2L7K A;  2CG4 A;  1XCV A;  4LLG F;  3A01 B;  4QPO A;  1HDP A;  1I50 J;  3P9I A;  2O03 A;  3PFY A;  4WF2 A;  4IHT A;  1W4M A;  4B1R A;  3I53 A;  2VAS A;  2FE3 A;  1AKH A;  5L3F A;  1F9N A;  2HR3 A;  2KPM A;  4MQV A;  3KE2 A;  4HOB A;  4XNF A;  3JR9 A;  2OC6 A;  1WZ2 A;  2LR8 A;  4BJ6 C;  2DXI A;  5EZH A;  5EZG A;  3D5S C;  3E5X A;  4HYE A;  1AOY A;  1TZL A;  3F21 A;  1D0X A;  2HNH A;  2AQE A;  2WBM A;  1U8R A;  5JLW A;  4WCG A;  3G7K A;  4IHS A;  4RA2 A;  3E6C C;  3O8H A;  2UZK A;  4FET A;  4CO8 A;  1R1U A;  2HAW A;  3MD2 A;  4IL6 C;  5ICF A;  4M3D A;  5M3F J;  4IHX A;  2ZXR A;  2LNB A;  2PI0 A;  3Q0V A;  1ON1 A;  1DU6 A;  1MDM B;  2D1H A;  2Z5U A;  4EJO A;  2KW7 A;  2X1E A;  3U2R A;  2EB7 A;  4A3K J;  2AZP A;  2YU3 A;  1OCP A;  4LD5 A;  4XR6 A;  4M71 A;  4L9T A;  2HQN A;  3ECO A;  5FRN A;  2FNA A;  5K7F A;  3FMS A;  3CJN A;  1UG2 A;  4L9N A;  5IPA A;  5LLQ A;  4YIF A;  5AIP A;  1QZE A;  1EH8 A;  4I99 C;  4E7L A;  2IS2 A;  4QWQ A;  4MLO A;  1FWZ A;  3GLL A;  1F36 A;  5E1Z B;  3B73 A;  3F6O A;  4LMY A;  1XUB A;  4HA8 A;  1OQY A;  1YJN I;  4L5E A;  1FT9 A;  2FF4 A;  4NC6 A;  1XSV A;  1MW7 A;  1Z67 A;  1FMW A;  3BCA A;  3ICJ A;  3BQY A;  2WY7 Q;  2GOM A;  4N9H A;  3W6K B;  2NNY A;  4KJZ A;  4UV8 A;  5EEH A;  3TED A;  3JRG A;  1YX5 A;  2ZKZ A;  1VQL I;  3TP3 A;  2KMU A;  1RI7 A;  1E3O C;  1RUO A;  3MKY B;  1T08 B;  3W2W A;  2IAI A;  5C4J J;  1X1C A;  2XDV A;  1U9N A;  2JSC A;  2L3D A;  4BY1 J;  2F2E A;  3GTM J;  1ITY A;  1YLF A;  5M5X J;  4XBF A;  2RV8 A;  3CMY A;  2K85 A;  2E2H J;  4KIS A;  2AHQ A;  3OYF A;  2HPM A;  2EV6 A;  2F5V A;  4IOA F;  2AXL A;  3QAH A;  3GTQ J;  2AQF A;  2E5N A;  1P4A A;  4P1W A;  4Y33 A;  4Y3O A;  4JOM A;  3NWT A;  4HF0 A;  1Z9C A;  2ID6 A;  5TJJ A;  4DZP A;  5CQE A;  2UV1 A;  1GLN A;  2IGK A;  3A1Y A;  3QOP A;  2EA2 A;  2EBI A;  3OYK A;  3RPQ A;  2ZXH A;  1QZZ A;  2WY8 Q;  5JI6 A;  4EM0 B;  4ESJ A;  1LQ1 A;  3MN2 A;  2R7T A;  4B47 A;  1QGP A;  3ZQG A;  2ZME C;  3MMY B;  4BGD A;  3HKZ A;  1SAX A;  3R61 A;  2L4M A;  2Q0O A;  3SHF A;  3NAU A;  2TCT A;  1IDZ A;  2BBY A;  1FIP A;  1KU3 A;  2D2W A;  4XLN F;  2EZI A;  3K1N A;  4DYQ A;  3OSF A;  3BCB A;  5BQT A;  4FX0 A;  5FD6 A;  1W61 A;  3PQK A;  3V8K A;  4DYC A;  5AIQ A;  3GZN B;  1F1Z A;  1LDD A;  3ONQ A;  1BI0 A;  1ETX A;  2KHM A;  3RCO A;  3TGN A;  4ZYD A;  2WAQ N;  2LF7 A;  4EVI A;  3L2V A;  3E97 A;  1B4A A;  2OAZ A;  3H92 A;  3K4K A;  2ZJR F;  4O6J A;  1MMS A;  4BQQ A;  5LRR A;  2XAG