4LGDE

Structural basis for autoactivation of human mst2 kinase and its regulation by rassf5
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
47
Chain Sequence
b'VEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase 3
publication title Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 47
sequence length 47
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16517 Nore1-SARAH Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4lgdE00
5CCGC 3HD7C 1N7SA 3RK3B 1N7SD 2HG5D 2N1TA 2H8PD 3B5NA 1URQD 2YMYA 4WY4C 2NPSD 3RL0C 2NPSB 4OH8B 2PP6A 1SFCA 1L4AD 1GL2B 5CCHC 4W80A 1L4AB 1GL2C 5KJ7A 3PP5A 5KJ7D 4LGDE 1JTHA 3VOPA 3RK3C 1KILA 1N7SB 2N1TD 3B5ND 2N1TB 3B5NB 5CCGA 1XTGB 1URQB 3HD7A 2KOGA 3TSIA 3RK2D 2NPSC 1SFCD 3RK2B 1SFCB 1L4AC 4WY4A 1NHLA 3RL0D 4W7YA 3KYQA 1KILD 1JTHB 2WZ7A 1N7SC 5CCHA 2XDJA 1T3JA 1GL2A 2N1TC 5CCGD 3B5NC 4N78E 1HVVA 3HD7D 4W7ZA 1URQC 3HD7B 3HTKB 3RK3D 3M0DC 3RK2C 4JF7A 1SFCC 1URQA 4WY4D 4WY4B 2HFED 3P8CE 5KJ7C 3RL0B 2NPSA 1KILB 2M8RA 5CCHD 1KILC 1L4AA 1GL2D
chains in the Genus database with same CATH superfamily
2HLOA 3ZDMA 4EI2A 5AW4B 1YTZI 4YPCA 1YQ4C 1MZ9A 3CX5I 4JBZA 3Q5PA 2D2CB 1M56D 1NKZB 2PP6A 2FYUD 4M3LA 1FDMA 2FFDA 3W68A 4EOTA 2A06D 1K04A 1N7SB 5KLVG 2OYHC 2AEFA 2R32A 1NTZJ 3A2AA 3VMXA 3S1KA 2R5DA 1OZHA 2QRXA 2KLUA 2B89A 4RKUJ 1SFCD 1NYHA 2FXOA 1DD4A 1MUUA 4OWFA 5KKZB 1R5SA 1NHLA 1W2BO 4ASWA 1T3JA 4C7NA 5CBOA 2XU6A 2NZ2A 4PV1B 5GTHH 5AVSB 1MFZA 4KJMA 1LTTC 3SFEC 1KYOE 1HWTC 2ZVNB 2ZXEB 2H89C 1NTZD 1URQA 4L73A 2A06G 1EZVD 2O1JA 5KLVK 4XFJA 4XA4A 1LJ2A 3TYYA 1QEXA 2L91A 3O6QA 1PFIA 2ITAA 2KSEA 2ZYGA 3P7KA 1L0NE 2LR2A 1YYCA 2W90A 1BSHA 1SQXJ 2IX7C 3H25A 2FXMA 4PJ0H 2OYIB 1N73C 3P32A 1HH0A 2IBZE 2D2CC 1GL2B 3EQ2A 1NJIQ 2QJKC 3H1HE 3PP5A 3CCSP 