4LGAB

Aba-mimicking ligand n-(2-oxo-1-propyl-1,2,3,4-tetrahydroquinolin-6-yl)-1-phenylmethanesulfonamide in complex with aba receptor pyl2 and pp2c hab1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
321
structure length
303
Chain Sequence
b'CIPLWGTVSIQGNRSEMEDAFAVSPHFLKLPIKMLMSPSLTHLTGHFFGVYDGHGGHKVADYCRDRLHFALAEEIERIKDQVQWDKVFTSCFLTVDGEIEGKIGRAVVSSDKVLEAVASETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQEVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDLKAQRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abscisic acid receptor PYL2
publication title An ABA-mimicking ligand that reduces water loss and promotes drought resistance in plants.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase/receptor
total genus 82
structure length 303
sequence length 321
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00481 PP2C Protein phosphatase 2C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.40.10 Alpha Beta 4-Layer Sandwich Phosphatase 2c; domain 1 PPM-type phosphatase domain 4lgaB00
3ZT9A 4DS8B 3W45A 2J4OA 3PU9A 5D2UA 2POMA 4DA1A 2PK0A 2XZVA 3W41A 2P8EA 3ZVUB 2J86A 2JFSA 3T9QA 2IRMA 4N0GA 3FXOA 4OICB 4WVOB 3KDJB 2V06A 3EQ2A 2IQ1A 3QN1B 5JO1B 3RT0A 4LGAB 2POPA 2JFTA 2Y09A 3FXJA 3T91A 4LG5B 2J82A 4YZGA 3RNRA 1A6QA 4JNDA 3KB3B 3NMNB 2CM1A 3FXLA 4LA7B 4LGBB 3KE6A 5JO2B 2PNQA 4YZHA 3FXMA 5ITIA 3NMTB 3FXKA 5F1MA 3UJKA 2I0OA 4RA2A 4RAGA 3W40A 4RAFA 3W43A 3UJLB 3JRQA 2ISNA 3D8KA 3W44A 2JFRA 2I44A 3ES2A 1TXOA 3F79A 3N3CA 3NMVB 3W42A 3MQ3A 3UJGB
chains in the Genus database with same CATH superfamily
3ZT9A 4DS8B 3W45A 2J4OA 3PU9A 5D2UA 2POMA 4DA1A 2PK0A 2XZVA 3W41A 2P8EA 3ZVUB 2J86A 4IIPA 2JFSA 3T9QA 2IRMA 4N0GA 3FXOA 4OICB 4WVOB 3KDJB 2V06A 3EQ2A 2IQ1A 3QN1B 5JO1B 3RT0A 4LGAB 2POPA 2JFTA 4IIKA 2Y09A 3FXJA 3T91A 4LG5B 2J82A 4YZGA 3RNRA 1A6QA 4JNDA 3KB3B 3NMNB 2CM1A 3FXLA 4LA7B 4LGBB 3KE6A 5JO2B 2PNQA 4YZHA 3FXMA 5ITIA 3NMTB 3FXKA 5F1MA 3UJKA 2I0OA 4RA2A 4RAGA 3W40A 4RAFA 3W43A 3UJLB 3JRQA 2ISNA 3D8KA 3W44A 2JFRA 2I44A 3ES2A 1TXOA 3F79A 3N3CA 3NMVB 3W42A 3MQ3A 3UJGB
chains in the Genus database with same CATH topology