A;  1S8N A;  2YUS A;  3LA7 A;  1SAU A;  3NRV A;  1GV5 A;  4E7H A;  5FKM A;  3H5N A;  2MLG A;  4DJA A;  4P96 A;  3UNG C;  3S2H J;  3PJR A;  1I3A A;  3OYE A;  4BHB A;  3HDD A;  1TTY A;  3OYM A;  1FBU A;  1FX7 A;  3ZMZ A;  3LSR A;  3TQN A;  2EFN A;  4KT5 C;  1H0M A;  2V6C A;  3SDB A;  1YHQ I;  4KMU X;  4DZJ A;  3R0J A;  2BOL A;  4K8L A;  4CYD A;  1HST A;  2JVG A;  2DMP A;  4XLP F;  3GO5 A;  3BPV A;  2I5U A;  4P9F A;  2VKV A;  4II3 A;  1Z6R A;  4N4N B;  2OTL I;  3HZJ A;  5D6F A;  4XMY A;  1ZTR A;  1UMQ A;  3GZ5 A;  3C2H A;  3JRE A;  4PJL A;  2L0K A;  3KZI C;  2RKH A;  1V5E A;  1Y56 A;  2HQR A;  3IGH X;  2LD5 A;  2UWM A;  2M8G X;  3L7W A;  2JA7 J;  1HA8 A;  1H88 C;  4MFD A;  4HNU A;  3J7Z I;  4O3M A;  2MSY A;  3FK6 A;  1TC3 C;  4JK1 X;  2N8G A;  1JE8 A;  4A3C J;  3CCY A;  1RES A;  4BHP A;  3A01 A;  5GTI C;  1LNW A;  2ZO4 A;  1FP1 D;  2MAB A;  4RB1 A;  1IAW A;  1TM0 A;  2EPF A;  1WJA A;  3JRA A;  1FZP B;  2A5Y B;  4IRH A;  1U9O A;  1SFE A;  2CO5 A;  1YIT I;  1TWH J;  1XCB A;  4A3B J;  4UV9 A;  1KYW A;  3HOV J;  3FIS A;  2MW8 A;  2HS5 A;  4BEH B;  3QPS A;  2E1M C;  2IXS A;  4CUG A;  5ANP A;  1DGW Y;  2L9R A;  4KN4 X;  1TWG J;  1QVT A;  3GCM A;  3LL7 A;  3WTU C;  3MKW B;  4AVZ A;  2BYV E;  2OTJ I;  2IT0 A;  1R9T J;  1R71 A;  1YQA A;  1WH7 A;  1Z77 A;  3DTE A;  2D45 A;  2OQR A;  2E7W A;  4OMZ A;  4V19 K;  3ZMT A;  2W24 A;  3GFI A;  1S6L A;  2Z99 A;  1H89 C;  4HG2 A;  1K78 B;  4P55 A;  2MC3 A;  1S5L C;  3HOX J;  3V8L A;  1MMD A;  3QOD A;  4NNJ A;  5C3E J;  1ZRD A;  4Z6Y A;  1K4S A;  4C2T A;  3BZK A;  2GXA A;  1TNT A;  2LG4 A;  3QPH A;  4ZTF A;  1OPC A;  2Q2E A;  5DUK A;  1FOX A;  2VKD A;  2IGN A;  1VZ0 A;  5KK1 A;  2OF7 A;  1A5J A;  2Q9J A;  2I10 A;  3H35 A;  1Y39 A;  2HPI A;  3MWM A;  4U87 A;  5E8G A;  1WJ5 A;  2K9L A;  1T33 A;  3ASO H;  3BJA A;  2DI3 A;  2H8W A;  1RIO H;  2MFZ A;  1R00 A;  2DMN A;  3ML6 A;  3SFI A;  2F6C A;  5L3E A;  3AL0 C;  4J19 A;  3LSG A;  2QEX I;  2OUM A;  2VQL A;  2B9S A;  1XS9 A;  1U0K A;  4BDZ A;  5IWE A;  3PQJ A;  2BVM A;  1X58 A;  5HS7 A;  1Z05 A;  4L0Z B;  1OFC X;  2IBD A;  5JVG F;  1U5T B;  3BY6 A;  4H0E A;  1R7J A;  3EUK L;  2DFE A;  2FOK A;  1TWA J;  2IW5 A;  2Y9Y A;  4R79 A;  1IG7 A;  1ORK A;  3F72 A;  3I56 I;  3CCV I;  5CVJ A;  3WTV C;  3CO6 C;  5H6Q A;  2W57 A;  2NS8 A;  3ERM A;  3TDU C;  1G59 A;  4A3M J;  1LEB A;  1ZAO A;  2CW8 A;  1BL0 A;  3RKX A;  1YW8 A;  4IXA A;  1Y8R B;  4CYC B;  3CME I;  2KP6 A;  4A93 J;  4IHV A;  4GL6 A;  4KUM