4LG3A

Crystal structure of a duf487 family protein (despig_00776) from desulfovibrio piger atcc 29098 at 2.49 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
179
structure length
179
Chain Sequence
SEAQFFAPTKESPYEGIPGRLRYNVRIVLVEQDKQGNYIARRDSSTVSKRQLAATVIAAARYYAQEKRAAVVSITLDSQPGPAFGKTVLATATYAPDGKGVSGSDDWTWNTLQATPRGLTAQELKIQCLWGEMRGKFQVDGSTDERRLKAAIAKKLKIPAEKVMLNPVFPEPFPQEWTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (DESPIG_00776) from Desulfovibrio piger ATCC 29098 at 2.49 A resolution
rcsb
source organism Desulfovibrio piger
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 49
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16175 DUF4875 Domain of unknown function (DUF4875)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2610 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4lg3A02
3.10.310.90 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4lg3A01
4LG3A
chains in the Genus database with same CATH superfamily
1Q1HA 1U5TC 4DNCA 2DQLA 3LSRA 3SZPA 3WG9A 3S2DJ 4RLQA 5E1WA 2O8XA 1SDJA 2DPDA 1QZEA 3K70C 4M9ZA 2ZXIA 3L00A 3NRVA 4RA2A 3G6EI 4JD7A 3OYNA 2FD5A 4XLEA 5D5XB 1JUPA 1ULYA 1KONA 4BH9A 3C2GA 1NTCA 1NG7A 4EJOA 2MC4A 2QSGX 3MEXA 1K79A 3EUKL 4EJVA 2NS0A 1JE8A 5IT9Z 1OPCA 3HPHA 2LK2A 2G0EA 3C18A 1V54H 5LHIA 2EFNA 1PYVA 1Y56A 2OU2A 4A5NA 3S3NA 2HYFA 2QM3A 3B02A 3L2WA 1QHHD 1P2FA 2X51A 4CXFA 3G71I 4Q48A 1ZLKA 4A3LJ 1LNWA 3TP3A 2L7KA 3GFJA 1O3SA 2ZNYA 4X1EA 3K4NA 1X1AA 4A5MA 4RMNA 4IHSA 3HXLA 1XX5A 4HV6A 3L2CA 2DOFA 5H2GA 2W84A 1T8IA 4XKWA 3E5QA 3LSHA 5IYBJ 1FIAA 2H6BA 5E17F 4PGGA 1ETVA 4MEXF 2ZC2A 4PJJA 3QOEA 2W57A 2E1MC 2X48A 4NC6A 4QPOA 1IC8A 1FYMA 1FY7A 2ME0A 1JTYA 3I9V2 3WGGA 1U0KA 4IHTA 1MBHA 2ZKZA 3N4MA 1Z67A 2ZJRF 5E3NA 2E5ZA 2E5NA 3W5WA 4UUSB 1JKOC 4CCMA 5IY5H 3WHCA 4JBDA 2QYOA 1ZARA 5K5QA 2ESNA 2DT7B 4ON0A 4GDFA 6PAXA 4L9VA 4DZPA 2EIJH 3TEDA 1OLTA 5ED4A 2Y31A 3JRHA 5HA4A 4CCNA 4FE4A 2RDPA 1AA7A 3BROA 3KP6A 1P4AA 3F8CA 1X4PA 1IDYA 3VEPA 4UUSA 3KP7A 3EYIA 3HIFA 4AUXA 3CCVI 4BKXA 4N9IA 2EIKH 3G4SI 1XCVA 2CQNA 1FSEA 1W61A 3J80K 1GV2A 2CJJA 3BT9A 5BS6A 5DS9A 2JA2A 4ITVA 4IHVA 1P9QC 1VI0A 1K78B 3E6BA 4PFOA 1OKRA 2XKOA 1JGSA 4EM1A 2LP0A 1QQIA 1EV7A 1QHGA 2VJ5A 4D1QA 5DD4A 2VKVA 4HX7A 2I8DA 4DOZA 5JR3A 5HNFA 2WAEA 3TQNA 1ZYRF 2O8KA 2OJED 3HOVJ 3JTHA 4R8HA 3CCJI 3FVEA 1ZLJA 4HYEA 4WWCA 2DXIA 2QLZA 2VQCA 2DA6A 2F5FA 1LKXA 2M8EA 2DFHA 1I5ZA 1U78A 5L3DA 4OU0A 1E17A 3K2AA 3TW6A 3HKZA 1XGMA 3J81K 1WJAA 3GW2A 1VQPI 3VSKA 4XN0A 1UG2A 1HC8A 5ANPA 3GFIA 1BWZA 1YO5C 3LQQA 1X3UA 4LK0F 1EA3A 2CQKA 2K9QA 4I7HA 2VJ4A 4ZJZA 5F27A 2HU9A 2WY7Q 4I01A 3RJPA 3R60A 2V6CA 3FKJA 2HYGD 4BE0A 2NVQJ 3HRTA 2YPRA 5GPAA 3JTGA 3HOZJ 2Y0SA 1RESA 2Z1DA 2J5OA 1L0OC 3WTWC 1N25A 2L02A 5LHHA 2BXZA 1IJWC 4RAZA 1TQPA 5L3GA 1J59A 1OCOH 1MJBA 2VQHA 4HBLA 1IXCA 5FLVA 1NK2P 4GYGA 1B9MA 2M4GA 5EEAA 4C3IJ 2WTEA 2KQRA 3NARA 5EG0B 2R5YB 3OYFA 2V7FA 3VOEA 3ABUA 2EZKA 1HBXG 2WA0A 1Z77A 4NDLA 3OYKA 2IS4A 3BR2A 3K4KA 3IKTA 2CQQA 2QZ8A 1WH7A 4ZC3A 2UUZA 3FXLA 3E97A 2E1OA 3K7AJ 4BHCA 5J47A 2XKPA 1HCRA 3G3ZA 1R5GA 2NVYJ 2X6YA 3RTRA 4UVAA 1HW1A 5JFRA 3JW4A 4NB5A 1WHUA 1QPIA 2A5WA 4DUNA 3SZTA 1YW9A 2JPBA 1TNSA 2JRTA 5GP9A 3RIRA 2ID3A 3OS1A 1VFCA 2ZCWA 3AAFA 2HS5A 4J9WA 1PVEA 4A0XA 4EV0A 5GTIC 1AHDP 2A3SA 4V2GA 4XLPF 4L18B 2PVZA 3SEQA 2DMQA 5BPIA 3ZMTA 3K4LA 5JI6A 1W7PB 4IRGA 3GFLA 1I6XA 3JRCA 1YRNA 3FBNB 3QPSA 1LFPA 3KEOA 2W82A 2V9KA 5D6FA 3WHBA 3M4OJ 4EM2A 1J2XA 2XASA 3BR6A 1FOWA 1OJLA 3IUOA 5M5YJ 1OYYA 3PFYA 2RN7A 1ZH5A 3RDIA 1TWCJ 3VYSB 4OIPF 3FK7A 4D9JA 4Z2YA 5J4YA 4MNUA 5FLMJ 4FE7A 1RUOA 5LEKA 4UNOA 1H8AC 2K02A 3L7WA 5D5UB 2M34A 2JA8J 3OYCA 2FOWA 2ZB9A 3KP2A 3V7CA 3RYPA 4C9YA 4RGXA 2H6CA 3ZQIA 3FISA 1ZELA 5HODA 5C3EJ 2Z99A 4F55A 2F6CA 3JR9A 2IA0A 2BW3A 2A6EF 2ESHA 1YOVB 1P7JA 1D8JA 5IOZA 4BBSJ 2FQ4A 2V1DA 1DPRA 3OYJA 2JA5J 2E1MB 3IH3A 3V8JA 2HR3A 2BGCA 2XSDC 2TRTA 2ZXWH 4DYQA 3H1CA 1WSUA 2OD5A 1G4DA 3J81Z 2DPUA 5CJ9A 2DN0A 2UZKA 3I4PA 5C4XJ 4P9FA 1BR1A 2DJIA 1TWFJ 2E34A 1Y0NA 2VN2A 1I74A 2FE3A 3GTGJ 1R71A 1IRXA 4B3XA 1HSTA 2V6EA 1C0WA 3M8FA 5TRDA 5K7HA 4HF2A 2D45A 4LG3A 1BJAA 2EBIA 2VASA 2R7VA 3FXRA 5CVRA 1HF0A 2XAGA 5L3FA 1W5CC 4MLOA 2XB5A 1ERDA 2R4GA 3OIQA 1IN6A 1FOKA 5L3CA 2KT0A 1ZN2A 3E5XA 3AG2H 1EH8A 3QODA 2LF8A 2VI6A 2ZMEA 2NOJB 1XGSA 1R1TA 5AIQA 4CHUA 1O3QA 4IHXA 3LL7A 4XOPA 5DCMA 4JOMA 3W6KB 3RKXA 4K7GB 1AOYA 2EWNA 2JSCA 2NS7A 1SVOA 2L4AA 4KNYA 1T95A 4G12A 1H89C 1R00A 2JVGA 1ETWA 2X1CA 4I98B 2OUMA 2Z2SB 2IGOA 5GAHJ 3GX4X 3L2UA 4JP0A 2EV6A 2DO7A 3F22A 1G3SA 4DIQA 1MSEC 1KU2A 1TQMA 2CU7A 2HXOA 1YX5A 2KISA 4BEHB 1XB4A 3QP5A 3H35A 1ZGWA 2X1DA 3OYIA 3I3LA 3JRDA 2ZXHA 1BW6A 2FJ1A 2XSJC 1ZG3A 2EA2A 4UV9A 1D0XA 4NC7A 4BQQA 1HW5A 2QF7A 3WE3A 3ZQCA 2HQNA 1FJLA 1MH4A 3DQVC 4K8LA 3OYLA 4YIRX 3ULQB 3FXOA 2CS3A 3QYFA 2CYYA 4PJMA 1U1WA 3FWEA 5F0HA 2MA3A 4E7IA 3K1NA 4HNTA 2QKMB 3E1SA 4MIMA 1FTTA 4HDVA 2YS9A 3S1NJ 4IQJA 4OIRF 1QNTA 3S1QJ 4Q2HA 4E70A 2FSWA 3M8JA 2LSOA 4ETSA 2VC1A 3UR3C 1S7JA 4F7ZA 3F8MA 2X6OA 2DT5A 1JJ6C 3Q0VA 3AL0B 5EGOA 1MBKA 1BW5A 2R7WA 4HOBA 2MD0A 3IAM2 3K0LA 1R22A 1PUFB 3O8HA 3LQRA 1BI2A 3QYBA 2CWEA 1QRYA 2XRNA 3DPLC 1MDMA 3QAHA 1ETOA 1XD7A 3OR1C 5L3EA 2Y75A 2A6HF 3L2RA 3BDDA 5J1YA 4EJTA 4MGRA 1Z7LA 2H1KA 1JKRC 1T0FC 2QSFX 3FMSA 4XOTA 5B66C 3IWFA 3VYTB 2JZYA 2ZJ2A 2FNPA 2KKOA 2XF7A 1RUNA 1DPUA 2DODA 2DJNA 1GLNA 2P6SA 3NAUA 2IS2A 4JBAA 4L9TA 2CUEA 2KRHA 1SMYF 3F6OA 3T1BA 3CZ6A 3PVHA 4IJZA 2DCEA 1Y8QB 2CW8A 5J1RA 3HSFA 4IQ4A 1IN4A 5BPDA 3LA2A 3PFIA 4XRMA 1K7AA 2BZTA 1FP1D 1X2NA 4Y13A 4MFDA 2GAUA 4I09A 4HV5A 5FKOA 3ESWB 2Y0SN 3LSPA 3MFKA 1IDZA 2HWVA 2P5LC 4AIDA 1LFUP 1T38A 3W2WA 4A0YA 1PJRA 1KQ0A 3ZR8X 3LSGA 3OY9A 1UFMA 1WJ5A 2L7FP 2OAZA 3K4MA 4JYKA 3T0YA 1QU3A 3LSIA 4AM3A 4BYYA 2FQ3A 2STWA 5M47A 3W6JB 2O0YA 4UVBA 1EJ9A 1YS7A 3F23A 2BVLA 3EDNA 4BJTA 4A3DJ 2KIFA 1BI0A 4AU7A 4RM2A 3JAMZ 3B73A 1TM0A 1KU3A 3OL3A 4HSTA 2R7SA 3TO6A 2FA5A 4WF2A 2PJPA 3RZOJ 2DA4A 1VQLI 4JCIA 2GA2A 3ZQQA 3I71A 1EF4A 2ZXRA 1D1AA 1OQYA 1JTXA 2L9RA 3MMYB 3ONQA 3PQJA 1KQ9A 3QU6A 4JQFA 1MJAA 3OL4A 1WJFA 1ACIA 4E7LA 1G2HA 4XRFA 4UB8C 2FU4A 3HOWJ 3PNYA 2LG4A 1WWXA 4YIFA 4G9YA 3U1DA 4BY1J 3FMQA 3I5UA 2FX0A 1D1CA 2DI3A 4Q47A 2DW4A 2NVUB 2W85A 3VPRA 2L9SA 1XPXA 1T08B 2E2JJ 1MD0A 3O2PE 3CDLA 5K5OA 4HRIA 2OCEA 5CKTA 5FKLA 1UAAA 1X1CA 1BIAA 1OR7A 3LA3A 3EYYA 2LKPA 2R93J 2R3SA 4Y7NJ 1Y0UA 2JSPA 3K4CA 5DM7F 4KA4A 1X1DA 2VJIA 5EGOB 1B6AA 2LY2A 2MH9A 3FDYA 2KMUA 1LJ9A 2F4IA 2R7DA 5ILSA 3RKYA 4XBFA 2KRCA 5IPAA 4YFXF 1UMQA 1TWHJ 3TGNA 5DV5A 3CJNA 4JX6A 2HNHA 1P4XA 4NBQA 3OWTA 3BR5A 4LK1F 4JX5A 2JVHA 3I53A 3H5NA 1IZ1A 2BY0A 2NYXA 2A5YB 4PJLA 3Q9SA 5HLIA 3BG7A 4BJ5C 1FBQA 4I02A 1E2XA 3FXQA 4RAFA 3K70D 2LTPA 1ZGAA 2LBFA 4E7JA 4J9XA 3BJ6A 2D1VA 2K3PA 3QWLA 3RQ4A 3FHNA 4UXNA 4F91B 3FXMA 2LY1A 5FD6A 2DDBA 4MFEA 2GQQA 2EB0A 2ISYA 4U0VA 2DT6A 2QQ9A 1B8IB 5LD2C 3CC7I 2GXBA 5C4JJ 2MH2A 4LLLA 1UZCA 3TO7A 4P9UA 1YRNB 4G7HF 2HVRA 2PLYA 5EZGA 3H9QA 4FQGA 2QUFA 1YIJI 3M9AA 1LDKB 2D2WA 1V4RA 2OPTA 4M73A 3GZ5A 3DKYA 3M1CA 5LGNA 2FMLA 5JVGF 3N97A 4XLAA 2XAHA 2GLOA 4B43A 2GKJA 1GUUA 2HYJA 1Z6TA 2JUCA 1I1SA 1Z21A 1XS9A 2AZPA 1RC9A 2DU9A 3LWFA 3KZZA 2BE5F 4BQNA 1GXPA 2ZMEC 4ZH4F 2AS5F 3RYRA 3ASNH 3H3ZA 1GQZA 3I4MJ 2ENXA 1B9NA 4Y33A 2DFIA 1WPKA 1LEAA 4B47A 4UVCA 4AWXB 4BXUA 4DQ2A 1SFOJ 4NUBA 2LFBA 3G7KA 2WADA 3HSEA 1QGPA 3C3WA 2ZJPF 2Y9ZA 1GHCA 4MTEA 4A69C 1U6GA 2VBXA 2QQBA 4F92B 3CJRB 2PMZA 2CW0F 3SEZA 1QY9A 3E5UA 3X2QH 1VF9A 3GEZA 3HTSB 4M71A 2WB1N 3MWMA 3P5JA 4HX8A 3ZN0A 3K69A 4NHJA 3DTKA 2Q9HA 1X1PA 3IH4A 2HQRA 2OTJI 1G3YA 2GA1A 2GM4A 1ON1A 1TBXA 1RIOH 1T6KA 2DAOA 4A3GJ 1U9OA 2IAIA 3K4JA 4G8XA 2M8GX 4UY8I 3EKMA 3CCLI 4OIOF 1WGXA 2PG4A 3UNGC 3BR3A 5F6FA 1S7AA 4IPAA 4N0BA 3GLLA 5H2YA 1UHMA 1WKMA 4KYWA 2P5KA 1BI3A 4BGDA 5A2QZ 2Y0MA 