4LG6A

Crystal structure of ankra2-ccdc8 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
163
structure length
163
Chain Sequence
ANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ankyrin Repeats of ANKRA2 Recognize a PxLPxL Motif on the 3M Syndrome Protein CCDC8.
pubmed doi rcsb
molecule keywords Ankyrin repeat family A protein 2
source organism Homo sapiens
molecule tags Structural protein
total genus 52
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4lg6A00
5HS0A 3Q9UC 4C48B 1BU9A 1MJ0A 2XEHA 2Y1LE 2XEEA 3TWTA 4BETA 4F1PA 2DZNA 4LSZE 5ENSD 5ITZF 4GPMA 4HQDA 4K5BA 1TR4A 2ETCA 3UXGA 3V79K 2MYOA 5KNHD 4K5AB 1MX6A 2VGEA 3UI2A 1BD8A 3Q9NC 5AARA 3ZUVB 1NFIE 5AQBA 5AAOA 4N5QA 1K1BA 5AN8A 5CBNA 3AJIA 4G8KA 4RLYA 1N0RA 5JMND 3J5PA 4QFVA 2J8SD 4U95D 5ENTD 4BESA 3B7BA 2DZOA 4Z68A 4F6RD 2F8YA 1MX2A 3AAAC 1SW6A 3ZNGA 4YDYA 1BI8B 4G8LA 1S70B 1YCSB 1A5EA 2AJAA 4LG6A 5D66A 4HRMB 3V30A 2B0OE 4ZFHA 4UUCA 4O1PA 4HRNA 1OY3D 4DRXE 2NYJA 1DCQA 2JABA 3NBNB 1IHBA 4ATZD 4HRLA 4BEPA 2L6BA 1UOHA 1AWCB 4HBDA 1K3ZD 4K5CA 4B93B 3W9GA 2F37A 3D9HA 5HRYA 2FO1E 3V31A 1QYMA 4J7WA 2HE0A 1G3NB 4HI9A 4O60A 5JA4D 1AP7A 1OT8A 3EHRA 4CZ2D 5BXUA 3JXIA 3EU9A 3J5QB 3NOGD 5EIBE 4LNUD 1YYHA 3KEAA 3ZU7B 2XENA 3JXJA 5AQAA 2ZGDA 3EHQA 3C5RA 5CERB 3LJNA 1IKND 5CEAA 2RFMA 1WG0A 4U96D 5EN5D 4OAUC 3UTMA 3W9FA 3T8KA 4TUMA 3TWRA 3V2OA 5EIDA 3DEPA 4ZHBA 5CECB 1YMPA 5CEDB 2F8XK 3TWXA 5KNGA 1IXVA 2ETBA 4BERA 5ENQD 4DUIA 3JUEA 4HB5A 5ENOD 5ENRD 4HNAD 2V4HC 1MX4A 2BKGA 3F6QA 4HI8A 5FINA 2Y0BG 1WDYA 4U8VD 5HKPA 1BI7B 4DX7D 2PNNA 2KXPC 2V5QC 1K1AA 2ZGGA 4YDWA 2BKKB 4U8YD 4DX5D 5FIOA 4QQIA 4A63B 3B95A 4BSZB 4O1OA 2A5EA 1SVXA 2DVWA 2XZDG 2QYJA 2QC9A 1DC2A 4DX2A 5KWDA 2XZTG 5EYPF 3TWVA 5EYLA 3TWQA 5KBAA 3TWWA 3V2XA 3ZKJA 4OAVB 4J8YA 2RFAA 5CBOA 1N11A 2ETAA 3T9KA 3TWUA 3HRAA 3DEOA 4JB8P 3SO8A 3HG0D 4GMRA 4DX6D 5AQ7A 5BXOA 3TWSA 5AQ9A 1MYOA 3NOCD 2DWZA 5ENPD 1BLXB 1N0QA 4CYMD 2P2CP 2KBXA 4DX1A 5EILA 4NIKA 4HLLA 1D9SA 3IXEA
chains in the Genus database with same CATH superfamily
5HS0A 1OCZE 3HIZA 2Y69E 4N5CA 3ASDA 4I17A 4F1PA 3BG1B 1H19A 3CGHA 1O1TA 1PC2A 4L7TA 2P9NG 2KATA 4LNGA 4CEMA 3KSQA 1A5EA 4PS8A 1TEZA 3MKQB 4PS3A 3QWPA 4JHRA 4UUCA 3CKBA 3LXUX 3AG2E 3ZW3A 4A1SA 1MZCA 3ESLA 1JUQA 1S64A 4G23A 4CDRA 1G3NB 3PE4A 2LSUA 1OWLA 2KCVA 2CG2A 3UIOC 5KJLA 3FTWA 4APFA 3SF4A 1TNOA 3CVYA 5AENA 4DUIA 3SGHA 4XIFA 4U8VD 2WXLA 3TJPA 2A5EA 4IULA 4J8DA 3MKQA 1XGWA 2WXHA 2WXRA 2OEWA 2H6FA 2OCCE 3DSXA 2VSNA 4JHJA 3GZ1A 1ELRA 3DRAA 3IEGA 5T8IA 2I1JA 1GW6A 3FU0A 3FUKA 2DZNA 2H6HA 4R7LA 5BV0A 3CEQA 2XCCA 4FHKA 1MX6A 3SFXA 5AQBA 3CHSA 4FLBA 1H2UA 3UQ3A 4BT8A 4WWPA 2R02A 5JMND 3ONLA 1OCRE 3GZSA 3JCKC 4OVVA 3APFA 1UJJA 2VSOE 1MHQA 3TL5A 4Y6CA 4ZFHA 3B7SA 4GZ3A 3C3QA 1IHBA 1K8KG 4I2WA 3UT4A 2XRYA 3UX4A 5CCMA 3FU5A 2X6IA 3Q79A 2CHXA 1N94A 4FA6A 3FUJA 4WNDA 3B7TA 3I5PA 4J8SA 2WM9A 4Q94A 5CMWA 4URKA 3PNTB 3K9IA 2RG8A 2J09A 2IFUA 1ZBPA 3EIJA 1WDYA 4MLPA 4U8YD 5BV1A 2XZDG 5E76A 4X8QA 3AS5A 4U7EB 2ILRA 2KC7A 2WMOA 1E7UA 3ZGQA 5LP0A 1JPLA 2PM6A 4C0EA 1LTXA 4EZJA 3ULYA 3IXEA 2EIME 4FU3A 4BY6A 4UQZA 2XGSA 1O1RA 3HXDA 4CT4A 2EIJE 1BD8A 1DVPA 3ZUVB 3SZ7A 4G2VA 5AN8A 4I6GA 4GMLA 2YINA 1HG2A 3AAAC 3ZNGA 1YCSB 3DXKG 2EILE 5BNWA 1N4RA 3CSFA 3RRMB 2BEDA 2WQHA 4H7YA 4GTSA 3CVPA 2JABA 2R17C 2P9LG 2YNQA 1HXIA 1D8EA 2X38A 3EHRA 5AYWD 1HO8A 1FT2A 3LJNA 5LX8A 1IKND 3BQOA 3U66A 4C0MA 4GTOA 1Z3YA 1H2VC 1X81A 1FT1A 4UWFA 3CSTA 3SBSA 3C98A 1SA4A 4F53A 3U64A 1Q2ZA 3SD5A 2YQ8A 3UMVA 4G1TA 3MEKA 5EYLA 3HXFA 1N11A 3FUHA 2RD0A 3TWUA 2J08A 5BXOA 4W9RA 5C2YA 4WWOA 5JHBA 1RW2A 3FTYA 4Y6WA 5D0OD 2ETCA 3Q7FA 5KCMA 4I9CA 3EJNA 1EYHA 3ZFWA 3O4ZA 4QFVA 4XI9A 2BF0X 2LNIA 4CGWA 4WUYA 4FJYA 2WPVA 4ATGA 2PM7A 3SI5A 4GZ6A 2QZAA 2KCKA 4TV3A 4J0UA 