4LG6A

Crystal structure of ankra2-ccdc8 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
163
structure length
163
Chain Sequence
ANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat family A protein 2
publication title Ankyrin Repeats of ANKRA2 Recognize a PxLPxL Motif on the 3M Syndrome Protein CCDC8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 52
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4lg6A00
5AARA 2F37A 2BKKB 2ETAA 2KBXA 2XEHA 2F8YA 1BU9A 5KNHD 2KXPC 4GMRA 2FO1E 2XEEA 3NBNB 3TWVA 4J8YA 3SO8A 2MYOA 3EHRA 2RFMA 2XZTG 3NOGD 4YDWA 1NFIE 3V2XA 2V4HC 1AP7A 1MX4A 1WDYA 4HRLA 3ZNGA 4ZFHA 3AJIA 4YDYA 4B93B 3UTMA 3ZKJA 5AQAA 5BXUA 2NYJA 4A63B 2A5EA 4HRMB 3AAAC 1K1BA 5EIDA 3T8KA 3TWTA 1SW6A 4HB5A 5CERB 1MJ0A 1IXVA 3JUEA 4OAVB 4LNUD 3HRAA 5HRYA 1YYHA 2ETBA 5AN8A 2ETCA 4G8KA 3W9FA 4DX7D 5EYLA 4F6RD 4BSZB 4BESA 2ZGGA 4DX6D 4F1PA 1D9SA 1MX2A 3TWXA 4BERA 4J7WA 4UUCA 5AQBA 1BLXB 4O1PA 2QYJA 2QC9A 4CYMD 3EU9A 4U8YD 3ZUVB 3DEOA 1MYOA 3DEPA 3J5PA 3F6QA 4LG6A 3KEAA 2B0OE 3TWSA 5KWDA 5ITZF 4U95D 1N0QA 4GPMA 5ENQD 3TWUA 4QQIA 1YCSB 4Z68A 1G3NB 2Y1LE 1N11A 3B95A 4ATZD 1IKND 3NOCD 4DUIA 5ENPD 1BI8B 1K1AA 4C48B 4K5CA 4RLYA 4JB8P 4DRXE 4HI9A 5KBAA 1A5EA 4QFVA 4O1OA 5CBOA 2F8XK 4HI8A 2RFAA 5ENOD 3V79K 1UOHA 1YMPA 3TWRA 5JMND 4HNAD 5EN5D 2V5QC 3V31A 5D66A 5AQ7A 3V30A 5AAOA 2DZOA 5ENTD 5ENSD 3JXIA 4K5AB 1K3ZD 2J8SD 3ZU7B 3T9KA 1BD8A 5EIBE 3UI2A 1IHBA 3TWQA 4BEPA 1OY3D 2XZDG 4O60A 1N0RA 3IXEA 5CBNA 3Q9UC 3W9GA 4G8LA 2Y0BG 4K5BA 5ENRD 4ZHBA 3HG0D 1OT8A 1AWCB 5EILA 4DX1A 3B7BA 3J5QB 1WG0A 5CECB 4TUMA 4HQDA 4N5QA 2XENA 5CEDB 3EHQA 5BXOA 1MX6A 2P2CP 2ZGDA 1QYMA 2VGEA 5FINA 4LSZE 3JXJA 4NIKA 5HKPA 2JABA 4HBDA 5CEAA 5KNGA 2PNNA 3TWWA 2BKGA 2DZNA 5HS0A 4DX2A 1S70B 4HRNA 3UXGA 2AJAA 5AQ9A 1TR4A 4BETA 4CZ2D 2DWZA 2DVWA 3LJNA 3Q9NC 1SVXA 4U8VD 4HLLA 2L6BA 3D9HA 1DC2A 1DCQA 4OAUC 3C5RA 1BI7B 4U96D 4DX5D 5EYPF 5FIOA 5JA4D 3V2OA 2HE0A
chains in the Genus database with same CATH superfamily
2P9NG 2BKKB 3PEVB 2Y69E 4PDXA 2XPIA 3ESLA 3DXKG 4J8EA 1MZCA 2XZTG 1N4SA 3T5XA 1MHQA 1WM5A 5EIDA 2J9QA 1ZBPA 1YYHA 4CRWA 4AXHA 5G2NA 3C98A 4GPKA 3ONKA 3DEPA 3SI5A 4GYOA 5FZSA 1E96B 4GPMA 2ILRA 2DYRE 1E8XA 2PQRA 1JCSA 2MOWA 2VGXB 4HI9A 5HI7A 4N39A 2F8XK 3FTYA 4RG6A 3AG4E 5EN5D 3V31A 4Y6WA 4WNDA 3BUAA 1XGWA 2XS8A 1U2VG 1TJFA 1SZ9A 2Y0BG 2A5UA 1PC2A 1UN9A 3RO3A 2WQ6A 2BTDA 5CECB 5CMYA 3FEXA 3FU5A 2WXKA 4XKCA 4UWKA 4WWPA 4OYSA 2X3MA 5CEAA 3AU4A 4I1AA 4IYPA 4LERA 2R2LA 1JCQA 4G2VA 4A1SA 2JEKA 4G26A 2WXHA 2L6BA 2NXPA 4U96D 2H6HA 3AS8A 2WXOA 2OEWA 3AG3E 1UN8A 3D3MA 2RKKA 5CCMA 3FUMA 4JEHA 3NBNB 1E8ZA 3APDA 3MA5A 3FTZA 1HF8A 3UIOC 3HXCA 4N3BA 4XI9A 2P9LG 3ZKJA 2H6IA 4ILHB 4ACLA 3HRAA 4KXKB 3U64A 1OWNA 4GA0A 5D2MC 2IOLA 2WMOA 5AQBA 4KVMA 3FWVA 3DEOA 4UWHA 3HHMA 4ILIA 3KEAA 4Q94A 3TGOA 3ABME 2AXZA 2WXRA 4GTPA 1IKND 2CFUA 5BT1A 4UQXA 2DBAA 3QWPA 4MS6A 2BF0X 2LAHA 3S7JA 4BSXA 1WAO1 1K3ZD 3PDNA 1HFAA 1Q2ZA 2DYSE 2ZISA 3WG7E 3NB2A 3FUNA 1X5BA 4GA2A 1W3BA 3EU5A 3CIAA 4I2WA 3EHQA 3E4BA 2ZGDA 5EDSA 3VLFA 2RG8A 4O6FA 4PS8A 3MYVA 2PZIA 2VGXA 3KD7A 3T5VA 1NA0A 4HLEA 4H7XA 2HE0A 3S7FA 1HO8A 2LSUA 4BX9A 2XEEA 1JWGA 5J90A 2FF4A 3LPZA 3RSEG 1K1BA 2R17C 1YA0A 5HRYA 2YHEA 4BESA 2YNQA 1KLXA 4J7WA 2IFUA 3R9MA 1O1RA 3PREA 5KWDA 2B0OE 3IHVA 5ENQD 3ULQA 3S7DA 3DSUA 3QDNA 2LNIA 4B8CB 3AS4A 4RLYA 4DRXE 2OV8A 3V30A 5J08A 5ENTD 4MLPA 5EIBE 1BD8A 1K8KG 2WXNA 4HOTA 2L9BA 1OY3D 3FUHA 5CBNA 1HXIA 2L0TB 3W9GA 4DJAA 3L6AA 2CFZA 3PZ4A 3C3OA 4HFGA 4TUMA 3G2VA 2NC9A 4HBDA 5KNGA 3ONLA 3QKYA 1D8EA 3FULA 1Y6IA 5AIJA 3LJNA 3B13A 1FVHA 3DRAA 5FZQA 3CHRA 4TRQA 4D10C 2KM4A 4JPSA 3CVXA 4DPRA 3LEWA 4GMRA 1N54A 4RSYA 1GW6A 2EQXA 2I1KA 3MV2B 4YDWA 4GZ3A 1OWLA 2QZAA 4I6EA 4EHMA 2CHWA 1Y8MA 3D9PA 2GROB 5AN8A 