4LG6A

Crystal structure of ankra2-ccdc8 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
163
structure length
163
Chain Sequence
ANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ankyrin Repeats of ANKRA2 Recognize a PxLPxL Motif on the 3M Syndrome Protein CCDC8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Ankyrin repeat family A protein 2
total genus 52
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4lg6A00
5EIDA 2V4HC 4DX5D 5KBAA 3TWUA 4F1PA 2F8XK 4BSZB 1K3ZD 1WG0A 4YDYA 1MYOA 4O1OA 2VGEA 3T8KA 3NOCD 3TWXA 2RFAA 4N5QA 4CZ2D 2NYJA 5KNHD 5HKPA 3TWQA 3J5PA 3V2OA 3NBNB 4QFVA 1BI8B 1K1BA 3JXJA 4DX7D 4DX1A 4TUMA 3TWSA 5AN8A 3IXEA 2XEHA 4U95D 2ETCA 2Y1LE 3SO8A 4HQDA 4DRXE 2F8YA 1SVXA 3Q9NC 2V5QC 1BLXB 1TR4A 2DZOA 1DC2A 4UUCA 3D9HA 1UOHA 4HRLA 4K5BA 1SW6A 3ZUVB 1NFIE 1N11A 2A5EA 1G3NB 2KXPC 5CEDB 3ZU7B 4G8KA 3EHRA 4YDWA 5AQ9A 4A63B 1BI7B 5CBOA 5CECB 2DZNA 3TWVA 1N0QA 3ZKJA 5CERB 1BD8A 3AAAC 3LJNA 1YCSB 1OT8A 3UTMA 3W9FA 2PNNA 2DVWA 5ENOD 3T9KA 4DX6D 2BKGA 4CYMD 4ZFHA 1MX6A 5ENSD 4J8YA 5EYLA 5KWDA 3DEOA 3B95A 5ENRD 4DX2A 2ETBA 4U8VD 2Y0BG 4J7WA 2JABA 1WDYA 3HG0D 5ENPD 2XZDG 5EN5D 5JMND 2J8SD 1OY3D 2HE0A 3V2XA 1QYMA 4BERA 4ATZD 1IKND 3DEPA 4LSZE 1DCQA 5CBNA 3F6QA 4RLYA 4GMRA 4HNAD 4NIKA 5EIBE 5AARA 5HS0A 5FIOA 1D9SA 1BU9A 4Z68A 3AJIA 3EHQA 4F6RD 5CEAA 3UXGA 5EILA 1IXVA 2L6BA 4BETA 1N0RA 4BESA 1MJ0A 5KNGA 2DWZA 1A5EA 2BKKB 1AP7A 3V31A 3V79K 3V30A 4BEPA 2ETAA 2FO1E 5BXUA 2QYJA 3W9GA 4O60A 2XEEA 4HLLA 2RFMA 1IHBA 2ZGGA 3JXIA 4HI8A 4U96D 5FINA 3Q9UC 4GPMA 4HI9A 3TWTA 4ZHBA 4OAUC 4G8LA 1S70B 4HRNA 2KBXA 3EU9A 3NOGD 5ENTD 1YMPA 4K5AB 4U8YD 5ENQD 5JA4D 3ZNGA 4LG6A 5AQ7A 5ITZF 3C5RA 5AQBA 3B7BA 4C48B 3TWWA 3TWRA 4HB5A 5AQAA 1MX4A 2XENA 5HRYA 4B93B 2P2CP 2XZTG 4DUIA 1AWCB 1K1AA 4K5CA 4OAVB 1YYHA 3KEAA 3HRAA 4HRMB 4QQIA 2AJAA 2F37A 4HBDA 3J5QB 3JUEA 4LNUD 3UI2A 5BXOA 2ZGDA 4JB8P 2QC9A 4O1PA 5AAOA 1MX2A 5D66A 5EYPF 2MYOA 2B0OE
chains in the Genus database with same CATH superfamily
4U0SA 4B89A 4HOTA 4X8QA 5FQ8A 1E90A 1ELKA 2GRPB 2R02A 2LO6A 2VGEA 3EIQC 1H6KA 4K0RA 4N5QA 2Y3AA 3ZXSA 2GROB 2FBNA 1O1TA 3IXEA 5CCLA 3CR3A 1NFIE 3ASNE 2OOEA 3L6AA 4BY6A 4DK5A 1DCEA 5EDSA 3PH0C 3MKQA 3ZKJA 5BV0A 2LSVA 3DSWA 1HG5A 1P5QA 4U8VD 3DPYA 4N5CA 4C9BB 5EX3A 2X6JA 3HVEB 1TNUA 3V2XA 2WQ7A 3DEPA 3HXCA 2RKKA 3F6QA 1ZU2A 3GW4A 4WNGA 3G2VA 3C72A 2PM7A 2VSYA 3FUHA 4U0ZA 2UWJG 2AW6A 1O1SA 1WM5A 4BETA 4WNFA 3B7UX 5FQ7A 2P58C 5FZQA 3D9MA 3EHMA 5LCWJ 3MX3A 3PE4A 4Y6CA 5ANLA 4FC8A 4F7AA 1UG3A 4A3VA 3S7BA 2EQXA 2HR2A 5BNWA 5JJTA 3AU4A 4O1PA 2QC9A 4U7EB 3PEUB 4I6JA 5EYPF 1E8YA 2PQNA 4F1PA 1TEZA 3JUIA 1U3CA 3TG5A 1FCHA 3MKQB 4OVUA 2RFAA 3CK9A 3PZ4A 4DI3A 3CVWA 3D9PA 5AN8A 3CK8A 2ZXWE 3FFLA 1E7VA 4A3TA 1BLXB 3FUJA 3IKOB 2R59A 1OUVA 3UX4A 3ZUVB 4A1GA 3HXBA 4U04A 3S7DA 1INZA 3CSFA 2EINE 1OWLA 4EZJA 3FUKA 3O4ZA 3W9FA 1MHQA 5ENSD 5AIJA 3ASOE 3MV3B 3APFA 4BT9A 4H7YA 4TXRA 3MYVA 5EKQD 4GTQA 2R2LA 1PC2A 3FUMA 3KD7A 2FO1E 4WWOA 3AG4E 4EECA 1JUQA 2OVFA 4EQFA 2IO3C 3ULQA 5JHBA 5ENQD 3CGHA 2MHKA 4GAAA 4J8DA 2WXIA 1JCQA 1ELWA 3CHRA 3D9NA 4BX9A 3HIZA 2I6HA 3DRAA 4WAFA 2HM8A 3PE3A 5H7PA 3APDA 3JXJA 5E75A 3UKUG 5G05J 3TWSA 3SI5A 4DJAA 2LSUA 3ZEFA 2P9KG 4V3IA 2XCBA 3ZW3A 3ASHA 1GW6A 5CEDB 3P2BA 1BI7B 3UKRG 5CBOA 1KPSB 1KZPA 2KCVA 3VLFA 2WQ6A 1N9AA 4ZFHA 3D9IA 1MX6A 4N3AA 2F0YA 4GTSA 4JW1A 4IRUA 2Y0BG 1WDYA 1V54E 3QC1A 5J90A 3OAWA 1IKND 3WXXA 3G2TA 3UIOC 4IYPA 2EIKE 3G2WA 5BUZA 3QWWA 3LY9A 5KNGA 2GRMA 1TNZA 1FVFA 4I1MA 4XE0A 2XPZA 2QYJA 5FJYA 1Z3XA 4L9PA 3ONLA 4XI0A 3HVEA 4OAUC 3FTWA 2I2OA 5AQ7A 1SZ9A 4MKTA 2WXPA 3EDTB 5BPPA 4P29A 4DUIA 2RD0A 5BXOA 2CG3A 1MX2A 3QNKA 5J08A 1H2VC 2WXKA 4EHMA 4L2YA 4BSZB 4EBAA 4ILGA 3RO2A 2H6GA 5KCMA 4FLHA 2QY7A 3QWPA 5LOZA 5LCWC 2L0TB 3L13A 