A;  2OA4 A;  3S1M J;  3SQN A;  1ZG5 A;  2EIK H;  1TT0 A;  2ZCW A;  2M0M A;  1L3L A;  5GPA A;  4D7N A;  2LLK A;  4OMY A;  3RPU A;  3R4K A;  1REP C;  3HXL A;  1EF4 A;  3RSN A;  2KL4 A;  2ZXO A;  4L5I A;  1YS6 A;  3FDY A;  3FMR A;  5H2Y A;  4CSW A;  2BW3 B;  3IWZ A;  5EG0 B;  5D8L B;  2V4J C;  2M8E A;  3B02 A;  3DPT A;  1K61 A;  2KIQ A;  2NXN B;  4UHT A;  2F48 A;  5FRO A;  3OYH A;  2HOA A;  3L2U A;  2VQH A;  3GTO J;  2ISZ A;  4XK4 A;  2CUE A;  4D9J A;  4RLF A;  5LFA A;  1U78 A;  5B1A H;  2EB0 A;  2CUJ A;  4OU0 A;  1RZ4 A;  3K69 A;  3EQL F;  4QIW N;  1VQ9 I;  1PUF B;  5FLX Z;  4DIQ A;  3IH2 A;  5J4V A;  5C4X J;  2JA6 J;  2FNP A;  5CYV A;  3SZG A;  2JA8 J;  3K4J A;  4ZH4 F;  1FYL A;  3Q5F A;  3W5W A;  2EIJ H;  3A0H C;  4DW6 A;  1WCM J;  3CDI A;  2ADU A;  1T6S A;  4F93 B;  3V8J A;  2VPR A;  2X51 A;  2XAQ A;  5E17 F;  3FXR A;  5H2G A;  4YII A;  1QU3 A;  1WJE A;  3JCU C;  5F0H A;  5J1Y A;  3TOA A;  2VLA A;  4IQ4 A;  4XM3 A;  1UHS A;  3DV8 A;  4KIG A;  3SEZ A;  4J01 A;  3G3Z A;  1E3P A;  2PW0 A;  4LLL A;  2O5R A;  4LG0 B;  3WTS C;  4BH9 A;  4MNU A;  3W6J B;  3L00 A;  1I3Q J;  3BR5 A;  1SVM A;  5LD2 C;  3WE3 A;  1D3Y A;  1T8I A;  3OYJ A;  3OYN A;  4BXF A;  3BRO A;  4L0Y B;  4S04 A;  1BOB A;  1JKQ C;  4EMS A;  2VUM J;  4RAG A;  1SFX A;  1T95 A;  5JR3 A;  2QBY A;  2WV1 A;  1XG1 A;  1S7E A;  1VND A;  3OIO A;  4RB0 A;  3RKQ A;  4ZYA A;  1ZEL A;  4ESF A;  2FRH A;  3WTT C;  5IOZ A;  3BTC A;  3IHU A;  1QNT A;  2HOS A;  2H94 A;  3OWT A;  2CV1 A;  3LSH A;  5IT3 A;  1F5T A;  1PYV A;  2WAF A;  3BOQ A;  3UR3 C;  3HUG A;  1QPI A;  2L02 A;  1RUN A;  2CU7 A;  5FKK A;  2VJI A;  3JRD A;  1U2W A;  4AIJ A;  2VJJ A;  3QYB A;  5B5E C;  3KX2 A;  4DUN A;  2VIX A;  2GA1 A;  2OU2 A;  1JI8 A;  4WXC A;  3AG2 H;  2NOG A;  1IW7 F;  2RAE A;  2E1C A;  4GCV A;  3GEZ A;  4N0B A;  2Y9Z A;  3V42 A;  3I4N J;  1KQ0 A;  2PMH A;  4Y52 J;  2YMA A;  2FMY A;  5FGM A;  3ZXS A;  2DJN A;  1FSE A;  1LVK A;  5J6X A;  2A68 F;  1G2H A;  3R0A A;  5IYC J;  3ERE D;  2P7V B;  2Q8K A;  1MH4 A;  2DFI A;  2E34 A;  3OMY A;  4Y7N J;  4HF2 A;  2WA0 A;  5F0F A;  4BEH A;  4IHY A;  3HKZ N;  1BW6 A;  2QWW A;  2RQQ A;  4HQM A;  3BZC A;  1I39 A;  4BBR J;  3QWL A;  2X85 A;  3DBR B;  1B72 A;  3F8M A;  2Z16 A;  1ONV A;  3MZH A;  1DDN A;  1W62 A;  3CMM A;  1YRN B;  3S15 J;  5GAE J;  4HNV A;  3F0C A;  5JFR A;  4IK0 A;  2XGE A;  1HQC A;  3BJO A;  3V7R A;  1J75 A;  4RB2 C;  3TKY A;  3GTK J;  3CMA I;  2DK8 A;  4YFN F;  1LVA A;  2LKP A;  