2ETCA 4UI9K 4U04A 3L54A 4W9RA 4JD2G 5AYWD 3MJWA 2RD0A 4BX8A 3ZUVB 5LX8A 1XNFA 4QQIA 2AW6A 4XEIG 5FQ6A 2VYIA 3QARA 3FTUA 2P9SG 3Q73A 4U8HA 3ZYLA 3LVRE 3P2BA 2DZOA 5LCWC 3PEUB 5LFAA 3D9LA 3BEEA 2GRMA 3Q7AA 2ZIRA 2P9UG 2XRYA 2HR2A 1QYMA 2VGEA 3JXJA 4YVQC 4UWFA 4MKTA 4GTVA 3NQPA 3MKQB 4CZ2D 2X6FA 2R03A 2XS1A 3QAQA 1S0PA 2GRQB 4AV7A 4G1TA 4IULA 2KBXA 1E8YA 2IO2C 3CQCB 2A4ZA 1NI1A 2XRZA 3CR3A 2MYOA 2RFMA 2Y4TA 2ZU6B 2EILE 2IOSA 3R9AB 3CVNA 3RAUA 4B93B 3UPVA 1TNBA 4A63B 4I9EA 2P9KG 3D9IA 1UW4B 2WQ7A 4M7CA 1MX2A 3ASNE 4HXIA 3QWWA 4GZ6A 1FCHA 3SFXA 5ITZF 3SGHA 3FUKA 3TWUA 5KJMA 4KT6B 4ATZD 4C0MA 2CHXA 3PZDA 4FLHA 4UWGA 4FADA 2EIKE 1Z3YA 3I4GA 3OXFA 5KJNA 3ML8A 4U7EB 4N5CA 3LXUX 2PM6A 1LTXA 3Q75A 3TL5A 4BT9A 5G55A 5ENRD 2R02A 4ZHBA 4JA9A 3J5QB 2MHKA 5FQ4A 3MEKA 4BTAA 1NZNA 2OVBA 3UMVA 2CG3A 3PE4A 2QFCA 2DZNA 1NL4A 1IYGA 1TR4A 1UG3A 5EKQD 2OCCE 3LVQE 1QZ2A 2Y3AA 1DC2A 1DCQA 5JHAA 5JHBA 2F8YA 3EIQC 1BU9A 4GZ5A 3CK9A 4JXTA 3TWVA 1WDYA 4ZFHA 3PH0C 5D0OD 3LY8A 5DBKA 4AVXA 2QY7A 5KJKA 3JUEA 3SFYA 4TXRA 4NURA 3W9FA 4F6RD 4BERA 4GB9A 1EF1C 2R59A 3GZ1A 3VTYA 3TG5A 3ASGA 3MKQA 2R5SA 2IQCA 4H7YA 2WM9A 2J4BA 4EQFA 1N11A 4FHKA 5LCWJ 4DK5A 4HI8A 3V79K 4CEMA 4WWOA 2V5QC 5AQ7A 2PQNA 5ENSD 3JXIA 3I5PA 3Q7FA 3JQ0A 5FT9A 3PUKA 3Q47B 4GTRA 3Q4AB 1WG0A 4I1MA 1Z6TA 1N95A 4NIKA 3LY7A 3APCA 3IBEA 1INZA 2AXUA 3CVVA 1TNUA 4AJWA 2XGSA 3BG0B 3P1UA 3N71A 3MZLB 5FIOA 4KZ0A 2XEHA 3CSTA 4L2YA 3IHYA 2IU1A 3IKOB 4CCAA 3OXGA 1AP7A 5BV0A 1JWFA 3ZNGA 1OCRE 1H6OA 3U4TA 5FTPA 4YDYA 3URZA 4JW1A 4GZDA 3CQGB 2AWIA 4AY5A 4LNGA 5JJTA 2F0YA 4G11A 4EPZA 4RQIA 1OWMA 3TWXA 4LNBA 4GMJA 4FA6A 4EBAA 3OTNA 1OWOA 1QQEA 2IEJA 4XZ4A 3KSQA 5B3SE 2EIME 3ZVVA 4ATGA 1FPPA 3B95A 4E6HA 1O1TA 4NACA 2VQ2A 2M63A 3FDHA 4UQYA 3SBSA 1HE8A 1OCZE 2IONA 3FY4A 2LXMA 4HNAD 1JUQA 5ARGA 4B8AA 3UKRG 4YNDA 3CVQA 2WXMA 2VSNA 4XKBA 3E37A 4DLQA 2I6HA 4AY6A 3GYZA 3CK8A 4URKA 4KZCA 3DWLG 4X8QA 5ANRA 4WNFA 3PZ3A 2FULA 2X6KA 3TXNA 1BPOA 4LSZE 2PL2A 1OCCE 3NZSA 2C2LA 3UXGA 1HS6A 1EPUA 4BY6A 3O4ZA 1U3DA 3RO2A 2I9CA 3G2WA 4WWNA 3ESKA 3SY2A 4BWRA 4U0SA 3EHRA 3HVEB 4HORA 4HOSA 4Y6CA 4BTBA 4J8SA 3CHSA 3L9TA 1ELKA 3PE3A 3TWTA 4OAVB 4N2SA 1EYHA 4AP2A 3ASDA 4WUYA 4U8YD 3ZHEB 2FI7A 1N94A 4P29A 3FP3A 4U07A 3R7QA 1H0AA 3ZN3A 2VJ8A 2CG2A 4PH4B 2ZXWE 4DI3A 3FTXA 3L16A 5D66A 4GTQA 2LUHA 4JA7A 4AIFA 2C0LA 3Q5MA 2VTBB 4L23A 4K03A 3T9KA 1TN7A 4JHJA 2WXPA 4B0ZA 5CCLA 3FFLA 3D9MA 4HQDA 5BXOA 1MX6A 2KC7A 2JABA 4GYWA 3I4RB 2WXIA 2X38A 2VSOE 2PM7A 4ANUA 2XCBA 4FP7A 2DVWA 3EJNA 3SD5A 2R05A 2FEZA 2V4LA 3C5RA 4J0UA 2F37A 5FJYA 4K0RA 3L17A 3ZEFA 3QK0A 4FU3A 1OCOE 1JCRA 3ZFWA 4GTMA 3AU5A 5ENNA 2I1JA 2HYZA 5AQAA 4FC8A 2WVIA 5KJLA 3AAAC 1IXVA 2WQHA 2H6GA 3MX3A 4JL0A 1LD8A 5EYLA 3TJPA 3D9NA 1HH8A 3FEYA 3F6QA 5CRVA 1OXJA 3BG1B 3SBTB 3QNKA 4XIFA 3CVWA 3GZSA 4K5CA 2GW1A 2ONDA 3ZYQA 1TJCA 1TNOA 3BU8A 3FH8A 3D9KA 1S64A 1SQMA 3HVEA 3FH5A 3UM2A 1FT1A 2YINA 4OVVA 4NRHB 3HDXA 2CHZA 3EHNA 1SA4A 4N5QA 4JEUA 3ZHEA 4UWLA 4V3IA 3DPDA 5BW8C 4CDRA 1S70B 2HM8A 2UWJG 4DI4A 4B89A 2JLBA 2XPZA 4NQ0A 3U3WA 5JJ7A 3BQOA 1H19A 2WMNA 3DSTA 3E30A 3TXMA 1N4QA 2VTBA 1NFIE 2J4DA 2LSVA 4APOA 1MX4A 5BV1A 3I3NA 1SZAA 3HXDA 2WB2A 3HYMB 3UTMA 2KCKA 3NZUA 5BXUA 4C9BB 5CERB 2XCCA 1MJ0A 2Y4UA 5FWQA 1IHGA 5D0QD 1BLXB 3S7BA 4LG6A 2C0MA 3S2AA 3ABKE 4PS3A 3PVLA 1U3CA 3PS6A 4CT4A 3FUIA 3D9JA 3NOCD 4C0EA 5T3RA 2B6CA 3CK7A 2EIJE 4UI9C 1UOHA 1YMPA 2IY0C 4CGWA 1B89A 3OXLA 1FT2A 2FBNA 4HS2A 3ZRHA 3CHPA 3QB2A 3TWQA 4HOUA 1OT8A 4WAFA 2XPYA 4A1GA 4DX1A 4MRUA 1V54E 2DCPA 5FZRA 4G25A 3KS2A 3ZXPA 3TWWA 2BKGA 4FLBA 3B7UX 1RW2A 4AOFA 4F3VA 4FHJA 3RRMB 2VSXE 3HIZA 3MGBA 5AJDA 3TAXA 4ABNA 1L5JA 3RU0A 5BUZA 3X2QE 3VLEA 2IF4A 3UT4A 2NYJA 1RZ4A 1SW6A 2VSYA 2BEDA 2LO6A 3DXMG 1ZB1A 1H2UA 4DX7D 5IY5E 1KPSB 