1UOHA 4FLHA 2ZISA 5DIZA 4O60A 2L0TB 4FHJA 3CR3A 1YA0A 3CK9A 4WNGA 2BUGA 3QC1A 4HXIA 2Y4TA 4ACLA 1WG0A 4DPRA 3T5XA 4TUMA 3DEPA 4UQYA 4FULA 2VGXB 3S2AA 5FZSA 1B89A 4HI8A 4DK5A 3EU5A 3PVLA 4DX5D 4ANVA 5HI7A 3RIBA 1DC2A 5B3SE 3G2SA 5HQ8A 3V2XA 2ZXWE 4FJZA 3LCAA 1QNFA 5AQ7A 3LPZA 4HOUA 4G26A 4BT9A 4I1AA 3Q5MA 4HLLA 4ME2A 3Q9UC 4C48B 2GRRB 3PZ2A 3CVQA 3QJZA 1KT0A 2KZTB 3NF1A 5AAOA 3DSVA 4H7XA 4I6JA 3HVEB 4N5QA 2AXVA 2XRZA 1UN9A 3AJIA 4RLYA 2J8SD 2VGXA 4M3OA 2WXJA 5CHEE 2F8YA 4E85A 1OCOE 4OYSA 5H7PA 4I9EA 4HRMB 4GZ5A 2PQNA 2QFCA 2X6FA 3FWVA 5B1BE 2FEZA 3VLFA 1OY3D 2YHEA 4CGVA 5FQ4A 3DPYA 4F7AA 1NA0A 2WVIA 3PZ4A 2F37A 4GYOA 1JWGA 3JXIA 4GTVA 3KEAA 5G05C 2LSVA 4JXTA 5AQAA 3C5RA 4J8EA 4AP2A 5LFAA 2I6HA 5ANLA 2RFMA 3P2BA 1SZ9A 2XGOA 2ETBA 2DBAA 5FZQA 1UG3A 4F1SA 3CVVA 2NXPA 1MX4A 2BKGA 3FH5A 3ABLE 1E8XA 3I4GA 3HVEA 4GTQA 2XEVA 2BKKB 1U3DA 1JCSA 2X6JA 4TUUA 1FVFA 2XZTG 5EYPF 3GZ2A 1QBQA 3T9KA 1ZB1A 3DSWA 5JJ7A 2VQ2A 2I9CA 3U9WA 2L0IA 3JQ1A 1HU3A 1X5BA 4U63A 3D9PA 5EILA 1HFAA 3RSEG 4U07A 1OWNA 4BETA 2AXUA 4LSZE 3Q4AB 4GMJA 3HXBA 3UT8A 3SQVA 1UN8A 4IYPA 3G2VA 3L6AA 3NAWA 4NURA 4WAFA 1HH8A 2HYZA 3D3MA 4GZCA 3L08A 4I1OB 2J9QA 3PEUB 4EBAG 2KM4A 4I6EA 1TJCA 3MGBA 4ATZD 1PY1A 3QDNA 1K3ZD 3CK7A 1BPOA 4PS7A 4BSXA 1TN8A 4IN3B 4WNFA 4AOFA 4MKTA 5KJMA 2ZGDA 1NI1A 1ZU2A 4DJAA 3UKRG 1OXJA 1HG5A 5EIDA 3SHFA 4JA7A 1N54A 3S7JA 1NP7A 3UT7A 4BERA 3R9MA 1OWMA 4HB5A 4MBGA 3MA5A 1N4QA 4L2YA 2Y0BG 4YNDA 5HKPA 4UWLA 3DWLG 2R59A 4O1OA 1SVXA 5M72A 3WG7E 5A7DB 3VLEA 5KBAA 4OAVB 2RFAA 3ISMC 4YVQC 4AY5A 4JB8P 5AQ9A 3MKRA 3FY4A 2WQ6A 2R03A 3LY9A 1TYQG 3FU6A 3BG0B 1VDYA 5LOZA 4HQDA 3V79K 1TR4A 5LCWC 2R05A 3D9OA 2Y4UA 2FULA 3OXLA 2DZOA 3TG5A 4RG6A 4GYYA 5AJLA 5A23A 1E7VA 2IQCA 3APCA 5FJYA 4NRHB 1NA3A 2QY7A 1O1SA 4BTBA 4MRUA 1OT8A 4CZ2D 4UWGA 1SA5A 2WB2A 4XZ4A 4JEUA 2X3MA 3UKUG 4ABNA 3ZRHA 3L13A 3HDXA 4AJWA 5IY5E 3FULA 4ACKA 3PNLB 1EDUA 3JUEA 2UY1B 2WXQA 1HS6A 3ULQA 1EF1C 2VTBA 2DVWA 4JVSA 4DX2A 5KWDA 4GA1A 2WQ7A 4TXRA 2I1KA 5CBOA 1JCQA 2HM8A 3ZVVA 2XHEA 3AU4A 1V55E 2WXGA 4AIFA 1MJ0A 2J4BA 2XEHA 4PDXA 3FH8A 2VSXE 4UWKA 5ITZF 3CKCA 1K1BA 4JA9A 5ENTD 4FC8A 4G8LA 2UY1A 1S70B 5D66A 2B0OE 1SZAA 5G2NA 1DCQA 5CRVA 3LKUA 3FUIA 4ILIA 3MX3A 2EINE 4HBDA 4U0SA 3VLDA 1Z5SC 1V54E 3FEXA 3KD7A 2C0MA 3AS8A 4GCOA 5T4YA 2CFZA 3R7QA 3EU9A 3J5QB 2AW6A 4N3CA 2IF4A 4B0ZA 5EX0A 5G55A 3QOUA 3DSTA 1IXVA 1N95A 1JWFA 1S63A 3PH0C 2LUHA 5ENOD 4NACA 3DPDA 3FP3A 3OAWA 2E0IA 2V5QC 2ZGGA 1Z3XA 3MYVA 1OCCE 2CG3A 3TWQA 2KCLA 4KXKB 4I1MA 3ASGA 2JEKA 3BEEA 4LRZA 1ELWA 3CHQA 1TJFA 4TXPA 5G04C 3FUNA 4U04A 3SFZA 2NC9A 2I2OA 1H2TC 1H6OA 2P9IG 4U0UA 2HO1A 4JC8A 4AXHA 3WXXA 4EECA 2WXOA 2LAIA 1DCEA 2FF4A 2GROB 4GPMA 5CRUA 2V5FA 3SBTB 2OVFA 5AARA 3IBEA 5DBKA 4KVMA 3U3WA 3ML9A 4EQFA 2LO6A 2P9PG 4FP7A 3PDNA 3ZHEB 3U4TA 3QNKA 3V31A 5JA4D 4J7WA 2HE0A 1KLXA 2XGMA 5EIBE 3P1UA 4GTTA 3ABME 1S0PA 2NSZA 5FQ6A 4N3BA 4P29A 4ANWA 5CEAA 1ELKA 5EKQD 3ZYQA 3TWRA 3OTNA 1N4PA 2Q7FA 4EZKA 3I4RB 3AG3E 3CVUA 2IU1A 3G2UA 3ESKA 3B95A 2OOEA 4UI9C 2AWIA 3MZLB 4UWHA 4K0RA 4GZDA 4RQIA 5A6CA 4J8YA 2WXKA 1NZNA 1WY6A 4ANXA 3HRAA 4A3VA 4GA0A 1IQUA 4GA2A 3ZHEA 3D9MA 2E2EA 3FDHA 3NOCD 4DI3A 3GW4A 4CYMD 2WXPA 2J07A 4AY6A 1D9SA 4BFRA 4J6IA 1BU9A 4AEZC 3MV2B 3CQGB 4K5AB 1KPSB 3ASNE 3UI2A 4G8KA 3LY7A 4Z68A 3D9LA 1SW6A 4YDYA 2GRNB 2VSYA 1WAO1 3QWWA 3LS8A 4LUNU 4XI0A 3RO3A 3DXMG 2PQRA 2ZIRA 4B93B 2V0PA 2J4DA 1FPPA 3QK0A 5J90A 3ZYKA 4APOA 4ANUA 3L22A 1YYHA 3ML8A 3FTSA 3ZPJA 1PAQA 3PREA 3NB2A 4GTPA 1TNZA 4U96D 3BU8A 2HR2A 5CEDB 3RU0A 3UIPC 2PL2A 1QZ2A 2EQXA 2X6HA 2P58C 4O6FA 3ONKA 4DX7D 3PUJA 4OVUA 1K1AA 3DBSA 5D0QD 3ZEFA 1RZ4A 2IOSA 4L9PA 5G05J 1FVHA 5J08A 3IHYA 3UM3A 5ANRA 3FHEA 1MQSA 4CDMA 4GMRA 4UQXA 4HOQA 2AVPA 1HZ4A 1HX8A 3NQPA 3OXFA 4RVBA 3KSLA 4FADA 3MJWA 