1YW8A 2Q0OA 2NXNB 4CICA 4ZDPA 3FM3A 2LMDA 2M3AA 5KAIC 3FK6A 3LFKA 3OMYA 1DGWY 3ZOBA 3MKWB 2R7ZJ 3V4GA 2JA7J 2IW4A 2WAQA 4AYBN 4CCKA 3QPTA 5HNHA 1XUAA 1RETA 1WRJA 2XAQA 3BQYA 1X3ZB 4L0ZB 2XHKA 3CCEI 1SAXA 3BY6A 3DBRB 1R36A 5K7FA 5ILVA 4ENNA 4L0YB 2CQXA 2MLKA 2LKXA 5AONA 1SFXA 2RNJA 5HVQC 1TL8A 1A31A 1ZRCA 4HNVA 2K9LA 3GXOA 1UELB 2NS8A 3SJMA 3FX3A 1SAUA 2QB8A 4B8XA 1ETQA 4FT8A 1EKEA 5AIPA 5IP7J 1IF1A 2OTNA 4WX9A 1QA6A 3H0GJ 1SD6A 2XPWA 3Q9VA 4ZYAA 1W36C 1Q1VA 3A03A 1YX3A 3FZVA 3Q0WA 3HRMA 2L9NA 2ECBA 4LFUA 1WJBA 4N9HA 4LS9A 2OF7A 1MW7A 4LITA 2XGDA 4BHPA 1B72A 3V8KA 1TQIA 1G6NA 4LMYA 3RQIA 1LFBA 2EINH 2HFHA 3CUQC 2K9SA 3O8GA 3ZQGA 2TCTA 1W7PA 3HHHA 4A3MJ 3ROUA 1JUMA 4IRHA 2X9DA 1NHAA 4EMSA 2BEOA 2ZO4A 4U0YA 3UKGA 2DFFA 4HG2A 4CYDA 1AKHB 2L5QA 1MNMC 2V26A 2RKHA 3G98A 4FASD 5CVIA 1Z1DA 1LEBA 2KZGA 3DKWA 4G7ZF 1T56A 1VQ6I 3ZMSA 1S7EA 3P9CA 3NWTA 4C2MJ 3AL0C 1DQUA 4BHBA 4I2OA 1R4NB 5FFXA 4IHYA 1FWZA 1ZRDA 2L4MA 3CQZJ 2LC2A 5HLTA 5C44J 4L5IA 5FRNA 1WPMA 3CDHA 4X0GA 1Z91A 3JSOA 1N75A 2DTZA 4LOCA 4CCOA 2OZ6A 1BBYA 4AC0A 1XGNA 5EEGA 2F4MB 2LKSA 5K5RA 2R7OA 4LLNA 4EATA 3NEUA 2F5DA 1MKMA 4I6ZA 2IGKA 3ZQLA 1V55H 4A0ZA 3CJQB 2A69F 1DP7P 3BG5A 5K1YA 2JQ7A 4YIIA 4JK1X 2RVCA 2KLOA 2ZSIB 5CPRB 3WTXC 1QPMA 4R79A 2PMZN 1AKHA 4DW6A 1N77A 4LJZF 5EJCA 3V7RA 3J7YJ 2ELJA 4Y17A 2ZNZA 2E1CA 2P7CB 1XG1A 3KEQA 4BS9A 1OFCX 2LREA 1GDTA 2HDDA 3DLAA 2QVOA 4O6JA 5FLXZ 2VT2A 4XKBA 3WTUC 1B8IA 4JUUA 1F4KA 2M4KA 3Q5FA 2V9VA 1USTA 3S3OA 3HOXJ 3MD2A 4AIKA 2K86A 4ZDOA 1Z05A 2I10A 1CF7B 3WU0A 5FKNA 2KP6A 4CUGA 1LUJB 2A68F 2VKEA 4BXFA 3PO2J 3KEYA 5A2QK 1XMAA 5E18F 4ZTJA 4ABZA 4B1RA 1VQ4I 3BG9A 4IHWA 1BOBA 2IBDA 4WXDA 4RM3A 4ASNA 1K23A 2ME6A 1R5HA 2Y9YA 2BVMA 2R7RA 3V42A 3SYTA 4BNCA 2Q1ZB 3CP2A 1HOMA 2L9VA 1PDNC 4M6YA 3PJRA 4C3HJ 3BG6A 2E2HJ 2FOKA 4RB0A 3DF8A 3MN2A 1FPQA 1S9HA 5HDNA 2CO5A 1IRZA 3D0SA 1A04A 1MMNA 3W3CA 2Q9JA 4XORA 3G2BA 3ASOH 4UUVA 3CCRI 2P7VB 2YX4A 4XLNF 2PX9A 2IEKA 2VUMJ 2MG4A 1H9GA 2IVMA 4U87A 3WGIA 1YTYA 4D7MA 3OYDA 1BL0A 5LGUA 1SEUA 3ZQFA 3H0DA 3AG1H 2QA4I 3IP4B 2ZBKA 4P96A 3TW7A 5JLWA 4RGRA 1JUSA 4E7SA 2OQRA 1ETXA 3HDDA 1MMGA 1Z6RA 3I56I 3CMEI 3OYHA 2GXGA 4O3MA 1RZ4A 3A4CA 5DCFA 1UHWA 3GBGA 3G1LA 3OS0A 3J7AY 1KA8A 2VPRA 2VQGA 2DA7A 3VODA 4UHTA 1ZR4A 1SANA 1IN5A 2Y69H 3ZXSA 1A36A 1T39A 2O61A 4FX4A 4XK4A 3IAS2 2E71A 2OCCH 3COAC 2LD5A 5E79C 3S1MJ 1WI3A 4S0HB 1IGNA 3EJXA 1G59A 5F04A 3WGHA 1JT6A 2NVTJ 4ZYEA 3D5LA 1EH7A 2W1OA 2W4SA 2G7HA 5B1BH 1IXRC 2AQEA 2EZHA 2HZTA 2H8WA 2CUFA 2F2EA 4RGSA 1K4TA 1K6OA 4I76A 2GKEA 2W25A 3REOA 2BXYA 2KIQA 2K85A 1KYWA 3B6AA 4OWRB 5IP9J 3GCMA 2V1XA 5K7ZA 1BM9A 4KT6A 3IL2A 4KITB 1HKSA 4N4NB 4XN3A 1U5TB 4J01A 1Y8RB 1H9TA 1XC5A 4H4KC 2MD5A 4IOCF 3K2ZA 3GZ6A 2ZJQF 3S16J 2JT1A 2PQ8A 5DM6F 4HQEA 3MQ0A 3IV5A 1WI9A 5KHDA 2O5RA 2CW7A 2WV1A 2HKOA 5TISC 3OOPA 5B1AH 5LLQA 1OCTC 4MQ9F 1MMSA 4M6XA 3JREA 1KU9A 4XNFA 2R5YA 2YMAA 2EFQA 1V3FA 3WTSC 2ZXOA 1TTYA 2BHZA 3KIOA 3DTEA 2XAUA 1YIOA 3CO6C 2LLKA 2B7EA 2JN6A 1LB2A 3C2BA 1KZHA 4ANJA 4E6KG 4XLCA 2KZVA 2B9SA 1GT0C 3MKZA 4XKCA 3G73A 4IVNA 4BACA 2CV0A 3GTLJ 4XICA 4QWQA 5IP6A 1TWGJ 1MH3A 2Z3YA 4GGGA 4WXCA 3IKVA 3A01A 2QSHX 4Y3OA 1LE8B 3P7NA 3CD6I 3PTJA 4DYRA 3DTIA 1VZ0A 1YFHA 3HKZN 2AXTC 4EM0B 5DYMA 5E8IA 1SFKA 4P55A 1Y39A 3K10A 2IJLA 2EV0A 3TDZC 3GTOJ 3B6CA 3WODF 2RV8A 5IYDJ 1VQ7I 2RREA 2DK8A 3H3UA 4D5FA 4U0WA 1XSDA 2EFWA 4UB6C 1YS6A 3HM5A 4WCGA 4BQAA 2A05A 1OCCH 4C30A 2A07F 4F93B 4XL9A 2VLAA 2NOGA 3S15J 5J1UA 3VWBA 3FHZA 1J09A 4RB3C 2FMYA 3BZ6A 5H2FC 1FLIA 4G6TB 4KIFA 2XC7A 2OA4A 3SHFA 2PJRB 4G94A 2KIUA 3PQKA 4E7ZA 2FBKA 4IKFA 1UG0A 5GADJ 3CJTB 1L3LA 1DGRM 3IH2A 4HLXA 3GTPJ 4LB0A 4B44A 1Y6IA 4E4HA 1TT0A 2LY9A 3DBLB 3D5SC 5FKMA 2HPIA 2G9WA 1KGSA 1USSA 3HOTA 3A0HC 2LF7A 3VSLA 3KP5A 1PP7U 2RC4A 2IA2A 1S72I 2H8RA 3HUGB 1R23A 1FNNA 2JRMA 2L7MP 4D0PA 2WAFA 4PSWA 2L01A 5CVUA 4B48A 2HOSA 3CCSI 1U8RA 3N05A 3JRAA 3OYMA 1O4XA 4KMFA 2X0LA 3HRUA 1YJNI 4C2TA 1ZREA 1D0ZA 4IOAF 2FUG2 4CO8A 1WZ2A 1F1ZA 3DEUA 4KN4X 1X3WB 2B0LA 4HPQA 5LRSA 1YYVA 4IF4A 3PUBA 4Y15A 5FO5A 5FRMA 2BOLA 3DU5A 5DCMB 3M3YJ 4DJAA 2QB7A 2M7AA 2A61A 1MSFC 3MAJA 2KW7A 3IC7A 2VONA 2W48A 3LMMA 2YU9J 1S5LC 3ERED 3GO5A 4R1HA 4M6VA 5JLXA 4PK4A 1DP3A 2DA5A 1MNDA 2HDCA 3GTKJ 5EF6A 2WAQN 4N4OB 1TW3A 2M5WA 4AYBA 1F5TA 1RI7A 2W24A 1JGGA 2UXXA 4OAZA 3I64A 1O3RA 1HQCA 2M9HA 1IV8A 3K1MA 1T6SA 2MLGA 3CCMI 3OSGA 1JKQC 1JHHA 2BY2A 4F3QA 2R7XA 2QKLB 1LE8A 2ACJA 3F8BA 3F21A 3I59A 3LSKA 5DD8A 5CQEA 5JHUA 4RB2C 2BYVE 1I6HJ 3ML6A 3H92A 1MBJA 4WK8F 4A3JJ 2XIGA 3BR0A 2HZDA 2H9FA 3CDIA 4MQVA 5CQGA 2CV1A 4L9JA 2Y2ZA 3H5AA 1D1BA 2MFZA 1T0FA 2RAEA 3JCUC 5FD5A 1P92A 1ZR2A 2VKHA 3BG3A 3A0BC 1E3OC 1GVJA 3VFZA 2LVSA 2ZFWA 3ELKA 1MNEA 2M45A 2EILH 1HW2A 3DU6A 3LFUA 4YG2F 2R7FA 1ZK8A 2VIXA 3ERMA 3GWZA 3PO3J 2DTRA 1W7PD 2W7NA 3GFMA 2OZUA 3NQOA 4ENMA 4FTHA 1K78A 2ZVFA 2MC3A 3DPTA 3CF5F 4KICA 4HZFA 2FBIA 1UCRA 3ECOA 2KJBA 2WC2A 4KFCA 4S05A 5GPCA 4LIVA 2XUBA 1M1EB 3FM5A 4IEJA 1J0RA 2CQ7A 3OV8A 1O57A 5B5EC 3GZNB 1RKWA 2YU3A 1MIJA 2E1NA 3TOBA 3EDPA 2EJRA 1ONVA 1QYAA 3KE2A 2CGPA 1O7LA 1FEXA 5B3SH 3VYUB 4EQQA 4IO9F 3CO7C 2ECCA 4HA8A 3SQNA 2PJRA 3AFHA 3BPVA 3E6MA 2WB1A 4XSXF 5E3LA 5M3MJ 2CUZA 2X6XA 1WVRA 1VQMI 3V7SA 4XIDA 2QEXI 1A35A 3GTMJ 5D6EA 4QLCU 3J7AO 3EUHC 5FJ8J 2VT3A 4AIHA 2DYRH 3H9GA 3KYLA 2R7QA 3HL2A 3S1RJ 2XPUA 4BL0B 4AD9A 1IR6A 2EA4A 3S8PA 4HLYA 4Y52J 4HW0A 1QZYA 2HAWA 2HPMA 2MYSA 1YE9A 1Z0XA 3VDXA 2ZFUA 4ZYDA 4GRIA 3GTJJ 5EYRA 1ZGJA 1E3HA 3BTIA 3ZMZA 4II2A 4QSHA 2VBYA 2LT2A 3HBLA 5IOYA 4XR6A 3TP0A 1FYLA 4IK0A 2DFEA 3CLQA 2VOPA 4HF1A 3OIOA 3ICJA 1FIPA 1SD7A 2DYSH 4K2EA 2JWTA 1KYZA 2M1BA 3HUGA 5TGTA 1MJ9A 1BR2A 5LRRA 1K6YA 2COMA 2H27A 1JHFA 4NC8A 2PMHA 3E6DA 2GXAA 4X6AJ 1QBJA 1R5ID 1G3TA 4M3EA 4JX4A 3KLOA 2QB6A 5E3OA 1XMXA 2W00A 4M3FA 4IZZA 4O5VA 1OCPA 3MCZA 2XB0X 1W5SA 4XRSG 3PW9A 2H94A 3SXYA 4PFPA 5GAGJ 5HOOA 4ENJA 2K40A 3ZMVA 4W1UA 4CYCB 1KU7A 1J7KA 3U2RA 2A6TA 5HS7A 4C2UA 4BDYA 4GYIA 3U21A 2L3DA 1FYKA 4P1WA 5FGMA 3E0JB 1ORKA 5H20A 3RKWA 3TBIA 1RPWA 1RKTA 3I59B 3C1DA 2DOAA 2JJ7A 2ICWG 3FMRA 3L09A 3WE2A 1CGPA 1R58A 2E36A 2HOTA 2L2OA 5F08A 4Y4RA 3G1OA 5BQTA 4CA0A 5DEQA 4ZZDA 1DU6A 2VL8A 1VQ5I 2F5EA 2PW0A 4D7NA 5CVJA 2PEXA 1W62A 1XSVA 3S17J 3T8TA 3TOAA 3ZQ7A 2C6YA 4TV7A 1OYIA 2Y30A 3KZIC 5KAFC 3SFIA 1F9NA 2VB6A 1T33A 3FXJA 1XN7A 3ZP5A 3KPHA 2STTA 1S7OA 1XCBA 1Z3XA 3F72A 2M2EA 3QU3A 4IL6C 3BQZA 5E3MA 1LVAA 3DPUA 3EPZA 3HYIA 3K1PA 2CFXA 1IUFA 1WPPA 4MTDA 2CG4A 4XM3A 4BEHA 5GAEJ 2H1LA 2QGUA 3WTYC 1LDJA 1B1BA 4PDKA 4CYCA 3S2HJ 2XRLA 1W5TA 5KCMA 3L2QA 2ZXPA 1OYWA 3D1NI 2XAFA 1FX7A 2MGQA 5KK1A 3E6CC 1U1XA 2CRGA 3EUAA 2QCOA 1FBUA 2V1UA 3FF5A 2GZWA 4Q4ZF 1BN5A 1CF7A 3IGHX 5F0FA 4S04A 1ON2A 4KUMA 2COBA 1U3EM 1OCZH 2Z33A 4YRVA 3R0AA 4RGUA 2KL4A 5KNLA 3A2KA 2HTSA 2VODA 2O7OA 2GOMA 1FOYA 4RDUA 2MW8A 1HA8A 4AVPA 1U5TA 2HOAA 5FFZA 4GCVA 4OIQF 2CSOA 2FEZA 1S29A 2UV1A 3RZDJ 2BBYA 4QIWN 2Y48A 4OAYA 3MKYB 3Q3SA 1WFXA 3ISPA 4XLHA 3I55I 3DFGA 3I4NJ 1QVUA 1SFEA 5D5VB 3S93A 5BOXA 2F5CA 2JK3A 4RS8A 3SZGA 2NAZA 4XSZF 3BCAA 1R49A 1YLFA 3OR2C 2V4JC 3O3KA 3R4KA 2R7TA 3BZKA 2RGVA 3C7JA 3CCYA 1MGTA 2M0CA 4LIUA 4V19K 3MZ8A 3GTQJ 1BR4A 1ETKA 1P4WA 1ZKGA 3A01B 1R7JA 3CTAA 4ZYGA 3WG7H 2X6WA 4HDUA 4ESJA 4HX4A 4PJ0C 2K3FA 2JTVA 1T2KA 2OV7A 2BV6A 3D5RC 1IAWA 2PN6A 3DWLE 3VYRB 1D5YA 1ZAOA 4IX7A 1H0MA 2L54A 3RCOA 4BUPA 3RPUA 1WJCA 1R1UA 4DZJA 2HGCA 1NK3P 1TC3C 1FOXA 4HQMA 2M30A 4MO7A 4RBOA 5FROA 1E0EA 3BR1A 3CF2A 4A3FJ 1U9NA 2EK5A 4EGZA 1X4OA 2NVXJ 2KPTA 4Z6YA 1J9IA 1YW7A 2FRHA 4NNJA 5DDGA 2R5ZB 2DQRA 1FT9A 5D4SA 4GO1A 1IN7A 3GMEA 4LLGF 2VJJA 3HPGA 5CVVA 3H3VK 4ZDLA 5L3BA 2IGMA 1ZG5A 3BTLA 3VB2A 3P9KA 5M5WJ 1H88C 3DXJF 3M8EA 1D8KA 2QBYA 4HNUA 2IS6A 2WV0A 5HDGA 2XGCA 1SD4A 1ZHFA 3LSTA 3GYHX 4BE1A 2O9LA 3CESA 1ZRFA 3PNTA 1HSJA 2EFOA 1W4MA 2AQFA 