1WPM A;  2XHK A;  3IC7 A;  3HSF A;  5J40 A;  5FLM J;  4BYY A;  1YW9 A;  1HKT A;  2K4J A;  1RRJ A;  2X6W A;  2DMU A;  1X2N A;  2ZNY A;  2JA2 A;  1W7P B;  1FMV A;  3LSP A;  4ZC3 A;  4AUX A;  4JCI A;  2NS0 A;  4AC0 A;  5L3B A;  3HOZ J;  2X4H A;  2LT2 A;  2HZT A;  2CQK A;  5BS6 A;  4ANJ A;  3DTI A;  3DWL E;  1ZGA A;  5J3L A;  3C2G A;  4UVB A;  2VPL A;  1OIS A;  2E35 A;  5AON A;  1YOV B;  2KIM A;  5F27 A;  3M1E A;  1MD0 A;  5B66 C;  1S7A A;  1IN6 A;  1GVJ A;  2J5P A;  2EV0 A;  2M45 A;  2QQ9 A;  1XGN A;  2COB A;  3OYC A;  5CLS A;  3VWB A;  1LB2 A;  5CVV A;  2XRO A;  2MGQ A;  4KFC A;  1ON2 A;  3RQI A;  2ZBK A;  4UB8 C;  4D0P A;  5LHG A;  2IS4 A;  3PUF A;  4YG2 F;  1FOY A;  3HRM A;  1EV7 A;  2O3F A;  1CF7 A;  4XL9 A;  1R4M B;  5TIS C;  3COA C;  2M7A A;  4LGW A;  3MFK A;  2L2O A;  2I8D A;  1NK2 P;  4RM3 A;  5F0C A;  2IRF G;  3JTG A;  3F3X A;  3CCL I;  2E1O A;  3VOD A;  4C2U A;  1QRY A;  2FBI A;  4S0H B;  5DD8 A;  1J7K A;  3K4N A;  1IZ1 A;  3GME A;  1O7L A;  5ERI A;  1IXR C;  3TL4 X;  3AKZ A;  2M2E A;  3HL2 A;  5D4S A;  1D1B A;  2P81 A;  1MGT A;  4W97 A;  2LC2 A;  3S3N A;  3AG3 H;  2H09 A;  5LHH A;  3K2A A;  2HWV A;  3HSE A;  4I0B A;  4F55 A;  4UB6 C;  5E79 C;  3FM5 A;  1VQO I;  2LYC A;  2R92 J;  1BWZ A;  2W25 A;  4OIQ F;  2MPB A;  2JRT A;  2E2I J;  1IN7 A;  1AA7 A;  3BR6 A;  2BW3 A;  4G7O F;  1RET A;  3FKJ A;  5DM6 F;  5EG0 A;  1G3T A;  3F23 A;  3CJT B;  2OTN A;  4TV7 A;  1MBH A;  3PO3 J;  2LY9 A;  3PM1 A;  3GFJ A;  3OYG A;  4JUU A;  5FFZ A;  5F1J A;  1I6X A;  3MAJ A;  3FXM A;  1GDT A;  1R5G A;  2E5Z A;  1FTT A;  4XRF A;  4Q2H A;  4Y4R A;  2W85 A;  3H9Q A;  1NG7 A;  2FUG 2;  1AWC A;  1GQZ A;  2M5W A;  1TWC J;  3HC7 A;  1R1V A;  1ULY A;  1YE9 A;  4OA3 A;  3BTJ A;  4YIR X;  3OYI A;  3KEQ A;  4JYK A;  2NAZ A;  3AG4 H;  3FVE A;  4RGS A;  2TDX A;  2KDZ A;  2O6G E;  1S9H A;  1KU9 A;  2E71 A;  2W82 A;  1B8I A;  3IAM 2;  2L4A A;  3J7A Y;  3BTL A;  4LS9 A;  4BY7 J;  3V7S A;  1VQ5 I;  5L3G A;  1IN8 A;  5FB2 A;  2QSH X;  4L18 B;  3EDN A;  1VFC A;  1N78 A;  1G8X A;  2M0C A;  3CF2 A;  1F43 A;  3D1N I;  3DBH B;  4J9X A;  4LIU A;  2QQ8 A;  3QPT A;  3OOU A;  4WWC A;  5HDK A;  5GAH J;  1OCZ H;  2ZFU A;  2HEO A;  5K7Z A;  1D0Y A;  3JW4 A;  4RMN A;  3K70 C;  1U1V A;  1Z3X A;  1YW7 A;  3WU2 C;  5DS9 A;  1FBS A;  2YR2 A;  1FOW A;  3SEQ A;  3DP7 A;  3ABM H;  2E7X A;  4HX4 A;  1BW5 A;  1ZKG A;  2JZY A;  2LF8 A;  5EF6 A;  2QGU A;  1PVE A;  1WJB A;  4PUS A;  1FPQ A;  3L09 A;  4XOR A;  3GUD A;  