2OEVA 3TL5A 1DC2A 1OCCE 3EHRA 2IO2C 4JVSA 3LJ3A 2UY1A 1BD8A 3KEZA 2PQRA 2OV8A 4GTMA 2ZIRA 3UM1A 3IEGA 3NZSA 3C3RA 4J7WA 2JABA 3JQ1A 4XEIG 1IQRA 5E76A 3CLJA 4H7XA 3HXDA 3T5VA 2WPVA 3FU6A 3L16A 3Q15A 3KAEA 4CT0A 3NZUA 1QZ2A 1L5JA 4AOFA 1HH8A 2FF4A 4GTRA 4DPRA 4IN3B 1NP7A 2M63A 3JXIA 4HI8A 4HI9A 1S70B 2WXNA 2KBXA 3NOGD 4G24A 4ACKA 4U63A 3C5RA 1JPLA 4AV7A 3TWRA 5DIZA 3HYMB 4B93B 3I5PA 5FQ6A 3ENEA 1YYHA 4HBDA 4PS3A 3U66A 3RKVA 3G2SA 2YINA 3SGHA 4R7LA 4LERA 2WXOA 1EYHA 2R17C 2Y1LE 3SO8A 2V5QC 3L17A 3ML8A 1OWPA 4AM9A 3RRUA 4YDWA 5AQ9A 1IYGA 3ZVVA 4OYSA 3MZLB 2I9CA 1TNOA 1UN8A 3B95A 4KZ0A 1LD7A 1A17A 2CHXA 3S7FA 4JHRA 5EN5D 4KBQA 2R05A 3CHSA 1OXJA 3HXFA 2EIJE 4BERA 2IFUA 2R5SA 4PDXA 5CBNA 3DBSA 4UI9K 2I1JA 4O6FA 4UQYA 1SA5A 5CEAA 3E32A 3UXGA 4N2SA 1N0RA 3FUFA 3FY4A 3DSXA 4M3OA 1Z5SC 1AP7A 1MZCA 5DBKA 2ETAA 1Y6IA 3GYZA 5G04J 2FULA 4ANUA 4I9EA 4GTTA 1H2UA 2AVPA 4HFGA 5HQ8A 5JA4D 2A4ZA 2VSOE 3IHVA 4GZCA 4HOSA 4C48B 3VTXA 4B8CB 2P2CP 4AY5A 4I2ZA 2WXQA 5KBAA 1HXIA 2F8XK 3SD5A 2YQ8A 4CZ2D 5CMWA 4J0UA 5AENA 3EHNA 5ANRA 2X6HA 2AXUA 2GRQB 5G04C 4RG9A 1XNFA 2BTDA 3VLEA 3U64A 3LS8A 4BTAA 1E7UA 3AS5A 2L9BA 2LUHA 2AWIA 4I1AA 1TJFA 3TWVA 4W9RA 4AJWA 3CVNA 2IF4A 1OT8A 2XS8A 5ENRD 4JHKA 2WXMA 4NRHB 3TGOA 4G11A 4HLEA 1QYMA 2XPYA 4NIKA 4J8EA 3CK7A 5BW8C 4L1BA 2VGXB 2OCCE 4UWFA 1H6OA 1N94A 3OXGA 4ABNA 4HLLA 4RG6A 5FINA 2GRNB 4GYWA 4FJZA 4G23A 3IHYA 1O1RA 3E34A 4F53A 1O5MA 2A5UA 1K1AA 4LNUD 3MJWA 4YDOA 2DYSE 3ONKA 5BV1A 1WY6A 3CVVA 3TWUA 3EIJA 4YDYA 1N54A 4ACLA 3RO3A 2WQHA 5T3RA 2XEHA 3CKBA 4CGVA 2F8YA 2QYUA 2FEZA 2KATA 2J49A 3NF1A 4CDRA 3L82A 3LVRE 4E6HA 2X6KA 1EPUA 2P9IG 2DZNA 3UM3A 2XRZA 3IBEA 4J8SA 2VGXA 3SZ7A 4ILHB 2XQ0A 3S2AA 5FQ4A 3SFXA 3S7JA 3FUNA 3GZ2A 2BEDA 1DVPA 4TUUA 3FH5A 3ESKA 3LVQE 3U3WA 4GMJA 3UMVA 3BQOA 5KJMA 1PY1A 3PNTB 4Z68A 1BU9A 1KT1A 2WB2A 1VDYA 4GZDA 1JCRA 3PZ1A 2XS1A 2J4BA 2EILE 3LDZA 4HXIA 2AXZA 1S63A 4CT4A 4G1TA 1MX4A 1H0AA 2WXHA 4HVBA 3FTZA 4QQIA 3UI2A 3AG1E 4BSXA 4JPSA 2MYOA 2B0OE 2WXJA 5EIDA 4KZCA 3TAXA 2X38A 3T8KA 4Q94A 1HO8A 3J5PA 1NZNA 4GTPA 1B89A 3HHMA 3VTYA 4APFA 1KZOA 5CCMA 4HQDA 3ZYLA 2LAHA 3FEYA 4MLPA 4HRLA 4D10C 1NA3A 3DXKG 5LP0A 4J6IA 2VQ2A 2P9NG 4GTOA 1HU3A 1N52A 3AAAC 3FTUA 1YCSB 3BU8A 4GA1A 3UUXA 1HZ4A 2OEWA 2XGOA 4UWGA 4APOA 3T5XA 2C2LA 2J8SD 5AJDA 1LD8A 2NXPA 4DLOA 4LNBA 3VLDA 3PZ3A 1OCOE 5FIOA 1D9SA 3LCAA 4F6RD 1IXVA 1E8XA 4BESA 2ONDA 3V31A 2X6IA 3D9OA 2KC7A 4F1SA 5BXUA 4RQIA 4BX8A 2CHZA 4G8LA 5G05C 4HRNA 1YMPA 3ZYMA 3U4TA 5B3SE 4XKBA 2C0LA 3DSSA 1N4RA 4K5CA 4JEUA 4UWLA 1N4PA 4A55A 2XRYA 1X5BA 2WXLA 3UIPC 2RG8A 3SNXA 2V4HC 3UT4A 3UINC 3DSVA 3B7TA 3ULEG 1TNBA 3Q73A 3EJNA 4I1OB 3V2OA 3NBNB 3PREA 3UT8A 3ZN3A 4XZ4A 4TUMA 4GCOA 5ARFA 3AG3E 2PM6A 1H2TC 4ANXA 4I17A 2ZU6B 4DRXE 1SVXA 4ILIA 2L6JA 4UUCA 3CHQA 3QDNA 4CDMA 3SHFA 3LEWA 4XI9A 2A5EA 3O48A 2KXPC 3RIBA 3IV0A 2LAIA 4HS2A 4WWPA 3ASFA 1Z6TA 4UI9J 4XIFA 4L23A 3SFZA 2PNNA 4JZYA 3JQ0A 4A1SA 4DX6D 3ABLE 3DWLG 1XGWA 3N71A 4UI9C 3QWVA 3C98A 5ARGA 1SQMA 2GGFA 3FWVA 3HG0D 5AJLA 3D3MA 1E8ZA 1QBQA 4RLYA 4JC8A 2ZISA 4NURA 3Q75A 3EU5A 3CVYA 1FT1A 3EHQA 4GTVA 5LX8A 2BF0X 2J09A 2P9UG 5FT9A 3KS2A 5D0OD 3PUJA 1HF8A 4U07A 1MQSA 5A6CA 3FU0A 1TNYA 1N4QA 4ZHBA 4N3CA 3UQ3A 1TN7A 3TWWA 4YVOA 5AQAA 5EX0A 1AWCB 2GRLA 4OAVB 3RK6A 2JEKA 5AYWD 3CHOA 4CRWA 3GZSA 1ZB1A 3AS8A 3PVLA 3RAUA 1K3ZD 3QAQA 4JL0A 1MYOA 2NYJA 2V4LA 3RU0A 4BFRA 1BI8B 1K1BA 4GZ3A 1TR4A 3CHPA 4M7CA 1N11A 2AXVA 2KZTA 3ML9A 4A63B 5HI7A 5CERB 2X3MA 2P9SG 4I9CA 3NAWA 3D9JA 1LTXA 2XPIA 4J8YA 3AS4A 4C0MA 3LXUX 1X81A 4DX2A 1TJCA 4KVMA 3I3NA 1S0PA 2XEVA 4L2LA 4LSZE 3JCKC 4PS8A 2NSZA 1EF1C 1MJ0A 2IOLA 3RRMB 3SBTB 1A5EA 4FA6A 2LNIA 3W9GA 1DNPA 1ZBPA 2ZGGA 3I4RB 3LPZA 2X6FA 1Q2ZA 3L22A 2JLBA 4BTBA 3ABME 4GZ5A 3Q7AA 1HFAA 4MS6A 4PUCA 