3JYSA 4O1PA 1ELWA 4CYMD 2AXVA 3E34A 3UM3A 3CHQA 4EZJA 1PY1A 5CHEE 4A3TA 5ENPD 2NSZA 4PUCA 3EIJA 2LXLA 1E8WA 4FJYA 3FH7A 2X6HA 5ANLA 3U9WA 3CVYA 5E76A 5EX3A 3U66A 3HXEA 1N4PA 3LS8A 1HG5A 4HOQA 4JVSA 3CVUA 4G8LA 3HG0D 2V0PA 3O48A 3PRZA 3HXFA 3ULYA 5AJLA 2FO7A 1H6KA 1KZPA 3CGHA 4R7LA 1H2TC 2KZTB 1A17A 5G05C 2P9PG 1OWPA 4HRNA 3G2UA 5AQ9A 4I1OB 4BETA 3B7RL 2QYUA 4HLLA 3D9HA 2V5FA 4DX5D 5EYPF 2LAIA 1MQSA 3UM0A 4OVUA 3PZ2A 2GRLA 4J8YA 3SO8A 3B7SA 2J07A 1EDUA 3EHMA 3CVLA 3V2XA 3RK6A 3NAWA 3RJVA 4I43A 3T8KA 4HB5A 3NF1A 2GRNB 2J08A 3ZGQA 4DX6D 4J6IA 4CDMA 3QWVA 3J5PA 4U95D 4ANXA 3UM1A 4UI9J 4IRUA 3QJZA 5A6CA 2XGMA 3WXXA 1P5QA 3LDZA 1NP7A 3SZ7A 3ULEG 4JB8P 3SFZA 4QFVA 3RRNB 3CVPA 3LY9A 2WXGA 2OOEA 5E75A 4GYYA 5T4YA 4GTSA 3UX4A 4ME2A 3ASHA 1AWCB 3LYAA 5EILA 4FJZA 4A55A 4F1SA 4ILGA 3K9IA 4YDEA 5B1AE 4G23A 4LCTA 2P2CP 1KT1A 4GA1A 4I6JA 2PNNA 1TNZA 4J8FA 3FU3A 3KSLA 1D8DA 2E0IA 3FU0A 1SVXA 4TXPA 3CSFA 3RRUA 2L6JA 4HVBA 2DIWA 3T8MA 3JUIA 2OEVA 2FO1E 5C1DA 1KZOA 3L08A 1LF8A 3L13A 2E2EA 3MKRA 3C72A 1E90A 4RG9A 3ZIMA 3Q79A 1TNYA 1N52A 4ANWA 2VGYA 5A23A 4KYOB 4I9CA 4IN3B 4BSZB 3E32A 4UUCA 1WY6A 1H2VC 2KZTA 2GGFA 3CEQA 3G2SA 3CV0A 2WXJA 4CT0A 2XHEA 1DCEA 2Y1LE 1DNPA 3AG1E 4C48B 3ZW3A 5KBAA 3C3RA 4O1OA 4XX5A 4N3CA 3HXBA 4BFRA 1N9AA 3FUEA 2L0IA 4AM9A 3CLJA 5AAOA 1SA5A 2X6IA 3AS5A 3ISMC 4K5AB 3L22A 2WXQA 2YQ8A 1ZU2A 3UI2A 4BEPA 2V8SE 4K5BA 3C3QA 4I17A 5M72A 4AEZC 3B7BA 1HZ4A 5G05J 5JJ6A 5CEDB 3MCXA 5LP0A 4U0ZA 2H6FA 3JQ1A 4YVOA 4L1BA 4U0UA 4LRZA 2MRIA 3UKUG 4OAUC 3LJ3A 5FQ8A 4MBGA 5BNWA 2ETAA 3UT7A 3DBSA 2KXPC 4RVBA 1N4RA 1DVPA 2P58C 3Q49B 2V4HC 5H7PA 4UQZA 4M3OA 4G24A 3UIPC 3FUJA 4WNEA 4APFA 1HX8A 4CDNA 1OUVA 4F1PA 3ENEA 4ACKA 2GRRB 5A7DB 2P9IG 1MYOA 4DLOA 3E33A 4EECA 3FUFA 4Z68A 3Q78A 4JHRA 5CMWA 4DUIA 4JHKA 2UY1B 1E7UA 3RIBA 3UT8A 3MV3B 3FTSA 3ZXSA 1A5EA 1JPLA 2XEVA 1UJJA 1HU3A 2I2OA 3OAWA 5FQ7A 2WXLA 3ZPJA 2XZDG 4O60A 1IQRA 3Q9UC 3EUVA 4L7TA 1KT0A 1HG2A 3VLDA 4BT8A 4L9PA 1NA3A 3B7TA 4LUNU 1H6PA 3IEGA 2KATA 4DX2A 3GZ2A 2AJAA 2DWZA 5AENA 5ARFA 5JA4D 3FU6A 3V2OA 4U63A 4N2QA 2KCVA 5T8IA 4FULA 4LEUA 1O5MA 5G04C 3LKUA 2WXFA 5KCMA 5EX0A 4GU5A 1TEZA 4HRLA 3AJIA 3FUDA 1UJKA 4GTTA 2GRPB 3SQVA 4F53A 2ETBA 2YHCA 4G8KA 4JC8A 4KVOA 3FTWA 4J8DA 3AG2E 3DSVA 1D9SA 4EZLA 2QC9A 3EU9A 4XI0A 3TWSA 4GAAA 1TN6A 1QBQA 4GCOA 1N0QA 3UINC 2EINE 4F7AA 1G3NB 4TUUA 5DIZA 3PZ1A 3KEZA 3ABLE 4GMLA 4GTOA 4GCNA 3RKVA 2OVFA 3UUXA 1LD7A 3CKCA 1VDYA 2AVPA 2J8SD 3ZU7B 5HQ8A 1IHBA 3ASFA 2Q7FA 4KBQA 4KMOA 1IQUA 3Q15A 3ZYMA 5B1BE 1S63A 3DSWA 2XENA 3L82A 4A3VA 3ML9A 3FHEA 2J09A 3SF4A 5HS0A 3R7RA 3VTXA 4ANVA 2UY1A 4U8VD 2KCLA 4B94A 3PUJA 3CHMA 5AARA 2BUGA 4Q96A 3DSXA 5KNHD 1O1SA 2X6JA 3UQ3A 3PNTB 3ZYKA 3DPYA 3NOGD 1TN8A 1FVFA 3SNXA 1QNFA 2A5EA 4HRMB 3PNLB 4TV3A 4LNUD 3GW4A 3EDTB 4EBAG 2ZGGA 1V55E 3G2TA 4JZYA 1ELRA 1X81A 2QYJA 3KAEA 1Z3XA 4YDOA 4N3AA 3SHFA 3TG4A 1YCSB 3CKBA 1TYQG 1PAQA 3LCAA 1E7VA 1BI8B 1K1AA 5BPPA 2HO1A 4E85A 5CBOA 2WPVA 5ENOD 2RFAA 2J49A 3TWRA 5JMND 4PS7A 3QOUA 3ASOE 2XGOA 4Q69A 4I2ZA 3CHOA 3DSSA 1N0RA 3IXEA 1Z5SC 4L2LA 4WNGA 3APFA 2IJGX 3IV0A 3FTVA 3QC1A 5LOZA 5C2YA 3D9OA 4EZKA 5FINA 4I6GA 3JCKC 5HKPA 2XQ0A 5CRUA 4TXQA 3Q9NC 4XE0A 4CGVA 5G04J 4GZCA 1BI7B 2IO3C
chains in the Genus database with same CATH topology