2MA3 A;  3OIQ A;  4CCN A;  2HGC A;  4EJW A;  4RGX A;  2CWE A;  1ZRC A;  3M1C A;  3FXQ A;  4AIH A;  4NDL A;  4LG3 A;  5F1R A;  3GTL J;  4NQW B;  4Q4Z F;  1X3U A;  3DPU A;  3DBL B;  3HBL A;  3RYR A;  3QU6 A;  2P7C B;  3IH4 A;  1STZ A;  1LDK B;  2XAS A;  2EJR A;  3IAS 2;  2VOD A;  4CCJ A;  5EEA A;  4CH7 A;  3TOB A;  3WG9 A;  2R7F A;  2P5L C;  2WB1 A;  1V5G A;  2IPQ X;  2KRH A;  4CA0 A;  3ZQL A;  1IR6 A;  3E0J B;  4EQQ A;  3DF8 A;  1FBQ A;  3CC4 I;  5H6R A;  2HQA A;  2DDA A;  2DJI A;  2VL8 A;  5E20 A;  4WXH A;  1ZG3 A;  2W1O A;  3FXL A;  4M73 A;  3DEE A;  5GTH C;  3BTI A;  3CUQ A;  2HOT A;  2R5Y A;  1JTX A;  3H9J A;  4M74 A;  1Z7U A;  4KT6 A;  2ESH A;  2X48 A;  1XN7 A;  5CVI A;  3OV8 A;  4UUT A;  2V6E A;  1IN5 A;  4HPQ A;  2OCE A;  3ZMV A;  4A0Y A;  2LP0 A;  4A6D A;  3K4B A;  2JPB A;  1GVD A;  2EFQ A;  3EYY A;  1MZB A;  5KHD A;  4I98 B;  4WK8 F;  1VQ6 I;  1WFX A;  2WAE A;  1RKT A;  3GTJ J;  2Q1Z B;  4P9U A;  5CJ9 A;  1POG A;  5IP6 A;  1B9N A;  2CQQ A;  3MVP A;  4BKX A;  3G2B A;  2LBF B;  2QM3 A;  4PFP A;  1YO5 C;  1V4R A;  4EV0 A;  3DLL F;  1SFU A;  3BR1 A;  4E7S A;  2E60 A;  2NVQ J;  3O6B B;  2GKJ A;  4LIT A;  4BQA A;  1HW5 A;  2EK5 A;  2V1D A;  2IA0 A;  4PJ0 C;  3PW9 A;  4EEF G;  2MD5 A;  1HXD A;  2VBZ A;  3TO6 A;  4Y13 A;  1BI2 A;  4QPQ A;  3WE2 A;  4XRS G;  4KIT B;  4BBS J;  1QYA A;  4D1Q A;  3BR2 A;  3TO7 A;  2EWN A;  1ERD A;  1UJ8 A;  2LY1 A;  5EGO A;  1I6H J;  2FJ1 A;  4I7H A;  2VE8 A;  2X6O A;  3I54 A;  3I59 A;  3FXJ A;  3M07 A;  3HTU A;  5DCF A;  3J81 K;  1S72 I;  2Q9H A;  1IF1 A;  1FLI A;  5IP7 J;  2XUB A;  2ME6 A;  3L2R A;  2JMW A;  4AM3 A;  2HU9 A;  2FU4 A;  4U88 A;  4OIP F;  3H5R A;  1J5Y A;  1HW1 A;  2RDP A;  5F04 A;  4KA4 A;  1LE8 A;  5BMZ A;  4IRI A;  2FQ4 A;  3O2P E;  1DPU A;  2V9K A;  4XOP A;  1VQM I;  1TWF J;  2K7L A;  3LOC A;  3WQZ A;  2FBK A;  2KDO A;  3FZV A;  5KAF C;  3F8F A;  4E70 A;  2F4M B;  2XRN A;  2STW A;  1E2X A;  2VOO A;  2ZXI A;  1W5S A;  3DPL C;  4N4O B;  2QA4 I;  4Y15 A;  3HRT A;  1A6Q A;  5EDN A;  5M5W J;  2DDB A;  3S1N J;  4UUS A;  2PQ8 A;  3ZQI A;  3GLX A;  4CZC A;  1XSD A;  1MJB A;  2R0Q C;  1SFK A;  1R1T A;  2YS9 A;  2LK2 A;  2DOE A;  2IVM A;  3KP4 A;  1XD7 A;  4B3A A;  5LHI A;  3E6D A;  3NQO A;  2VT2 A;  4IOC F;  9ANT A;  2DPD A;  3ZGK A;  4IF4 A;  3O3K A;  3WGH A;  3B6C A;  3VEP A;  1J09 A;  3T0Y A;  1R22 A;  2EZL A;  2DO7 A;  1O7F A;  2DT5 A;  1BI1 A;  5ILS A;  4ESB A;  2KPT A;  3PIO F;  3HOU J;  1MBK A;  2BY2 A;  3WTY C;  1UFM A;  3LFK A;  4QLC U;  2R7S A;  1XMK A;  3PIP F;  3BR0 A;  5D6E A;  2XGX A;  1WJF A;  4A0X A;  1Y1W J;  1HF0 A;  2EQR A;  1O4X A;  3L2C A;  2BY1 A;  2CSO A;  5BPI A;  1WI9 A; 