3FH7A 2C0MA 4LCTA 3SFYA 2J07A 3J5QB 2KZTB 4DX5D 3CVQA 4IULA 5D2MC 2V0PA 5CHEE 3R7QA 2QZAA 5KNHD 5BT1A 2DIWA 3JYSA 2VTBB 2HYZA 2HO1A 3FDHA 4EZKA 3QARA 4KYOB 4U8HA 5G2NA 4FP7A 2WXFA 3FUEA 3DPDA 2E2EA 4KT6B 5B1AE 4Q96A 2GW1A 5CMYA 1U2VG 3URZA 2FI7A 4LRZA 2OVBA 4B94A 3QK0A 2MRIA 3RSEG 3ZRHA 1TN6A 2GRRB 3C3OA 2HE0A 2PL2A 4ATZD 4DLQA 4GZ6A 3UT7A 5EIBE 2CG2A 3DXMG 5D0QD 4HORA 3AJIA 3L54A 1OWMA 4G26A 1KT0A 1QQEA 2WXGA 5LFAA 5KJKA 4TRQA 4UWKA 2R03A 3ISMC 5JJ6A 3TWTA 3LY8A 3EU9A 1IQUA 3B7BA 3LKUA 1RW2A 4FHJA 3ZYKA 4GCNA 3QOUA 4AP2A 1HS6A 2ZGDA 2IOSA 5FWQA 2VYIA 3SQVA 4G2VA 1H6PA 3EUVA 1IHGA 4XKCA 1HX8A 5A7DB 2Y69E 1V55E 2ILRA 4CDNA 3L9TA 3Q9NC 1UOHA 4EZLA 1SW6A 2DBAA 1E96B 1NI1A 3E33A 4ANVA 3R9AB 5CECB 4GA2A 3PZ2A 5ENOD 4CYMD 3QJZA 4RSYA 4NACA 3FU3A 3LYAA 2LXLA 2XCCA 3KSQA 5JHAA 3CKCA 2DCPA 4B0ZA 3P1UA 3ZFWA 4ME2A 3QKYA 2KCKA 4Y6WA 3FHEA 3PDNA 5ENNA 2J08A 4TV3A 3TXMA 2VSNA 5JJ7A 2NC9A 4GPMA 4G25A 2V5FA 3PRZA 2Y4TA 3DSTA 2H6IA 4TXQA 2BUGA 2XENA 2WM9A 5FZRA 5D66A 4K03A 2Y4UA 4CGWA 3TWXA 2PZIA 3TWQA 1HG2A 3OXLA 3SBSA 1EDUA 2B6CA 3Q4AB 3LY7A 2H6HA 3E30A 2DZOA 2QFCA 1D8EA 5CRVA 3PNLB 3OTNA 3ZU7B 4J8FA 2YNQA 5T8IA 3UTMA 3T9KA 4YNDA 2VTBA 1JWFA 5KJLA 2IU1A 5C2YA 2IQCA 3TG4A 3MV2B 3U9WA 4U0UA 1OCRE 1N95A 2WMOA 1UN9A 2IJGX 4AIFA 3PZDA 3ULYA 5A23A 3KSLA 5FZSA 2WVIA 1D8DA 3E37A 4WUYA 3V30A 3SF4A 3DSUA 4FULA 4O60A 4EPZA 3RJVA 3E4BA 3FUDA 1JCSA 3PUKA 4XX5A 5IY5E 2FO7A 4LG6A 5ITZF 2XHEA 4OVVA 3Q7FA 5AQBA 3FU5A 2J9QA 3PS6A 4HB5A 2XZTG 4AXHA 2AJAA 3BUAA 3PEVB 3ZIMA 2E0IA 3CQCB 3D9LA 3OXFA 4O1OA 3AU5A 4GMLA 3CV0A 4DX1A 4BT8A 4LUNU 3CEQA 3ZYQA 3MCXA 1E8WA 3WG7E 1LF8A 4K5BA 2IEJA 3TJPA 4ANWA 3UPVA 4CEMA 1G3NB 2P9PG 3FTYA 1FT2A 3ZXPA 2DVWA 2BKGA 5T4YA 1WAO1 1U3DA 3HXEA 5EYLA 3T8MA 1UJJA 4JXTA 2ETBA 4FLBA 3Q49B 2XGMA 5JMND 3R7RA 5M72A 4AVXA 3FEXA 4L7TA 4GPKA 4FHKA 4GMRA 2WXRA 4GA0A 4C0EA 1NA0A 2I1KA 4EBAG 1OCZE 4GYYA 3Q5MA 3TXNA 3L08A 4U96D 3Q9UC 3I4GA 3UM0A 1Z3YA 4AY6A 2XGSA 4I6GA 2V8SE 4K5AB 4U8YD 2CHWA 4GU5A 3CVUA 5CRUA 3CIAA 1FVHA 2P9LG 4KVOA 4HRMB 3KEAA 3HRAA 2H6FA 2F37A 4HOUA 1YA0A 3JUEA 5KJNA 5B1BE 4GB9A 4LNGA 2CFZA 1UW4B 3CQGB 3UM2A 1Y8MA 2EIME 5HKPA 4JA9A 2J4DA 3MA5A 4AEZC 2VSXE 4DX7D 4YVQC 3CVLA 3QB2A 1QNFA 3B7SA 4U95D 2ETCA 3BEEA 4FADA 4LEUA 3CVXA 4JHJA 1OWNA 3GZ1A 1RZ4A 4G8KA 3FP3A 4JEHA 1N0QA 3AG2E 3BG1B 4PS7A 1ELRA 1SZAA 2CFUA 3NB2A 5KWDA 3DEOA 3Q79A 1UJKA 2KCLA 3B13A 3SY2A 4N2QA 1OY3D 1PAQA 3Q78A 3ASGA 2L0IA 4HNAD 1K8KG 2VGYA 1HE8A 5EILA 2WMNA 4JA7A 2BKKB 4NQ0A 4I6EA 3V79K 4BEPA 3HDXA 3Q47B 2YHEA 4FJYA 2XEEA 2RFMA 1IHBA 5FTPA 1FPPA 2Q7FA 3ESLA 3FTXA 4GYOA 1W3BA 2IY0C 1H19A 4F3VA 1OWOA 4JB8P 3ZHEA 3D9KA 4KXKB 3X2QE 4HOQA 4UWHA 4RVBA 3APCA 4FU3A 1WG0A 1TYQG 3NOCD 4I43A 1S64A 1N4SA 4N3BA 3FULA 1TN8A 4QFVA 1JWGA 4CCAA 4UQXA 4MRUA 3D9HA 4B8AA 3B7RL 1NL4A 3FH8A 4E85A 4WWNA 4BWRA 3LJNA 4JD2G 3C3QA 4MBGA 1SA4A 4URKA 3CVPA 2UY1B 3FTVA 5ENPD 2XZDG 4I2WA 2IONA 3ASDA 3NQPA 3BG0B 4TXPA 1KLXA 1DCQA 2VJ8A 5G55A 3K9IA 5AARA 5HS0A 3MKRA 2L6BA 2KM4A 3G2UA 3CSTA 2DWZA 3ZGQA 4PH4B 3ZHEB 2LXMA 2YHCA 3CHMA 3FTSA 4WNEA 3MEKA 3RRNB 4YDEA 3ABKE 5C1DA 4DI4A 5ENTD 3ZNGA 1BPOA 3FUIA 3MGBA 4Q69A 5HRYA 4ATGA 3ZPJA 2DYRE 3R9MA 4WNDA 4UQZA 4KMOA 5AAOA 4N39A 2MOWA
chains in the Genus database with same CATH topology