3H1IE 2WSFJ 3VOPA 2RH0A 1Q90D 1NTZG 3B5ND 3GW6A 2N9BA 2DW3A 1N86A 1ZN5A 1VPCA 3OJAB 2O01N 3B8EB 1PV3A 1YBKA 1OIPA 1VL2A 1KN7A 1VQ7P 3ABVC 3KZIE 1FJPA 2BEZF 3WUTA 3WUUA 2Y9YA 2E42A 1L0NJ 2AEMA 4H44D 2ZT9C 2LKMA 1M7LA 1LTGC 2ZAEB 2K9JB 2OQQA 3B71A 3E7KA 4WVZA 5CMZA 1RQVA 2YXQB 2QEXP 1KYOD 3RK3E 3H1LE 2IYOA 3H1HJ 3H1IJ 1OMIA 3CCRP 2Y9ZA 1P84I 2KK7A 3W67A 1N7SA 2KLVA 2Q3EA 3Q5SA 1PGOA 1SQXG 1VQNP 1IFJA 4ZKPA 1FAVA 5AVWB 5KAFE 1RF1C 2G8YA 1R8EA 1HUCA 2O3JA 3CL3D 2KUBA 2C9LY 4DCKA 4YTPC 1XTCC 3L72E 1ZMEC 1FS0E 1S5LE 3HE5B 1GL2C 1OW8A 1GW4A 1NO4A 1OVUA 3WUVA 2E5YA 2IBZD 4HJGH 2WT7B 1BGYD 5APWA 2E76D 3V4QA 2N1TB 3CXHE 3H1ID 3HRNA 3CMEP 1QVFO 3JC22 5B66E 4IL6X 3F5HA 2WSFH 1M1JA 5H2FE 1L4AC 3C9IA 1LTJC 2HYNA 2Q5UA 3E1RA 1GU5A 2P1JA 3H1LJ 1RY3A 2BCCE 1KYOH 1SQXK 2WSCJ 1EDJA 4K35A 1L0NG 2POHA 1KMIZ 1ZOYC 1NU1D 2ZVOB 1T8ZA 2CK3H 2ZFCA 2OYIA 1OX3A 4KT0J 4WBAA 3H1HG 1KFNA 3CCUP 1U7JA 1X0TA 5KTBA 2O01J 2R5BA 1OW6A 1LT9C 1M8OB 1USDA 1QVGO 3FXDA 3V2NA 1KZUB 3CX5D 3E1IA 4NPEA 3HTKA 1OW7A 2WPSA 3TDKA 3RL0C 1PL5A 3AE4C 2WVRA 3FX0A 3G6EP 1VF5C 1L0NK 3NXSA 4R4LA 1N2DC 2KZJA 2BCCJ 3TK1A 4I6MC 1KILA 3L72D 1QL2A 1PGJA 1GK4A 3AECC 1SQQD 2K9JA 3D70A 1RE3C 2NPSC 1PGPA 1NH4A 3H1LG 3G3ZA 3RL0D 1SQBE 1FOSE 1JTHB 2ZYAA 4TLFA 3MTUE 1VF5D 4ZKUA 3TGUE 3BCCE 1T6AA 1UIIA 1PGQA 2PFXA 5AW9B 2BCCD 1H88A 3CMAP 1L0LG 2OGUA 2YO2A 1NTME 1FDOA 3RK2C 3AE2C 3A3YB 3HE4B 1RF0A 4H0LC 1VQKP 3CWBE 1AA0A 2H88C 2FBWC 3P8CE 3CX5H 3TNUB 1P84E 2YKPA 1IJDB 3MZWB 4UB8H 3HE5A 2JO1A 3HUSB 5KAFH 3H1JD 3HD7C 3VP9A 4I1LA 2N1TA 1S5LH 3USSA 5GTHE 5AVUB 3CCVP 3H6PA 2RKLA 2YIUC 2J5UA 4W80A 1YI2P 4H0LD 1SQBJ 1L0LK 3TGUJ 1IFDA 3BCCJ 5M1BA 3L73D 2IPPA 5H2FH 1URQB 3H32B 1MV8A 1OFCX 3BATA 3VP8A 2N9YB 3CCQP 2I8DA 3CWBJ 3CC7P 1SFCB 4YXWH 1NAFA 