5AARA 2F37A 2BKKB 2ETAA 2KBXA 2XEHA 2F8YA 1BU9A 5KNHD 2KXPC 4GMRA 2FO1E 2XEEA 3NBNB 3TWVA 4J8YA 3SO8A 2MYOA 3EHRA 2RFMA 2XZTG 3NOGD 4YDWA 1NFIE 3V2XA 2V4HC 1AP7A 1MX4A 1WDYA 4HRLA 3ZNGA 4ZFHA 3AJIA 4YDYA 4B93B 3UTMA 3ZKJA 5AQAA 5BXUA 2NYJA 4A63B 2A5EA 4HRMB 3AAAC 1K1BA 5EIDA 3T8KA 3TWTA 1SW6A 4HB5A 5CERB 1MJ0A 1IXVA 3JUEA 4OAVB 4LNUD 3HRAA 5HRYA 1YYHA 2ETBA 5AN8A 2ETCA 4G8KA 3W9FA 4DX7D 5EYLA 4F6RD 4BSZB 4BESA 2ZGGA 4DX6D 4F1PA 1D9SA 1MX2A 3TWXA 4BERA 4J7WA 4UUCA 5AQBA 1BLXB 4O1PA 2QYJA 2QC9A 4CYMD 3EU9A 4U8YD 3ZUVB 3DEOA 1MYOA 3DEPA 3J5PA 3F6QA 4LG6A 3KEAA 2B0OE 3TWSA 5KWDA 5ITZF 4U95D 1N0QA 4GPMA 5ENQD 3TWUA 4QQIA 1YCSB 4Z68A 1G3NB 2Y1LE 1N11A 3B95A 4ATZD 1IKND 3NOCD 4DUIA 5ENPD 1BI8B 1K1AA 4C48B 4K5CA 4RLYA 4JB8P 4DRXE 4HI9A 5KBAA 1A5EA 4QFVA 4O1OA 5CBOA 2F8XK 4HI8A 2RFAA 5ENOD 3V79K 1UOHA 1YMPA 3TWRA 5JMND 4HNAD 5EN5D 2V5QC 3V31A 5D66A 5AQ7A 3V30A 5AAOA 2DZOA 5ENTD 5ENSD 3JXIA 4K5AB 1K3ZD 2J8SD 3ZU7B 3T9KA 1BD8A 5EIBE 3UI2A 1IHBA 3TWQA 4BEPA 1OY3D 2XZDG 4O60A 1N0RA 3IXEA 5CBNA 3Q9UC 3W9GA 4G8LA 2Y0BG 4K5BA 5ENRD 4ZHBA 3HG0D 1OT8A 1AWCB 5EILA 4DX1A 3B7BA 3J5QB 1WG0A 5CECB 4TUMA 4HQDA 4N5QA 2XENA 5CEDB 3EHQA 5BXOA 1MX6A 2P2CP 2ZGDA 1QYMA 2VGEA 5FINA 4LSZE 3JXJA 4NIKA 5HKPA 2JABA 4HBDA 5CEAA 5KNGA 2PNNA 3TWWA 2BKGA 2DZNA 5HS0A 4DX2A 1S70B 4HRNA 3UXGA 2AJAA 5AQ9A 1TR4A 4BETA 4CZ2D 2DWZA 2DVWA 3LJNA 3Q9NC 1SVXA 4U8VD 4HLLA 2L6BA 3D9HA 1DC2A 1DCQA 4OAUC 3C5RA 1BI7B 4U96D 4DX5D 5EYPF 5FIOA 5JA4D 3V2OA 2HE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AAR A;  2F37 A;  2BKK B;  2ETA A;  2KBX A;  2XEH A;  2F8Y A;  1BU9 A;  5KNH D;  2KXP C;  4GMR A;  2FO1 E;  2XEE A;  3NBN B;  3TWV A;  4J8Y A;  3SO8 A;  2MYO A;  3EHR A;  2RFM A;  2XZT G;  3NOG D;  4YDW A;  1NFI E;  3V2X A;  2V4H C;  1AP7 A;  1MX4 A;  1WDY A;  4HRL A;  3ZNG A;  4ZFH A;  3AJI A;  4YDY A;  4B93 B;  3UTM A;  3ZKJ A;  5AQA A;  5BXU A;  2NYJ A;  4A63 B;  2A5E A;  4HRM B;  3AAA C;  1K1B A;  5EID A;  3T8K A;  3TWT A;  1SW6 A;  4HB5 A;  5CER B;  1MJ0 A;  1IXV A;  3JUE A;  4OAV B;  4LNU D;  3HRA A;  5HRY A;  1YYH A;  2ETB A;  5AN8 A;  2ETC A;  4G8K A;  3W9F A;  4DX7 D;  5EYL A;  4F6R D;  4BSZ B;  4BES A;  2ZGG A;  4DX6 D;  4F1P A;  1D9S A;  1MX2 A;  3TWX A;  4BER A;  4J7W A;  4UUC A;  5AQB A;  1BLX B;  4O1P A;  2QYJ A;  2QC9 A;  4CYM D;  3EU9 A;  4U8Y D;  3ZUV B;  3DEO A;  1MYO A;  3DEP A;  3J5P A;  3F6Q A;  4LG6 A;  3KEA A;  2B0O E;  3TWS A;  5KWD A;  5ITZ F;  4U95 D;  1N0Q A;  4GPM A;  5ENQ D;  3TWU A;  4QQI A;  1YCS B;  4Z68 A;  1G3N B;  2Y1L E;  1N11 A;  3B95 A;  4ATZ D;  1IKN D;  3NOC D;  4DUI A;  5ENP D;  1BI8 B;  1K1A A;  4C48 B;  4K5C A;  4RLY A;  4JB8 P;  4DRX E;  4HI9 A;  5KBA A;  1A5E A;  4QFV A;  4O1O A;  5CBO A;  2F8X K;  4HI8 A;  2RFA A;  5ENO D;  3V79 K;  1UOH A;  1YMP A;  3TWR A;  5JMN D;  4HNA D;  5EN5 D;  2V5Q C;  3V31 A;  5D66 A;  5AQ7 A;  3V30 A;  5AAO A;  2DZO A;  5ENT D;  5ENS D;  3JXI A;  4K5A B;  1K3Z D;  2J8S D;  3ZU7 B;  3T9K A;  1BD8 A;  5EIB E;  3UI2 A;  1IHB A;  3TWQ A;  4BEP A;  1OY3 D;  2XZD G;  4O60 A;  1N0R A;  3IXE A;  5CBN A;  3Q9U C;  3W9G A;  4G8L A;  2Y0B G;  4K5B A;  5ENR D;  4ZHB A;  3HG0 D;  1OT8 A;  1AWC B;  5EIL A;  4DX1 A;  3B7B A;  3J5Q B;  1WG0 A;  5CEC B;  4TUM A;  4HQD A;  4N5Q A;  2XEN A;  5CED B;  3EHQ A;  5BXO A;  1MX6 A;  2P2C P;  2ZGD A;  1QYM A;  2VGE A;  5FIN A;  4LSZ E;  3JXJ A;  4NIK A;  5HKP A;  2JAB A;  4HBD A;  5CEA A;  5KNG A;  2PNN A;  3TWW A;  2BKG A;  2DZN A;  5HS0 A;  4DX2 A;  1S70 B;  4HRN A;  3UXG A;  2AJA A;  5AQ9 A;  1TR4 A;  4BET A;  4CZ2 D;  2DWZ A;  2DVW A;  3LJN A;  3Q9N C;  1SVX A;  4U8V D;  4HLL A;  2L6B A;  3D9H A;  1DC2 A;  1DCQ A;  4OAU C;  3C5R A;  1BI7 B;  4U96 D;  4DX5 D;  5EYP F;  5FIO A;  5JA4 D;  3V2O A;  2HE0 A; 
#chains in the Genus database with same CATH topology