3FUDA 5FT9A 2KBXA 2M63A 3LVRE 3LY8A 2LAHA 4JHKA 2P9UG 3Q78A 3L9TA 1NL4A 3RKVA 4U95D 5AIJA 4F6RD 3UUXA 4B8AA 4U0ZA 3S7BA 2XS1A 5FWQA 3QKYA 3FUMA 4DRXE 2NYJA 4KYOB 3FU3A 5FQ7A 2GGFA 4BX9A 2GRPB 1AWCB 1E8WA 4K5CA 2OEVA 2FO1E 1N9AA 2XPZA 3CQCB 4CRWA 2DIWA 3Q15A 1AP7A 4EZLA 3ZN3A 3JQ0A 2P9KG 3FH7A 3Q47B 2XPYA 3JXJA 3QARA 3CLJA 4ILGA 3C3OA 2XCBA 4ZHBA 2FBNA 2H6IA 5ENRD 4Q69A 4HOTA 2DYSE 4GB9A 3LYAA 4EPZA 1BI7B 1O5MA 3AG4E 2KXPC 4GPKA 4WNEA 4A63B 3FTVA 2H6GA 4N2QA 1P5QA 3CK8A 3CVWA 3HYMB 4XEIG 1OUVA 1TN6A 4N2SA 5EDSA 4EHMA 3BUAA 3KS2A 5JJ6A 2MHKA 4PUCA 1D8DA 4UI9K 4V3IA 3RAUA 2DWZA 2P2CP 4DX1A 5BPPA 3SFYA 4Q96A 2R2LA 2JLBA 2V8SE 4KMOA 4CT0A 3L82A 3RJVA 3RRUA 4A3TA 5KNHD 4L1BA 2LXMA 2VGEA 3ZXSA 2V4LA 3J5PA 5B1AE 3ASOE 4KZCA 3IHVA 4G11A 3CIAA 4LG6A 3IKOB 2ZU6B 1IHGA 3AS4A 4U8HA 5BT1A 4O1PA 4HS2A 3Q75A 3T5VA 3E32A 5LCWJ 3CVNA 3D9NA 2VTBB 2J49A 3ENEA 3AG1E 4EBAA 1QQEA 5E75A 5ARFA 1HE8A 4IRUA 3EHQA 3LVQE 5EN5D 4YVOA 4N39A 5CECB 3QAQA 5FQ8A 2PZIA 2XQ0A 3F6QA 2CHZA 1H0AA 5FTPA 5AJDA 4A1GA 1TNYA 3VTYA 4YDWA 5FIOA 3Q73A 3EHNA 1U2VG 3Q7AA 1HF8A 2R5SA 2OVBA 1UJKA 3IV0A 3B7UX 4AM9A 4E6HA 3MCXA 4JPSA 4BTAA 3PZ1A 2P9SG 1IYGA 4GYWA 2MRIA 4CCAA 4K5BA 3UXGA 2EIKE 2MYOA 4AV7A 3EDTB 3R9AB 4KT6B 4GCNA 1L5JA 2DCPA 5CBNA 4BESA 5ENNA 3ASHA 3B7BA 1MX2A 3ZXPA 2GRQB 3PS6A 4TRQA 2X6KA 4BEPA 3URZA 2L6BA 3HXCA 2XS8A 2L9BA 4JD2G 3SY2A 1QYMA 3EHMA 5CMYA 4HLEA 4HOSA 3ZYLA 4LEUA 3ZU7B 1LD7A 4BX8A 3RO2A 3W9FA 3MV3B 4KVOA 2ONDA 3G2WA 3JYSA 5KNGA 2AXZA 5JHAA 2C0LA 2FI7A 2V4HC 2VYIA 3ABKE 3I3NA 2RKKA 3TXMA 3UINC 4JL0A 2CHWA 2OV8A 2WMNA 5BW8C 1OWOA 2ETAA 2Y3AA 4JZYA 3FTZA 1E90A 3HG0D 3PRZA 1MYOA 4RG9A 4C9BB 3X2QE 5ENPD 2QYUA 3QWVA 2IO2C 4GTRA 3GYZA 4MS6A 3CHRA 3L54A 4M7CA 3LEWA 1UW4B 1W3BA 1U3CA 1N0RA 3UM2A 5G04J 4NQ0A 4JEHA 1BI8B 5JJTA 2A5UA 4XKBA 3V30A 3RK6A 5ARGA 1XNFA 3CVLA 2DYRE 3B13A 3CV0A 4HRLA 4J8FA 1Y6IA 4F3VA 4B89A 2IOLA 3W9GA 3D9HA 3CHOA 3O48A 3L17A 2IO3C 2XPIA 3APDA 3UM1A 3NOGD 4LNUD 1FCHA 2WXNA 2GRMA 1N52A 2CFUA 5FZRA 3PE3A 5CERB 2IJGX 4PH4B 2LXLA 4OAUC 3PZ3A 4TXQA 3T8KA 2MOWA 1YMPA 2F8XK 3TWXA 5ENQD 3N71A 1LF8A 4XKCA 5D2MC 2WXFA 3ZYMA 4HNAD 4YDEA 1E8ZA 4I43A 4XE0A 5CCLA 4DLQA 3KEZA 3R7RA 4XX5A 3TWWA 3ZKJA 3C3RA 4I2ZA 1KZPA 3FEYA 1OWPA 1TNUA 2VJ8A 3CHPA 3TXNA 4B8CB 1BLXB 1N0QA 4NIKA 3AU5A 2GW1A 2A4ZA 4L23A 4UI9J 3TWTA 3KAEA 3Q9NC 1NFIE 2B6CA 3PEVB 4BSZB 3NZUA 4KBQA 4L2LA 3S7DA 4G25A 3VTXA 4CDNA 4BWRA 3EUVA 3Q49B 3FTUA 3NZSA 3T8MA 3LJ3A 2F0YA 3L16A 4G24A 1DNPA 2IY0C 5EX3A 3HXEA 1LD8A 2UWJG 1SQMA 2BTDA 1E8YA 2FO7A 3E4BA 4JW1A 5BUZA 3FUFA 5FINA 3PUKA 4RSYA 2PNNA 4HVBA 4A55A 4DI4A 3C72A 4HFGA 3G2TA 4GAAA 3PZDA 3TGOA 4GTMA 3SO8A 4DX6D 2VGYA 4WWNA 4B94A 3TWSA 5T3RA 3ZIMA 5KJKA 2IONA 3DSSA 3D9IA 1KZOA 3E30A 4GU5A 4K03A 2Y1LE 1WM5A 2XEEA 4N3AA 3ASFA 3FFLA 5ENSD 1TN7A 2WXMA 1INZA 2L6JA 4LERA 3E33A 3E37A 1E96B 1IQRA 3UPVA 4YDOA 1A17A 4DLOA 1N4SA 4D10C 2AJAA 1Z6TA 2GRLA 4HRNA 3NBNB 1H6KA 5HRYA 2KZTA 4HI9A 4HORA 3LDZA 3UM0A 5BXUA 3QB2A 3D9JA 2XENA 3EIQC 4KZ0A 3TG4A 5KJNA 2IEJA 3DSUA 5C1DA 2WXIA 3OXGA 4AVXA 3UTMA 3V2OA 1KT1A 3S7FA 3RRNB 3CHMA 3FUEA 2YHCA 2C2LA 1TNBA 3TAXA 4QQIA 3ULEG 1H6PA 3SNXA 2QYJA 2QC9A 4LNBA 1Y8MA 3TWVA 3D9KA 3FTXA 3CVXA 3DEOA 3E34A 4LCTA 3HHMA 3B7RL 3JUIA 4ILHB 1EPUA 1JCRA
chains in the Genus database with same CATH topology