5EIDA 2V4HC 4DX5D 5KBAA 3TWUA 4F1PA 2F8XK 4BSZB 1K3ZD 1WG0A 4YDYA 1MYOA 4O1OA 2VGEA 3T8KA 3NOCD 3TWXA 2RFAA 4N5QA 4CZ2D 2NYJA 5KNHD 5HKPA 3TWQA 3J5PA 3V2OA 3NBNB 4QFVA 1BI8B 1K1BA 3JXJA 4DX7D 4DX1A 4TUMA 3TWSA 5AN8A 3IXEA 2XEHA 4U95D 2ETCA 2Y1LE 3SO8A 4HQDA 4DRXE 2F8YA 1SVXA 3Q9NC 2V5QC 1BLXB 1TR4A 2DZOA 1DC2A 4UUCA 3D9HA 1UOHA 4HRLA 4K5BA 1SW6A 3ZUVB 1NFIE 1N11A 2A5EA 1G3NB 2KXPC 5CEDB 3ZU7B 4G8KA 3EHRA 4YDWA 5AQ9A 4A63B 1BI7B 5CBOA 5CECB 2DZNA 3TWVA 1N0QA 3ZKJA 5CERB 1BD8A 3AAAC 3LJNA 1YCSB 1OT8A 3UTMA 3W9FA 2PNNA 2DVWA 5ENOD 3T9KA 4DX6D 2BKGA 4CYMD 4ZFHA 1MX6A 5ENSD 4J8YA 5EYLA 5KWDA 3DEOA 3B95A 5ENRD 4DX2A 2ETBA 4U8VD 2Y0BG 4J7WA 2JABA 1WDYA 3HG0D 5ENPD 2XZDG 5EN5D 5JMND 2J8SD 1OY3D 2HE0A 3V2XA 1QYMA 4BERA 4ATZD 1IKND 3DEPA 4LSZE 1DCQA 5CBNA 3F6QA 4RLYA 4GMRA 4HNAD 4NIKA 5EIBE 5AARA 5HS0A 5FIOA 1D9SA 1BU9A 4Z68A 3AJIA 3EHQA 4F6RD 5CEAA 3UXGA 5EILA 1IXVA 2L6BA 4BETA 1N0RA 4BESA 1MJ0A 5KNGA 2DWZA 1A5EA 2BKKB 1AP7A 3V31A 3V79K 3V30A 4BEPA 2ETAA 2FO1E 5BXUA 2QYJA 3W9GA 4O60A 2XEEA 4HLLA 2RFMA 1IHBA 2ZGGA 3JXIA 4HI8A 4U96D 5FINA 3Q9UC 4GPMA 4HI9A 3TWTA 4ZHBA 4OAUC 4G8LA 1S70B 4HRNA 2KBXA 3EU9A 3NOGD 5ENTD 1YMPA 4K5AB 4U8YD 5ENQD 5JA4D 3ZNGA 4LG6A 5AQ7A 5ITZF 3C5RA 5AQBA 3B7BA 4C48B 3TWWA 3TWRA 4HB5A 5AQAA 1MX4A 2XENA 5HRYA 4B93B 2P2CP 2XZTG 4DUIA 1AWCB 1K1AA 4K5CA 4OAVB 1YYHA 3KEAA 3HRAA 4HRMB 4QQIA 2AJAA 2F37A 4HBDA 3J5QB 3JUEA 4LNUD 3UI2A 5BXOA 2ZGDA 4JB8P 2QC9A 4O1PA 5AAOA 1MX2A 5D66A 5EYPF 2MYOA 2B0OE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EID A;  2V4H C;  4DX5 D;  5KBA A;  3TWU A;  4F1P A;  2F8X K;  4BSZ B;  1K3Z D;  1WG0 A;  4YDY A;  1MYO A;  4O1O A;  2VGE A;  3T8K A;  3NOC D;  3TWX A;  2RFA A;  4N5Q A;  4CZ2 D;  2NYJ A;  5KNH D;  5HKP A;  3TWQ A;  3J5P A;  3V2O A;  3NBN B;  4QFV A;  1BI8 B;  1K1B A;  3JXJ A;  4DX7 D;  4DX1 A;  4TUM A;  3TWS A;  5AN8 A;  3IXE A;  2XEH A;  4U95 D;  2ETC A;  2Y1L E;  3SO8 A;  4HQD A;  4DRX E;  2F8Y A;  1SVX A;  3Q9N C;  2V5Q C;  1BLX B;  1TR4 A;  2DZO A;  1DC2 A;  4UUC A;  3D9H A;  1UOH A;  4HRL A;  4K5B A;  1SW6 A;  3ZUV B;  1NFI E;  1N11 A;  2A5E A;  1G3N B;  2KXP C;  5CED B;  3ZU7 B;  4G8K A;  3EHR A;  4YDW A;  5AQ9 A;  4A63 B;  1BI7 B;  5CBO A;  5CEC B;  2DZN A;  3TWV A;  1N0Q A;  3ZKJ A;  5CER B;  1BD8 A;  3AAA C;  3LJN A;  1YCS B;  1OT8 A;  3UTM A;  3W9F A;  2PNN A;  2DVW A;  5ENO D;  3T9K A;  4DX6 D;  2BKG A;  4CYM D;  4ZFH A;  1MX6 A;  5ENS D;  4J8Y A;  5EYL A;  5KWD A;  3DEO A;  3B95 A;  5ENR D;  4DX2 A;  2ETB A;  4U8V D;  2Y0B G;  4J7W A;  2JAB A;  1WDY A;  3HG0 D;  5ENP D;  2XZD G;  5EN5 D;  5JMN D;  2J8S D;  1OY3 D;  2HE0 A;  3V2X A;  1QYM A;  4BER A;  4ATZ D;  1IKN D;  3DEP A;  4LSZ E;  1DCQ A;  5CBN A;  3F6Q A;  4RLY A;  4GMR A;  4HNA D;  4NIK A;  5EIB E;  5AAR A;  5HS0 A;  5FIO A;  1D9S A;  1BU9 A;  4Z68 A;  3AJI A;  3EHQ A;  4F6R D;  5CEA A;  3UXG A;  5EIL A;  1IXV A;  2L6B A;  4BET A;  1N0R A;  4BES A;  1MJ0 A;  5KNG A;  2DWZ A;  1A5E A;  2BKK B;  1AP7 A;  3V31 A;  3V79 K;  3V30 A;  4BEP A;  2ETA A;  2FO1 E;  5BXU A;  2QYJ A;  3W9G A;  4O60 A;  2XEE A;  4HLL A;  2RFM A;  1IHB A;  2ZGG A;  3JXI A;  4HI8 A;  4U96 D;  5FIN A;  3Q9U C;  4GPM A;  4HI9 A;  3TWT A;  4ZHB A;  4OAU C;  4G8L A;  1S70 B;  4HRN A;  2KBX A;  3EU9 A;  3NOG D;  5ENT D;  1YMP A;  4K5A B;  4U8Y D;  5ENQ D;  5JA4 D;  3ZNG A;  4LG6 A;  5AQ7 A;  5ITZ F;  3C5R A;  5AQB A;  3B7B A;  4C48 B;  3TWW A;  3TWR A;  4HB5 A;  5AQA A;  1MX4 A;  2XEN A;  5HRY A;  4B93 B;  2P2C P;  2XZT G;  4DUI A;  1AWC B;  1K1A A;  4K5C A;  4OAV B;  1YYH A;  3KEA A;  3HRA A;  4HRM B;  4QQI A;  2AJA A;  2F37 A;  4HBD A;  3J5Q B;  3JUE A;  4LNU D;  3UI2 A;  5BXO A;  2ZGD A;  4JB8 P;  2QC9 A;  4O1P A;  5AAO A;  1MX2 A;  5D66 A;  5EYP F;  2MYO A;  2B0O E; 
#chains in the Genus database with same CATH topology
 4U0S A;  4B89 A;  4HOT A;  4X8Q A;  5FQ8 A;  1E90 A;  1ELK A;  2GRP B;  2R02 A;  2LO6 A;  2VGE A;  3EIQ C;  1H6K A;  4K0R A;  4N5Q A;  2Y3A A;  3ZXS A;  2GRO B;  2FBN A;  1O1T A;  3IXE A;  5CCL A;  3CR3 A;  1NFI E;  3ASN E;  2OOE A;  3L6A A;  4BY6 A;  4DK5 A;  1DCE A;  5EDS A;  3PH0 C;  3MKQ A;  3ZKJ A;  5BV0 A;  2LSV A;  3DSW A;  1HG5 A;  1P5Q A;  4U8V D;  3DPY A;  4N5C A;  4C9B B;  5EX3 A;  2X6J A;  3HVE B;  1TNU A;  3V2X A;  2WQ7 A;  3DEP A;  3HXC A;  2RKK A;  3F6Q A;  1ZU2 A;  3GW4 A;  4WNG A;  3G2V A;  3C72 A;  2PM7 A;  2VSY A;  3FUH A;  4U0Z A;  2UWJ G;  2AW6 A;  1O1S A;  1WM5 A;  4BET A;  4WNF A;  3B7U X;  5FQ7 A;  2P58 C;  5FZQ A;  3D9M A;  3EHM A;  5LCW J;  3MX3 A;  3PE4 A;  4Y6C A;  5ANL A;  4FC8 A;  4F7A A;  1UG3 A;  4A3V A;  3S7B A;  2EQX A;  2HR2 A;  5BNW A;  5JJT A;  3AU4 A;  4O1P A;  2QC9 A;  4U7E B;  3PEU B;  4I6J A;  5EYP F;  1E8Y A;  2PQN A;  4F1P A;  1TEZ A;  3JUI A;  1U3C A;  3TG5 A;  1FCH A;  3MKQ B;  4OVU A;  2RFA A;  3CK9 A;  3PZ4 A;  4DI3 A;  3CVW A;  3D9P A;  5AN8 A;  3CK8 A;  2ZXW E;  3FFL A;  1E7V A;  4A3T A;  1BLX B;  3FUJ A;  3IKO B;  2R59 A;  1OUV A;  3UX4 A;  3ZUV B;  4A1G A;  3HXB A;  4U04 A;  3S7D A;  1INZ A;  3CSF A;  2EIN E;  1OWL A;  4EZJ A;  3FUK A;  3O4Z A;  3W9F A;  1MHQ A;  5ENS D;  5AIJ A;  3ASO E;  3MV3 B;  3APF A;  4BT9 A;  4H7Y A;  4TXR A;  3MYV A;  5EKQ D;  4GTQ A;  2R2L A;  1PC2 A;  3FUM A;  3KD7 A;  2FO1 E;  4WWO A;  3AG4 E;  4EEC A;  1JUQ A;  2OVF A;  4EQF A;  2IO3 C;  3ULQ A;  5JHB A;  5ENQ D;  3CGH A;  2MHK A;  4GAA A;  4J8D A;  2WXI A;  1JCQ A;  1ELW A;  3CHR A;  3D9N A;  4BX9 A;  3HIZ A;  2I6H A;  3DRA A;  4WAF A;  2HM8 A;  3PE3 A;  5H7P A;  3APD A;  3JXJ A;  5E75 A;  3UKU G;  5G05 J;  3TWS A;  3SI5 A;  4DJA A;  2LSU A;  3ZEF A;  2P9K G;  4V3I A;  2XCB A;  3ZW3 A;  3ASH A;  1GW6 A;  5CED B;  3P2B A;  1BI7 B;  3UKR G;  5CBO A;  1KPS B;  1KZP A;  2KCV A;  3VLF A;  2WQ6 A;  1N9A A;  4ZFH A;  3D9I A;  1MX6 A;  4N3A A;  2F0Y A;  4GTS A;  4JW1 A;  4IRU A;  2Y0B G;  1WDY A;  1V54 E;  3QC1 A;  5J90 A;  3OAW A;  1IKN D;  3WXX A;  3G2T A;  3UIO C;  4IYP A;  2EIK E;  3G2W A;  5BUZ A;  3QWW A;  3LY9 A;  5KNG A;  2GRM A;  1TNZ A;  1FVF A;  4I1M A;  4XE0 A;  2XPZ A;  2QYJ A;  5FJY A;  1Z3X A;  4L9P A;  3ONL A;  4XI0 A;  3HVE A;  4OAU C;  3FTW A;  2I2O A;  5AQ7 A;  1SZ9 A;  4MKT A;  2WXP A;  3EDT B;  5BPP A;  4P29 A;  4DUI A;  2RD0 A;  5BXO A;  2CG3 A;  1MX2 A;  3QNK A;  5J08 A;  1H2V C;  2WXK A;  4EHM A;  4L2Y A;  4BSZ B;  4EBA A;  4ILG A;  3RO2 A;  2H6G A;  5KCM A;  4FLH A;  2QY7 A;  3QWP A;  5LOZ A;  5LCW C;  2L0T B;  3L13 A;  2OEV A;  3TL5 A;  1DC2 A;  1OCC E;  3EHR A;  2IO2 C;  4JVS A;  3LJ3 A;  2UY1 A;  1BD8 A;  3KEZ A;  2PQR A;  2OV8 A;  4GTM A;  2ZIR A;  3UM1 A;  3IEG A;  3NZS A;  3C3R A;  4J7W A;  2JAB A;  3JQ1 A;  4XEI G;  1IQR A;  5E76 A;  3CLJ A;  4H7X A;  3HXD A;  3T5V A;  2WPV A;  3FU6 A;  3L16 A;  3Q15 A;  3KAE A;  4CT0 A;  3NZU A;  1QZ2 A;  1L5J A;  4AOF A;  1HH8 A;  2FF4 A;  4GTR A;  4DPR A;  4IN3 B;  1NP7 A;  2M63 A;  3JXI A;  4HI8 A;  4HI9 A;  1S70 B;  2WXN A;  2KBX A;  3NOG D;  4G24 A;  4ACK A;  4U63 A;  3C5R A;  1JPL A;  4AV7 A;  3TWR A;  5DIZ A;  3HYM B;  4B93 B;  3I5P A;  5FQ6 A;  3ENE A;  1YYH A;  4HBD A;  4PS3 A;  3U66 A;  3RKV A;  3G2S A;  2YIN A;  3SGH A;  4R7L A;  4LER A;  2WXO A;  1EYH A;  2R17 C;  2Y1L E;  3SO8 A;  2V5Q C;  3L17 A;  3ML8 A;  1OWP A;  4AM9 A;  3RRU A;  4YDW A;  5AQ9 A;  1IYG A;  3ZVV A;  4OYS A;  3MZL B;  2I9C A;  1TNO A;  1UN8 A;  3B95 A;  4KZ0 A;  1LD7 A;  1A17 A;  2CHX A;  3S7F A;  4JHR A;  5EN5 D;  4KBQ A;  2R05 A;  3CHS A;  1OXJ A;  3HXF A;  2EIJ E;  4BER A;  2IFU A;  2R5S A;  4PDX A;  5CBN A;  3DBS A;  4UI9 K;  2I1J A;  4O6F A;  4UQY A;  1SA5 A;  5CEA A;  3E32 A;  3UXG A;  4N2S A;  1N0R A;  3FUF A;  3FY4 A;  3DSX A;  4M3O A;  1Z5S C;  1AP7 A;  1MZC A;  5DBK A;  2ETA A;  1Y6I A;  3GYZ A;  5G04 J;  2FUL A;  4ANU A;  4I9E A;  4GTT A;  1H2U A;  2AVP A;  4HFG A;  5HQ8 A;  5JA4 D;  2A4Z A;  2VSO E;  3IHV A;  4GZC A;  4HOS A;  4C48 B;  3VTX A;  4B8C B;  2P2C P;  4AY5 A;  4I2Z A;  2WXQ A;  5KBA A;  1HXI A;  2F8X K;  3SD5 A;  