2X4HA 4UUTA 1PP8F 5M5XJ 4M9XA 4Q5SF 3OYAA 2XAJA 2NRAC 2X1EA 2MPBA 3EETA 4KT5C 4A12A 1TZLA 2XGEA 2P6TA 2Z9OA 4RPAA 2VQLA 3CCQI 3L2VA 3CUQB 4PUSA 1VQKI 1NG6A 4EJWA 4KN7X 4CCLA 3OOUA 4FCYA 2M0MA 2QENA 5J40A 1X19A 2O3FA 2XDVA 5ICFA 4EJUA 1DU0A 5HS9A 2E2IJ 3TKYA 1YM5A 1QZZA 3RSNA 3P9IA 4IRIA 4GL6A 2FBHA 3IRQA 1XMKA 4EGYA 3PM1A 1IV6A 4YFNF 4CSWA 3J80Z 3JAMK 2HQ5A 1B4AA 5J8CA 5D4RA 4BBRJ 3E3VA 1EH6A 1OISA 3BTCA 3F0CA 1I50J 1YITI 3RPQA 3K4BA 4CCJA 2GIVA 4ESFA 3TMOA 4EVIA 2E19A 4J19A 3CC2I 2AXLA 1SD5A 2RQPA 2XGXA 2XF5A 2Q2EA 3HZJA 3KLNA 4P5OA 2O03A 1A6QA 1MZBA 3M1EA 2ADUA 2PBIA 3A1YA 3EQLF 4XRSA 5DTDA 3ABMH 1D5VA 2NNNA 3OYBA 4MHGA 1ENHA 5LBQA 2IA1A 1WJDA 4ENKA 2EZIA 3KP4A 4DGWB 3KYCB 4ZTFA 2GWRA 5ERIA 2VOOA 1JI8A 2BHYA 1U1VA 3BC8A 2DLLA 2ZMEB 1A6IA 3LA7A 3LNQA 2AO9A 2DA3A 2VE9A 4KISA 1LVKA 1K61A 1DDNA 2N8GA 4HAMA 3HC7A 1JXSA 4XONA 4B3AA 1D0YA 2K5CA 3GLXA 2B63J 1U0JA 3PSIA 4BE2A 2IPQX 2X85A 2LNBA 2KJCA 1ZTRA 2HEOA 5ICEA 3HB9A 3KCCA 1R4MB 1PUFA 3O6BB 4YEJA 1D3YA 2CFOA 2P0WA 4BY7J 1S8NA 4A2UA 4QPQA 3NWSA 3R6SA 1TNTA 1O3TA 2NNYA 4M9SA 1R6RA 2BY1A 5E1ZB 1ZQ3P 1HDDC 3EUHA 5KVRA 4LG0B 4CH7A 4M3DA 3T8RA 3SDBA 3FKIJ 3WTTC 4W97A 2KFDA 4HSRA 3S32A 1MBEA 2CMPA 2XROA 3HRSA 5LEJA 3QOPA 4KJZA 3DLLF 1XTAA 1TLHB 2YUSA 3KP3A 4M74A 3AKZA 2VKDA 1I3QJ 2V1NA 1S6LA 2OQGA 4B4CA 1V5GA 2DMUA 2HI3A 2I5UA 1HLVA 1NH3A 4IXAA 3FBIB 2PFBA 5TJJA 1REPC 1VQ9I 4MEYF 3WU2C 4J00A 4ESBA 1FMVA 1HKTA 3FXUA 1N78A 2ELKA 1FBSA 3F3XA 1BC8C 3JRFA 3CCUI 1SVLA 4BJ6C 3WTZA 5EZHA 3BWGA 3KYDB 2YR2A 1IG7A 1YJ9I 4LB6B 5HLHA 1B59A 4GXOA 2IXSA 4M3BA 4Q60A 5CYVA 3HEFA 3K6GA 2FNAA 4FX0A 2CV2A 1AU7A 1TP4A 2KDZA 1I39A 1OMIA 1R1VA 3LSMA 4GFBA 2V9PA 4A6EA 5DUKA 3KX2A 3ZMUA 1U2WA 1FTZA 3MKLA 4CZCA 3IWZA 4LG0A 2QQAA 2F5VA 4M72A 4LD5A 2VPLA 4LGWA 1P7IA 3AG4H 3IHUA 2KPMA 3QPLA 5EEHA 3SDGA 3JRBA 1BC7C 4FETA 2D1HA 5HLGA 2ZSHB 4A3KJ 3ZRGA 2K27A 5EG0A 2RQQA 5BMZA 3HOSA 2XPVA 3F8FA 1W0UA 1OR7C 4OMZA 4PCQA 5D8LB 3CLOA 5ICGA 1FMWA 3OS2A 1FSHA 4BQOA 4WXHA 1GVDA 4L9NA 5LHGA 5FKKA 3DEEA 2P81A 3I54A 2P5VA 3CMMA 3J7ZI 1R9TJ 4XLFA 1POGA 3ZN1A 5H6QA 4B09A 1YJWI 3GF2A 2L0KA 3QRFF 3OSFA 2Z16A 1YHQI 3BP8A 2K9NA 3GUDA 2GBYA 3W2VA 1Y1VJ 1GXQA 3HJEA 2MBFA 2HVQA 4U88A 2EQRA 3Q0UA 1IRGA 2M7BA 3HHGA 3BLYA 3CUQA 5E20A 2BY3A 4OOIA 3LSJA 2VE8A 3BJOA 2VXZA 3HOUJ 1J5YA 2R7UA 2DOEA 3I58A 1LDDA 5J3LA 1YI2I 1IRFA 2P8TA 4OA3A 1MMDA 4A3BJ 1MDMB 2BW3B 4H0EA 4OMYA 3G1MA 4RAGA 3DBHB 3OIPA 2UWMA 3I0TA 2OC6A 1BIBA 1QVTA 2HOEA 3HTUA 4PZJA 4II3A 3ZCOA 1FP2A 2Q8KA 4DYCA 5J4VA 3S3MA 2JPCA 2MSYA 3ZQHA 3JRGA 1YQAA 2D5VA 2F48A 3T5XA 3RI4A 5D5WB 1JJ8C 3DEVA 2RNGA 4ZYHA 1VNDA 2XVCA 2PMUA 1BJZA 2DMPA 2O6GE 3HGGA 3PSFA 1TW2A 4RAYA 3BOQA 2OBPA 5J6XA 1ZG1A 4M3GA 1IUYA 2LH9A 4KIBA 2K7LA 4PJNA 1HKQA 2J5PA 4L5JA 2LDUA 3DCFA 5HS8A 1RNLA 1Z7UA 3QP6A 4RLFA 2H09A 1ITYA 2KIMA 4FISA 3ECHA 3CC4I 2ETHA 2KDOA 3IRRA 1T98A 2PI0A 5J8FA 1XUBA 4FHTA 2VXDA 1UB9A 1XGOA 3W2AA 4G6DA 2ZXJA 5E8GA 5BNGA 1BA5A 1P6RA 2Q2EB 3F9KA 2HVSA 5M3FJ 4DBQA 3W6VA 4PY9A 2IT0A 3ABTA 4PSXA 1XDSA 5IWEA 5EDNA 1GV5A 2GIZA 1APLC 2CH0A 1I27A 1JT0A 2EFPA 4QTRA 4V2FA 5E1XA 2LYCA 5D8KB 1U8BA 2KRFA 1W36D 1VQNI 2EH3A 3LOCA 2WY8Q 4A3EJ 2DA1A 4YELA 1HXDA 1X58A 1JKPC 3QPHA 2F4OB 4UV8A 3LAJA 5F1JA 3PIOF 2JUGA 4AVZA 3JSPA 4ZZLA 2K4BA 4C3JJ 2K4JA 5GTHC 3CMYA 2E7WA 1Y1WJ 1I3AA 2QBYB 5CLSA 1UHSA 1G3WA 2GOXB 3DKXA 4CDGA 1X2MA 1STZA 2R0QC 1KQ8A 3ZGKA 3TO9A 3DP7A 3QQAA 2EZLA 4KDPA 3WTVC 1HDPA 2XV4S 1WCMJ 3CUOA 1PUEE 5FLXK 2HTJA 3RKQA 5IYCJ 2R5ZA 3ABKH 1RR7A 1RRJA 3CP8A 2XF6A 3MZYA 2OTLI 2WBMA 1MBGA 2VC0A 4XMYA 2CUJA 1IW7F 3KZYA 3TL4X 5HDKA 1MBFA 2LRDA 4L5EA 3BCBA 1BI1A 2JMWA 3AG3H 4I0AA 4NQWB 3TDUC 3BPXA 1RR8C 4KMUX 1B72B 1XSXA 4YFKF 1Z9CA 5JVTA 2LR8A 2V79A 1I1GA 3R61A 1E3PA 1IO2A 4IJAA 3JRIA 9ANTA 3S14J 4A3IJ 3HGYA 4D5CA 4A93J 5IT9K 1SMTA 2E60A 2HKXA 2EB7A 2KHMA 3KETA 3M7GA 4LB5A 1UJ8A 2TDXA 2MABA 3E7LA 1WH5A 1IXSB 1K83J 3V8LA 2YX7A 5ICCA 1LQ1A 3OYGA 1SVMA 1F43A 2WWYA 2JA6J 2K9MA 1F36A 3U9GA 3WU1B 3WQZA 4AIJA 3FIWA 2HXIA 4BDZA 3QYEA 5JHFA 5LFAA 1LPQA 3MVPA 1V5FA 1DUXC 1WJEA 4CGZA 3R0JA 3F8NA 5FB2A 4E7HA 3ZPLA 2ID6A 1J75A 4F52A 3GVAA 2LBFB 3HSRA 1SFUA 1FZPB 4U7DA 1IN8A 1K4SA 3PUFA 5F1RA 2YSRA 1S3JA 4XQFA 4CZZA 1O7FA 4NQWA 4EEFG 3L1PA 2AHQA 2ISZA 3KFWX 3HOYJ 3SFZA 3F6VA 1XDUA 2R92J 1TT5B 2VBZA 2DDAA 4XKVA 1K20A 4PGHA 3M07A 3CMAI 4HEA2 4A6DA 4A3CJ 3L9FA 2EPFA 2EV5A 3PNVA 2DMTA 3FXKA 3RPUD 2IS1A 3DV8A 2DK5A 4G6QA 2VBWA 2G7UA 1G8XA 4G7OF 4I99C 4OINF 1ODDA 2E35A 3C2HA 3DEWA 3HG9A 4BAYA 4RB1A 2M87A 1V5EA 2HQAA 2QWWA 3BTJA 2IP2A 4BU2A 2DMNA 1FC3A 5F64A 1VQ8I 1WQ2A 2DBBA 2E7XA 2Z5UA 3U1KA 2FF4A 1OCRH 5LGTA 3ZMDA 4HF0A 1SC7A 3BJAA 4K7XA 3LAPA 1CQTA 5H6RA 3S2WA 2DA2A 2L7ZA 3ABLH 3H5RA 4BXXJ 3PIPF 1W1WE 1VQOI 3A02A 3K9TA 5DUIA 2IRFG 1Z3YA 3H9JA 2EIMH 1ETYA 1X1BA 4DBRA 4U7BA 5ILUA 2LOOA 1TWAJ 3BZCA 4E7KA 1A5JA 3OYEA 2ELHA 1BOAA 2QQ8A 1VTNC 3MZHA 5IT3A 1YG2A 2IW5A 2FXAA 1W0TA 2HDWA 3PL8A 3H36A 1AWCA 4I0BA 1QO0D 2P4WA 1MMAA 2UXNA 2IGNA 4KIGA 5F0CA
chains in the Genus database with same CATH topology
3LSGA 4ANJA 4E6KG 1WJ5A 4XLCA 2KZVA 2X1EA 3K4MA 3OY9A 3OYAA 3MKZA 3LSIA 1QU3A 2MPBA 4XKCA 1TZLA 4RPAA 2VQLA 4BACA 3L2VA 4RLQA 2CV0A 5M47A 1SDJA 4PUSA 1NG6A 3K70C 2ZXIA 4JD7A 4CCLA 3OYNA 3OOUA 2M0MA 4XLEA 2BVLA 4Y3OA 3EDNA 4BJTA 1X19A 3PTJA 2XDVA 4AU7A 1KONA 3DTIA 3C2GA 4RM2A 1TM0A 1VZ0A 1NG7A 3OL3A 4HSTA 2MC4A 2R7SA 1YM5A 4JCIA 3RSNA 4GL6A 3EUKL 3ZQQA 4CSWA 2ZXRA 1SFKA 1D1AA 3HPHA 3K10A 3ONQA 3MMYB 1PYVA 1Y56A 4JQFA 3OL4A 1WJFA 4E7LA 3S3NA 2RREA 3K4BA 4CCJA 3L2WA 3PNYA 2LG4A 1QHHD 3TMOA 2X51A 4C30A 4F93B 1D1CA 4XL9A 2VLAA 2XF5A 2L7KA 4P5OA 3VWBA 1J09A 3K4NA 1X1AA 2L9SA 4RMNA 3HXLA 3A1YA 4HRIA 4G6TB 5CKTA 2XC7A 1UAAA 2PJRB 5H2GA 1X1CA 3OYBA 4XKWA 4E7ZA 1WJDA 3LSHA 4IKFA 4DGWB 1UG0A 4ZTFA 2JSPA 3K4CA 4PJJA 3QOEA 1X1DA 2VJIA 1DGRM 1JI8A 4LB0A 2E1MC 4B44A 1Y6IA 2LY2A 3FDYA 4QPOA 4E4HA 1TT0A 1U1VA 2KMUA 3BC8A 3D5SC 2F4IA 2HPIA 3I9V2 1U0KA 3HOTA 2KRCA 3VSLA 4KISA 2E5ZA 2E5NA 2HNHA 1LVKA 3W5WA 3OWTA 3HUGB 4CCMA 4JBDA 2JVHA 3HC7A 2WAFA 3H5NA 4PSWA 4XONA 4B48A 1D0YA 4PJLA 2K5CA 3BG7A 1U0JA 2DT7B 3PSIA 4BJ5C 2X85A 3N05A 3OYMA 4BE2A 3K70D 2LBFA 4C2TA 4E7JA 1OLTA 1D0ZA 4J9XA 2FUG2 5HA4A 4CCNA 4YEJA 2K3PA 3RQ4A 1AA7A 2CFOA 4HPQA 2P0WA 3FHNA 4F91B 3PUBA 2LY1A 4QPQA 5FRMA 2BOLA 3NWSA 3DU5A 1X4PA 1R6RA 2EB0A 4DJAA 2QB7A 4CH7A 2DT6A 2M7AA 3SDBA 5LD2C 4HSRA 2HVRA 3S32A 2CMPA 1W61A 2KW7A 3LMMA 4KJZA 3H9QA 3AKZA 2JA2A 4ITVA 2VKDA 1P9QC 2V1NA 1LDKB 4PFOA 1V5GA 3DKYA 3M1CA 1QHGA 2VJ5A 4XLAA 2GKJA 4PK4A 1PJRA 4B43A 1DP3A 3FBIB 4D1QA 1MNDA 4J00A 1FMVA 4N4OB 4AYBA 2I8DA 1Z21A 4DOZA 1N78A 4OAZA 2AZPA 5HNFA 4BJ6C 2WAEA 4F3QA 2R7XA 2QKLB 4BQNA 3FVEA 2IXSA 4Q60A 2DXIA 2VQCA 1LKXA 3LSKA 5CQEA 3K6GA 1GQZA 2ENXA 4Y33A 4B47A 2HPMA 2CV2A 2HZDA 3HKZA 2H9FA 1WJAA 5ANPA 5CQGA 4XN0A 3VSKA 2CV1A 1BWZA 3H5AA 3LSMA 4NUBA 3G7KA 1D1BA 2WADA 3KX2A 2MFZA 1EA3A 4CZCA 4F92B 3CJRB 2F5VA 2VKHA 2PMZA 2VJ4A 4ZJZA 2HU9A 3SEZA 2WY7Q 1MNEA 2VPLA 1QY9A 2KPMA 3DU6A 3LFUA 4FETA 3FKJA 3DTKA 4BE0A 2ZSHB 2VIXA 2Q9HA 3ZRGA 2RQQA 3HOSA 2W7NA 1OR7C 1T6KA 2Y0SA 2Z1DA 3K4JA 2ZVFA 3DPTA 1FMWA 3OS2A 3EKMA 4BQOA 3UNGC 3DEEA 4LIVA 2VQHA 3CMMA 5H2YA 4XLFA 2M4GA 2KQRA 4BGDA 4ZDPA 2Z16A 3OYFA 2V7FA 1QYAA 2M3AA 3OMYA 1DGWY 3W2VA 3MKWB 2WA0A 3VYUB 2IW4A 3OYKA 2IS4A 2HVQA 2WAQA 4CCKA 1XUAA 5HNHA 2PJRA 3AFHA 2M7BA 3K4KA 3BLYA 2WB1A 2CUZA 2X6XA 2VXZA 4ZC3A 2UUZA 5HVQC 2R7UA 2K9LA 3EUHC 1UELB 4OA3A 1MMDA 1SAUA 3H9GA 3KYLA 2R7QA 2BW3B 2QB8A 2X6YA 3RTRA 3HL2A 4BL0B 3OIPA 1IR6A 3S8PA 2UWMA 2HAWA 2OTNA 2OC6A 4ZYAA 2MYSA 4II3A 3ZCOA 2A5WA 1W36C 4DUNA 3S3MA 1YE9A 1YX3A 2ZFUA 3VDXA 3OS1A 4GRIA 2L9NA 1WJBA 4II2A 3DEVA 2RNGA 4J9WA 4LS9A 2LT2A 1MW7A 4LITA 4XR6A 4IK0A 2PVZA 3SEQA 3PSFA 3ICJA 3K4LA 5TGTA 1BR2A 3FBNB 1K6YA 4NC8A 1LFPA 2LH9A 2W82A 