5HS0A 3Q9UC 4C48B 1BU9A 1MJ0A 2XEHA 2Y1LE 2XEEA 3TWTA 4BETA 4F1PA 2DZNA 4LSZE 5ENSD 5ITZF 4GPMA 4HQDA 4K5BA 1TR4A 2ETCA 3UXGA 3V79K 2MYOA 5KNHD 4K5AB 1MX6A 2VGEA 3UI2A 1BD8A 3Q9NC 5AARA 3ZUVB 1NFIE 5AQBA 5AAOA 4N5QA 1K1BA 5AN8A 5CBNA 3AJIA 4G8KA 4RLYA 1N0RA 5JMND 3J5PA 4QFVA 2J8SD 4U95D 5ENTD 4BESA 3B7BA 2DZOA 4Z68A 4F6RD 2F8YA 1MX2A 3AAAC 1SW6A 3ZNGA 4YDYA 1BI8B 4G8LA 1S70B 1YCSB 1A5EA 2AJAA 4LG6A 5D66A 4HRMB 3V30A 2B0OE 4ZFHA 4UUCA 4O1PA 4HRNA 1OY3D 4DRXE 2NYJA 1DCQA 2JABA 3NBNB 1IHBA 4ATZD 4HRLA 4BEPA 2L6BA 1UOHA 1AWCB 4HBDA 1K3ZD 4K5CA 4B93B 3W9GA 2F37A 3D9HA 5HRYA 2FO1E 3V31A 1QYMA 4J7WA 2HE0A 1G3NB 4HI9A 4O60A 5JA4D 1AP7A 1OT8A 3EHRA 4CZ2D 5BXUA 3JXIA 3EU9A 3J5QB 3NOGD 5EIBE 4LNUD 1YYHA 3KEAA 3ZU7B 2XENA 3JXJA 5AQAA 2ZGDA 3EHQA 3C5RA 5CERB 3LJNA 1IKND 5CEAA 2RFMA 1WG0A 4U96D 5EN5D 4OAUC 3UTMA 3W9FA 3T8KA 4TUMA 3TWRA 3V2OA 5EIDA 3DEPA 4ZHBA 5CECB 1YMPA 5CEDB 2F8XK 3TWXA 5KNGA 1IXVA 2ETBA 4BERA 5ENQD 4DUIA 3JUEA 4HB5A 5ENOD 5ENRD 4HNAD 2V4HC 1MX4A 2BKGA 3F6QA 4HI8A 5FINA 2Y0BG 1WDYA 4U8VD 5HKPA 1BI7B 4DX7D 2PNNA 2KXPC 2V5QC 1K1AA 2ZGGA 4YDWA 2BKKB 4U8YD 4DX5D 5FIOA 4QQIA 4A63B 3B95A 4BSZB 4O1OA 2A5EA 1SVXA 2DVWA 2XZDG 2QYJA 2QC9A 1DC2A 4DX2A 5KWDA 2XZTG 5EYPF 3TWVA 5EYLA 3TWQA 5KBAA 3TWWA 3V2XA 3ZKJA 4OAVB 4J8YA 2RFAA 5CBOA 1N11A 2ETAA 3T9KA 3TWUA 3HRAA 3DEOA 4JB8P 3SO8A 3HG0D 4GMRA 4DX6D 5AQ7A 5BXOA 3TWSA 5AQ9A 1MYOA 3NOCD 2DWZA 5ENPD 1BLXB 1N0QA 4CYMD 2P2CP 2KBXA 4DX1A 5EILA 4NIKA 4HLLA 1D9SA 3IXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HS0 A;  3Q9U C;  4C48 B;  1BU9 A;  1MJ0 A;  2XEH A;  2Y1L E;  2XEE A;  3TWT A;  4BET A;  4F1P A;  2DZN A;  4LSZ E;  5ENS D;  5ITZ F;  4GPM A;  4HQD A;  4K5B A;  1TR4 A;  2ETC A;  3UXG A;  3V79 K;  2MYO A;  5KNH D;  4K5A B;  1MX6 A;  2VGE A;  3UI2 A;  1BD8 A;  3Q9N C;  5AAR A;  3ZUV B;  1NFI E;  5AQB A;  5AAO A;  4N5Q A;  1K1B A;  5AN8 A;  5CBN A;  3AJI A;  4G8K A;  4RLY A;  1N0R A;  5JMN D;  3J5P A;  4QFV A;  2J8S D;  4U95 D;  5ENT D;  4BES A;  3B7B A;  2DZO A;  4Z68 A;  4F6R D;  2F8Y A;  1MX2 A;  3AAA C;  1SW6 A;  3ZNG A;  4YDY A;  1BI8 B;  4G8L A;  1S70 B;  1YCS B;  1A5E A;  2AJA A;  4LG6 A;  5D66 A;  4HRM B;  3V30 A;  2B0O E;  4ZFH A;  4UUC A;  4O1P A;  4HRN A;  1OY3 D;  4DRX E;  2NYJ A;  1DCQ A;  2JAB A;  3NBN B;  1IHB A;  4ATZ D;  4HRL A;  4BEP A;  2L6B A;  1UOH A;  1AWC B;  4HBD A;  1K3Z D;  4K5C A;  4B93 B;  3W9G A;  2F37 A;  3D9H A;  5HRY A;  2FO1 E;  3V31 A;  1QYM A;  4J7W A;  2HE0 A;  1G3N B;  4HI9 A;  4O60 A;  5JA4 D;  1AP7 A;  1OT8 A;  3EHR A;  4CZ2 D;  5BXU A;  3JXI A;  3EU9 A;  3J5Q B;  3NOG D;  5EIB E;  4LNU D;  1YYH A;  3KEA A;  3ZU7 B;  2XEN A;  3JXJ A;  5AQA A;  2ZGD A;  3EHQ A;  3C5R A;  5CER B;  3LJN A;  1IKN D;  5CEA A;  2RFM A;  1WG0 A;  4U96 D;  5EN5 D;  4OAU C;  3UTM A;  3W9F A;  3T8K A;  4TUM A;  3TWR A;  3V2O A;  5EID A;  3DEP A;  4ZHB A;  5CEC B;  1YMP A;  5CED B;  2F8X K;  3TWX A;  5KNG A;  1IXV A;  2ETB A;  4BER A;  5ENQ D;  4DUI A;  3JUE A;  4HB5 A;  5ENO D;  5ENR D;  4HNA D;  2V4H C;  1MX4 A;  2BKG A;  3F6Q A;  4HI8 A;  5FIN A;  2Y0B G;  1WDY A;  4U8V D;  5HKP A;  1BI7 B;  4DX7 D;  2PNN A;  2KXP C;  2V5Q C;  1K1A A;  2ZGG A;  4YDW A;  2BKK B;  4U8Y D;  4DX5 D;  5FIO A;  4QQI A;  4A63 B;  3B95 A;  4BSZ B;  4O1O A;  2A5E A;  1SVX A;  2DVW A;  2XZD G;  2QYJ A;  2QC9 A;  1DC2 A;  4DX2 A;  5KWD A;  2XZT G;  5EYP F;  3TWV A;  5EYL A;  3TWQ A;  5KBA A;  3TWW A;  3V2X A;  3ZKJ A;  4OAV B;  4J8Y A;  2RFA A;  5CBO A;  1N11 A;  2ETA A;  3T9K A;  3TWU A;  3HRA A;  3DEO A;  4JB8 P;  3SO8 A;  3HG0 D;  4GMR A;  4DX6 D;  5AQ7 A;  5BXO A;  3TWS A;  5AQ9 A;  1MYO A;  3NOC D;  2DWZ A;  5ENP D;  1BLX B;  1N0Q A;  4CYM D;  2P2C P;  2KBX A;  4DX1 A;  5EIL A;  4NIK A;  4HLL A;  1D9S A;  3IXE A; 
#chains in the Genus database with same CATH topology