2YQ8 A;  4CZ2 D;  5CMW A;  4J0U A;  5AEN A;  3EHN A;  5ANR A;  2X6H A;  2AXU A;  2GRQ B;  5G04 C;  4RG9 A;  1XNF A;  2BTD A;  3VLE A;  3U64 A;  3LS8 A;  4BTA A;  1E7U A;  3AS5 A;  2L9B A;  2LUH A;  2AWI A;  4I1A A;  1TJF A;  3TWV A;  4W9R A;  4AJW A;  3CVN A;  2IF4 A;  1OT8 A;  2XS8 A;  5ENR D;  4JHK A;  2WXM A;  4NRH B;  3TGO A;  4G11 A;  4HLE A;  1QYM A;  2XPY A;  4NIK A;  4J8E A;  3CK7 A;  5BW8 C;  4L1B A;  2VGX B;  2OCC E;  4UWF A;  1H6O A;  1N94 A;  3OXG A;  4ABN A;  4HLL A;  4RG6 A;  5FIN A;  2GRN B;  4GYW A;  4FJZ A;  4G23 A;  3IHY A;  1O1R A;  3E34 A;  4F53 A;  1O5M A;  2A5U A;  1K1A A;  4LNU D;  3MJW A;  4YDO A;  2DYS E;  3ONK A;  5BV1 A;  1WY6 A;  3CVV A;  3TWU A;  3EIJ A;  4YDY A;  1N54 A;  4ACL A;  3RO3 A;  2WQH A;  5T3R A;  2XEH A;  3CKB A;  4CGV A;  2F8Y A;  2QYU A;  2FEZ A;  2KAT A;  2J49 A;  3NF1 A;  4CDR A;  3L82 A;  3LVR E;  4E6H A;  2X6K A;  1EPU A;  2P9I G;  2DZN A;  3UM3 A;  2XRZ A;  3IBE A;  4J8S A;  2VGX A;  3SZ7 A;  4ILH B;  2XQ0 A;  3S2A A;  5FQ4 A;  3SFX A;  3S7J A;  3FUN A;  3GZ2 A;  2BED A;  1DVP A;  4TUU A;  3FH5 A;  3ESK A;  3LVQ E;  3U3W A;  4GMJ A;  3UMV A;  3BQO A;  5KJM A;  1PY1 A;  3PNT B;  4Z68 A;  1BU9 A;  1KT1 A;  2WB2 A;  1VDY A;  4GZD A;  1JCR A;  3PZ1 A;  2XS1 A;  2J4B A;  2EIL E;  3LDZ A;  4HXI A;  2AXZ A;  1S63 A;  4CT4 A;  4G1T A;  1MX4 A;  1H0A A;  2WXH A;  4HVB A;  3FTZ A;  4QQI A;  3UI2 A;  3AG1 E;  4BSX A;  4JPS A;  2MYO A;  2B0O E;  2WXJ A;  5EID A;  4KZC A;  3TAX A;  2X38 A;  3T8K A;  4Q94 A;  1HO8 A;  3J5P A;  1NZN A;  4GTP A;  1B89 A;  3HHM A;  3VTY A;  4APF A;  1KZO A;  5CCM A;  4HQD A;  3ZYL A;  2LAH A;  3FEY A;  4MLP A;  4HRL A;  4D10 C;  1NA3 A;  3DXK G;  5LP0 A;  4J6I A;  2VQ2 A;  2P9N G;  4GTO A;  1HU3 A;  1N52 A;  3AAA C;  3FTU A;  1YCS B;  3BU8 A;  4GA1 A;  3UUX A;  1HZ4 A;  2OEW A;  2XGO A;  4UWG A;  4APO A;  3T5X A;  2C2L A;  2J8S D;  5AJD A;  1LD8 A;  2NXP A;  4DLO A;  4LNB A;  3VLD A;  3PZ3 A;  1OCO E;  5FIO A;  1D9S A;  3LCA A;  4F6R D;  1IXV A;  1E8X A;  4BES A;  2OND A;  3V31 A;  2X6I A;  3D9O A;  2KC7 A;  4F1S A;  5BXU A;  4RQI A;  4BX8 A;  2CHZ A;  4G8L A;  5G05 C;  4HRN A;  1YMP A;  3ZYM A;  3U4T A;  5B3S E;  4XKB A;  2C0L A;  3DSS A;  1N4R A;  4K5C A;  4JEU A;  4UWL A;  1N4P A;  4A55 A;  2XRY A;  1X5B A;  2WXL A;  3UIP C;  2RG8 A;  3SNX A;  2V4H C;  3UT4 A;  3UIN C;  3DSV A;  3B7T A;  3ULE G;  1TNB A;  3Q73 A;  3EJN A;  4I1O B;  3V2O A;  3NBN B;  3PRE A;  3UT8 A;  3ZN3 A;  4XZ4 A;  4TUM A;  4GCO A;  5ARF A;  3AG3 E;  2PM6 A;  1H2T C;  4ANX A;  4I17 A;  2ZU6 B;  4DRX E;  1SVX A;  4ILI A;  2L6J A;  4UUC A;  3CHQ A;  3QDN A;  4CDM A;  3SHF A;  3LEW A;  4XI9 A;  2A5E A;  3O48 A;  2KXP C;  3RIB A;  3IV0 A;  2LAI A;  4HS2 A;  4WWP A;  3ASF A;  1Z6T A;  4UI9 J;  4XIF A;  4L23 A;  3SFZ A;  2PNN A;  4JZY A;  3JQ0 A;  4A1S A;  4DX6 D;  3ABL E;  3DWL G;  1XGW A;  3N71 A;  4UI9 C;  3QWV A;  3C98 A;  5ARG A;  1SQM A;  2GGF A;  3FWV A;  3HG0 D;  5AJL A;  3D3M A;  1E8Z A;  1QBQ A;  4RLY A;  4JC8 A;  2ZIS A;  4NUR A;  3Q75 A;  3EU5 A;  3CVY A;  1FT1 A;  3EHQ A;  4GTV A;  5LX8 A;  2BF0 X;  2J09 A;  2P9U G;  5FT9 A;  3KS2 A;  5D0O D;  3PUJ A;  1HF8 A;  4U07 A;  1MQS A;  5A6C A;  3FU0 A;  1TNY A;  1N4Q A;  4ZHB A;  4N3C A;  3UQ3 A;  1TN7 A;  3TWW A;  4YVO A;  5AQA A;  5EX0 A;  1AWC B;  2GRL A;  4OAV B;  3RK6 A;  2JEK A;  5AYW D;  3CHO A;  4CRW A;  3GZS A;  1ZB1 A;  3AS8 A;  3PVL A;  3RAU A;  1K3Z D;  3QAQ A;  4JL0 A;  1MYO A;  2NYJ A;  2V4L A;  3RU0 A;  4BFR A;  1BI8 B;  1K1B A;  4GZ3 A;  1TR4 A;  3CHP A;  4M7C A;  1N11 A;  2AXV A;  2KZT A;  3ML9 A;  4A63 B;  5HI7 A;  5CER B;  2X3M A;  2P9S G;  4I9C A;  3NAW A;  3D9J A;  1LTX A;  2XPI A;  4J8Y A;  3AS4 A;  4C0M A;  3LXU X;  1X81 