 2P9N G;  2BKK B;  3PEV B;  2Y69 E;  4PDX A;  2XPI A;  3ESL A;  3DXK G;  4J8E A;  1MZC A;  2XZT G;  1N4S A;  3T5X A;  1MHQ A;  1WM5 A;  5EID A;  2J9Q A;  1ZBP A;  1YYH A;  4CRW A;  4AXH A;  5G2N A;  3C98 A;  4GPK A;  3ONK A;  3DEP A;  3SI5 A;  4GYO A;  5FZS A;  1E96 B;  4GPM A;  2ILR A;  2DYR E;  1E8X A;  2PQR A;  1JCS A;  2MOW A;  2VGX B;  4HI9 A;  5HI7 A;  4N39 A;  2F8X K;  3FTY A;  4RG6 A;  3AG4 E;  5EN5 D;  3V31 A;  4Y6W A;  4WND A;  3BUA A;  1XGW A;  2XS8 A;  1U2V G;  1TJF A;  1SZ9 A;  2Y0B G;  2A5U A;  1PC2 A;  1UN9 A;  3RO3 A;  2WQ6 A;  2BTD A;  5CEC B;  5CMY A;  3FEX A;  3FU5 A;  2WXK A;  4XKC A;  4UWK A;  4WWP A;  4OYS A;  2X3M A;  5CEA A;  3AU4 A;  4I1A A;  4IYP A;  4LER A;  2R2L A;  1JCQ A;  4G2V A;  4A1S A;  2JEK A;  4G26 A;  2WXH A;  2L6B A;  2NXP A;  4U96 D;  2H6H A;  3AS8 A;  2WXO A;  2OEW A;  3AG3 E;  1UN8 A;  3D3M A;  2RKK A;  5CCM A;  3FUM A;  4JEH A;  3NBN B;  1E8Z A;  3APD A;  3MA5 A;  3FTZ A;  1HF8 A;  3UIO C;  3HXC A;  4N3B A;  4XI9 A;  2P9L G;  3ZKJ A;  2H6I A;  4ILH B;  4ACL A;  3HRA A;  4KXK B;  3U64 A;  1OWN A;  4GA0 A;  5D2M C;  2IOL A;  2WMO A;  5AQB A;  4KVM A;  3FWV A;  3DEO A;  4UWH A;  3HHM A;  4ILI A;  3KEA A;  4Q94 A;  3TGO A;  3ABM E;  2AXZ A;  2WXR A;  4GTP A;  1IKN D;  2CFU A;  5BT1 A;  4UQX A;  2DBA A;  3QWP A;  4MS6 A;  2BF0 X;  2LAH A;  3S7J A;  4BSX A;  1WAO 1;  1K3Z D;  3PDN A;  1HFA A;  1Q2Z A;  2DYS E;  2ZIS A;  3WG7 E;  3NB2 A;  3FUN A;  1X5B A;  4GA2 A;  1W3B A;  3EU5 A;  3CIA A;  4I2W A;  3EHQ A;  3E4B A;  2ZGD A;  5EDS A;  3VLF A;  2RG8 A;  4O6F A;  4PS8 A;  3MYV A;  2PZI A;  2VGX A;  3KD7 A;  3T5V A;  1NA0 A;  4HLE A;  4H7X A;  2HE0 A;  3S7F A;  1HO8 A;  2LSU A;  4BX9 A;  2XEE A;  1JWG A;  5J90 A;  2FF4 A;  3LPZ A;  3RSE G;  1K1B A;  2R17 C;  1YA0 A;  5HRY A;  2YHE A;  4BES A;  2YNQ A;  1KLX A;  4J7W A;  2IFU A;  3R9M A;  1O1R A;  3PRE A;  5KWD A;  2B0O E;  3IHV A;  5ENQ D;  3ULQ A;  3S7D A;  3DSU A;  3QDN A;  2LNI A;  4B8C B;  3AS4 A;  4RLY A;  4DRX E;  2OV8 A;  3V30 A;  5J08 A;  5ENT D;  4MLP A;  5EIB E;  1BD8 A;  1K8K G;  2WXN A;  4HOT A;  2L9B A;  1OY3 D;  3FUH A;  5CBN A;  1HXI A;  2L0T B;  3W9G A;  4DJA A;  3L6A A;  2CFZ A;  3PZ4 A;  3C3O A;  4HFG A;  4TUM A;  3G2V A;  2NC9 A;  4HBD A;  5KNG A;  3ONL A;  3QKY A;  1D8E A;  3FUL A;  1Y6I A;  5AIJ A;  3LJN A;  3B13 A;  1FVH A;  3DRA A;  5FZQ A;  3CHR A;  4TRQ A;  4D10 C;  2KM4 A;  4JPS A;  3CVX A;  4DPR A;  3LEW A;  4GMR A;  1N54 A;  4RSY A;  1GW6 A;  2EQX A;  2I1K A;  3MV2 B;  4YDW A;  4GZ3 A;  1OWL A;  2QZA A;  4I6E A;  4EHM A;  2CHW A;  1Y8M A;  3D9P A;  2GRO B;  5AN8 A;  2ETC A;  4UI9 K;  4U04 A;  3L54 A;  4W9R A;  4JD2 G;  5AYW D;  3MJW A;  2RD0 A;  4BX8 A;  3ZUV B;  5LX8 A;  1XNF A;  4QQI A;  2AW6 A;  4XEI G;  5FQ6 A;  2VYI A;  3QAR A;  3FTU A;  2P9S G;  3Q73 A;  4U8H A;  3ZYL A;  3LVR E;  3P2B A;  2DZO A;  5LCW C;  3PEU B;  5LFA A;  3D9L A;  3BEE A;  2GRM A;  3Q7A A;  2ZIR A;  2P9U G;  2XRY A;  2HR2 A;  1QYM A;  2VGE A;  3JXJ A;  4YVQ C;  4UWF A;  4MKT A;  4GTV A;  3NQP A;  3MKQ B;  4CZ2 D;  2X6F A;  2R03 A;  2XS1 A;  3QAQ A;  1S0P A;  2GRQ B;  4AV7 A;  4G1T A;  4IUL A;  2KBX A;  1E8Y A;  2IO2 C;  3CQC B;  2A4Z A;  1NI1 A;  2XRZ A;  3CR3 A;  2MYO A;  2RFM A;  2Y4T A;  2ZU6 B;  2EIL E;  2IOS A;  3R9A B;  3CVN A;  3RAU A;  4B93 B;  3UPV A;  1TNB A;  4A63 B;  4I9E A;  2P9K G;  3D9I A;  1UW4 B;  2WQ7 A;  4M7C A;  1MX2 A;  3ASN E;  4HXI A;  3QWW A;  4GZ6 A;  1FCH A;  3SFX A;  5ITZ F;  3SGH A;  3FUK A;  3TWU A;  5KJM A;  4KT6 B;  4ATZ D;  4C0M A;  2CHX A;  3PZD A;  4FLH A;  4UWG A;  4FAD A;  2EIK E;  1Z3Y A;  3I4G A;  3OXF A;  5KJN A;  3ML8 A;  4U7E B;  4N5C A;  3LXU X;  2PM6 A;  1LTX A;  3Q75 A;  3TL5 A;  4BT9 A;  5G55 A;  5ENR D;  2R02 A;  4ZHB A;  4JA9 A;  3J5Q B;  2MHK A;  5FQ4 A;  3MEK A;  4BTA A;  1NZN A;  2OVB A;  3UMV A;  2CG3 A;  3PE4 A;  2QFC A;  2DZN A;  1NL4 A;  1IYG A;  1TR4 A;  1UG3 A;  5EKQ D;  2OCC E;  3LVQ E;  1QZ2 A;  2Y3A A;  1DC2 A;  1DCQ A;  5JHA A;  5JHB A;  2F8Y A;  3EIQ C;  1BU9 A;  4GZ5 A;  3CK9 A;  4JXT A;  3TWV A;  1WDY A;  4ZFH A;  3PH0 C;  5D0O D;  3LY8 A;  5DBK A;  4AVX A;  