2PGDA 5AW6B 1S9KE 1IZNB 3CI9A 4RESB 4GDOA 1NTKK 1NAYA 5CCGD 4N78E 1SQBD 2E74B 1RE4A 3A7OA 3TGUD 2Y0DA 3AEEC 5KLIC 4PD4I 4WY4D 1U57A 2FFDC 4JPZB 1SQVE 1NTMD 3K5BA 2NRGA 5CCHD 1EDLA 1RHZB 1G1IA 3P8CD 1P84D 1SVFA 3M0AA 2Q1KA 4Y99B 1NOHA 2FYUJ 4GKGA 1VQ9P 2WWWA 2YMYA 1KQSO 3BRTB 4H13D 1VQ8P 4WB4A 4LC1A 1SQBG 1M57D 3TGUG 3JCUE 3BCCG 1T2KC 2W6BA 2ZXXA 1JTHA 2JWDA 2IFMA 3D6ZA 1BCCD 2JP3A 3B5NB 1W2EA 3AE8C 3II6A 2KS1B 3V5BA 2FYNC 3CWBG 2GUSA 3HE4A 1H89A 3GMAA 1KB9I 1SQVJ 2Q7CA 1N8RQ 3TNUA 2B87B 2FYZA 2GUVA 1KD1Q 4U3FE 2QSIA 1BDDA 3ITKA 3HUSA 1VQMP 1S1CX 4W7ZA 1S9KD 1SQPE 4H44B 2R3SA 1P84H 2Q6QA 2G3AA 2Q3IA 2Y0EA 1GZLA 4N78D 2P7JA 2W6JH 2QA4P 2A45H 4C7RA 3RL0g 1NKNA 5AW3B 1JCDA 1PPJE 3C8VA 2P10A 2YMKA 2K1AA 4CPGA 3AE9C 5BVZA 3L74D 1OWAA 5APQA 1HBWA 3GG2A 1FDIA 1SQVD 3AEBC 1ZR4A 1VDFA 2FYUG 2HG5D 3A5TA 2J59M 2W83C 1M1JB 3H32A 3M0DA 1FE6A 1GU4A 2OTKE 3D71A 4IFFA 3P8MC 1SFCA 3FWLA 5APXA 1SP4A 4ZNCA 2E5TA 4U3FJ 5TISH 3OAKA 2I1KA 1SQPJ 2E76B 2W27A 1DD3A 3BVHA 4IL6E 2UWJE 1CI6B 3G71P 1X79B 3TSIA 3A0HH 1TU3F 3B4SA 2CPSA 1BGYE 1CZQA 3MUDA 1DEEG 2FYUK 2K37A 3IF4A 1ZR2A 1N7SC 2M5AB 2KYVA 1EZVG 1HVVA 2QJYB 1G1JA 4PD4E 5DJTB 2W8ZA 3L75E 3HTKB 4U3FD 4I2LC 2B9BA 2WTYA 2RN0A 1YITP 1SQPD 3FWNA 2RMZA 2OTLP 5KKZC 1NU1E 3I55P 1KILB 1Q86Q 1ZP0C 2D2CD 3IFMA 1PPJD 2KXPB 4AQRD 2AXTE 4PV1C 2HPCB 5KAIE 1WRGA 3RK3B 4Z1MH 1N7SD 3R2PA 2C0WA 1EDIA 3B5NA 3M9BA 2KS1A 1D7MA 1M1JC 3JCUH 2E43A 1BGYJ 1NTZK 3MP7B 5AVXB 1JY2P 1LGHB 1J1EB 1JY2O 2B87A 2KB7P 2E75B 3CX5E 3L37A 1JNMA 2A45I 4UB8E 1EXJA 2KZIA 3RBXA 1LTIC 2ZT9D 3GLMA 1KB9E 1RH5B 2OYIC 4L74A 2IFNA 1NU1J 2WPRA 3Q2YA 2Z5HA 1KC8Q 2JDIH 5B5EE 5APUA 3SSUA 1SQQE 2XDJA 5C39A 4N6JA 1X8YA 2IZ1A 5APYA 4EDFA 3CC4P 4OGQB 1PIXA 2J58A 5TJHA 3SWYA 2WSSH 2YKOA 4PD4D 3L75D 