A;  4DX2 A;  1TJC A;  4KVM A;  3I3N A;  1S0P A;  2XEV A;  4L2L A;  4LSZ E;  3JCK C;  4PS8 A;  2NSZ A;  1EF1 C;  1MJ0 A;  2IOL A;  3RRM B;  3SBT B;  1A5E A;  4FA6 A;  2LNI A;  3W9G A;  1DNP A;  1ZBP A;  2ZGG A;  3I4R B;  3LPZ A;  2X6F A;  1Q2Z A;  3L22 A;  2JLB A;  4BTB A;  3ABM E;  4GZ5 A;  3Q7A A;  1HFA A;  4MS6 A;  4PUC A;  3FH7 A;  2C0M A;  4LCT A;  3SFY A;  2J07 A;  3J5Q B;  2KZT B;  4DX5 D;  3CVQ A;  4IUL A;  5D2M C;  2V0P A;  5CHE E;  3R7Q A;  2QZA A;  5KNH D;  5BT1 A;  2DIW A;  3JYS A;  2VTB B;  2HYZ A;  2HO1 A;  3FDH A;  4EZK A;  3QAR A;  4KYO B;  4U8H A;  5G2N A;  4FP7 A;  2WXF A;  3FUE A;  3DPD A;  2E2E A;  4KT6 B;  5B1A E;  4Q96 A;  2GW1 A;  5CMY A;  1U2V G;  3URZ A;  2FI7 A;  4LRZ A;  2OVB A;  4B94 A;  3QK0 A;  2MRI A;  3RSE G;  3ZRH A;  1TN6 A;  2GRR B;  3C3O A;  2HE0 A;  2PL2 A;  4ATZ D;  4DLQ A;  4GZ6 A;  3UT7 A;  5EIB E;  2CG2 A;  3DXM G;  5D0Q D;  4HOR A;  3AJI A;  3L54 A;  1OWM A;  4G26 A;  1KT0 A;  1QQE A;  2WXG A;  5LFA A;  5KJK A;  4TRQ A;  4UWK A;  2R03 A;  3ISM C;  5JJ6 A;  3TWT A;  3LY8 A;  3EU9 A;  1IQU A;  3B7B A;  3LKU A;  1RW2 A;  4FHJ A;  3ZYK A;  4GCN A;  3QOU A;  4AP2 A;  1HS6 A;  2ZGD A;  2IOS A;  5FWQ A;  2VYI A;  3SQV A;  4G2V A;  1H6P A;  3EUV A;  1IHG A;  4XKC A;  1HX8 A;  5A7D B;  2Y69 E;  1V55 E;  2ILR A;  4CDN A;  3L9T A;  3Q9N C;  1UOH A;  4EZL A;  1SW6 A;  2DBA A;  1E96 B;  1NI1 A;  3E33 A;  4ANV A;  3R9A B;  5CEC B;  4GA2 A;  3PZ2 A;  5ENO D;  4CYM D;  3QJZ A;  4RSY A;  4NAC A;  3FU3 A;  3LYA A;  2LXL A;  2XCC A;  3KSQ A;  5JHA A;  3CKC A;  2DCP A;  4B0Z A;  3P1U A;  3ZFW A;  4ME2 A;  3QKY A;  2KCK A;  4Y6W A;  3FHE A;  3PDN A;  5ENN A;  2J08 A;  4TV3 A;  3TXM A;  2VSN A;  5JJ7 A;  2NC9 A;  4GPM A;  4G25 A;  2V5F A;  3PRZ A;  2Y4T A;  3DST A;  2H6I A;  4TXQ A;  2BUG A;  2XEN A;  2WM9 A;  5FZR A;  5D66 A;  4K03 A;  2Y4U A;  4CGW A;  3TWX A;  2PZI A;  3TWQ A;  1HG2 A;  3OXL A;  3SBS A;  1EDU A;  2B6C A;  3Q4A B;  3LY7 A;  2H6H A;  3E30 A;  2DZO A;  2QFC A;  1D8E A;  5CRV A;  3PNL B;  3OTN A;  3ZU7 B;  4J8F A;  2YNQ A;  5T8I A;  3UTM A;  3T9K A;  4YND A;  2VTB A;  1JWF A;  5KJL A;  2IU1 A;  5C2Y A;  2IQC A;  3TG4 A;  3MV2 B;  3U9W A;  4U0U A;  1OCR E;  1N95 A;  2WMO A;  1UN9 A;  2IJG X;  4AIF A;  3PZD A;  3ULY A;  5A23 A;  3KSL A;  5FZS A;  2WVI A;  1D8D A;  3E37 A;  4WUY A;  3V30 A;  3SF4 A;  3DSU A;  4FUL A;  4O60 A;  4EPZ A;  3RJV A;  3E4B A;  3FUD A;  1JCS A;  3PUK A;  4XX5 A;  5IY5 E;  2FO7 A;  4LG6 A;  5ITZ F;  2XHE A;  4OVV A;  3Q7F A;  5AQB A;  3FU5 A;  2J9Q A;  3PS6 A;  4HB5 A;  2XZT G;  4AXH A;  2AJA A;  3BUA A;  3PEV B;  3ZIM A;  2E0I A;  3CQC B;  3D9L A;  3OXF A;  4O1O A;  3AU5 A;  4GML A;  3CV0 A;  4DX1 A;  4BT8 A;  4LUN U;  3CEQ A;  3ZYQ A;  3MCX A;  1E8W A;  3WG7 E;  1LF8 A;  4K5B A;  2IEJ A;  3TJP A;  4ANW A;  3UPV A;  4CEM A;  1G3N B;  2P9P G;  3FTY A;  1FT2 A;  3ZXP A;  2DVW A;  2BKG A;  5T4Y A;  1WAO 1;  1U3D A;  3HXE A;  5EYL A;  3T8M A;  1UJJ A;  4JXT A;  2ETB A;  4FLB A;  3Q49 B;  2XGM A;  5JMN D;  3R7R A;  5M72 A;  4AVX A;  3FEX A;  4L7T A;  4GPK A;  4FHK A;  4GMR A;  2WXR A;  4GA0 A;  4C0E A;  1NA0 A;  2I1K A;  4EBA G;  1OCZ E;  4GYY A;  3Q5M A;  3TXN A;  3L08 A;  4U96 D;  3Q9U C;  3I4G A;  3UM0 A;  1Z3Y A;  4AY6 A;  2XGS A;  4I6G A;  2V8S E;  4K5A B;  4U8Y D;  2CHW A;  4GU5 A;  3CVU A;  5CRU A;  3CIA A;  1FVH A;  2P9L G;  4KVO A;  4HRM B;  3KEA A;  3HRA A;  2H6F A;  2F37 A;  4HOU A;  1YA0 A;  3JUE A;  5KJN A;  5B1B E;  4GB9 A;  4LNG A;  2CFZ A;  1UW4 B;  3CQG B;  3UM2 A;  1Y8M A;  2EIM E;  5HKP A;  4JA9 A;  2J4D A;  3MA5 A;  4AEZ C;  2VSX E;  4DX7 D;  4YVQ C;  3CVL A;  3QB2 A;  1QNF A;  3B7S A;  4U95 D;  2ETC A;  3BEE A;  4FAD A;  4LEU A;  3CVX A;  4JHJ A;  1OWN