2QY7 A;  5KJK A;  3JUE A;  3SFY A;  4TXR A;  4NUR A;  3W9F A;  4F6R D;  4BER A;  4GB9 A;  1EF1 C;  2R59 A;  3GZ1 A;  3VTY A;  3TG5 A;  3ASG A;  3MKQ A;  2R5S A;  2IQC A;  4H7Y A;  2WM9 A;  2J4B A;  4EQF A;  1N11 A;  4FHK A;  5LCW J;  4DK5 A;  4HI8 A;  3V79 K;  4CEM A;  4WWO A;  2V5Q C;  5AQ7 A;  2PQN A;  5ENS D;  3JXI A;  3I5P A;  3Q7F A;  3JQ0 A;  5FT9 A;  3PUK A;  3Q47 B;  4GTR A;  3Q4A B;  1WG0 A;  4I1M A;  1Z6T A;  1N95 A;  4NIK A;  3LY7 A;  3APC A;  3IBE A;  1INZ A;  2AXU A;  3CVV A;  1TNU A;  4AJW A;  2XGS A;  3BG0 B;  3P1U A;  3N71 A;  3MZL B;  5FIO A;  4KZ0 A;  2XEH A;  3CST A;  4L2Y A;  3IHY A;  2IU1 A;  3IKO B;  4CCA A;  3OXG A;  1AP7 A;  5BV0 A;  1JWF A;  3ZNG A;  1OCR E;  1H6O A;  3U4T A;  5FTP A;  4YDY A;  3URZ A;  4JW1 A;  4GZD A;  3CQG B;  2AWI A;  4AY5 A;  4LNG A;  5JJT A;  2F0Y A;  4G11 A;  4EPZ A;  4RQI A;  1OWM A;  3TWX A;  4LNB A;  4GMJ A;  4FA6 A;  4EBA A;  3OTN A;  1OWO A;  1QQE A;  2IEJ A;  4XZ4 A;  3KSQ A;  5B3S E;  2EIM E;  3ZVV A;  4ATG A;  1FPP A;  3B95 A;  4E6H A;  1O1T A;  4NAC A;  2VQ2 A;  2M63 A;  3FDH A;  4UQY A;  3SBS A;  1HE8 A;  1OCZ E;  2ION A;  3FY4 A;  2LXM A;  4HNA D;  1JUQ A;  5ARG A;  4B8A A;  3UKR G;  4YND A;  3CVQ A;  2WXM A;  2VSN A;  4XKB A;  3E37 A;  4DLQ A;  2I6H A;  4AY6 A;  3GYZ A;  3CK8 A;  4URK A;  4KZC A;  3DWL G;  4X8Q A;  5ANR A;  4WNF A;  3PZ3 A;  2FUL A;  2X6K A;  3TXN A;  1BPO A;  4LSZ E;  2PL2 A;  1OCC E;  3NZS A;  2C2L A;  3UXG A;  1HS6 A;  1EPU A;  4BY6 A;  3O4Z A;  1U3D A;  3RO2 A;  2I9C A;  3G2W A;  4WWN A;  3ESK A;  3SY2 A;  4BWR A;  4U0S A;  3EHR A;  3HVE B;  4HOR A;  4HOS A;  4Y6C A;  4BTB A;  4J8S A;  3CHS A;  3L9T A;  1ELK A;  3PE3 A;  3TWT A;  4OAV B;  4N2S A;  1EYH A;  4AP2 A;  3ASD A;  4WUY A;  4U8Y D;  3ZHE B;  2FI7 A;  1N94 A;  4P29 A;  3FP3 A;  4U07 A;  3R7Q A;  1H0A A;  3ZN3 A;  2VJ8 A;  2CG2 A;  4PH4 B;  2ZXW E;  4DI3 A;  3FTX A;  3L16 A;  5D66 A;  4GTQ A;  2LUH A;  4JA7 A;  4AIF A;  2C0L A;  3Q5M A;  2VTB B;  4L23 A;  4K03 A;  3T9K A;  1TN7 A;  4JHJ A;  2WXP A;  4B0Z A;  5CCL A;  3FFL A;  3D9M A;  4HQD A;  5BXO A;  1MX6 A;  2KC7 A;  2JAB A;  4GYW A;  3I4R B;  2WXI A;  2X38 A;  2VSO E;  2PM7 A;  4ANU A;  2XCB A;  4FP7 A;  2DVW A;  3EJN A;  3SD5 A;  2R05 A;  2FEZ A;  2V4L A;  3C5R A;  4J0U A;  2F37 A;  5FJY A;  4K0R A;  3L17 A;  3ZEF A;  3QK0 A;  4FU3 A;  1OCO E;  1JCR A;  3ZFW A;  4GTM A;  3AU5 A;  5ENN A;  2I1J A;  2HYZ A;  5AQA A;  4FC8 A;  2WVI A;  5KJL A;  3AAA C;  1IXV A;  2WQH A;  2H6G A;  3MX3 A;  4JL0 A;  1LD8 A;  5EYL A;  3TJP A;  3D9N A;  1HH8 A;  3FEY A;  3F6Q A;  5CRV A;  1OXJ A;  3BG1 B;  3SBT B;  3QNK A;  4XIF A;  3CVW A;  3GZS A;  4K5C A;  2GW1 A;  2OND A;  3ZYQ A;  1TJC A;  1TNO A;  3BU8 A;  3FH8 A;  3D9K A;  1S64 A;  1SQM A;  3HVE A;  3FH5 A;  3UM2 A;  1FT1 A;  2YIN A;  4OVV A;  4NRH B;  3HDX A;  2CHZ A;  3EHN A;  1SA4 A;  4N5Q A;  4JEU A;  3ZHE A;  4UWL A;  4V3I A;  3DPD A;  5BW8 C;  4CDR A;  1S70 B;  2HM8 A;  2UWJ G;  4DI4 A;  4B89 A;  2JLB A;  2XPZ A;  4NQ0 A;  3U3W A;  5JJ7 A;  3BQO A;  1H19 A;  2WMN A;  3DST A;  3E30 A;  3TXM A;  1N4Q A;  2VTB A;  1NFI E;  2J4D A;  2LSV A;  4APO A;  1MX4 A;  5BV1 A;  3I3N A;  1SZA A;  3HXD A;  2WB2 A;  3HYM B;  3UTM A;  2KCK A;  3NZU A;  5BXU A;  4C9B B;  5CER B;  2XCC A;  1MJ0 A;  2Y4U A;  5FWQ A;  1IHG A;  5D0Q D;  1BLX B;  3S7B A;  4LG6 A;  2C0M A;  3S2A A;  3ABK E;  4PS3 A;  3PVL A;  1U3C A;  3PS6 A;  4CT4 A;  3FUI A;  3D9J A;  3NOC D;  4C0E A;  5T3R A;  2B6C A;  3CK7 A;  2EIJ E;  4UI9 C;  1UOH A;  1YMP A;  2IY0 C;  4CGW A;  1B89 A;  3OXL A;  1FT2 A;  2FBN A;  4HS2 A;  3ZRH A;  3CHP A;  3QB2 A;  3TWQ A;  4HOU A;  1OT8 A;  4WAF A;  2XPY A;  4A1G A;  4DX1 A;  4MRU A;  1V54 E;  2DCP A;  5FZR A;  4G25 