 5HS0 A;  1OCZ E;  3HIZ A;  2Y69 E;  4N5C A;  3ASD A;  4I17 A;  4F1P A;  3BG1 B;  1H19 A;  3CGH A;  1O1T A;  1PC2 A;  4L7T A;  2P9N G;  2KAT A;  4LNG A;  4CEM A;  3KSQ A;  1A5E A;  4PS8 A;  1TEZ A;  3MKQ B;  4PS3 A;  3QWP A;  4JHR A;  4UUC A;  3CKB A;  3LXU X;  3AG2 E;  3ZW3 A;  4A1S A;  1MZC A;  3ESL A;  1JUQ A;  1S64 A;  4G23 A;  4CDR A;  1G3N B;  3PE4 A;  2LSU A;  1OWL A;  2KCV A;  2CG2 A;  3UIO C;  5KJL A;  3FTW A;  4APF A;  3SF4 A;  1TNO A;  3CVY A;  5AEN A;  4DUI A;  3SGH A;  4XIF A;  4U8V D;  2WXL A;  3TJP A;  2A5E A;  4IUL A;  4J8D A;  3MKQ A;  1XGW A;  2WXH A;  2WXR A;  2OEW A;  2H6F A;  2OCC E;  3DSX A;  2VSN A;  4JHJ A;  3GZ1 A;  1ELR A;  3DRA A;  3IEG A;  5T8I A;  2I1J A;  1GW6 A;  3FU0 A;  3FUK A;  2DZN A;  2H6H A;  4R7L A;  5BV0 A;  3CEQ A;  2XCC A;  4FHK A;  1MX6 A;  3SFX A;  5AQB A;  3CHS A;  4FLB A;  1H2U A;  3UQ3 A;  4BT8 A;  4WWP A;  2R02 A;  5JMN D;  3ONL A;  1OCR E;  3GZS A;  3JCK C;  4OVV A;  3APF A;  1UJJ A;  2VSO E;  1MHQ A;  3TL5 A;  4Y6C A;  4ZFH A;  3B7S A;  4GZ3 A;  3C3Q A;  1IHB A;  1K8K G;  4I2W A;  3UT4 A;  2XRY A;  3UX4 A;  5CCM A;  3FU5 A;  2X6I A;  3Q79 A;  2CHX A;  1N94 A;  4FA6 A;  3FUJ A;  4WND A;  3B7T A;  3I5P A;  4J8S A;  2WM9 A;  4Q94 A;  5CMW A;  4URK A;  3PNT B;  3K9I A;  2RG8 A;  2J09 A;  2IFU A;  1ZBP A;  3EIJ A;  1WDY A;  4MLP A;  4U8Y D;  5BV1 A;  2XZD G;  5E76 A;  4X8Q A;  3AS5 A;  4U7E B;  2ILR A;  2KC7 A;  2WMO A;  1E7U A;  3ZGQ A;  5LP0 A;  1JPL A;  2PM6 A;  4C0E A;  1LTX A;  4EZJ A;  3ULY A;  3IXE A;  2EIM E;  4FU3 A;  4BY6 A;  4UQZ A;  2XGS A;  1O1R A;  3HXD A;  4CT4 A;  2EIJ E;  1BD8 A;  1DVP A;  3ZUV B;  3SZ7 A;  4G2V A;  5AN8 A;  4I6G A;  4GML A;  2YIN A;  1HG2 A;  3AAA C;  3ZNG A;  1YCS B;  3DXK G;  2EIL E;  5BNW A;  1N4R A;  3CSF A;  3RRM B;  2BED A;  2WQH A;  4H7Y A;  4GTS A;  3CVP A;  2JAB A;  2R17 C;  2P9L G;  2YNQ A;  1HXI A;  1D8E A;  2X38 A;  3EHR A;  5AYW D;  1HO8 A;  1FT2 A;  3LJN A;  5LX8 A;  1IKN D;  3BQO A;  3U66 A;  4C0M A;  4GTO A;  1Z3Y A;  1H2V C;  1X81 A;  1FT1 A;  4UWF A;  3CST A;  3SBS A;  3C98 A;  1SA4 A;  4F53 A;  3U64 A;  1Q2Z A;  3SD5 A;  2YQ8 A;  3UMV A;  4G1T A;  3MEK A;  5EYL A;  3HXF A;  1N11 A;  3FUH A;  2RD0 A;  3TWU A;  2J08 A;  5BXO A;  4W9R A;  5C2Y A;  4WWO A;  5JHB A;  1RW2 A;  3FTY A;  4Y6W A;  5D0O D;  2ETC A;  3Q7F A;  5KCM A;  4I9C A;  3EJN A;  1EYH A;  3ZFW A;  3O4Z A;  4QFV A;  4XI9 A;  2BF0 X;  2LNI A;  4CGW A;  4WUY A;  4FJY A;  2WPV A;  4ATG A;  2PM7 A;  3SI5 A;  4GZ6 A;  2QZA A;  2KCK A;  4TV3 A;  4J0U A;  1UOH A;  4FLH A;  2ZIS A;  5DIZ A;  4O60 A;  2L0T B;  4FHJ A;  3CR3 A;  1YA0 A;  3CK9 A;  4WNG A;  2BUG A;  3QC1 A;  4HXI A;  2Y4T A;  4ACL A;  1WG0 A;  4DPR A;  3T5X A;  4TUM A;  3DEP A;  4UQY A;  4FUL A;  2VGX B;  3S2A A;  5FZS A;  1B89 A;  4HI8 A;  4DK5 A;  3EU5 A;  3PVL A;  4DX5 D;  4ANV A;  5HI7 A;  3RIB A;  1DC2 A;  5B3S E;  3G2S A;  5HQ8 A;  3V2X A;  2ZXW E;  4FJZ A;  3LCA A;  1QNF A;  5AQ7 A;  3LPZ A;  4HOU A;  4G26 A;  4BT9 A;  4I1A A;  3Q5M A;  4HLL A;  4ME2 A;  3Q9U C;  4C48 B;  2GRR B;  3PZ2 A;  3CVQ A;  3QJZ A;  1KT0 A;  2KZT B;  3NF1 A;  5AAO A;  3DSV A;  4H7X A;  4I6J A;  3HVE B;  4N5Q A;  2AXV A;  2XRZ A;  1UN9 A;  3AJI A;  4RLY A;  2J8S D;  2VGX A;  4M3O A;  2WXJ A;  5CHE E;  2F8Y A;  4E85 A;  1OCO E;  4OYS A;  5H7P A;  4I9E A;  4HRM B;  4GZ5 A;  2PQN A;  2QFC A;  2X6F A;  3FWV A;  5B1B E;  2FEZ A;  3VLF A;  1OY3 D;  2YHE A;  4CGV A;  5FQ4 A;  3DPY A;  4F7A A;  1NA0 A;  2WVI A;  3PZ4 A;  2F37 A;  4GYO A;  1JWG A;  3JXI A;  4GTV A;  3KEA A;  5G05 C;  2LSV A;  4JXT A;  5AQA A;  3C5R A;  4J8E A;  4AP2 A;  5LFA A;  2I6H A;  5ANL A;  2RFM A;  3P2B A;  1SZ9 A;  2XGO A;  2ETB A;  2DBA A;  5FZQ A;  1UG3 A;  4F1S A;  3CVV A;  2NXP A;  1MX4 A;  2BKG A;  3FH5 A;  3ABL E;  1E8X A;  3I4G A;  3HVE A;  4GTQ A;  2XEV A;  2BKK B;  1U3D A;  1JCS A;  2X6J A;  4TUU A;  1FVF A;  2XZT G;  5EYP F;  3GZ2 A;  1QBQ A;  3T9K A;  1ZB1 A;  3DSW A;  5JJ7 A;  2VQ2 A;  2I9C A;  3U9W A;  2L0I A;  3JQ1 A;  1HU3 A;  1X5B A;  4U63 A;  3D9P A;  5EIL A;  1HFA A;  3RSE G;  4U07 A;  1OWN A;  4BET A;  2AXU A;  