#chains in the Genus database with same CATH homology
 3OS1 A;  3OYH A;  1N77 A;  3L2U A;  2PJR B;  2VQH A;  3KYL A;  4D9J A;  4RLF A;  5LFA A;  2EB0 A;  2CUJ A;  3CZ6 A;  4E7Z A;  2IGM A;  5CPR B;  3EKM A;  3NWS A;  2NOJ B;  4BQN A;  4XON A;  3OR1 C;  3PTJ A;  3M8J A;  4DIQ A;  3SZG A;  3W2A A;  2Q2E B;  3K4J A;  4ITV A;  3VYT B;  4F3Q A;  3HOS A;  3PNT A;  4K7X A;  3W5W A;  3S32 A;  1Z21 A;  2ZSI B;  4F93 B;  2X51 A;  3PNV A;  1W36 D;  5H2G A;  1QU3 A;  5HNH A;  4BE1 A;  1WJE A;  2A5W A;  3AFH A;  5KNL A;  3HPH A;  3OY9 A;  4XKC A;  3ZRG A;  4ZDL A;  2V26 A;  2VLA A;  4IQ4 A;  4IJZ A;  4XM3 A;  4JQF A;  3LSI A;  3SEZ A;  4J01 A;  2PW0 A;  2O5R A;  2M4K A;  2CUZ A;  2UUZ A;  1MNE A;  3DLA A;  2M4G A;  5LD2 C;  3OYJ A;  3OYN A;  4BXF A;  1BOB A;  1P9Q C;  3N05 A;  1T95 A;  4XN3 A;  3DEV A;  1QHH D;  2CV0 A;  2ZXP A;  4ZDO A;  3LSM A;  3S3O A;  1YM5 A;  4ZYA A;  1K6Y A;  1ZEL A;  1DQU A;  1Z3Y A;  2XF7 A;  4DBQ A;  2GOX B;  2QB8 A;  2HVQ A;  2KQR A;  3OWT A;  2CV1 A;  4OAZ A;  5CKT A;  2RNG A;  1U0J A;  3LSH A;  4HST A;  2L9S A;  1PYV A;  2WAF A;  3UR3 C;  3PL8 A;  3G98 A;  3OYA A;  2VJI A;  3I3L A;  3CJR B;  3K6G A;  5HVQ C;  1WJD A;  2VJJ A;  3DQV C;  3QYB A;  3KX2 A;  4DUN A;  4C30 A;  3DU5 A;  2VIX A;  2K9M A;  2K3P A;  4BS9 A;  1JI8 A;  2BVL A;  2IS6 A;  3OS0 A;  3V42 A;  3PUB A;  1UEL B;  3D5R C;  4C9Y A;  2YMA A;  2ZVF A;  3ZR8 X;  3ZXS A;  3DTK A;  2MD0 A;  1MMG A;  2X1D A;  1MMA A;  1LVK A;  4NUB A;  2W7N A;  2XAU A;  1BR4 A;  4GRI A;  3S8P A;  2LY2 A;  4BAC A;  2DOA A;  5TGT A;  1X1A A;  3TMO A;  3DU6 A;  4ZJZ A;  4RM2 A;  3OMY A;  4XN0 A;  3U21 A;  5HA4 A;  3S93 A;  2WA0 A;  4BEH A;  2HZD A;  4BJ5 C;  2RQQ A;  1LFP A;  1XUA A;  2M3A A;  3I9V 2;  3GBG A;  2L7K A;  4XLH A;  2XC7 A;  2ENX A;  2X85 A;  2Z16 A;  4QPO A;  1W62 A;  3CMM A;  3OYB A;  3PFY A;  1U1W A;  4HRI A;  4IK0 A;  3FHN A;  1DP3 A;  2X6X A;  2VAS A;  4BE0 A;  3BG6 A;  1WPM A;  2KPM A;  3PSI A;  4BQO A;  2X6W A;  4XNF A;  2OC6 A;  4BJ6 C;  2DXI A;  2JA2 A;  4YRV A;  3D5S C;  1FMV A;  2L9N A;  1TZL A;  4ZC3 A;  3RTR A;  4JCI A;  2VQG A;  4PSW A;  1D0X A;  2HNH A;  2AQE A;  2WBM A;  3ZCO A;  2LT2 A;  1BR2 A;  1R6R A;  3OS2 A;  4ANJ A;  1MMN A;  3DTI A;  3DWL E;  3G7K A;  4E7J A;  3C2G A;  2VPL A;  3H0D A;  