3L70D 1JUNA 1FU1A 1LNQA 1R5LA 3O8ZA 4N3YB 2H7HA 3KQGA 4WWIA 2YXRB 3KXDA 1KILC 1GL2D 1KORA 3VMAA 1PP9E 1MKMA 1X22A 3KHUA 3MHVA 3I56P 5AVRB 1ZXGA 3CLQA 2Q9IA 4BXLA 2XNDH 1K8AQ 2IBZG 1CI6A 1BGYG 3H1JE 3L72J 3H1IG 3BRVB 1L4AD 3QH9A 4A7PA 1GK6A 2P2UA 4L76A 5KJ7A 1QLED 1K73Q 4IL6H 1SQQJ 5EFWB 4IFMA 4UB6H 2M5AA 3I5CA 1AVOA 1JY3P 1KQGB 1JY3O 3LIEA 1RF0C 4I7ZB 1DX7A 3UIAA 2WPVB 4YXDC 1NU1G 3L73E 1JOCA 2GA1A 1KB9D 3EFGA 1JM0A 4PD4H 3AEAC 1DIPA 1PP9J 2WZ7A 3VN0A 1FZCB 3PTZA 1NVOA 1W5CE 2N1TC 3R4YA 3OW2O 1M90Q 2HPCA 1LTJA 3NFQA 2BASA 5AW5B 3VYIA 3SWKA 4OGQC 3F89A 3AEFC 3H1JJ 1EXIA 1YJNP 2AXTH 4WY4B 3KPEA 3N4XA 5KAIH 1LT1A 1M1KQ 1FZBA 1X9VA 2BEQD 1LWUA 1S5LX 4D6TD 3RGUA 1PP9D 3SWFA 1S3JA 3L72G 1AFOA 3L73J 2NPSD 1IK9A 2R3CA 3M06A 4H13B 3IN6A 1Y47A 2XKMA 3D6YA 3IAOA 1SQQG 3MGNA 1FJKA 1KB9H 1LTSC 1RE4C 1CW5A 4HB1A 2KIKA 5GTIE 5KLVE 2JKVA 2WPQA 1J1DB 3V2RA 3RK2D 5B5EH 4L75A 2BCCG 1BCCE 2M3EA 4AYCA 1EDKA 1HF9A 2XV5A 3MIWA 1YIJP 3HD7D 1NTMJ 3L4FA 5TISE 1HTLC 3M91A 1YQ3C 5E79E 2QVAA 1FC2C 3H1JG 3QWOC 3PH0A 3AEDC 2HFED 4HKZH 3A0HE 2OTJP 2M8RA 3FXEA 5AW0B 3TF5A 1N7LA 2KI7B 4IOIH 3AE1C 2OYHB 1VQLP 1U7MA 2H8PD 3L35A 3A0BE 3L74E 1FOSF 5BU8B 3L73G 3NTNA 5CBNA 1BCCJ 3CCMP 1BE3E 3HUSC 4KHXA 4EYYQ 1FZCA 3AE7C 5APVA 1KFMA 2QM7A 5CCGA 1XTGB 1JY2N 3VMYA 1IO4A 1KTMA 2KOGA 4BWNA 4GIFA 1HGZA 1J1DC 5CJ0A 5KLVD 3M9QA 1Y9BA 3U1CA 1IFMA 2YKQA 4WY4A 1PZQA 3VTPC 4BRYB 5CCHA 3L71E 4RO0A 3CCEP 2OARA 1NTMG 1URQC 3FGAD 1Y8AA 4JQ0D 3PHLA 3M0DC 3T97B 3L74J 3G9RA 1UIXA 1SFCC 3AE5C 2A45G 2KNCB 1N73B 1S72P 1BE3J 5CHXA 2QJKB 1T2KD 2E74C 3GHGA 1SQBK 3MD0A 4Y28J 1E79H 1URQD 2P58A 3C1LA 2SPZA 3MUDC 1IFNA 1BCCG 1OVRA 1SQXE 1L2PA 4NPDA 1GW3A 1NTMK 3CXHI 1VQOP 5GTIH 2LXCB 3L71J 2V7QH 2IDBA 4Y99C 2Z5IA 1BE3D 3AE6C 3BASA 1USEA 