4PJNA 2V9KA 2QB6A 3IUOA 4RLFA 3PFYA 4HG2A 2W00A 4IZZA 2L5QA 3VYSB 2V26A 4D9JA 3G98A 4FASD 2KDOA 3PW9A 1XUBA 2VXDA 3W2AA 4PFPA 5HOOA 3OYCA 3NWTA 3AL0C 1DQUA 2Q2EB 4C9YA 3F9KA 2HVSA 4DBQA 4PY9A 5HLTA 2LC2A 1WPMA 5FRNA 4X0GA 4PSXA 1ZELA 2A6TA 4F55A 4C2UA 2F6CA 5IWEA 4BDYA 2BW3A 1N75A 3U21A 2CH0A 4P1WA 2LYCA 3E0JB 3TBIA 4CCOA 1W36D 2DOAA 2WY8Q 3OYJA 2E1MB 2L2OA 4YELA 4Y4RA 2R7OA 4CA0A 4EATA 2VL8A 2PW0A 2IGKA 1BR1A 2DJIA 2JUGA 1W62A 4AVZA 1I74A 3CJQB 1IRXA 4B3XA 2GOXB 3DKXA 2V6EA 2KLOA 2ZSIB 2VB6A 5CPRB 3ZGKA 4LG3A 4R79A 2VASA 2R7VA 1Z3XA 1N77A 3DPUA 3EPZA 4MLOA 2ELJA 1WPPA 4BS9A 1ERDA 2R4GA 3OIQA 4XM3A 2LREA 3CP8A 2XF6A 3DLAA 4BEHA 3QODA 2WBMA 2NOJB 4XKBA 4XMYA 2CUJA 3TL4X 3L2QA 5KCMA 2ZXPA 4JUUA 2LRDA 4NQWB 2M4KA 3BCBA 4ZDOA 3S3OA 3MD2A 3LL7A 4XOPA 1U1XA 4JOMA 3EUAA 4K7GB 2KP6A 4CUGA 3IGHX 4BXFA 2E60A 4YRVA 1T95A 3KEYA 2KL4A 2JVGA 2KHMA 5KNLA 4ZTJA 3A2KA 2X1CA 2GOMA 2MABA 2OUMA 2Z2SB 1HA8A 2IGOA 1BOBA 3L2UA 4RM3A 3OYGA 2UV1A 1K23A 4DIQA 2K9MA 1YX5A 4OAYA 3MKYB 4BEHB 1WFXA 4XLHA 3WQZA 4BDZA 2BVMA 3H35A 3QYEA 2R7RA 3V42A 5JHFA 2X1DA 5LFAA 3S93A 3OYIA 3SYTA 3I3LA 2ZXHA 1V5FA 1WJEA 2Q1ZB 3CP2A 2XSJC 3SZGA 4E7HA 3BCAA 3PJRA 3OR2C 1D0XA 3BG6A 4NC7A 4BQQA 4F52A 2V4JC 1S9HA 2LBFB 2R7TA 1MMNA 3W3CA 2Q9JA 3DQVC 4XORA 4K8LA 3G2BA 3OYLA 2CS3A 4LIUA 3QYFA 4PJMA 1U1WA 4XQFA 4U87A 4E7IA 1BR4A 4HNTA 3OYDA 2QKMB 3E1SA 3H0DA 3IP4B 4IQJA 2X6WA 4XKVA 4Q2HA 3M8JA 4E7SA 1K20A 1MMGA 4HEA2 2OV7A 3OYHA 3A4CA 3UR3C 3GBGA 1S7JA 3OS0A 3D5RC 3PNVA 3RPUD 3J7AY 2IS1A 2VQGA 3AL0B 3DWLE 3VYRB 3ZXSA 4IX7A 2R7WA 2MD0A 3IAS2 3RCOA 4BUPA 1WJCA 3IAM2 1G8XA 3EJXA 3C2HA 1G59A 3HG9A 3QYBA 1V5EA 3DPLC 5FROA 2HQAA 1E0EA 3OR1C 4BU2A 3CF2A 3D5LA 2W4SA 2W1OA 3L2RA 2AQEA 1X4OA 1Z7LA 2GKEA 2KPTA 4K7XA 1T0FC 4XOTA 3VYTB 4NNJA 2XF7A 3H5RA 4OWRB 1GLNA 4KT6A 4KITB 2IS2A 1Z3YA 3H9JA 2VJJA 3HPGA 4N4NB 4XN3A 4ZDLA 4J01A 2IGMA 1X1BA 2KRHA 4H4KC 4DBRA 4U7BA 3CZ6A 3PVHA 4IJZA 2DCEA 2LOOA 2CW8A 4E7KA 4IQ4A 3OYEA 5KHDA 2O5RA 4HNUA 2IS6A 2CW7A 4BE1A 2HDWA 3PL8A 4XNFA 3CESA 2YMAA 2ZXOA 3PNTA 2XAUA 3DTEA 2AQFA 1MMAA 3W2WA 2IGNA 3ZR8X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG3 A; 
#chains in the Genus database with same CATH topology
 1Q1H A;  1U5T C;  4DNC A;  2DQL A;  3LSR A;  3SZP A;  3WG9 A;  3S2D J;  4RLQ A;  5E1W A;  2O8X A;  1SDJ A;  2DPD A;  1QZE A;  3K70 C;  4M9Z A;  2ZXI A;  3L00 A;  3NRV A;  4RA2 A;  3G6E I;  4JD7 A;  3OYN A;  2FD5 A;  4XLE A;  5D5X B;  1JUP A;  1ULY A;  1KON A;  4BH9 A;  3C2G A;  1NTC A;  1NG7 A;  4EJO A;  2MC4 A;  2QSG X;  3MEX A;  1K79 A;  3EUK L;  4EJV A;  2NS0 A;  1JE8 A;  5IT9 Z;  1OPC A;  3HPH A;  2LK2 A;  2G0E A;  3C18 A;  1V54 H;  5LHI A;  2EFN A;  1PYV A;  1Y56 A;  2OU2 A;  4A5N A;  3S3N A;  2HYF A;  2QM3 A;  3B02 A;  3L2W A;  1QHH D;  1P2F A;  2X51 A;  4CXF A;  3G71 I;  4Q48 A;  1ZLK A;  4A3L J;  1LNW A;  3TP3 A;  2L7K A;  3GFJ A;  1O3S A;  2ZNY A;  4X1E A;  3K4N A;  1X1A A;  4A5M A;  4RMN A;  4IHS A;  3HXL A;  1XX5 A;  4HV6 A;  3L2C A;  2DOF A;  5H2G A;  2W84 A;  1T8I A;  4XKW A;  3E5Q A;  3LSH A;  5IYB J;  1FIA A;  2H6B A;  5E17 F;  4PGG A;  1ETV A;  4MEX F;  2ZC2 A;  4PJJ A;  3QOE A;  2W57 A;  2E1M C;  2X48 A;  4NC6 A;  4QPO A;  1IC8 A;  1FYM A;  1FY7 A;  2ME0 A;  1JTY A;  3I9V 2;  3WGG A;  1U0K A;  4IHT A;  1MBH A;  2ZKZ A;  3N4M A;  1Z67 A;  2ZJR F;  5E3N A;  2E5Z A;  2E5N A;  3W5W A;  4UUS B;  1JKO C;  4CCM A;  5IY5 H;  3WHC A;  4JBD A;  2QYO A;  1ZAR A;  5K5Q A;  2ESN A;  2DT7 B;  4ON0 A;  4GDF A;  6PAX A;  4L9V A;  4DZP A;  2EIJ H;  3TED A;  1OLT A;  5ED4 A;  2Y31 A;  3JRH A;  5HA4 A;  4CCN A;  4FE4 A;  2RDP A;  1AA7 A;  3BRO A;  3KP6 A;  1P4A A;  3F8C A;  1X4P A;  1IDY A;  3VEP A;  4UUS A;  3KP7 A;  3EYI A;  3HIF A;  4AUX A;  3CCV I;  4BKX A;  4N9I A;  2EIK H;  3G4S I;  1XCV A;  2CQN A;  1FSE A;  1W61 A;  3J80 K;  1GV2 A;  2CJJ A;  3BT9 A;  5BS6 A;  5DS9 A;  2JA2 A;  4ITV A;  4IHV A;  1P9Q C;  1VI0 A;  1K78 B;  3E6B A;  4PFO A;  1OKR A;  2XKO A;  1JGS A;  4EM1 A;  2LP0 A;  1QQI A;  1EV7 A;  1QHG A;  2VJ5 A;  4D1Q A;  5DD4 A;  2VKV A;  4HX7 A;  2I8D A;  4DOZ A;  5JR3 A;  5HNF A;  2WAE A;  3TQN A;  1ZYR F;  2O8K A;  2OJE D;  3HOV J;  3JTH A;  4R8H A;  3CCJ I;  3FVE A;  1ZLJ A;  4HYE A;  4WWC A;  2DXI A;  2QLZ A;  2VQC A;  2DA6 A;  2F5F A;  1LKX A;  2M8E A;  2DFH A;  1I5Z A;  1U78 A;  5L3D A;  4OU0 A;  1E17 A;  3K2A A;  3TW6 A;  3HKZ A;  1XGM A;  3J81 K;  1WJA A;  3GW2 A;  1VQP I;  3VSK A;  4XN0 A;  1UG2 A;  1HC8 A;  5ANP A;  3GFI A;  1BWZ A;  1YO5 C;  3LQQ A;  1X3U A;  4LK0 F;  1EA3 A;  2CQK A;  2K9Q A;  4I7H A;  2VJ4 A;  4ZJZ A;  5F27 A;  2HU9 A;  2WY7 Q;  4I01 A;  3RJP A;  3R60 A;  2V6C A;  3FKJ A;  2HYG D;  4BE0 A;  2NVQ J;  3HRT A;  2YPR A;  5GPA A;  3JTG A;  3HOZ J;  2Y0S A;  1RES A;  2Z1D A;  2J5O A;  1L0O C;  3WTW C;  1N25 A;  2L02 A;  5LHH A;  2BXZ A;  1IJW C;  4RAZ A;  1TQP A;  5L3G A;  1J59 A;  1OCO H;  1MJB A;  2VQH A;  4HBL A;  1IXC A;  5FLV A;  1NK2 P;  4GYG A;  1B9M A;  2M4G A;  5EEA A;  4C3I J;  2WTE A;  2KQR A;  3NAR A;  5EG0 B;  2R5Y B;  3OYF A;  2V7F A;  3VOE A;  3ABU A;  2EZK A;  1HBX G;  2WA0 A;  1Z77 A;  4NDL A;  3OYK A;  2IS4 A;  3BR2 A;  3K4K A;  3IKT A;  2CQQ A;  2QZ8 A;  1WH7 A;  4ZC3 A;  2UUZ A;  3FXL A;  3E97 A;  2E1O A;  3K7A J;  4BHC A;  5J47 A;  2XKP A;  1HCR A;  3G3Z A;  1R5G A;  2NVY J;  2X6Y A;  3RTR A;  4UVA A;  1HW1 A;  5JFR A;  3JW4 A;  4NB5 A;  1WHU A;  1QPI A;  2A5W A;  4DUN A;  3SZT A;  1YW9 A;  2JPB A;  1TNS A;  2JRT A;  5GP9 A;  3RIR A;  2ID3 A;  3OS1 A;  1VFC A;  2ZCW A;  3AAF A;  2HS5 A;  4J9W A;  1PVE A;  4A0X A;  4EV0 A;  5GTI C;  1AHD P;  2A3S A;  4V2G A;  4XLP F;  4L18 B;  2PVZ A;  3SEQ A;  2DMQ A;  5BPI A;  3ZMT A;  3K4L A;  5JI6 A;  1W7P B;  4IRG A;  3GFL A;  1I6X A;  3JRC A;  1YRN A;  3FBN B;  3QPS A;  1LFP A;  3KEO A;  2W82 A;  2V9K A;  5D6F A;  3WHB A;  3M4O J;  4EM2 A;  1J2X A;  2XAS A;  3BR6 A;  1FOW A;  1OJL A;  3IUO A;  5M5Y J;  1OYY A;  3PFY A;  2RN7 A;  1ZH5 A;  3RDI A;  1TWC J;  3VYS B;  4OIP F;  3FK7 A;  4D9J A;  4Z2Y A;  5J4Y A;  4MNU A;  5FLM J;  4FE7 A;  1RUO A;  5LEK A;  4UNO A;  1H8A C;  2K02 A;  3L7W A;  5D5U B;  2M34 A;  2JA8 J;  3OYC A;  2FOW A;  2ZB9 A;  3KP2 A;  3V7C A;  3RYP A;  4C9Y A;  4RGX A;  2H6C A;  3ZQI A;  3FIS A;  1ZEL A;  5HOD A;  5C3E J;  2Z99 A;  4F55 A;  2F6C A;  3JR9 A;  2IA0 A;  2BW3 A;  2A6E F;  2ESH A;  1YOV B;  1P7J A;  1D8J A;  5IOZ A;  4BBS J;  2FQ4 A;  2V1D A;  1DPR A;  3OYJ A;  2JA5 J;  2E1M B;  3IH3 A;  3V8J A;  2HR3 A;  2BGC A;  2XSD C;  2TRT A;  2ZXW H;  4DYQ A;  3H1C A;  1WSU A;  2OD5 A;  1G4D A;  3J81 Z;  2DPU A;  5CJ9 A;  2DN0 A;  2UZK A;  3I4P A;  5C4X J;  4P9F A;  1BR1 A;  2DJI A;  1TWF J;  2E34 A;  1Y0N A;  2VN2 A;  1I74 A;  2FE3 A;  3GTG J;  1R71 A;  1IRX A;  4B3X A;  1HST A;  2V6E A;  1C0W A;  3M8F A;  5TRD A;  5K7H A;  4HF2 A;  2D45 A;  4LG3 A;  1BJA A;  2EBI A;  2VAS A;  2R7V A;  3FXR A;  5CVR A;  1HF0 A;  2XAG A;  5L3F A;  1W5C C;  4MLO A;  2XB5 A;  1ERD A;  2R4G A;  3OIQ A;  1IN6 A;  1FOK A;  5L3C A;  2KT0 A;  1ZN2 A;  3E5X A;  3AG2 H;  1EH8 A;  3QOD A;  2LF8 A;  2VI6 A;  2ZME A;  2NOJ B;  1XGS A;  1R1T A;  5AIQ A;  4CHU A;  1O3Q A;  4IHX A;  3LL7 A;  4XOP A;  5DCM A;  4JOM A;  3W6K B;  3RKX A;  4K7G B;  1AOY A;  2EWN A;  2JSC A;  2NS7 A;  1SVO A;  2L4A A;  4KNY A;  1T95 A;  4G12 A;  1H89 C;  1R00 A;  2JVG A;  1ETW A;  2X1C A;  4I98 B;  2OUM A;  2Z2S B;  2IGO A;  5GAH J;  3GX4 X;  3L2U A;  4JP0 A;  2EV6 A;  2DO7 A;  3F22 A;  1G3S A;  4DIQ A;  1MSE C;  1KU2 A;  1TQM A;  2CU7 A;  2HXO A;  1YX5 A;  2KIS A;  4BEH B;  1XB4 A;  3QP5 A;  3H35 A;  1ZGW A;  2X1D A;  3OYI A;  3I3L A;  3JRD A;  2ZXH A;  1BW6 A;  2FJ1 A;  2XSJ C;  1ZG3 A;  2EA2 A;  4UV9 A;  1D0X A;  4NC7 A;  4BQQ A;  1HW5 A;  2QF7 A;  3WE3 A;  3ZQC A;  2HQN A;  1FJL A;  1MH4 A;  3DQV C;  4K8L A;  3OYL A;  4YIR X;  3ULQ B;  3FXO A;  2CS3 A;  3QYF A;  2CYY A;  4PJM A;  1U1W A;  3FWE A;  5F0H A;  2MA3 A;  4E7I A;  3K1N A;  4HNT A;  2QKM B;  3E1S A;  4MIM A;  1FTT A;  4HDV A;  2YS9 A;  3S1N J;  4IQJ A;  4OIR F;  1QNT A;  3S1Q J;  4Q2H A;  4E70 A;  2FSW A;  3M8J A;  2LSO A;  4ETS A;  2VC1 A;  3UR3 C;  1S7J A;  4F7Z A;  3F8M A;  2X6O A;  2DT5 A;  1JJ6 C;  3Q0V A;  3AL0 B;  5EGO A;  1MBK A;  1BW5 A;  2R7W A;  4HOB A;  2MD0 A;  3IAM 2;  3K0L A;  1R22 A;  1PUF B;  3O8H A;  3LQR A;  1BI2 A;  3QYB A;  2CWE A;  1QRY A;  2XRN A;  3DPL C;  1MDM A;  3QAH A;  1ETO A;  1XD7 A;  3OR1 C;  5L3E A;  2Y75 A;  2A6H F;  3L2R A;  3BDD A;  5J1Y A;  4EJT A;  4MGR A;  1Z7L A;  2H1K A;  1JKR C;  1T0F C;  2QSF X;  3FMS A;  4XOT A;  5B66 C;  3IWF A;  3VYT B;  2JZY A;  2ZJ2 A;  2FNP A;  2KKO A;  2XF7 A;  1RUN A;  1DPU A;  2DOD A;  2DJN A;  1GLN A;  2P6S A;  3NAU A;  2IS2 A;  4JBA A;  4L9T A;  2CUE A;  2KRH A;  1SMY F;  3F6O A;  3T1B A;  3CZ6 A;  3PVH A;  4IJZ A;  2DCE A;  1Y8Q B;  2CW8 A;  5J1R A;  3HSF A;  4IQ4 A;  1IN4 A;  5BPD A;  3LA2 A;  3PFI A;  4XRM A;  1K7A A;  2BZT A;  1FP1 D;  1X2N A;  4Y13 A;  4MFD A;  2GAU A;  4I09 A;  4HV5 A;  5FKO A;  3ESW B;  2Y0S N;  3LSP A;  3MFK A;  1IDZ A;  2HWV A;  2P5L C;  4AID A;  1LFU P;  1T38 A;  3W2W A;  4A0Y A;  1PJR A;  1KQ0 A;  3ZR8 X;  3LSG A;  3OY9 A;  1UFM A;  1WJ5 A;  2L7F P;  2OAZ A;  3K4M A;  4JYK A;  3T0Y A;  1QU3 A;  3LSI A;  4AM3 A;  4BYY A;  2FQ3 A;  2STW A;  5M47 A;  3W6J B;  2O0Y A;  4UVB A;  1EJ9 A;  1YS7 A;  3F23 A;  2BVL A;  3EDN A;  4BJT A;  4A3D J;  2KIF A;  1BI0 A;  4AU7 A;  4RM2 A;  3JAM Z;  3B73 A;  1TM0 A;  1KU3 A;  3OL3 A;  4HST A;  2R7S A;  3TO6 A;  2FA5 A;  4WF2 A;  2PJP A;  3RZO J;  2DA4 A;  1VQL I;  4JCI A;  2GA2 A;  3ZQQ A;  3I71 A;  1EF4 A;  2ZXR A;  1D1A A;  1OQY A;  1JTX A;  2L9R A;  3MMY B;  3ONQ A;  3PQJ A;  1KQ9 A;  3QU6 A;  4JQF A;  1MJA A;  3OL4 A;  1WJF A;  1ACI A;  4E7L A;  1G2H A;  4XRF A;  4UB8 C;  2FU4 A;  3HOW J;  3PNY A;  2LG4 A;  1WWX A;  4YIF A;  4G9Y A;  3U1D A;  4BY1 J;  3FMQ A;  3I5U A;  2FX0 A;  1D1C A;  2DI3 A;  4Q47 A;  2DW4 A;  2NVU B;  2W85 A;  3VPR A;  2L9S A;  1XPX A;  1T08 B;  2E2J J;  1MD0 A;  3O2P E;  3CDL A;  5K5O A;  4HRI A;  2OCE A;  5CKT A;  5FKL A;  1UAA A;  1X1C A;  1BIA A;  1OR7 A;  3LA3 A;  3EYY A;  2LKP A;  2R93 J;  2R3S A;  4Y7N J;  1Y0U A;  2JSP A;  3K4C A;  5DM7 F;  4KA4 A;  1X1D A;  2VJI A;  5EGO B;  1B6A A;  2LY2 A;  2MH9 A;  3FDY A;  2KMU A;  1LJ9 A;  2F4I A;  2R7D A;  5ILS A;  3RKY A;  4XBF A;  2KRC A;  5IPA A;  4YFX F;  1UMQ A;  1TWH J;  3TGN A;  5DV5 A;  3CJN A;  4JX6 A;  2HNH A;  1P4X A;  4NBQ A;  3OWT A;  3BR5 A;  4LK1 F;  4JX5 A;  2JVH A;  3I53 A;  3H5N A;  1IZ1 A;  2BY0 A;  2NYX A;  2A5Y B;  4PJL A;  3Q9S A;  5HLI A;  3BG7 A;  4BJ5 C;  1FBQ A;  4I02 A;  1E2X A;  3FXQ A;  4RAF A;  3K70 D;  2LTP A;  1ZGA A;  2LBF A;  4E7J A;  4J9X A;  3BJ6 A;  2D1V A;  2K3P A;  3QWL A;  3RQ4 A;  3FHN A;  4UXN A;  4F91 B;  3FXM A;  2LY1 A;  5FD6 A;  2DDB A;  4MFE A;  2GQQ A;  2EB0 A;  2ISY A;  4U0V A;  2DT6 A;  2QQ9 A;  1B8I B;  5LD2 C;  3CC7 I;  2GXB A;  5C4J J;  2MH2 A;  4LLL A;  1UZC A;  3TO7 A;  4P9U A;  1YRN B;  4G7H F;  2HVR A;  2PLY A;  5EZG A;  3H9Q A;  4FQG A;  2QUF A;  1YIJ I;  3M9A A;  1LDK B;  2D2W A;  1V4R A;  2OPT A;  4M73 A;  3GZ5 A;  3DKY A;  3M1C A;  5LGN A;  2FML A;  5JVG F;  3N97 A;  4XLA A;  2XAH A;  2GLO A;  4B43 A;  2GKJ A;  1GUU A;  2HYJ A;  1Z6T A;  2JUC A;  1I1S A;  1Z21 A;  1XS9 A;  2AZP A;  1RC9 A;  2DU9 A;  3LWF A;  3KZZ A;  2BE5 F;  4BQN A;  1GXP A;  2ZME C;  4ZH4 F;  2AS5 F;  3RYR A;  3ASN H;  3H3Z A;  1GQZ A;  3I4M J;  2ENX A;  1B9N A;  4Y33 A;  2DFI A;  1WPK A;  1LEA A;  4B47 A;  4UVC A;  4AWX B;  4BXU A;  4DQ2 A;  1SFO J;  4NUB A;  2LFB A;  3G7K A;  2WAD A;  3HSE A;  1QGP A;  3C3W A;  2ZJP F;  2Y9Z A;  1GHC A;  4MTE A;  4A69 C;  1U6G A;  2VBX A;  2QQB A;  4F92 B;  3CJR B;  2PMZ A;  2CW0 F;  3SEZ A;  1QY9 A;  3E5U A;  3X2Q H;  1VF9 A;  3GEZ A;  3HTS B;  4M71 A;  2WB1 N;  3MWM A;  3P5J A;  4HX8 A;  3ZN0 A;  3K69 A;  4NHJ A;  3DTK A;  2Q9H A;  1X1P A;  3IH4 A;  2HQR A;  2OTJ I;  1G3Y A;  2GA1 A;  2GM4 A;  1ON1 A;  1TBX A;  1RIO H;  1T6K A;  2DAO A;  4A3G J;  1U9O A;  2IAI A;  3K4J A;  4G8X A;  2M8G X;  4UY8 I;  3EKM A;  3CCL I;  4OIO F;  1WGX A;  2PG4 A;  3UNG C;  3BR3 A;  5F6F A;  1S7A A;  4IPA A;  4N0B A;  3GLL A;  5H2Y A;  1UHM A;  1WKM A;  4KYW A;  2P5K A;  1BI3 A;  4BGD A;  5A2Q Z;  2Y0M A;  1YW8 A;  2Q0O A;  2NXN B;  4CIC A;  4ZDP A;  3FM3 A;  2LMD A;  2M3A A;  5KAI C;  3FK6 A;  3LFK A;  3OMY A;  1DGW Y;  3ZOB A;  3MKW B;  2R7Z J;  3V4G A;  2JA7 J;  2IW4 A;  2WAQ A;  4AYB N;  4CCK A;  3QPT A;  5HNH A;  1XUA A;  1RET A;  1WRJ A;  2XAQ A;  3BQY A;  1X3Z B;  4L0Z B;  2XHK A;  3CCE I;  1SAX A;  3BY6 A;  3DBR B;  1R36 A;  5K7F A;  5ILV A;  4ENN A;  4L0Y B;  2CQX A;  2MLK A;  2LKX A;  5AON A;  1SFX A;  2RNJ A;  5HVQ C;  1TL8 A;  1A31 A;  1ZRC A;  4HNV A;  2K9L A;  3GXO A;  1UEL B;  2NS8 A;  3SJM A;  3FX3 A;  1SAU A;  2QB8 A;  4B8X A;  1ETQ A;  4FT8 A;  1EKE A;  5AIP A;  5IP7 J;  1IF1 A;  2OTN A;  4WX9 A;  1QA6 A;  3H0G J;  1SD6 A;  2XPW A;  3Q9V A;  4ZYA A;  1W36 C;  1Q1V A;  3A03 A;  1YX3 A;  3FZV A;  3Q0W A;  3HRM A;  2L9N A;  2ECB A;  4LFU A;  1WJB A;  4N9H A;  4LS9 A;  2OF7 A;  1MW7 A;  4LIT A;  2XGD A;  4BHP A;  1B72 A;  3V8K A;  1TQI A;  1G6N A;  4LMY A;  3RQI A;  1LFB A;  2EIN H;  2HFH A;  3CUQ C;  2K9S A;  3O8G A;  3ZQG A;  2TCT A;  1W7P A;  3HHH A;  4A3M J;  3ROU A;  1JUM A;  4IRH A;  2X9D A;  1NHA A;  4EMS A;  2BEO A;  2ZO4 A;  4U0Y A;  3UKG A;  2DFF A;  4HG2 A;  4CYD A;  1AKH B;  2L5Q A;  1MNM C;  2V26 A;  2RKH A;  3G98 A;  4FAS D;  5CVI A;  1Z1D A;  1LEB A;  2KZG A;  3DKW A;  4G7Z F;  1T56 A;  1VQ6 I;  3ZMS A;  1S7E A;  3P9C A;  3NWT A;  4C2M J;  3AL0 C;  1DQU A;  4BHB A;  4I2O A;  1R4N B;  5FFX A;  4IHY A;  1FWZ A;  1ZRD A;  2L4M A;  3CQZ J;  2LC2 A;  5HLT A;  5C44 J;  4L5I A;  5FRN A;  1WPM A;  3CDH A;  4X0G A;  1Z91 A;  3JSO A;  1N75 A;  2DTZ A;  4LOC A;  4CCO A;  2OZ6 A;  1BBY A;  4AC0 A;  1XGN A;  5EEG A;  2F4M B;  2LKS A;  5K5R A;  2R7O A;  4LLN A;  4EAT A;  3NEU A;  2F5D A;  1MKM A;  4I6Z A;  2IGK A;  3ZQL A;  1V55 H;  4A0Z A;  3CJQ B;  2A69 F;  1DP7 P;  3BG5 A;  5K1Y A;  2JQ7 A;  4YII A;  4JK1 X;  2RVC A;  2KLO A;  2ZSI B;  5CPR B;  3WTX C;  1QPM A;  4R79 A;  2PMZ N;  1AKH A;  4DW6 A;  1N77 A;  4LJZ F;  5EJC A;  3V7R A;  3J7Y J;  2ELJ A;  4Y17 A;  2ZNZ A;  2E1C A;  2P7C B;  1XG1 A;  3KEQ A;  4BS9 A;  1OFC X;  2LRE A;  1GDT A;  2HDD A;  3DLA A;  2QVO A;  4O6J A;  5FLX Z;  2VT2 A;  4XKB A;  3WTU C;  1B8I A;  4JUU A;  1F4K A;  2M4K A;  3Q5F A;  2V9V A;  1UST A;  3S3O A;  3HOX J;  3MD2 A;  4AIK A;  2K86 A;  4ZDO A;  1Z05 A;  2I10 A;  1CF7 B;  3WU0 A;  5FKN A;  2KP6 A;  4CUG A;  1LUJ B;  2A68 F;  2VKE A;  4BXF A;  3PO2 J;  3KEY A;  5A2Q K;  1XMA A;  5E18 F;  4ZTJ A;  4ABZ A;  4B1R A;  1VQ4 I;  3BG9 A;  4IHW A;  1BOB A;  2IBD A;  4WXD A;  4RM3 A;  4ASN A;  1K23 A;  2ME6 A;  1R5H A;  2Y9Y A;  2BVM A;  2R7R A;  3V42 A;  3SYT A;  4BNC A;  2Q1Z B;  3CP2 A;  1HOM A;  2L9V A;  1PDN C;  4M6Y A;  3PJR A;  4C3H J;  3BG6 A;  2E2H J;  2FOK A;  4RB0 A;  3DF8 A;  3MN2 A;  1FPQ A;  1S9H A;  5HDN A;  2CO5 A;  1IRZ A;  3D0S A;  1A04 A;  1MMN A;  3W3C A;  2Q9J A;  4XOR A;  3G2B A;  3ASO H;  4UUV A;  3CCR I;  2P7V B;  2YX4 A;  4XLN F;  2PX9 A;  2IEK A;  2VUM J;  2MG4 A;  1H9G A;  2IVM A;  4U87 A;  3WGI A;  1YTY A;  4D7M A;  3OYD A;  1BL0 A;  5LGU A;  1SEU A;  3ZQF A;  3H0D A;  3AG1 H;  2QA4 I;  3IP4 B;  2ZBK A;  4P96 A;  3TW7 A;  5JLW A;  4RGR A;  1JUS A;  4E7S A;  2OQR