A;  3KS2 A;  3ZXP A;  3TWW A;  2BKG A;  4FLB A;  3B7U X;  1RW2 A;  4AOF A;  4F3V A;  4FHJ A;  3RRM B;  2VSX E;  3HIZ A;  3MGB A;  5AJD A;  3TAX A;  4ABN A;  1L5J A;  3RU0 A;  5BUZ A;  3X2Q E;  3VLE A;  2IF4 A;  3UT4 A;  2NYJ A;  1RZ4 A;  1SW6 A;  2VSY A;  2BED A;  2LO6 A;  3DXM G;  1ZB1 A;  1H2U A;  4DX7 D;  5IY5 E;  1KPS B;  3JYS A;  4O1P A;  1ELW A;  4CYM D;  2AXV A;  3E34 A;  3UM3 A;  3CHQ A;  4EZJ A;  1PY1 A;  5CHE E;  4A3T A;  5ENP D;  2NSZ A;  4PUC A;  3EIJ A;  2LXL A;  1E8W A;  4FJY A;  3FH7 A;  2X6H A;  5ANL A;  3U9W A;  3CVY A;  5E76 A;  5EX3 A;  3U66 A;  3HXE A;  1N4P A;  3LS8 A;  1HG5 A;  4HOQ A;  4JVS A;  3CVU A;  4G8L A;  3HG0 D;  2V0P A;  3O48 A;  3PRZ A;  3HXF A;  3ULY A;  5AJL A;  2FO7 A;  1H6K A;  1KZP A;  3CGH A;  4R7L A;  1H2T C;  2KZT B;  1A17 A;  5G05 C;  2P9P G;  1OWP A;  4HRN A;  3G2U A;  5AQ9 A;  4I1O B;  4BET A;  3B7R L;  2QYU A;  4HLL A;  3D9H A;  2V5F A;  4DX5 D;  5EYP F;  2LAI A;  1MQS A;  3UM0 A;  4OVU A;  3PZ2 A;  2GRL A;  4J8Y A;  3SO8 A;  3B7S A;  2J07 A;  1EDU A;  3EHM A;  3CVL A;  3V2X A;  3RK6 A;  3NAW A;  3RJV A;  4I43 A;  3T8K A;  4HB5 A;  3NF1 A;  2GRN B;  2J08 A;  3ZGQ A;  4DX6 D;  4J6I A;  4CDM A;  3QWV A;  3J5P A;  4U95 D;  4ANX A;  3UM1 A;  4UI9 J;  4IRU A;  3QJZ A;  5A6C A;  2XGM A;  3WXX A;  1P5Q A;  3LDZ A;  1NP7 A;  3SZ7 A;  3ULE G;  4JB8 P;  3SFZ A;  4QFV A;  3RRN B;  3CVP A;  3LY9 A;  2WXG A;  2OOE A;  5E75 A;  4GYY A;  5T4Y A;  4GTS A;  3UX4 A;  4ME2 A;  3ASH A;  1AWC B;  3LYA A;  5EIL A;  4FJZ A;  4A55 A;  4F1S A;  4ILG A;  3K9I A;  4YDE A;  5B1A E;  4G23 A;  4LCT A;  2P2C P;  1KT1 A;  4GA1 A;  4I6J A;  2PNN A;  1TNZ A;  4J8F A;  3FU3 A;  3KSL A;  1D8D A;  2E0I A;  3FU0 A;  1SVX A;  4TXP A;  3CSF A;  3RRU A;  2L6J A;  4HVB A;  2DIW A;  3T8M A;  3JUI A;  2OEV A;  2FO1 E;  5C1D A;  1KZO A;  3L08 A;  1LF8 A;  3L13 A;  2E2E A;  3MKR A;  3C72 A;  1E90 A;  4RG9 A;  3ZIM A;  3Q79 A;  1TNY A;  1N52 A;  4ANW A;  2VGY A;  5A23 A;  4KYO B;  4I9C A;  4IN3 B;  4BSZ B;  3E32 A;  4UUC A;  1WY6 A;  1H2V C;  2KZT A;  2GGF A;  3CEQ A;  3G2S A;  3CV0 A;  2WXJ A;  4CT0 A;  2XHE A;  1DCE A;  2Y1L E;  1DNP A;  3AG1 E;  4C48 B;  3ZW3 A;  5KBA A;  3C3R A;  4O1O A;  4XX5 A;  4N3C A;  3HXB A;  4BFR A;  1N9A A;  3FUE A;  2L0I A;  4AM9 A;  3CLJ A;  5AAO A;  1SA5 A;  2X6I A;  3AS5 A;  3ISM C;  4K5A B;  3L22 A;  2WXQ A;  2YQ8 A;  1ZU2 A;  3UI2 A;  4BEP A;  2V8S E;  4K5B A;  3C3Q A;  4I17 A;  5M72 A;  4AEZ C;  3B7B A;  1HZ4 A;  5G05 J;  5JJ6 A;  5CED B;  3MCX A;  5LP0 A;  4U0Z A;  2H6F A;  3JQ1 A;  4YVO A;  4L1B A;  4U0U A;  4LRZ A;  2MRI A;  3UKU G;  4OAU C;  3LJ3 A;  5FQ8 A;  4MBG A;  5BNW A;  2ETA A;  3UT7 A;  3DBS A;  2KXP C;  4RVB A;  1N4R A;  1DVP A;  2P58 C;  3Q49 B;  2V4H C;  5H7P A;  4UQZ A;  4M3O A;  4G24 A;  3UIP C;  3FUJ A;  4WNE A;  4APF A;  1HX8 A;  4CDN A;  1OUV A;  4F1P A;  3ENE A;  4ACK A;  2GRR B;  5A7D B;  2P9I G;  1MYO A;  4DLO A;  3E33 A;  4EEC A;  3FUF A;  4Z68 A;  3Q78 A;  4JHR A;  5CMW A;  4DUI A;  4JHK A;  2UY1 B;  1E7U A;  3RIB A;  3UT8 A;  3MV3 B;  3FTS A;  3ZXS A;  1A5E A;  1JPL A;  2XEV A;  1UJJ A;  1HU3 A;  2I2O A;  3OAW A;  5FQ7 A;  2WXL A;  3ZPJ A;  2XZD G;  4O60 A;  1IQR A;  3Q9U C;  3EUV A;  4L7T A;  1KT0 A;  1HG2 A;  3VLD A;  4BT8 A;  4L9P A;  1NA3 A;  3B7T A;  4LUN U;  1H6P A;  3IEG A;  2KAT A;  4DX2 A;  3GZ2 A;  2AJA A;  2DWZ A;  5AEN A;  5ARF A;  5JA4 D;  3FU6 A;  3V2O A;  4U63 A;  4N2Q A;  2KCV A;  5T8I A;  4FUL A;  4LEU A;  1O5M A;  5G04 C;  3LKU A;  2WXF A;  5KCM A;  5EX0 A;  4GU5 A;  1TEZ A;  4HRL A;  3AJI A;  3FUD A;  1UJK A;  4GTT A;  2GRP B;  3SQV A;  4F53 A;  2ETB A;  2YHC A;  4G8K A;  4JC8 A;  4KVO A;  3FTW A;  4J8D A;  3AG2 E;  3DSV A;  1D9S A;  4EZL A;  2QC9 