4LSZ E;  3Q4A B;  4GMJ A;  3HXB A;  3UT8 A;  3SQV A;  1UN8 A;  4IYP A;  3G2V A;  3L6A A;  3NAW A;  4NUR A;  4WAF A;  1HH8 A;  2HYZ A;  3D3M A;  4GZC A;  3L08 A;  4I1O B;  2J9Q A;  3PEU B;  4EBA G;  2KM4 A;  4I6E A;  1TJC A;  3MGB A;  4ATZ D;  1PY1 A;  3QDN A;  1K3Z D;  3CK7 A;  1BPO A;  4PS7 A;  4BSX A;  1TN8 A;  4IN3 B;  4WNF A;  4AOF A;  4MKT A;  5KJM A;  2ZGD A;  1NI1 A;  1ZU2 A;  4DJA A;  3UKR G;  1OXJ A;  1HG5 A;  5EID A;  3SHF A;  4JA7 A;  1N54 A;  3S7J A;  1NP7 A;  3UT7 A;  4BER A;  3R9M A;  1OWM A;  4HB5 A;  4MBG A;  3MA5 A;  1N4Q A;  4L2Y A;  2Y0B G;  4YND A;  5HKP A;  4UWL A;  3DWL G;  2R59 A;  4O1O A;  1SVX A;  5M72 A;  3WG7 E;  5A7D B;  3VLE A;  5KBA A;  4OAV B;  2RFA A;  3ISM C;  4YVQ C;  4AY5 A;  4JB8 P;  5AQ9 A;  3MKR A;  3FY4 A;  2WQ6 A;  2R03 A;  3LY9 A;  1TYQ G;  3FU6 A;  3BG0 B;  1VDY A;  5LOZ A;  4HQD A;  3V79 K;  1TR4 A;  5LCW C;  2R05 A;  3D9O A;  2Y4U A;  2FUL A;  3OXL A;  2DZO A;  3TG5 A;  4RG6 A;  4GYY A;  5AJL A;  5A23 A;  1E7V A;  2IQC A;  3APC A;  5FJY A;  4NRH B;  1NA3 A;  2QY7 A;  1O1S A;  4BTB A;  4MRU A;  1OT8 A;  4CZ2 D;  4UWG A;  1SA5 A;  2WB2 A;  4XZ4 A;  4JEU A;  2X3M A;  3UKU G;  4ABN A;  3ZRH A;  3L13 A;  3HDX A;  4AJW A;  5IY5 E;  3FUL A;  4ACK A;  3PNL B;  1EDU A;  3JUE A;  2UY1 B;  2WXQ A;  1HS6 A;  3ULQ A;  1EF1 C;  2VTB A;  2DVW A;  4JVS A;  4DX2 A;  5KWD A;  4GA1 A;  2WQ7 A;  4TXR A;  2I1K A;  5CBO A;  1JCQ A;  2HM8 A;  3ZVV A;  2XHE A;  3AU4 A;  1V55 E;  2WXG A;  4AIF A;  1MJ0 A;  2J4B A;  2XEH A;  4PDX A;  3FH8 A;  2VSX E;  4UWK A;  5ITZ F;  3CKC A;  1K1B A;  4JA9 A;  5ENT D;  4FC8 A;  4G8L A;  2UY1 A;  1S70 B;  5D66 A;  2B0O E;  1SZA A;  5G2N A;  1DCQ A;  5CRV A;  3LKU A;  3FUI A;  4ILI A;  3MX3 A;  2EIN E;  4HBD A;  4U0S A;  3VLD A;  1Z5S C;  1V54 E;  3FEX A;  3KD7 A;  2C0M A;  3AS8 A;  4GCO A;  5T4Y A;  2CFZ A;  3R7Q A;  3EU9 A;  3J5Q B;  2AW6 A;  4N3C A;  2IF4 A;  4B0Z A;  5EX0 A;  5G55 A;  3QOU A;  3DST A;  1IXV A;  1N95 A;  1JWF A;  1S63 A;  3PH0 C;  2LUH A;  5ENO D;  4NAC A;  3DPD A;  3FP3 A;  3OAW A;  2E0I A;  2V5Q C;  2ZGG A;  1Z3X A;  3MYV A;  1OCC E;  2CG3 A;  3TWQ A;  2KCL A;  4KXK B;  4I1M A;  3ASG A;  2JEK A;  3BEE A;  4LRZ A;  1ELW A;  3CHQ A;  1TJF A;  4TXP A;  5G04 C;  3FUN A;  4U04 A;  3SFZ A;  2NC9 A;  2I2O A;  1H2T C;  1H6O A;  2P9I G;  4U0U A;  2HO1 A;  4JC8 A;  4AXH A;  3WXX A;  4EEC A;  2WXO A;  2LAI A;  1DCE A;  2FF4 A;  2GRO B;  4GPM A;  5CRU A;  2V5F A;  3SBT B;  2OVF A;  5AAR A;  3IBE A;  5DBK A;  4KVM A;  3U3W A;  3ML9 A;  4EQF A;  2LO6 A;  2P9P G;  4FP7 A;  3PDN A;  3ZHE B;  3U4T A;  3QNK A;  3V31 A;  5JA4 D;  4J7W A;  2HE0 A;  1KLX A;  2XGM A;  5EIB E;  3P1U A;  4GTT A;  3ABM E;  1S0P A;  2NSZ A;  5FQ6 A;  4N3B A;  4P29 A;  4ANW A;  5CEA A;  1ELK A;  5EKQ D;  3ZYQ A;  3TWR A;  3OTN A;  1N4P A;  2Q7F A;  4EZK A;  3I4R B;  3AG3 E;  3CVU A;  2IU1 A;  3G2U A;  3ESK A;  3B95 A;  2OOE A;  4UI9 C;  2AWI A;  3MZL B;  4UWH A;  4K0R A;  4GZD A;  4RQI A;  5A6C A;  4J8Y A;  2WXK A;  1NZN A;  1WY6 A;  4ANX A;  3HRA A;  4A3V A;  4GA0 A;  1IQU A;  4GA2 A;  3ZHE A;  3D9M A;  2E2E A;  3FDH A;  3NOC D;  4DI3 A;  3GW4 A;  4CYM D;  2WXP A;  2J07 A;  4AY6 A;  1D9S A;  4BFR A;  4J6I A;  1BU9 A;  4AEZ C;  3MV2 B;  3CQG B;  4K5A B;  1KPS B;  3ASN E;  3UI2 A;  4G8K A;  3LY7 A;  4Z68 A;  3D9L A;  1SW6 A;  4YDY A;  2GRN B;  2VSY A;  1WAO 1;  3QWW A;  3LS8 A;  4LUN U;  4XI0 A;  3RO3 A;  3DXM G;  2PQR A;  2ZIR A;  4B93 B;  2V0P A;  2J4D A;  1FPP A;  3QK0 A;  5J90 A;  3ZYK A;  4APO A;  4ANU A;  3L22 A;  1YYH A;  3ML8 A;  3FTS A;  3ZPJ A;  1PAQ A;  3PRE A;  3NB2 A;  4GTP A;  1TNZ A;  4U96 D;  3BU8 A;  2HR2 A;  5CED B;  3RU0 A;  3UIP C;  2PL2 A;  1QZ2 A;  2EQX A;  2X6H A;  2P58 C;  4O6F A;  