1KQFB 2E74D 2ZT9B 2IZ0A 1WT6A 2FY8A 1JY3N 2KSJA 4U7JA 3V4WA 4W7YA 3WU2H 3KYQA 5E79H 4GOFA 1YTZT 3B5NC 2B88A 4DOJA 5APSA 4UB6E 3L71D 4QMAA 1KV4A 2OYHA 1GDTA 3L74G 5L8RJ 1VQ5P 1SQVG 4JF7A 3GF7A 1Q2NA 1RF1B 1BE3G 3KDPB 3N7NA 3V2QA 1KQLA 5AVZB 3A0BH 3S4RA 3L70E 4H44C 1H0TB 1ZRTE 1G2CA 2QE7H 5AW1B 2ZYDA 2CPBA 1JMMA 1IFPA 1ZW0A 4GOEA 1L4AB 1GD2E 1SQXD 2OYOA 3L71G 1LTJB 4LGDE 4BRYA 4C46A 2JR8A 4DT0A 3V6IA 1SQVK 1FBMA 1IK7A 1S2EA 4AUWA 2AEJA 3IR9A 4ASVA 3T97A 2QIWA 3CD6P 1KILE 4GODA 1EC5A 1WMKA 1LP1B 2KNCA 4U3FG 1N73A 1GMJA 1AQTA 5AVYB 1LWUB 1SQPG 3L75J 4K3AA 3L70J 2JJLA 2E76C 4PV1D 1J2JB 1SS1A 1LT9B 2YNYA 5CJ4A 4HH2A 1PPJG 5AW8B 1AVYA 4DZOA 1L0LE 1T3UA 3PRJA 1L0ND 5KJ7C 3H1KE 3RL0B 5AVTB 1DEBA 1IFIA 1VF5B 2WSEJ 1K05A 1FZEA 2QJYC 1JCCA 2KP8A 3G4SP 2WMMA 2V4HA 4O9BA 3PJSK 2XNXA 2VRSA 3H1HD 2MKVA 1ZRTD 4R4MA 1SQPK 2NPSB 1NTKE 2M3BA 4OH8B 4D6TE 5AVVB 4GT1A 5KJ7D 3RK3C 3EWKA 4RJTA 1BSNA 1A02J 1YJ9P 1QL1A 2QJPB 3CCLP 1QGKB 2GM4A 1L0LJ 3RK2B 2P67A 3Q3DA 1RF1A 3H1KJ 1YHQP 4H0LB 4TT3H 2ZJSE 3PLNA 1J1EC 1YJWP 2E75C 1Q81Q 2FKWB 1KILD 3L75G 1LWUC 3L70G 1GL2A 3U1AA 3Q1MA 4MN4C 3VMZA 3HD7B 1H0TA 3RK3D 1ZV8A 2K88A 3LW5J 2WITA 3H1LD 1DH3A 1Z56A 3LIDA 2Y0CA 4DJGA 2YO3A 1NTKJ 1AJYA 4D6TJ 1EZVI 4B86A 2YIUB 1HGVA 1L0LD 1L4AA 1GTWA 1A02F 3H1KD 1K9MQ 3CPWO 2E75D 2HODB 3L36A 1LTBC 2JWAA 2WSEH 3KZIH 3M9HA 1IC2A 3NMDA 3CXHD 1LTAC 1LP1A 1Q7YQ 3S9OA 4HYTB 1SLQA 2HR3A 1VQ4P 1NTKD 3SFDC 1NU1K 4IFDK 2WQYC 2PAJA 1BDCA 2N1TD 2C0XA 1VQPP 1LT9A 3EFFK 5AVQB 2JEEA 4OGQD 3CC2P 2QJPC 1MFTA 5KLIB 2L5GB 3H1KG 1VQ6P 2C9NY 2FFDB 4EIJA 2WSCH 3AEGC 3GHGB 4LLHA 1E5WA 3AE3C 2K9YA 2QM8A 3JSVC 4I7ZC 1FZAA 2WT7A 1S4XA 2FXPA 1NTKG 4D6TG 1PP9G 1KYOI 1RE3A 1JO5A 2NPSA 2O01H 1FZCC 2QG4A 4C7NB 2MJZA 3LW5H 5APTA 1NWQA 3CXHH 4XE5B 