3FBI B;  4FET A;  1N75 A;  2WAD A;  3MD2 A;  2HAW A;  2ZXR A;  2QB7 A;  2IW4 A;  2X1E A;  3OYC A;  3VWB A;  2KW7 A;  5M47 A;  4RPA A;  4LIV A;  4PK4 A;  3ZQQ A;  5FRM A;  3OYD A;  2AZP A;  4XLA A;  4XR6 A;  5JHF A;  4E7I A;  2IS4 A;  1K20 A;  3QYF A;  2VKH A;  5FRN A;  3EUA A;  3HUG B;  4XLC A;  3LFU A;  4XL9 A;  4JBD A;  1S7J A;  4G6T B;  2M7A A;  2L2O A;  2I8D A;  3VSK A;  4RM3 A;  2VQC A;  3DKX A;  3BG7 A;  4B43 A;  1K23 A;  4E7L A;  4C2U A;  4IKF A;  2IS2 A;  4MLO A;  5HNF A;  2LRE A;  2F4I A;  4AYB A;  2ZSH B;  3CJQ B;  2R7O A;  1XUB A;  4HNT A;  2CFO A;  2JVH A;  3BC8 A;  3K4N A;  4DGW B;  3H9G A;  3TL4 X;  1BR1 A;  2VXD A;  3HL2 A;  1MW7 A;  3LSK A;  3QYE A;  1D1B A;  1FMW A;  3BCA A;  2LC2 A;  3ICJ A;  3S3N A;  2L5Q A;  2WY7 Q;  2GOM A;  4F55 A;  2LYC A;  4KJZ A;  2LH9 A;  1EA3 A;  4PFO A;  1BWZ A;  1YX5 A;  2QB6 A;  4DOZ A;  2R4G A;  4BUP A;  4IQJ A;  2KMU A;  2MPB A;  3CP8 A;  3MKY B;  3W2W A;  2A6T A;  2P0W A;  3AKZ A;  1AA7 A;  2Y0S A;  1IRX A;  3OIP A;  3W2V A;  2R7W A;  1X1C A;  2XDV A;  2BW3 A;  1W36 C;  3FKJ A;  2KLO A;  2VJ4 A;  2OTN A;  5CQG A;  3F9K A;  2Z1D A;  4E7K A;  3OYG A;  4JUU A;  3VYU B;  1SDJ A;  3HG9 A;  4KIS A;  2E5Z A;  4OWR B;  2XF5 A;  1T0F C;  3OYF A;  2HPM A;  2F5V A;  4Q2H A;  2JUG A;  3CES A;  4Y4R A;  3H5A A;  3H9Q A;  2FUG 2;  1NG7 A;  2AQF A;  2E5N A;  3E1S A;  1GQZ A;  3CP2 A;  4P1W A;  3HC7 A;  1X19 A;  1YE9 A;  4Y33 A;  4OA3 A;  4Y3O A;  4JOM A;  3OYI A;  3A2K A;  3NWT A;  1X1B A;  5CQE A;  2UV1 A;  2X6Y A;  1GLN A;  2IGK A;  3A1Y A;  4CCL A;  3FVE A;  2DCE A;  3AL0 B;  3OYK A;  4K7G B;  4IX7 A;  1S9H A;  2WY8 Q;  2ZXH A;  2W82 A;  2R7T A;  4B47 A;  3IAM 2;  3MMY B;  4B3X A;  3HKZ A;  4BGD A;  3MKZ A;  3J7A Y;  4LS9 A;  2VB6 A;  3EDN A;  2LBF A;  3W3C A;  3BCB A;  1Z7L A;  1G8X A;  3CF2 A;  3OL4 A;  1N78 A;  4J9X A;  1W61 A;  4LIU A;  3IUO A;  3OOU A;  3ONQ A;  3RCO A;  2KHM A;  3EUH C;  3HPG A;  2ZFU A;  1OR7 C;  1U1V A;  1D0Y A;  1X4O A;  4RMN A;  3K70 C;  1Z3X A;  1WPP A;  2H9F A;  3K10 A;  3L2V A;  3BLY A;  1X1D A;  1U1X A;  4XOT A;  3VYR B;  4E6K G;  3D5L A;  3K4K A;  3SEQ A;  2R7V A;  1Y6I A;  3VDX A;  4HEA 2;  4BQQ A;  4JD7 A;  1SAU A;  1LKX A;  4NC8 A;  4E7H A;  1T6K A;  3H5N A;  1WJB A;  4DJA A;  1WJC A;  4PUS A;  4XOR A;  4YEL A;  3UNG C;  4J9W A;  3PJR A;  3OIQ A;  4CCN A;  1D0Z A;  3OYE A;  4XLF A;  3OYM A;  3M1C A;  2QKM B;  4LG3 A;  3S3M A;  1I74 A;  4NQW B;  2CW7 A;  2X1C A;  3DPU A;  4F52 A;  5HLT A;  