A;  1ETX A;  3HDD A;  1MMG A;  1Z6R A;  3I56 I;  3CME I;  3OYH A;  2GXG A;  4O3M A;  1RZ4 A;  3A4C A;  5DCF A;  1UHW A;  3GBG A;  3G1L A;  3OS0 A;  3J7A Y;  1KA8 A;  2VPR A;  2VQG A;  2DA7 A;  3VOD A;  4UHT A;  1ZR4 A;  1SAN A;  1IN5 A;  2Y69 H;  3ZXS A;  1A36 A;  1T39 A;  2O61 A;  4FX4 A;  4XK4 A;  3IAS 2;  2E71 A;  2OCC H;  3COA C;  2LD5 A;  5E79 C;  3S1M J;  1WI3 A;  4S0H B;  1IGN A;  3EJX A;  1G59 A;  5F04 A;  3WGH A;  1JT6 A;  2NVT J;  4ZYE A;  3D5L A;  1EH7 A;  2W1O A;  2W4S A;  2G7H A;  5B1B H;  1IXR C;  2AQE A;  2EZH A;  2HZT A;  2H8W A;  2CUF A;  2F2E A;  4RGS A;  1K4T A;  1K6O A;  4I76 A;  2GKE A;  2W25 A;  3REO A;  2BXY A;  2KIQ A;  2K85 A;  1KYW A;  3B6A A;  4OWR B;  5IP9 J;  3GCM A;  2V1X A;  5K7Z A;  1BM9 A;  4KT6 A;  3IL2 A;  4KIT B;  1HKS A;  4N4N B;  4XN3 A;  1U5T B;  4J01 A;  1Y8R B;  1H9T A;  1XC5 A;  4H4K C;  2MD5 A;  4IOC F;  3K2Z A;  3GZ6 A;  2ZJQ F;  3S16 J;  2JT1 A;  2PQ8 A;  5DM6 F;  4HQE A;  3MQ0 A;  3IV5 A;  1WI9 A;  5KHD A;  2O5R A;  2CW7 A;  2WV1 A;  2HKO A;  5TIS C;  3OOP A;  5B1A H;  5LLQ A;  1OCT C;  4MQ9 F;  1MMS A;  4M6X A;  3JRE A;  1KU9 A;  4XNF A;  2R5Y A;  2YMA A;  2EFQ A;  1V3F A;  3WTS C;  2ZXO A;  1TTY A;  2BHZ A;  3KIO A;  3DTE A;  2XAU A;  1YIO A;  3CO6 C;  2LLK A;  2B7E A;  2JN6 A;  1LB2 A;  3C2B A;  1KZH A;  4ANJ A;  4E6K G;  4XLC A;  2KZV A;  2B9S A;  1GT0 C;  3MKZ A;  4XKC A;  3G73 A;  4IVN A;  4BAC A;  2CV0 A;  3GTL J;  4XIC A;  4QWQ A;  5IP6 A;  1TWG J;  1MH3 A;  2Z3Y A;  4GGG A;  4WXC A;  3IKV A;  3A01 A;  2QSH X;  4Y3O A;  1LE8 B;  3P7N A;  3CD6 I;  3PTJ A;  4DYR A;  3DTI A;  1VZ0 A;  1YFH A;  3HKZ N;  2AXT C;  4EM0 B;  5DYM A;  5E8I A;  1SFK A;  4P55 A;  1Y39 A;  3K10 A;  2IJL A;  2EV0 A;  3TDZ C;  3GTO J;  3B6C A;  3WOD F;  2RV8 A;  5IYD J;  1VQ7 I;  2RRE A;  2DK8 A;  3H3U A;  4D5F A;  4U0W A;  1XSD A;  2EFW A;  4UB6 C;  1YS6 A;  3HM5 A;  4WCG A;  4BQA A;  2A05 A;  1OCC H;  4C30 A;  2A07 F;  4F93 B;  4XL9 A;  2VLA A;  2NOG A;  3S15 J;  5J1U A;  3VWB A;  3FHZ A;  1J09 A;  4RB3 C;  2FMY A;  3BZ6 A;  5H2F C;  1FLI A;  4G6T B;  4KIF A;  2XC7 A;  2OA4 A;  3SHF A;  2PJR B;  4G94 A;  2KIU A;  3PQK A;  4E7Z A;  2FBK A;  4IKF A;  1UG0 A;  5GAD J;  3CJT B;  1L3L A;  1DGR M;  3IH2 A;  4HLX A;  3GTP J;  4LB0 A;  4B44 A;  1Y6I A;  4E4H A;  1TT0 A;  2LY9 A;  3DBL B;  3D5S C;  5FKM A;  2HPI A;  2G9W A;  1KGS A;  1USS A;  3HOT A;  3A0H C;  2LF7 A;  3VSL A;  3KP5 A;  1PP7 U;  2RC4 A;  2IA2 A;  1S72 I;  2H8R A;  3HUG B;  1R23 A;  1FNN A;  2JRM A;  2L7M P;  4D0P A;  2WAF A;  4PSW A;  2L01 A;  5CVU A;  4B48 A;  2HOS A;  3CCS I;  1U8R A;  3N05 A;  3JRA A;  3OYM A;  1O4X A;  4KMF A;  2X0L A;  3HRU A;  1YJN I;  4C2T A;  1ZRE A;  1D0Z A;  4IOA F;  2FUG 2;  4CO8 A;  1WZ2 A;  1F1Z A;  3DEU A;  4KN4 X;  1X3W B;  2B0L A;  4HPQ A;  5LRS A;  1YYV A;  4IF4 A;  3PUB A;  4Y15 A;  5FO5 A;  5FRM A;  2BOL A;  3DU5 A;  5DCM B;  3M3Y J;  4DJA A;  2QB7 A;  2M7A A;  2A61 A;  1MSF C;  3MAJ A;  2KW7 A;  3IC7 A;  2VON A;  2W48 A;  3LMM A;  2YU9 J;  1S5L C;  3ERE D;  3GO5 A;  4R1H A;  4M6V A;  5JLX A;  4PK4 A;  1DP3 A;  2DA5 A;  1MND A;  2HDC A;  3GTK J;  5EF6 A;  2WAQ N;  4N4O B;  1TW3 A;  2M5W A;  4AYB A;  1F5T A;  1RI7 A;  2W24 A;  1JGG A;  2UXX A;  4OAZ A;  3I64 A;  1O3R A;  1HQC A;  2M9H A;  1IV8 A;  3K1M A;  1T6S A;  2MLG A;  3CCM I;  3OSG A;  1JKQ C;  1JHH A;  2BY2 A;  4F3Q A;  2R7X A;  2QKL B;  1LE8 A;  2ACJ A;  3F8B A;  3F21 A;  3I59 A;  3LSK A;  5DD8 A;  5CQE A;  5JHU A;  4RB2 C;  2BYV E;  1I6H J;  3ML6 A;  3H92 A;  1MBJ A;  4WK8 F;  4A3J J;  2XIG A;  3BR0 A;  2HZD A;  2H9F A;  3CDI A;  4MQV A;  5CQG A;  2CV1 A;  4L9J A;  2Y2Z A;  3H5A A;  1D1B A;  2MFZ A;  1T0F A;  2RAE A;  3JCU C;  5FD5 A;  1P92 A;  1ZR2 A;  2VKH A;  3BG3 A;  3A0B C;  1E3O C;  1GVJ A;  3VFZ A;  2LVS A;  2ZFW A;  3ELK A;  1MNE A;  2M45 A;  2EIL H;  1HW2 A;  3DU6 A;  3LFU A;  4YG2 F;  2R7F A;  1ZK8 A;  2VIX A;  3ERM A;  3GWZ A;  3PO3 J;  2DTR A;  1W7P D;  2W7N A;  3GFM A;  2OZU A;  3NQO A;  4ENM A;  4FTH A;  1K78 A;  2ZVF A;  2MC3 A;  3DPT A;  3CF5 F;  4KIC A;  4HZF A;  2FBI A;  1UCR A;  3ECO A;  2KJB A;  2WC2 A;  4KFC A;  4S05 A;  5GPC A;  4LIV A;  2XUB A;  1M1E B;  3FM5 A;  4IEJ A;  1J0R A;  2CQ7 A;  3OV8 A;  1O57 A;  5B5E C;  3GZN B;  1RKW A;  2YU3 A;  1MIJ A;  2E1N A;  3TOB A;  3EDP A;  2EJR A;  1ONV A;  1QYA A;  3KE2 A;  2CGP A;  1O7L A;  1FEX A;  5B3S H;  3VYU B;  4EQQ A;  4IO9 F;  3CO7 C;  2ECC A;  4HA8 A;  3SQN A;  2PJR A;  3AFH A;  3BPV A;  3E6M A;  2WB1 A;  4XSX F;  5E3L A;  5M3M J;  2CUZ A;  2X6X A;  1WVR A;  1VQM I;  3V7S A;  4XID A;  2QEX I;  1A35 A;  3GTM J;  5D6E A;  4QLC U;  3J7A O;  3EUH C;  5FJ8 J;  2VT3 A;  4AIH A;  2DYR H;  3H9G A;  3KYL A;  2R7Q A;  3HL2 A;  3S1R J;  2XPU A;  4BL0 B;  4AD9 A;  1IR6 A;  2EA4 A;  3S8P A;  4HLY A;  4Y52 J;  4HW0 A;  1QZY A;  2HAW A;  2HPM A;  2MYS A;  1YE9 A;  1Z0X A;  3VDX A;  2ZFU A;  4ZYD A;  4GRI A;  3GTJ J;  5EYR A;  1ZGJ A;  1E3H A;  3BTI A;  3ZMZ A;  4II2 A;  4QSH A;  2VBY A;  2LT2 A;  3HBL A;  5IOY A;  4XR6 A;  3TP0 A;  1FYL A;  4IK0 A;  2DFE A;  3CLQ A;  2VOP A;  4HF1 A;  3OIO A;  3ICJ A;  1FIP A;  1SD7 A;  2DYS H;  4K2E A;  2JWT A;  1KYZ A;  2M1B A;  3HUG A;  5TGT A;  1MJ9 A;  1BR2 A;  5LRR A;  1K6Y A;  2COM A;  2H27 A;  1JHF A;  4NC8 A;  2PMH A;  3E6D A;  2GXA A;  4X6A J;  1QBJ A;  1R5I D;  1G3T A;  4M3E A;  4JX4 A;  3KLO A;  2QB6 A;  5E3O A;  1XMX A;  2W00 A;  4M3F A;  4IZZ A;  4O5V A;  1OCP A;  3MCZ A;  2XB0 X;  1W5S A;  4XRS G;  3PW9 A;  2H94 A;  3SXY A;  4PFP A;  5GAG J;  5HOO A;  4ENJ A;  2K40 A;  3ZMV A;  4W1U A;  4CYC B;  1KU7 A;  1J7K A;  3U2R A;  2A6T A;  5HS7 A;  4C2U A;  4BDY A;  4GYI A;  3U21 A;  2L3D A;  1FYK A;  4P1W A;  5FGM A;  3E0J B;  1ORK A;  5H20 A;  3RKW A;  3TBI A;  1RPW A;  1RKT A;  3I59 B;  3C1D A;  2DOA A;  2JJ7 A;  2ICW G;  3FMR A;  3L09 A;  3WE2 A;  1CGP A;  1R58 A;  2E36 A;  2HOT A;  2L2O A;  5F08 A;  4Y4R A;  3G1O A;  5BQT A;  4CA0 A;  5DEQ A;  4ZZD A;  1DU6 A;  2VL8 A;  1VQ5 I;  2F5E A;  2PW0 A;  4D7N A;  5CVJ A;  2PEX A;  1W62 A;  1XSV A;  3S17 J;  3T8T A;  3TOA A;  3ZQ7 A;  2C6Y A;  4TV7 A;  1OYI A;  2Y30 A;  3KZI C;  5KAF C;  3SFI A;  1F9N A;  2VB6 A;  1T33 A;  3FXJ A;  1XN7 A;  3ZP5 A;  3KPH A;  2STT A;  1S7O A;  1XCB A;  1Z3X A;  3F72 A;  2M2E A;  3QU3 A;  4IL6 C;  3BQZ A;  5E3M A;  1LVA A;  3DPU A;  3EPZ A;  3HYI A;  3K1P A;  2CFX A;  1IUF A;  1WPP A;  4MTD A;  2CG4 A;  4XM3 A;  4BEH A;  5GAE J;  2H1L A;  2QGU A;  3WTY C;  1LDJ A;  1B1B A;  4PDK A;  4CYC A;  3S2H J;  2XRL A;  1W5T A;  5KCM A;  3L2Q A;  2ZXP A;  1OYW A;  3D1N I;  2XAF A;  1FX7 A;  2MGQ A;  5KK1 A;  3E6C C;  1U1X A;  2CRG A;  3EUA A;  2QCO A;  1FBU A;  2V1U A;  3FF5 A;  2GZW A;  4Q4Z F;  1BN5 A;  1CF7 A;  3IGH X;  5F0F A;  4S04 A;  1ON2 A;  4KUM A;  2COB A;  1U3E M;  1OCZ H;  2Z33 A;  4YRV A;  3R0A A;  4RGU A;  2KL4 A;  5KNL A;  3A2K A;  2HTS A;  2VOD A;  2O7O A;  2GOM A;  1FOY A;  4RDU A;  2MW8 A;  1HA8 A;  4AVP A;  1U5T A;  2HOA A;  5FFZ A;  4GCV A;  4OIQ F;  2CSO A;  2FEZ A;  1S29 A;  2UV1 A;  3RZD J;  2BBY A;  4QIW N;  2Y48 A;  4OAY A;  3MKY B;  3Q3S A;  1WFX A;  3ISP A;  4XLH A;  3I55 I;  3DFG A;  3I4N J;  1QVU A;  1SFE A;  5D5V B;  3S93 A;  5BOX A;  2F5C A;  2JK3 A;  4RS8 A;  3SZG A;  2NAZ A;  4XSZ F;  3BCA A;  1R49 A;  1YLF A;  3OR2 C;  2V4J C;  3O3K A;  3R4K A;  2R7T A;  3BZK A;  2RGV A;  3C7J A;  3CCY A;  1MGT A;  2M0C A;  4LIU A;  4V19 K;  3MZ8 A;  3GTQ J;  1BR4 A;  1ETK A;  1P4W A;  1ZKG A;  3A01 B;  1R7J A;  3CTA A;  4ZYG A;  3WG7 H;  2X6W A;  4HDU A;  4ESJ A;  4HX4 A;  4PJ0 C;  2K3F A;  2JTV A;  1T2K A;  2OV7 A;  2BV6 A;  3D5R C;  1IAW A;  2PN6 A;  3DWL E;  3VYR B;  1D5Y A;  1ZAO A;  4IX7 A;  1H0M A;  