A;  3EU9 A;  4XI0 A;  3TWS A;  4GAA A;  1TN6 A;  1QBQ A;  4GCO A;  1N0Q A;  3UIN C;  2EIN E;  4F7A A;  1G3N B;  4TUU A;  5DIZ A;  3PZ1 A;  3KEZ A;  3ABL E;  4GML A;  4GTO A;  4GCN A;  3RKV A;  2OVF A;  3UUX A;  1LD7 A;  3CKC A;  1VDY A;  2AVP A;  2J8S D;  3ZU7 B;  5HQ8 A;  1IHB A;  3ASF A;  2Q7F A;  4KBQ A;  4KMO A;  1IQU A;  3Q15 A;  3ZYM A;  5B1B E;  1S63 A;  3DSW A;  2XEN A;  3L82 A;  4A3V A;  3ML9 A;  3FHE A;  2J09 A;  3SF4 A;  5HS0 A;  3R7R A;  3VTX A;  4ANV A;  2UY1 A;  4U8V D;  2KCL A;  4B94 A;  3PUJ A;  3CHM A;  5AAR A;  2BUG A;  4Q96 A;  3DSX A;  5KNH D;  1O1S A;  2X6J A;  3UQ3 A;  3PNT B;  3ZYK A;  3DPY A;  3NOG D;  1TN8 A;  1FVF A;  3SNX A;  1QNF A;  2A5E A;  4HRM B;  3PNL B;  4TV3 A;  4LNU D;  3GW4 A;  3EDT B;  4EBA G;  2ZGG A;  1V55 E;  3G2T A;  4JZY A;  1ELR A;  1X81 A;  2QYJ A;  3KAE A;  1Z3X A;  4YDO A;  4N3A A;  3SHF A;  3TG4 A;  1YCS B;  3CKB A;  1TYQ G;  1PAQ A;  3LCA A;  1E7V A;  1BI8 B;  1K1A A;  5BPP A;  2HO1 A;  4E85 A;  5CBO A;  2WPV A;  5ENO D;  2RFA A;  2J49 A;  3TWR A;  5JMN D;  4PS7 A;  3QOU A;  3ASO E;  2XGO A;  4Q69 A;  4I2Z A;  3CHO A;  3DSS A;  1N0R A;  3IXE A;  1Z5S C;  4L2L A;  4WNG A;  3APF A;  2IJG X;  3IV0 A;  3FTV A;  3QC1 A;  5LOZ A;  5C2Y A;  3D9O A;  4EZK A;  5FIN A;  4I6G A;  3JCK C;  5HKP A;  2XQ0 A;  5CRU A;  4TXQ A;  3Q9N C;  4XE0 A;  4CGV A;  5G04 J;  4GZC A;  1BI7 B;  2IO3 C; 
#chains in the Genus database with same CATH homology
 5AAR A;  2F37 A;  2BKK B;  2ETA A;  2KBX A;  2XEH A;  2F8Y A;  1BU9 A;  5KNH D;  2KXP C;  4GMR A;  2FO1 E;  2XEE A;  3NBN B;  3TWV A;  4J8Y A;  3SO8 A;  2MYO A;  3EHR A;  2RFM A;  2XZT G;  3NOG D;  4YDW A;  1NFI E;  3V2X A;  2V4H C;  1AP7 A;  1MX4 A;  1WDY A;  4HRL A;  3ZNG A;  4ZFH A;  3AJI A;  4YDY A;  4B93 B;  3UTM A;  3ZKJ A;  5AQA A;  5BXU A;  2NYJ A;  4A63 B;  2A5E A;  4HRM B;  3AAA C;  1K1B A;  5EID A;  3T8K A;  3TWT A;  1SW6 A;  4HB5 A;  5CER B;  1MJ0 A;  1IXV A;  3JUE A;  4OAV B;  4LNU D;  3HRA A;  5HRY A;  1YYH A;  2ETB A;  5AN8 A;  2ETC A;  4G8K A;  3W9F A;  4DX7 D;  5EYL A;  4F6R D;  4BSZ B;  4BES A;  2ZGG A;  4DX6 D;  4F1P A;  1D9S A;  1MX2 A;  3TWX A;  4BER A;  4J7W A;  4UUC A;  5AQB A;  1BLX B;  4O1P A;  2QYJ A;  2QC9 A;  4CYM D;  3EU9 A;  4U8Y D;  3ZUV B;  3DEO A;  1MYO A;  3DEP A;  3J5P A;  3F6Q A;  4LG6 A;  3KEA A;  2B0O E;  3TWS A;  5KWD A;  5ITZ F;  4U95 D;  1N0Q A;  4GPM A;  5ENQ D;  3TWU A;  4QQI A;  1YCS B;  4Z68 A;  1G3N B;  2Y1L E;  1N11 A;  3B95 A;  4ATZ D;  1IKN D;  3NOC D;  4DUI A;  5ENP D;  1BI8 B;  1K1A A;  4C48 B;  4K5C A;  4RLY A;  4JB8 P;  4DRX E;  4HI9 A;  5KBA A;  1A5E A;  4QFV A;  4O1O A;  5CBO A;  2F8X K;  4HI8 A;  2RFA A;  5ENO D;  3V79 K;  1UOH A;  1YMP A;  3TWR A;  5JMN D;  4HNA D;  5EN5 D;  2V5Q C;  3V31 A;  5D66 A;  5AQ7 A;  3V30 A;  5AAO A;  2DZO A;  5ENT D;  5ENS D;  3JXI A;  4K5A B;  1K3Z D;  2J8S D;  3ZU7 B;  3T9K A;  1BD8 A;  5EIB E;  3UI2 A;  1IHB A;  3TWQ A;  4BEP A;  1OY3 D;  2XZD G;  4O60 A;  1N0R A;  3IXE A;  5CBN A;  3Q9U C;  3W9G A;  4G8L A;  2Y0B G;  4K5B A;  5ENR D;  4ZHB A;  3HG0 D;  1OT8 A;  1AWC B;  5EIL A;  4DX1 A;  3B7B A;  3J5Q B;  1WG0 A;  5CEC B;  4TUM A;  4HQD A;  4N5Q A;  2XEN A;  5CED B;  3EHQ A;  5BXO A;  1MX6 A;  2P2C P;  2ZGD A;  1QYM A;  2VGE A;  5FIN A;  4LSZ E;  3JXJ A;  4NIK A;  5HKP A;  2JAB A;  4HBD A;  5CEA A;  5KNG A;  2PNN A;  3TWW A;  2BKG A;  2DZN A;  5HS0 A;  4DX2 A;  1S70 B;  4HRN A;  3UXG A;  2AJA A;  5AQ9 A;  1TR4 A;  4BET A;  4CZ2 D;  2DWZ A;  2DVW A;  3LJN A;  3Q9N C;  1SVX A;  4U8V D;  4HLL A;  2L6B A;  3D9H A;  1DC2 A;  1DCQ A;  4OAU C;  3C5R A;  1BI7 B;  4U96 D;  4DX5 D;  5EYP F;  5FIO A;  5JA4 D;  3V2O A;  2HE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...