3SDB A;  1LDK B;  2BOL A;  4K8L A;  3L2Q A;  3IAS 2;  4CCJ A;  2PVZ A;  4CH7 A;  2XF6 A;  2JVG A;  4CCM A;  1NG6 A;  2WB1 A;  1V5G A;  2KRH A;  4XLE A;  5KCM A;  4BL0 B;  4CA0 A;  2CV2 A;  3E0J B;  1IR6 A;  4II3 A;  2CMP A;  2Z2S B;  4N4N B;  3EJX A;  2HQA A;  2DJI A;  2VL8 A;  2K5C A;  4XMY A;  4F91 B;  3C2H A;  4EAT A;  4PJL A;  3OL3 A;  2W1O A;  1V5E A;  1Y56 A;  3DEE A;  4P5O A;  3IGH X;  3TBI A;  2UWM A;  4PY9 A;  3H9J A;  4XKW A;  1HA8 A;  4KT6 A;  4HNU A;  2CS3 A;  4II2 A;  4BE2 A;  4AU7 A;  4Q60 A;  2E1M B;  1D1A A;  3QOE A;  2IS1 A;  2V6E A;  4HPQ A;  2MAB A;  2V1N A;  3DKY A;  1TM0 A;  2LRD A;  3K4B A;  1WJA A;  2CH0 A;  4IZZ A;  5KHD A;  4DBR A;  1WFX A;  2WAE A;  4CCO A;  1QHG A;  4J00 A;  2Q1Z B;  2R7U A;  3IP4 B;  2IGO A;  4B48 A;  1UAA A;  4BEH B;  3G2B A;  1MND A;  2LBF B;  2E1M C;  2IXS A;  4PFP A;  4CUG A;  1OLT A;  5ANP A;  1DGW Y;  4E7S A;  2GKJ A;  2E60 A;  4H4K C;  3LL7 A;  4LIT A;  3MKW B;  2HVS A;  4AVZ A;  2R7Q A;  3PW9 A;  4LB0 A;  1X4P A;  4KIT B;  4QPQ A;  5HOO A;  2R7R A;  2PJR A;  1QYA A;  3DTE A;  4D1Q A;  1DGR M;  3L2W A;  4B44 A;  1YX3 A;  1ERD A;  4BDY A;  4F92 B;  3FBN B;  4HG2 A;  4YEJ A;  2HVR A;  2LY1 A;  1MMD A;  3RPU D;  3QOD A;  4NNJ A;  4C2T A;  2LG4 A;  4ZTF A;  1QY9 A;  2Q9H A;  1D1C A;  2VKD A;  3L2R A;  2IGN A;  2RRE A;  1VZ0 A;  2HU9 A;  2PMZ A;  2M7B A;  2Q9J A;  3H35 A;  4ZTJ A;  4E4H A;  2DT6 A;  2MYS A;  3H5R A;  2HPI A;  4U87 A;  1WJ5 A;  1V5F A;  2K9L A;  2MC4 A;  4BJT A;  3K70 D;  3K4C A;  4PJM A;  2V9K A;  3VYS B;  4XOP A;  3OYL A;  3WQZ A;  2KDO A;  4XKB A;  2MFZ A;  2ZXI A;  3DPL C;  3PNY A;  2WAQ A;  4N4O B;  3VSL A;  3HOT A;  2F6C A;  3AL0 C;  4PJJ A;  3LMM A;  3LSG A;  3K4L A;  2OUM A;  2VQL A;  1U0K A;  3SYT A;  4CCK A;  4CZC A;  4BDZ A;  5IWE A;  2VXZ A;  1SFK A;  2BVM A;  2HDW A;  2XSJ C;  3EPZ A;  4BU2 A;  3OR2 C;  2VJ5 A;  3EUK L;  2DT7 B;  4NC7 A;  1UG0 A;  4R79 A;  3PSF A;  4X0G A;  4PSX A;  1PJR A;  2LOO A;  2V7F A;  3ZGK A;  2KZV A;  1KON A;  2QKL B;  4PJN A;  2W4S A;  1J09 A;  4FAS D;  1G59 A;  2W00 A;  2R7X A;  2CW8 A;  2JSP A;  4HSR A;  1E0E A;  2KPT A;  2KP6 A;  4GL6 A;  2KRC A;  4U7B A;  4ZDP A;  1TT0 A;  2M0M A;  4RLQ A;  2R7S A;  2GKE A;  4XQF A;  4XKV A;  3HXL A;  2ELJ A;  3RSN A;  3PVH A;  2KL4 A;  2ZXO A;  1WJF A;  3A4C A;  4OAY A;  3KEY A;  2OV7 A;  3FDY A;  5H2Y A;  4CSW A;  3RQ4 A;  2BW3 B;  2V4J C;  3DPT A;  3K4M A;  5FRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...