2L54 A;  3RCO A;  4BUP A;  3RPU A;  1WJC A;  1R1U A;  4DZJ A;  2HGC A;  1NK3 P;  1TC3 C;  1FOX A;  4HQM A;  2M30 A;  4MO7 A;  4RBO A;  5FRO A;  1E0E A;  3BR1 A;  3CF2 A;  4A3F J;  1U9N A;  2EK5 A;  4EGZ A;  1X4O A;  2NVX J;  2KPT A;  4Z6Y A;  1J9I A;  1YW7 A;  2FRH A;  4NNJ A;  5DDG A;  2R5Z B;  2DQR A;  1FT9 A;  5D4S A;  4GO1 A;  1IN7 A;  3GME A;  4LLG F;  2VJJ A;  3HPG A;  5CVV A;  3H3V K;  4ZDL A;  5L3B A;  2IGM A;  1ZG5 A;  3BTL A;  3VB2 A;  3P9K A;  5M5W J;  1H88 C;  3DXJ F;  3M8E A;  1D8K A;  2QBY A;  4HNU A;  2IS6 A;  2WV0 A;  5HDG A;  2XGC A;  1SD4 A;  1ZHF A;  3LST A;  3GYH X;  4BE1 A;  2O9L A;  3CES A;  1ZRF A;  3PNT A;  1HSJ A;  2EFO A;  1W4M A;  2AQF A;  2X4H A;  4UUT A;  1PP8 F;  5M5X J;  4M9X A;  4Q5S F;  3OYA A;  2XAJ A;  2NRA C;  2X1E A;  2MPB A;  3EET A;  4KT5 C;  4A12 A;  1TZL A;  2XGE A;  2P6T A;  2Z9O A;  4RPA A;  2VQL A;  3CCQ I;  3L2V A;  3CUQ B;  4PUS A;  1VQK I;  1NG6 A;  4EJW A;  4KN7 X;  4CCL A;  3OOU A;  4FCY A;  2M0M A;  2QEN A;  5J40 A;  1X19 A;  2O3F A;  2XDV A;  5ICF A;  4EJU A;  1DU0 A;  5HS9 A;  2E2I J;  3TKY A;  1YM5 A;  1QZZ A;  3RSN A;  3P9I A;  4IRI A;  4GL6 A;  2FBH A;  3IRQ A;  1XMK A;  4EGY A;  3PM1 A;  1IV6 A;  4YFN F;  4CSW A;  3J80 Z;  3JAM K;  2HQ5 A;  1B4A A;  5J8C A;  5D4R A;  4BBR J;  3E3V A;  1EH6 A;  1OIS A;  3BTC A;  3F0C A;  1I50 J;  1YIT I;  3RPQ A;  3K4B A;  4CCJ A;  2GIV A;  4ESF A;  3TMO A;  4EVI A;  2E19 A;  4J19 A;  3CC2 I;  2AXL A;  1SD5 A;  2RQP A;  2XGX A;  2XF5 A;  2Q2E A;  3HZJ A;  3KLN A;  4P5O A;  2O03 A;  1A6Q A;  1MZB A;  3M1E A;  2ADU A;  2PBI A;  3A1Y A;  3EQL F;  4XRS A;  5DTD A;  3ABM H;  1D5V A;  2NNN A;  3OYB A;  4MHG A;  1ENH A;  5LBQ A;  2IA1 A;  1WJD A;  4ENK A;  2EZI A;  3KP4 A;  4DGW B;  3KYC B;  4ZTF A;  2GWR A;  5ERI A;  2VOO A;  1JI8 A;  2BHY A;  1U1V A;  3BC8 A;  2DLL A;  2ZME B;  1A6I A;  3LA7 A;  3LNQ A;  2AO9 A;  2DA3 A;  2VE9 A;  4KIS A;  1LVK A;  1K61 A;  1DDN A;  2N8G A;  4HAM A;  3HC7 A;  1JXS A;  4XON A;  4B3A A;  1D0Y A;  2K5C A;  3GLX A;  2B63 J;  1U0J A;  3PSI A;  4BE2 A;  2IPQ X;  2X85 A;  2LNB A;  2KJC A;  1ZTR A;  2HEO A;  5ICE A;  3HB9 A;  3KCC A;  1R4M B;  1PUF A;  3O6B B;  4YEJ A;  1D3Y A;  2CFO A;  2P0W A;  4BY7 J;  1S8N A;  4A2U A;  4QPQ A;  3NWS A;  3R6S A;  1TNT A;  1O3T A;  2NNY A;  4M9S A;  1R6R A;  2BY1 A;  5E1Z B;  1ZQ3 P;  1HDD C;  3EUH A;  5KVR A;  4LG0 B;  4CH7 A;  4M3D A;  3T8R A;  3SDB A;  3FKI J;  3WTT C;  4W97 A;  2KFD A;  4HSR A;  3S32 A;  1MBE A;  2CMP A;  2XRO A;  3HRS A;  5LEJ A;  3QOP A;  4KJZ A;  3DLL F;  1XTA A;  1TLH B;  2YUS A;  3KP3 A;  4M74 A;  3AKZ A;  2VKD A;  1I3Q J;  2V1N A;  1S6L A;  2OQG A;  4B4C A;  1V5G A;  2DMU A;  2HI3 A;  2I5U A;  1HLV A;  1NH3 A;  4IXA A;  3FBI B;  2PFB A;  5TJJ A;  1REP C;  1VQ9 I;  4MEY F;  3WU2 C;  4J00 A;  4ESB A;  1FMV A;  1HKT A;  3FXU A;  1N78 A;  2ELK A;  1FBS A;  3F3X A;  1BC8 C;  3JRF A;  3CCU I;  1SVL A;  4BJ6 C;  3WTZ A;  5EZH A;  3BWG A;  3KYD B;  2YR2 A;  1IG7 A;  1YJ9 I;  4LB6 B;  5HLH A;  1B59 A;  4GXO A;  2IXS A;  4M3B A;  4Q60 A;  5CYV A;  3HEF A;  3K6G A;  2FNA A;  4FX0 A;  2CV2 A;  1AU7 A;  1TP4 A;  2KDZ A;  1I39 A;  1OMI A;  1R1V A;  3LSM A;  4GFB A;  2V9P A;  4A6E A;  5DUK A;  3KX2 A;  3ZMU A;  1U2W A;  1FTZ A;  3MKL A;  4CZC A;  3IWZ A;  4LG0 A;  2QQA A;  2F5V A;  4M72 A;  4LD5 A;  2VPL A;  4LGW A;  1P7I A;  3AG4 H;  3IHU A;  2KPM A;  3QPL A;  5EEH A;  3SDG A;  3JRB A;  1BC7 C;  4FET A;  2D1H A;  5HLG A;  2ZSH B;  4A3K J;  3ZRG A;  2K27 A;  5EG0 A;  2RQQ A;  5BMZ A;  3HOS A;  2XPV A;  3F8F A;  1W0U A;  1OR7 C;  4OMZ A;  4PCQ A;  5D8L B;  3CLO A;  5ICG A;  1FMW A;  3OS2 A;  1FSH A;  4BQO A;  4WXH A;  1GVD A;  4L9N A;  5LHG A;  5FKK A;  3DEE A;  2P81 A;  3I54 A;  2P5V A;  3CMM A;  3J7Z I;  1R9T J;  4XLF A;  1POG A;  3ZN1 A;  5H6Q A;  4B09 A;  1YJW I;  3GF2 A;  2L0K A;  3QRF F;  3OSF A;  2Z16 A;  1YHQ I;  3BP8 A;  2K9N A;  3GUD A;  2GBY A;  3W2V A;  1Y1V J;  1GXQ A;  3HJE A;  2MBF A;  2HVQ A;  4U88 A;  2EQR A;  3Q0U A;  1IRG A;  2M7B A;  3HHG A;  3BLY A;  3CUQ A;  5E20 A;  2BY3 A;  4OOI A;  3LSJ A;  2VE8 A;  3BJO A;  2VXZ A;  3HOU J;  1J5Y A;  2R7U A;  2DOE A;  3I58 A;  1LDD A;  5J3L A;  1YI2 I;  1IRF A;  2P8T A;  4OA3 A;  1MMD A;  4A3B J;  1MDM B;  2BW3 B;  4H0E A;  4OMY A;  3G1M A;  4RAG A;  3DBH B;  3OIP A;  2UWM A;  3I0T A;  2OC6 A;  1BIB A;  1QVT A;  2HOE A;  3HTU A;  4PZJ A;  4II3 A;  3ZCO A;  1FP2 A;  2Q8K A;  4DYC A;  5J4V A;  3S3M A;  2JPC A;  2MSY A;  3ZQH A;  3JRG A;  1YQA A;  2D5V A;  2F48 A;  3T5X A;  3RI4 A;  5D5W B;  1JJ8 C;  3DEV A;  2RNG A;  4ZYH A;  1VND A;  2XVC A;  2PMU A;  1BJZ A;  2DMP A;  2O6G E;  3HGG A;  3PSF A;  1TW2 A;  4RAY A;  3BOQ A;  2OBP A;  5J6X A;  1ZG1 A;  4M3G A;  1IUY A;  2LH9 A;  4KIB A;  2K7L A;  4PJN A;  1HKQ A;  2J5P A;  4L5J A;  2LDU A;  3DCF A;  5HS8 A;  1RNL A;  1Z7U A;  3QP6 A;  4RLF A;  2H09 A;  1ITY A;  2KIM A;  4FIS A;  3ECH A;  3CC4 I;  2ETH A;  2KDO A;  3IRR A;  1T98 A;  2PI0 A;  5J8F A;  1XUB A;  4FHT A;  2VXD A;  1UB9 A;  1XGO A;  3W2A A;  4G6D A;  2ZXJ A;  5E8G A;  5BNG A;  1BA5 A;  1P6R A;  2Q2E B;  3F9K A;  2HVS A;  5M3F J;  4DBQ A;  3W6V A;  4PY9 A;  2IT0 A;  3ABT A;  4PSX A;  1XDS A;  5IWE A;  5EDN A;  1GV5 A;  2GIZ A;  1APL C;  2CH0 A;  1I27 A;  1JT0 A;  2EFP A;  4QTR A;  4V2F A;  5E1X A;  2LYC A;  5D8K B;  1U8B A;  2KRF A;  1W36 D;  1VQN I;  2EH3 A;  3LOC A;  2WY8 Q;  4A3E J;  2DA1 A;  4YEL A;  1HXD A;  1X58 A;  1JKP C;  3QPH A;  2F4O B;  4UV8 A;  3LAJ A;  5F1J A;  3PIO F;  2JUG A;  4AVZ A;  3JSP A;  4ZZL A;  2K4B A;  4C3J J;  2K4J A;  5GTH C;  3CMY A;  2E7W A;  1Y1W J;  1I3A A;  2QBY B;  5CLS A;  1UHS A;  1G3W A;  2GOX B;  3DKX A;  4CDG A;  1X2M A;  1STZ A;  2R0Q C;  1KQ8 A;  3ZGK A;  3TO9 A;  3DP7 A;  3QQA A;  2EZL A;  4KDP A;  3WTV C;  1HDP A;  2XV4 S;  1WCM J;  3CUO A;  1PUE E;  5FLX K;  2HTJ A;  3RKQ A;  5IYC J;  2R5Z A;  3ABK H;  1RR7 A;  1RRJ A;  3CP8 A;  2XF6 A;  3MZY A;  2OTL I;  2WBM A;  1MBG A;  2VC0 A;  4XMY A;  2CUJ A;  1IW7 F;  3KZY A;  3TL4 X;  5HDK A;  1MBF A;  2LRD A;  4L5E A;  3BCB A;  1BI1 A;  2JMW A;  3AG3 H;  4I0A A;  4NQW B;  3TDU C;  3BPX A;  1RR8 C;  4KMU X;  1B72 B;  1XSX A;  4YFK F;  1Z9C A;  5JVT A;  2LR8 A;  2V79 A;  1I1G A;  3R61 A;  1E3P A;  1IO2 A;  4IJA A;  3JRI A;  9ANT A;  3S14 J;  4A3I J;  3HGY A;  4D5C A;  4A93 J;  5IT9 K;  1SMT A;  2E60 A;  2HKX A;  2EB7 A;  2KHM A;  3KET A;  3M7G A;  4LB5 A;  1UJ8 A;  2TDX A;  2MAB A;  3E7L A;  1WH5 A;  1IXS B;  1K83 J;  3V8L A;  2YX7 A;  5ICC A;  1LQ1 A;  3OYG A;  1SVM A;  1F43 A;  2WWY A;  2JA6 J;  2K9M A;  1F36 A;  3U9G A;  3WU1 B;  3WQZ A;  4AIJ A;  3FIW A;  2HXI A;  4BDZ A;  3QYE A;  5JHF A;  5LFA A;  1LPQ A;  3MVP A;  1V5F A;  1DUX C;  1WJE A;  4CGZ A;  3R0J A;  3F8N A;  5FB2 A;  4E7H A;  3ZPL A;  2ID6 A;  1J75 A;  4F52 A;  3GVA A;  2LBF B;  3HSR A;  1SFU A;  1FZP B;  4U7D A;  1IN8 A;  1K4S A;  3PUF A;  5F1R A;  2YSR A;  1S3J A;  4XQF A;  4CZZ A;  1O7F A;  4NQW A;  4EEF G;  3L1P A;  2AHQ A;  2ISZ A;  3KFW X;  3HOY J;  3SFZ A;  3F6V A;  1XDU A;  2R92 J;  1TT5 B;  2VBZ A;  2DDA A;  4XKV A;  1K20 A;  4PGH A;  3M07 A;  3CMA I;  4HEA 2;  4A6D A;  4A3C J;  3L9F A;  2EPF A;  2EV5 A;  3PNV A;  2DMT A;  3FXK A;  3RPU D;  2IS1 A;  3DV8 A;  2DK5 A;  4G6Q A;  2VBW A;  2G7U A;  1G8X A;  4G7O F;  4I99 C;  4OIN F;  1ODD A;  2E35 A;  3C2H A;  3DEW A;  3HG9 A;  4BAY A;  4RB1 A;  2M87 A;  1V5E A;  2HQA A;  2QWW A;  3BTJ A;  2IP2 A;  4BU2 A;  2DMN A;  1FC3 A;  5F64 A;  1VQ8 I;  1WQ2 A;  2DBB A;  2E7X A;  2Z5U A;  3U1K A;  2FF4 A;  1OCR H;  5LGT A;  3ZMD A;  4HF0 A;  1SC7 A;  3BJA A;  4K7X A;  3LAP A;  1CQT A;  5H6R A;  3S2W A;  2DA2 A;  2L7Z A;  3ABL H;  3H5R A;  4BXX J;  3PIP F;  1W1W E;  1VQO I;  3A02 A;  3K9T A;  5DUI A;  2IRF G;  1Z3Y A;  3H9J A;  2EIM H;  1ETY A;  1X1B A;  4DBR A;  4U7B A;  5ILU A;  2LOO A;  1TWA J;  3BZC A;  4E7K A;  1A5J A;  3OYE A;  2ELH A;  1BOA A;  2QQ8 A;  1VTN C;  3MZH A;  5IT3 A;  1YG2 A;  2IW5 A;  2FXA A;  1W0T A;  2HDW A;  3PL8 A;  3H36 A;  1AWC A;  4I0B A;  1QO0 D;  2P4W A;  1MMA A;  2UXN A;  2IGN A;  4KIG A;  5F0C A; 