3ONK A;  4DX7 D;  3PUJ A;  4OVU A;  1K1A A;  3DBS A;  5D0Q D;  3ZEF A;  1RZ4 A;  2IOS A;  4L9P A;  5G05 J;  1FVH A;  5J08 A;  3IHY A;  3UM3 A;  5ANR A;  3FHE A;  1MQS A;  4CDM A;  4GMR A;  4UQX A;  4HOQ A;  2AVP A;  1HZ4 A;  1HX8 A;  3NQP A;  3OXF A;  4RVB A;  3KSL A;  4FAD A;  3MJW A;  3FUD A;  5FT9 A;  2KBX A;  2M63 A;  3LVR E;  3LY8 A;  2LAH A;  4JHK A;  2P9U G;  3Q78 A;  3L9T A;  1NL4 A;  3RKV A;  4U95 D;  5AIJ A;  4F6R D;  3UUX A;  4B8A A;  4U0Z A;  3S7B A;  2XS1 A;  5FWQ A;  3QKY A;  3FUM A;  4DRX E;  2NYJ A;  4KYO B;  3FU3 A;  5FQ7 A;  2GGF A;  4BX9 A;  2GRP B;  1AWC B;  1E8W A;  4K5C A;  2OEV A;  2FO1 E;  1N9A A;  2XPZ A;  3CQC B;  4CRW A;  2DIW A;  3Q15 A;  1AP7 A;  4EZL A;  3ZN3 A;  3JQ0 A;  2P9K G;  3FH7 A;  3Q47 B;  2XPY A;  3JXJ A;  3QAR A;  3CLJ A;  4ILG A;  3C3O A;  2XCB A;  4ZHB A;  2FBN A;  2H6I A;  5ENR D;  4Q69 A;  4HOT A;  2DYS E;  4GB9 A;  3LYA A;  4EPZ A;  1BI7 B;  1O5M A;  3AG4 E;  2KXP C;  4GPK A;  4WNE A;  4A63 B;  3FTV A;  2H6G A;  4N2Q A;  1P5Q A;  3CK8 A;  3CVW A;  3HYM B;  4XEI G;  1OUV A;  1TN6 A;  4N2S A;  5EDS A;  4EHM A;  3BUA A;  3KS2 A;  5JJ6 A;  2MHK A;  4PUC A;  1D8D A;  4UI9 K;  4V3I A;  3RAU A;  2DWZ A;  2P2C P;  4DX1 A;  5BPP A;  3SFY A;  4Q96 A;  2R2L A;  2JLB A;  2V8S E;  4KMO A;  4CT0 A;  3L82 A;  3RJV A;  3RRU A;  4A3T A;  5KNH D;  4L1B A;  2LXM A;  2VGE A;  3ZXS A;  2V4L A;  3J5P A;  5B1A E;  3ASO E;  4KZC A;  3IHV A;  4G11 A;  3CIA A;  4LG6 A;  3IKO B;  2ZU6 B;  1IHG A;  3AS4 A;  4U8H A;  5BT1 A;  4O1P A;  4HS2 A;  3Q75 A;  3T5V A;  3E32 A;  5LCW J;  3CVN A;  3D9N A;  2VTB B;  2J49 A;  3ENE A;  3AG1 E;  4EBA A;  1QQE A;  5E75 A;  5ARF A;  1HE8 A;  4IRU A;  3EHQ A;  3LVQ E;  5EN5 D;  4YVO A;  4N39 A;  5CEC B;  3QAQ A;  5FQ8 A;  2PZI A;  2XQ0 A;  3F6Q A;  2CHZ A;  1H0A A;  5FTP A;  5AJD A;  4A1G A;  1TNY A;  3VTY A;  4YDW A;  5FIO A;  3Q73 A;  3EHN A;  1U2V G;  3Q7A A;  1HF8 A;  2R5S A;  2OVB A;  1UJK A;  3IV0 A;  3B7U X;  4AM9 A;  4E6H A;  3MCX A;  4JPS A;  4BTA A;  3PZ1 A;  2P9S G;  1IYG A;  4GYW A;  2MRI A;  4CCA A;  4K5B A;  3UXG A;  2EIK E;  2MYO A;  4AV7 A;  3EDT B;  3R9A B;  4KT6 B;  4GCN A;  1L5J A;  2DCP A;  5CBN A;  4BES A;  5ENN A;  3ASH A;  3B7B A;  1MX2 A;  3ZXP A;  2GRQ B;  3PS6 A;  4TRQ A;  2X6K A;  4BEP A;  3URZ A;  2L6B A;  3HXC A;  2XS8 A;  2L9B A;  4JD2 G;  3SY2 A;  1QYM A;  3EHM A;  5CMY A;  4HLE A;  4HOS A;  3ZYL A;  4LEU A;  3ZU7 B;  1LD7 A;  4BX8 A;  3RO2 A;  3W9F A;  3MV3 B;  4KVO A;  2OND A;  3G2W A;  3JYS A;  5KNG A;  2AXZ A;  5JHA A;  2C0L A;  2FI7 A;  2V4H C;  2VYI A;  3ABK E;  3I3N A;  2RKK A;  3TXM A;  3UIN C;  4JL0 A;  2CHW A;  2OV8 A;  2WMN A;  5BW8 C;  1OWO A;  2ETA A;  2Y3A A;  4JZY A;  3FTZ A;  1E90 A;  3HG0 D;  3PRZ A;  1MYO A;  4RG9 A;  4C9B B;  3X2Q E;  5ENP D;  2QYU A;  3QWV A;  2IO2 C;  4GTR A;  3GYZ A;  4MS6 A;  3CHR A;  3L54 A;  4M7C A;  3LEW A;  1UW4 B;  1W3B A;  1U3C A;  1N0R A;  3UM2 A;  5G04 J;  4NQ0 A;  4JEH A;  1BI8 B;  5JJT A;  2A5U A;  4XKB A;  3V30 A;  3RK6 A;  5ARG A;  1XNF A;  3CVL A;  2DYR E;  3B13 A;  3CV0 A;  4HRL A;  4J8F A;  1Y6I A;  4F3V A;  4B89 A;  2IOL A;  3W9G A;  3D9H A;  3CHO A;  3O48 A;  3L17 A;  2IO3 C;  2XPI A;  3APD A;  3UM1 A;  3NOG D;  4LNU D;  1FCH A;  2WXN A;  2GRM A;  1N52 A;  2CFU A;  5FZR A;  3PE3 A;  5CER B;  2IJG X;  4PH4 B;  2LXL A;  4OAU C;  3PZ3 A;  4TXQ A;  3T8K A;  2MOW A;  1YMP A;  2F8X K;  3TWX A;  5ENQ D;  3N71 A;  1LF8 A;  4XKC A;  5D2M C;  2WXF A;  3ZYM A;  4HNA D;  4YDE A;  1E8Z A;  4I43 A;  4XE0 A;  5CCL A;  4DLQ A;  3KEZ A;  3R7R A;  4XX5 A;  3TWW A;  3ZKJ A;  3C3R A;  4I2Z A;  1KZP A;  3FEY A;  1OWP A;  1TNU A;  2VJ8 A;  3CHP A;  3TXN A;  4B8C B;  1BLX B;  1N0Q A;  4NIK A;  3AU5 A;  2GW1 A;  2A4Z A;  