3ZT9A 4DS8B 3W45A 2J4OA 3PU9A 5D2UA 2POMA 4DA1A 2PK0A 2XZVA 3W41A 2P8EA 3ZVUB 2J86A 2JFSA 3T9QA 2IRMA 4N0GA 3FXOA 4OICB 4WVOB 3KDJB 2V06A 3EQ2A 2IQ1A 3QN1B 5JO1B 3RT0A 4LGAB 2POPA 2JFTA 2Y09A 3FXJA 3T91A 4LG5B 2J82A 4YZGA 3RNRA 1A6QA 4JNDA 3KB3B 3NMNB 2CM1A 3FXLA 4LA7B 4LGBB 3KE6A 5JO2B 2PNQA 4YZHA 3FXMA 5ITIA 3NMTB 3FXKA 5F1MA 3UJKA 2I0OA 4RA2A 4RAGA 3W40A 4RAFA 3W43A 3UJLB 3JRQA 2ISNA 3D8KA 3W44A 2JFRA 2I44A 3ES2A 1TXOA 3F79A 3N3CA 3NMVB 3W42A 3MQ3A 3UJGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZT9 A;  4DS8 B;  3W45 A;  2J4O A;  3PU9 A;  5D2U A;  2POM A;  4DA1 A;  2PK0 A;  2XZV A;  3W41 A;  2P8E A;  3ZVU B;  2J86 A;  2JFS A;  3T9Q A;  2IRM A;  4N0G A;  3FXO A;  4OIC B;  4WVO B;  3KDJ B;  2V06 A;  3EQ2 A;  2IQ1 A;  3QN1 B;  5JO1 B;  3RT0 A;  4LGA B;  2POP A;  2JFT A;  2Y09 A;  3FXJ A;  3T91 A;  4LG5 B;  2J82 A;  4YZG A;  3RNR A;  1A6Q A;  4JND A;  3KB3 B;  3NMN B;  2CM1 A;  3FXL A;  4LA7 B;  4LGB B;  3KE6 A;  5JO2 B;  2PNQ A;  4YZH A;  3FXM A;  5ITI A;  3NMT B;  3FXK A;  5F1M A;  3UJK A;  2I0O A;  4RA2 A;  4RAG A;  3W40 A;  4RAF A;  3W43 A;  3UJL B;  3JRQ A;  2ISN A;  3D8K A;  3W44 A;  2JFR A;  2I44 A;  3ES2 A;  1TXO A;  3F79 A;  3N3C A;  3NMV B;  3W42 A;  3MQ3 A;  3UJG B; 
#chains in the Genus database with same CATH topology
 3ZT9 A;  4DS8 B;  3W45 A;  2J4O A;  3PU9 A;  5D2U A;  2POM A;  4DA1 A;  2PK0 A;  2XZV A;  3W41 A;  2P8E A;  3ZVU B;  2J86 A;  4IIP A;  2JFS A;  3T9Q A;  2IRM A;  4N0G A;  3FXO A;  4OIC B;  4WVO B;  3KDJ B;  2V06 A;  3EQ2 A;  2IQ1 A;  3QN1 B;  5JO1 B;  3RT0 A;  4LGA B;  2POP A;  2JFT A;  4IIK A;  2Y09 A;  3FXJ A;  3T91 A;  4LG5 B;  2J82 A;  4YZG A;  3RNR A;  1A6Q A;  4JND A;  3KB3 B;  3NMN B;  2CM1 A;  3FXL A;  4LA7 B;  4LGB B;  3KE6 A;  5JO2 B;  2PNQ A;  4YZH A;  3FXM A;  5ITI A;  3NMT B;  3FXK A;  5F1M A;  3UJK A;  2I0O A;  4RA2 A;  4RAG A;  3W40 A;  4RAF A;  3W43 A;  3UJL B;  3JRQ A;  2ISN A;  3D8K A;  3W44 A;  2JFR A;  2I44 A;  3ES2 A;  1TXO A;  3F79 A;  3N3C A;  3NMV B;  3W42 A;  3MQ3 A;  3UJG B; 
#chains in the Genus database with same CATH homology
 3ZT9 A;  4DS8 B;  3W45 A;  2J4O A;  3PU9 A;  5D2U A;  2POM A;  4DA1 A;  2PK0 A;  2XZV A;  3W41 A;  2P8E A;  3ZVU B;  2J86 A;  2JFS A;  3T9Q A;  2IRM A;  4N0G A;  3FXO A;  4OIC B;  4WVO B;  3KDJ B;  2V06 A;  3EQ2 A;  2IQ1 A;  3QN1 B;  5JO1 B;  3RT0 A;  4LGA B;  2POP A;  2JFT A;  2Y09 A;  3FXJ A;  3T91 A;  4LG5 B;  2J82 A;  4YZG A;  3RNR A;  1A6Q A;  4JND A;  3KB3 B;  3NMN B;  2CM1 A;  3FXL A;  4LA7 B;  4LGB B;  3KE6 A;  5JO2 B;  2PNQ A;  4YZH A;  3FXM A;  5ITI A;  3NMT B;  3FXK A;  5F1M A;  3UJK A;  2I0O A;  4RA2 A;  4RAG A;  3W40 A;  4RAF A;  3W43 A;  3UJL B;  3JRQ A;  2ISN A;  3D8K A;  3W44 A;  2JFR A;  2I44 A;  3ES2 A;  1TXO A;  3F79 A;  3N3C A;  3NMV B;  3W42 A;  3MQ3 A;  3UJG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...