A;  3GZ1 A;  1RZ4 A;  4G8K A;  3FP3 A;  4JEH A;  1N0Q A;  3AG2 E;  3BG1 B;  4PS7 A;  1ELR A;  1SZA A;  2CFU A;  3NB2 A;  5KWD A;  3DEO A;  3Q79 A;  1UJK A;  2KCL A;  3B13 A;  3SY2 A;  4N2Q A;  1OY3 D;  1PAQ A;  3Q78 A;  3ASG A;  2L0I A;  4HNA D;  1K8K G;  2VGY A;  1HE8 A;  5EIL A;  2WMN A;  4JA7 A;  2BKK B;  4NQ0 A;  4I6E A;  3V79 K;  4BEP A;  3HDX A;  3Q47 B;  2YHE A;  4FJY A;  2XEE A;  2RFM A;  1IHB A;  5FTP A;  1FPP A;  2Q7F A;  3ESL A;  3FTX A;  4GYO A;  1W3B A;  2IY0 C;  1H19 A;  4F3V A;  1OWO A;  4JB8 P;  3ZHE A;  3D9K A;  4KXK B;  3X2Q E;  4HOQ A;  4UWH A;  4RVB A;  3APC A;  4FU3 A;  1WG0 A;  1TYQ G;  3NOC D;  4I43 A;  1S64 A;  1N4S A;  4N3B A;  3FUL A;  1TN8 A;  4QFV A;  1JWG A;  4CCA A;  4UQX A;  4MRU A;  3D9H A;  4B8A A;  3B7R L;  1NL4 A;  3FH8 A;  4E85 A;  4WWN A;  4BWR A;  3LJN A;  4JD2 G;  3C3Q A;  4MBG A;  1SA4 A;  4URK A;  3CVP A;  2UY1 B;  3FTV A;  5ENP D;  2XZD G;  4I2W A;  2ION A;  3ASD A;  3NQP A;  3BG0 B;  4TXP A;  1KLX A;  1DCQ A;  2VJ8 A;  5G55 A;  3K9I A;  5AAR A;  5HS0 A;  3MKR A;  2L6B A;  2KM4 A;  3G2U A;  3CST A;  2DWZ A;  3ZGQ A;  4PH4 B;  3ZHE B;  2LXM A;  2YHC A;  3CHM A;  3FTS A;  4WNE A;  3MEK A;  3RRN B;  4YDE A;  3ABK E;  5C1D A;  4DI4 A;  5ENT D;  3ZNG A;  1BPO A;  3FUI A;  3MGB A;  4Q69 A;  5HRY A;  4ATG A;  3ZPJ A;  2DYR E;  3R9M A;  4WND A;  4UQZ A;  4KMO A;  5AAO A;  4N39 A;  2MOW A; 
#chains in the Genus database with same CATH homology
 5EID A;  2V4H C;  4DX5 D;  5KBA A;  3TWU A;  4F1P A;  2F8X K;  4BSZ B;  1K3Z D;  1WG0 A;  4YDY A;  1MYO A;  4O1O A;  2VGE A;  3T8K A;  3NOC D;  3TWX A;  2RFA A;  4N5Q A;  4CZ2 D;  2NYJ A;  5KNH D;  5HKP A;  3TWQ A;  3J5P A;  3V2O A;  3NBN B;  4QFV A;  1BI8 B;  1K1B A;  3JXJ A;  4DX7 D;  4DX1 A;  4TUM A;  3TWS A;  5AN8 A;  3IXE A;  2XEH A;  4U95 D;  2ETC A;  2Y1L E;  3SO8 A;  4HQD A;  4DRX E;  2F8Y A;  1SVX A;  3Q9N C;  2V5Q C;  1BLX B;  1TR4 A;  2DZO A;  1DC2 A;  4UUC A;  3D9H A;  1UOH A;  4HRL A;  4K5B A;  1SW6 A;  3ZUV B;  1NFI E;  1N11 A;  2A5E A;  1G3N B;  2KXP C;  5CED B;  3ZU7 B;  4G8K A;  3EHR A;  4YDW A;  5AQ9 A;  4A63 B;  1BI7 B;  5CBO A;  5CEC B;  2DZN A;  3TWV A;  1N0Q A;  3ZKJ A;  5CER B;  1BD8 A;  3AAA C;  3LJN A;  1YCS B;  1OT8 A;  3UTM A;  3W9F A;  2PNN A;  2DVW A;  5ENO D;  3T9K A;  4DX6 D;  2BKG A;  4CYM D;  4ZFH A;  1MX6 A;  5ENS D;  4J8Y A;  5EYL A;  5KWD A;  3DEO A;  3B95 A;  5ENR D;  4DX2 A;  2ETB A;  4U8V D;  2Y0B G;  4J7W A;  2JAB A;  1WDY A;  3HG0 D;  5ENP D;  2XZD G;  5EN5 D;  5JMN D;  2J8S D;  1OY3 D;  2HE0 A;  3V2X A;  1QYM A;  4BER A;  4ATZ D;  1IKN D;  3DEP A;  4LSZ E;  1DCQ A;  5CBN A;  3F6Q A;  4RLY A;  4GMR A;  4HNA D;  4NIK A;  5EIB E;  5AAR A;  5HS0 A;  5FIO A;  1D9S A;  1BU9 A;  4Z68 A;  3AJI A;  3EHQ A;  4F6R D;  5CEA A;  3UXG A;  5EIL A;  1IXV A;  2L6B A;  4BET A;  1N0R A;  4BES A;  1MJ0 A;  5KNG A;  2DWZ A;  1A5E A;  2BKK B;  1AP7 A;  3V31 A;  3V79 K;  3V30 A;  4BEP A;  2ETA A;  2FO1 E;  5BXU A;  2QYJ A;  3W9G A;  4O60 A;  2XEE A;  4HLL A;  2RFM A;  1IHB A;  2ZGG A;  3JXI A;  4HI8 A;  4U96 D;  5FIN A;  3Q9U C;  4GPM A;  4HI9 A;  3TWT A;  4ZHB A;  4OAU C;  4G8L A;  1S70 B;  4HRN A;  2KBX A;  3EU9 A;  3NOG D;  5ENT D;  1YMP A;  4K5A B;  4U8Y D;  5ENQ D;  5JA4 D;  3ZNG A;  4LG6 A;  5AQ7 A;  5ITZ F;  3C5R A;  5AQB A;  3B7B A;  4C48 B;  3TWW A;  3TWR A;  4HB5 A;  5AQA A;  1MX4 A;  2XEN A;  5HRY A;  4B93 B;  2P2C P;  2XZT G;  4DUI A;  1AWC B;  1K1A A;  4K5C A;  4OAV B;  1YYH A;  3KEA A;  3HRA A;  4HRM B;  4QQI A;  2AJA A;  2F37 A;  4HBD A;  3J5Q B;  3JUE A;  4LNU D;  3UI2 A;  5BXO A;  2ZGD A;  4JB8 P;  2QC9 A;  4O1P A;  5AAO A;  1MX2 A;  5D66 A;  5EYP F;  2MYO A;  2B0O E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...