#chains in the Genus database with same CATH homology
 3LSG A;  4ANJ A;  4E6K G;  1WJ5 A;  4XLC A;  2KZV A;  2X1E A;  3K4M A;  3OY9 A;  3OYA A;  3MKZ A;  3LSI A;  1QU3 A;  2MPB A;  4XKC A;  1TZL A;  4RPA A;  2VQL A;  4BAC A;  3L2V A;  4RLQ A;  2CV0 A;  5M47 A;  1SDJ A;  4PUS A;  1NG6 A;  3K70 C;  2ZXI A;  4JD7 A;  4CCL A;  3OYN A;  3OOU A;  2M0M A;  4XLE A;  2BVL A;  4Y3O A;  3EDN A;  4BJT A;  1X19 A;  3PTJ A;  2XDV A;  4AU7 A;  1KON A;  3DTI A;  3C2G A;  4RM2 A;  1TM0 A;  1VZ0 A;  1NG7 A;  3OL3 A;  4HST A;  2MC4 A;  2R7S A;  1YM5 A;  4JCI A;  3RSN A;  4GL6 A;  3EUK L;  3ZQQ A;  4CSW A;  2ZXR A;  1SFK A;  1D1A A;  3HPH A;  3K10 A;  3ONQ A;  3MMY B;  1PYV A;  1Y56 A;  4JQF A;  3OL4 A;  1WJF A;  4E7L A;  3S3N A;  2RRE A;  3K4B A;  4CCJ A;  3L2W A;  3PNY A;  2LG4 A;  1QHH D;  3TMO A;  2X51 A;  4C30 A;  4F93 B;  1D1C A;  4XL9 A;  2VLA A;  2XF5 A;  2L7K A;  4P5O A;  3VWB A;  1J09 A;  3K4N A;  1X1A A;  2L9S A;  4RMN A;  3HXL A;  3A1Y A;  4HRI A;  4G6T B;  5CKT A;  2XC7 A;  1UAA A;  2PJR B;  5H2G A;  1X1C A;  3OYB A;  4XKW A;  4E7Z A;  1WJD A;  3LSH A;  4IKF A;  4DGW B;  1UG0 A;  4ZTF A;  2JSP A;  3K4C A;  4PJJ A;  3QOE A;  1X1D A;  2VJI A;  1DGR M;  1JI8 A;  4LB0 A;  2E1M C;  4B44 A;  1Y6I A;  2LY2 A;  3FDY A;  4QPO A;  4E4H A;  1TT0 A;  1U1V A;  2KMU A;  3BC8 A;  3D5S C;  2F4I A;  2HPI A;  3I9V 2;  1U0K A;  3HOT A;  2KRC A;  3VSL A;  4KIS A;  2E5Z A;  2E5N A;  2HNH A;  1LVK A;  3W5W A;  3OWT A;  3HUG B;  4CCM A;  4JBD A;  2JVH A;  3HC7 A;  2WAF A;  3H5N A;  4PSW A;  4XON A;  4B48 A;  1D0Y A;  4PJL A;  2K5C A;  3BG7 A;  1U0J A;  2DT7 B;  3PSI A;  4BJ5 C;  2X85 A;  3N05 A;  3OYM A;  4BE2 A;  3K70 D;  2LBF A;  4C2T A;  4E7J A;  1OLT A;  1D0Z A;  4J9X A;  2FUG 2;  5HA4 A;  4CCN A;  4YEJ A;  2K3P A;  3RQ4 A;  1AA7 A;  2CFO A;  4HPQ A;  2P0W A;  3FHN A;  4F91 B;  3PUB A;  2LY1 A;  4QPQ A;  5FRM A;  2BOL A;  3NWS A;  3DU5 A;  1X4P A;  1R6R A;  2EB0 A;  4DJA A;  2QB7 A;  4CH7 A;  2DT6 A;  2M7A A;  3SDB A;  5LD2 C;  4HSR A;  2HVR A;  3S32 A;  2CMP A;  1W61 A;  2KW7 A;  3LMM A;  4KJZ A;  3H9Q A;  3AKZ A;  2JA2 A;  4ITV A;  2VKD A;  1P9Q C;  2V1N A;  1LDK B;  4PFO A;  1V5G A;  3DKY A;  3M1C A;  1QHG A;  2VJ5 A;  4XLA A;  2GKJ A;  4PK4 A;  1PJR A;  4B43 A;  1DP3 A;  3FBI B;  4D1Q A;  1MND A;  4J00 A;  1FMV A;  4N4O B;  4AYB A;  2I8D A;  1Z21 A;  4DOZ A;  1N78 A;  4OAZ A;  2AZP A;  5HNF A;  4BJ6 C;  2WAE A;  4F3Q A;  2R7X A;  2QKL B;  4BQN A;  3FVE A;  2IXS A;  4Q60 A;  2DXI A;  2VQC A;  1LKX A;  3LSK A;  5CQE A;  3K6G A;  1GQZ A;  2ENX A;  4Y33 A;  4B47 A;  2HPM A;  2CV2 A;  2HZD A;  3HKZ A;  2H9F A;  1WJA A;  5ANP A;  5CQG A;  4XN0 A;  3VSK A;  2CV1 A;  1BWZ A;  3H5A A;  3LSM A;  4NUB A;  3G7K A;  1D1B A;  2WAD A;  3KX2 A;  2MFZ A;  1EA3 A;  4CZC A;  4F92 B;  3CJR B;  2F5V A;  2VKH A;  2PMZ A;  2VJ4 A;  4ZJZ A;  2HU9 A;  3SEZ A;  2WY7 Q;  1MNE A;  2VPL A;  1QY9 A;  2KPM A;  3DU6 A;  3LFU A;  4FET A;  3FKJ A;  3DTK A;  4BE0 A;  2ZSH B;  2VIX A;  2Q9H A;  3ZRG A;  2RQQ A;  3HOS A;  2W7N A;  1OR7 C;  1T6K A;  2Y0S A;  2Z1D A;  3K4J A;  2ZVF A;  3DPT A;  1FMW A;  3OS2 A;  3EKM A;  4BQO A;  3UNG C;  3DEE A;  4LIV A;  2VQH A;  3CMM A;  5H2Y A;  4XLF A;  2M4G A;  2KQR A;  4BGD A;  4ZDP A;  2Z16 A;  3OYF A;  2V7F A;  1QYA A;  2M3A A;  3OMY A;  1DGW Y;  3W2V A;  3MKW B;  2WA0 A;  3VYU B;  2IW4 A;  3OYK A;  2IS4 A;  2HVQ A;  2WAQ A;  4CCK A;  1XUA A;  5HNH A;  2PJR A;  3AFH A;  2M7B A;  3K4K A;  3BLY A;  2WB1 A;  2CUZ A;  2X6X A;  2VXZ A;  4ZC3 A;  2UUZ A;  5HVQ C;  2R7U A;  2K9L A;  3EUH C;  1UEL B;  4OA3 A;  1MMD A;  1SAU A;  3H9G A;  3KYL A;  2R7Q A;  2BW3 B;  2QB8 A;  2X6Y A;  3RTR A;  3HL2 A;  4BL0 B;  3OIP A;  1IR6 A;  3S8P A;  2UWM A;  2HAW A;  2OTN A;  2OC6 A;  4ZYA A;  2MYS A;  4II3 A;  3ZCO A;  2A5W A;  1W36 C;  4DUN A;  3S3M A;  1YE9 A;  1YX3 A;  2ZFU A;  3VDX A;  3OS1 A;  4GRI A;  2L9N A;  1WJB A;  4II2 A;  3DEV A;  2RNG A;  4J9W A;  4LS9 A;  2LT2 A;  1MW7 A;  4LIT A;  4XR6 A;  4IK0 A;  2PVZ A;  3SEQ A;  3PSF A;  3ICJ A;  3K4L A;  5TGT A;  1BR2 A;  3FBN B;  1K6Y A;  4NC8 A;  1LFP A;  2LH9 A;  2W82 A;  4PJN A;  2V9K A;  2QB6 A;  3IUO A;  4RLF A;  3PFY A;  4HG2 A;  2W00 A;  4IZZ A;  2L5Q A;  3VYS B;  2V26 A;  4D9J A;  3G98 A;  4FAS D;  2KDO A;  3PW9 A;  1XUB A;  2VXD A;  3W2A A;  4PFP A;  5HOO A;  3OYC A;  3NWT A;  3AL0 C;  1DQU A;  2Q2E B;  4C9Y A;  3F9K A;  2HVS A;  4DBQ A;  4PY9 A;  5HLT A;  2LC2 A;  1WPM A;  5FRN A;  4X0G A;  4PSX A;  1ZEL A;  2A6T A;  4F55 A;  4C2U A;  2F6C A;  5IWE A;  4BDY A;  2BW3 A;  1N75 A;  3U21 A;  2CH0 A;  4P1W A;  2LYC A;  3E0J B;  3TBI A;  4CCO A;  1W36 D;  2DOA A;  2WY8 Q;  3OYJ A;  2E1M B;  2L2O A;  4YEL A;  4Y4R A;  2R7O A;  4CA0 A;  4EAT A;  2VL8 A;  2PW0 A;  2IGK A;  1BR1 A;  2DJI A;  2JUG A;  1W62 A;  4AVZ A;  1I74 A;  3CJQ B;  1IRX A;  4B3X A;  2GOX B;  3DKX A;  2V6E A;  2KLO A;  2ZSI B;  2VB6 A;  5CPR B;  3ZGK A;  4LG3 A;  4R79 A;  2VAS A;  2R7V A;  1Z3X A;  1N77 A;  3DPU A;  3EPZ A;  4MLO A;  2ELJ A;  1WPP A;  4BS9 A;  1ERD A;  2R4G A;  3OIQ A;  4XM3 A;  2LRE A;  3CP8 A;  2XF6 A;  3DLA A;  4BEH A;  3QOD A;  2WBM A;  2NOJ B;  4XKB A;  4XMY A;  2CUJ A;  3TL4 X;  3L2Q A;  5KCM A;  2ZXP A;  4JUU A;  2LRD A;  4NQW B;  2M4K A;  3BCB A;  4ZDO A;  3S3O A;  3MD2 A;  3LL7 A;  4XOP A;  1U1X A;  4JOM A;  3EUA A;  4K7G B;  2KP6 A;  4CUG A;  3IGH X;  4BXF A;  2E60 A;  4YRV A;  1T95 A;  3KEY A;  2KL4 A;  2JVG A;  2KHM A;  5KNL A;  4ZTJ A;  3A2K A;  2X1C A;  2GOM A;  2MAB A;  2OUM A;  2Z2S B;  1HA8 A;  2IGO A;  1BOB A;  3L2U A;  4RM3 A;  3OYG A;  2UV1 A;  1K23 A;  4DIQ A;  2K9M A;  1YX5 A;  4OAY A;  3MKY B;  4BEH B;  1WFX A;  4XLH A;  3WQZ A;  4BDZ A;  2BVM A;  3H35 A;  3QYE A;  2R7R A;  3V42 A;  5JHF A;  2X1D A;  5LFA A;  3S93 A;  3OYI A;  3SYT A;  3I3L A;  2ZXH A;  1V5F A;  1WJE A;  2Q1Z B;  3CP2 A;  2XSJ C;  3SZG A;  4E7H A;  3BCA A;  3PJR A;  3OR2 C;  1D0X A;  3BG6 A;  4NC7 A;  4BQQ A;  4F52 A;  2V4J C;  1S9H A;  2LBF B;  2R7T A;  1MMN A;  3W3C A;  2Q9J A;  3DQV C;  4XOR A;  4K8L A;  3G2B A;  3OYL A;  2CS3 A;  4LIU A;  3QYF A;  4PJM A;  1U1W A;  4XQF A;  4U87 A;  4E7I A;  1BR4 A;  4HNT A;  3OYD A;  2QKM B;  3E1S A;  3H0D A;  3IP4 B;  4IQJ A;  2X6W A;  4XKV A;  4Q2H A;  3M8J A;  4E7S A;  1K20 A;  1MMG A;  4HEA 2;  2OV7 A;  3OYH A;  3A4C A;  3UR3 C;  3GBG A;  1S7J A;  3OS0 A;  3D5R C;  3PNV A;  3RPU D;  3J7A Y;  2IS1 A;  2VQG A;  3AL0 B;  3DWL E;  3VYR B;  3ZXS A;  4IX7 A;  2R7W A;  2MD0 A;  3IAS 2;  3RCO A;  4BUP A;  1WJC A;  3IAM 2;  1G8X A;  3EJX A;  3C2H A;  1G59 A;  3HG9 A;  3QYB A;  1V5E A;  3DPL C;  5FRO A;  2HQA A;  1E0E A;  3OR1 C;  4BU2 A;  3CF2 A;  3D5L A;  2W4S A;  2W1O A;  3L2R A;  2AQE A;  1X4O A;  1Z7L A;  2GKE A;  2KPT A;  4K7X A;  1T0F C;  4XOT A;  3VYT B;  4NNJ A;  2XF7 A;  3H5R A;  4OWR B;  1GLN A;  4KT6 A;  4KIT B;  2IS2 A;  1Z3Y A;  3H9J A;  2VJJ A;  3HPG A;  4N4N B;  4XN3 A;  4ZDL A;  4J01 A;  2IGM A;  1X1B A;  2KRH A;  4H4K C;  4DBR A;  4U7B A;  3CZ6 A;  3PVH A;  4IJZ A;  2DCE A;  2LOO A;  2CW8 A;  4E7K A;  4IQ4 A;  3OYE A;  5KHD A;  2O5R A;  4HNU A;  2IS6 A;  2CW7 A;  4BE1 A;  2HDW A;  3PL8 A;  4XNF A;  3CES A;  2YMA A;  2ZXO A;  3PNT A;  2XAU A;  3DTE A;  2AQF A;  1MMA A;  3W2W A;  2IGN A;  3ZR8 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...