4L23 A;  4UI9 J;  3TWT A;  3KAE A;  3Q9N C;  1NFI E;  2B6C A;  3PEV B;  4BSZ B;  3NZU A;  4KBQ A;  4L2L A;  3S7D A;  4G25 A;  3VTX A;  4CDN A;  4BWR A;  3EUV A;  3Q49 B;  3FTU A;  3NZS A;  3T8M A;  3LJ3 A;  2F0Y A;  3L16 A;  4G24 A;  1DNP A;  2IY0 C;  5EX3 A;  3HXE A;  1LD8 A;  2UWJ G;  1SQM A;  2BTD A;  1E8Y A;  2FO7 A;  3E4B A;  4JW1 A;  5BUZ A;  3FUF A;  5FIN A;  3PUK A;  4RSY A;  2PNN A;  4HVB A;  4A55 A;  4DI4 A;  3C72 A;  4HFG A;  3G2T A;  4GAA A;  3PZD A;  3TGO A;  4GTM A;  3SO8 A;  4DX6 D;  2VGY A;  4WWN A;  4B94 A;  3TWS A;  5T3R A;  3ZIM A;  5KJK A;  2ION A;  3DSS A;  3D9I A;  1KZO A;  3E30 A;  4GU5 A;  4K03 A;  2Y1L E;  1WM5 A;  2XEE A;  4N3A A;  3ASF A;  3FFL A;  5ENS D;  1TN7 A;  2WXM A;  1INZ A;  2L6J A;  4LER A;  3E33 A;  3E37 A;  1E96 B;  1IQR A;  3UPV A;  4YDO A;  1A17 A;  4DLO A;  1N4S A;  4D10 C;  2AJA A;  1Z6T A;  2GRL A;  4HRN A;  3NBN B;  1H6K A;  5HRY A;  2KZT A;  4HI9 A;  4HOR A;  3LDZ A;  3UM0 A;  5BXU A;  3QB2 A;  3D9J A;  2XEN A;  3EIQ C;  4KZ0 A;  3TG4 A;  5KJN A;  2IEJ A;  3DSU A;  5C1D A;  2WXI A;  3OXG A;  4AVX A;  3UTM A;  3V2O A;  1KT1 A;  3S7F A;  3RRN B;  3CHM A;  3FUE A;  2YHC A;  2C2L A;  1TNB A;  3TAX A;  4QQI A;  3ULE G;  1H6P A;  3SNX A;  2QYJ A;  2QC9 A;  4LNB A;  1Y8M A;  3TWV A;  3D9K A;  3FTX A;  3CVX A;  3DEO A;  3E34 A;  4LCT A;  3HHM A;  3B7R L;  3JUI A;  4ILH B;  1EPU A;  1JCR A; 
#chains in the Genus database with same CATH homology
 5HS0 A;  3Q9U C;  4C48 B;  1BU9 A;  1MJ0 A;  2XEH A;  2Y1L E;  2XEE A;  3TWT A;  4BET A;  4F1P A;  2DZN A;  4LSZ E;  5ENS D;  5ITZ F;  4GPM A;  4HQD A;  4K5B A;  1TR4 A;  2ETC A;  3UXG A;  3V79 K;  2MYO A;  5KNH D;  4K5A B;  1MX6 A;  2VGE A;  3UI2 A;  1BD8 A;  3Q9N C;  5AAR A;  3ZUV B;  1NFI E;  5AQB A;  5AAO A;  4N5Q A;  1K1B A;  5AN8 A;  5CBN A;  3AJI A;  4G8K A;  4RLY A;  1N0R A;  5JMN D;  3J5P A;  4QFV A;  2J8S D;  4U95 D;  5ENT D;  4BES A;  3B7B A;  2DZO A;  4Z68 A;  4F6R D;  2F8Y A;  1MX2 A;  3AAA C;  1SW6 A;  3ZNG A;  4YDY A;  1BI8 B;  4G8L A;  1S70 B;  1YCS B;  1A5E A;  2AJA A;  4LG6 A;  5D66 A;  4HRM B;  3V30 A;  2B0O E;  4ZFH A;  4UUC A;  4O1P A;  4HRN A;  1OY3 D;  4DRX E;  2NYJ A;  1DCQ A;  2JAB A;  3NBN B;  1IHB A;  4ATZ D;  4HRL A;  4BEP A;  2L6B A;  1UOH A;  1AWC B;  4HBD A;  1K3Z D;  4K5C A;  4B93 B;  3W9G A;  2F37 A;  3D9H A;  5HRY A;  2FO1 E;  3V31 A;  1QYM A;  4J7W A;  2HE0 A;  1G3N B;  4HI9 A;  4O60 A;  5JA4 D;  1AP7 A;  1OT8 A;  3EHR A;  4CZ2 D;  5BXU A;  3JXI A;  3EU9 A;  3J5Q B;  3NOG D;  5EIB E;  4LNU D;  1YYH A;  3KEA A;  3ZU7 B;  2XEN A;  3JXJ A;  5AQA A;  2ZGD A;  3EHQ A;  3C5R A;  5CER B;  3LJN A;  1IKN D;  5CEA A;  2RFM A;  1WG0 A;  4U96 D;  5EN5 D;  4OAU C;  3UTM A;  3W9F A;  3T8K A;  4TUM A;  3TWR A;  3V2O A;  5EID A;  3DEP A;  4ZHB A;  5CEC B;  1YMP A;  5CED B;  2F8X K;  3TWX A;  5KNG A;  1IXV A;  2ETB A;  4BER A;  5ENQ D;  4DUI A;  3JUE A;  4HB5 A;  5ENO D;  5ENR D;  4HNA D;  2V4H C;  1MX4 A;  2BKG A;  3F6Q A;  4HI8 A;  5FIN A;  2Y0B G;  1WDY A;  4U8V D;  5HKP A;  1BI7 B;  4DX7 D;  2PNN A;  2KXP C;  2V5Q C;  1K1A A;  2ZGG A;  4YDW A;  2BKK B;  4U8Y D;  4DX5 D;  5FIO A;  4QQI A;  4A63 B;  3B95 A;  4BSZ B;  4O1O A;  2A5E A;  1SVX A;  2DVW A;  2XZD G;  2QYJ A;  2QC9 A;  1DC2 A;  4DX2 A;  5KWD A;  2XZT G;  5EYP F;  3TWV A;  5EYL A;  3TWQ A;  5KBA A;  3TWW A;  3V2X A;  3ZKJ A;  4OAV B;  4J8Y A;  2RFA A;  5CBO A;  1N11 A;  2ETA A;  3T9K A;  3TWU A;  3HRA A;  3DEO A;  4JB8 P;  3SO8 A;  3HG0 D;  4GMR A;  4DX6 D;  5AQ7 A;  5BXO A;  3TWS A;  5AQ9 A;  1MYO A;  3NOC D;  2DWZ A;  5ENP D;  1BLX B;  1N0Q A;  4CYM D;  2P2C P;  2KBX A;  4DX1 A;  5EIL A;  4NIK A;  4HLL A;  1D9S A;  3IXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...