5CCGC 3WU2E 1NGMB 5B66H 4NPFX 1SQQK 1JEKA 2O1KA 2FYUE 1EQ7A 4WY4C 2H43A 2FYNB 3CCJP 2A06E 2LXBA 3O6QB 2K3RA 5CCHC 4JYCA 1FZFA 1OVVA 3WMM0 4PJ0E 1FZGA 1H8AA 4OVNF 2IBZI 5KLVJ 5AW7B 2V7QJ 1CSBA 1JB0J 3HD7A 1QX8A 1JMBA 3BCCD 2M0BA 1HJBA 1AQ5A 4H13C 3RBZA 1AV1A 1OXZA 5K5GB 3GF3A 1HJ0A 2W6AA 3GHGC 2I1JA 4ZMDA 2IYPA 3CWBD 3OA7A 4JYBA 2HODA 1G2CB 1RQUA 5BU5A 1NTZE 1ZLLA 2Z4EA 5DJUB 1EZVE 3U59A 2PRRA 2XZRA 5AW2B 2AXCA 2R44A 3V2PA 1Q82Q 3Q5RA
chains in the Genus database with same CATH topology
5AVZB 3HUSB 3HD7C 2HLOA 3VP9A 4I1LA 5AVRB 2N1TA 3CLQA 2Q9IA 5AW4B 1YTZI 1G2CA 5AVUB 1MZ9A 3H6PA 1CI6A 5AW1B 2CPBA 1JMMA 1NKZB 2PP6A 3BRVB 1L4AD 1GK6A 4M3LA 2P2UA 4W80A 1L4AB 1FDMA 2FFDA 1GD2E 5KJ7A 1L0LK 1LTJB 4EOTA 1IFDA 4LGDE 4C46A 4IFMA 1N7SB 3I5CA 1SQVK 2OYHC 1JY3P 2IPPA 2R32A 1FBMA 3A2AA 3VMXA 1JY3O 1URQB 2R5DA 3H32B 4AUWA 1MV8A 3LIEA 3BATA 1RF0C 3IR9A 3T97A 1DX7A 3UIAA 3VP8A 1SFCD 1JOCA 1SFCB 1MUUA 3EFGA 1NAFA 1N73A 5AW6B 1NHLA 5AVYB 1S9KE 1LWUB 3CI9A 2WZ7A 3VN0A 4RESB 1FZCB 1NTKK 1T3JA 4C7NA 2JJLA 2N1TC 5CCGD 4N78E 2XU6A 1J2JB 2HPCA 1LTJA 1RE4A 5AVSB 1MFZA 3NFQA 1LT9B 3A7OA 2BASA 2YNYA 5CJ4A 1LTTC 5AW5B 4HH2A 3VYIA 1HWTC 5AW8B 2ZXEB 4DZOA 1URQA 4WY4D 1T3UA 2FFDC 4WY4B 3KPEA 3N4XA 2O1JA 5KJ7C 5KLVK 3RL0B 5AVTB 4XA4A 1DEBA 1IFIA 3TYYA 1FZBA 5CCHD 1PFIA 1FZEA 1G1IA 1X9VA 3P7KA 3P8CD 1JCCA 1SVFA 2KP8A 3M0AA 4Y99B 1LWUA 1NOHA 1YYCA 4GKGA 4O9BA 2IX7C 2XNXA 2FXMA 2VRSA 2WWWA 3SWFA 1AFOA 2YMYA 2OYIB 1N73C 1SQPK 2NPSD 3P32A 1HH0A 1IK9A 2NPSB 2M3BA 2R3CA 3BRTB 3M06A 4OH8B 1GL2B 5AVVB 3EQ2A 4WB4A 4LC1A 2XKMA 4GT1A 3MGNA 1FJKA 3PP5A 5KJ7D 1T2KC 2W6BA 1JTHA 3VOPA 1LTSC 1RE4C 3RK3C 1CW5A 2IFMA 3B5ND 3B5NB 1A02J 1W2EA 2N9BA 3II6A 1QL1A 1N86A 2WPQA 1ZN5A 3V5BA 1J1DB 1VPCA 3V2RA 3OJAB 3RK2D 2GM4A 3B8EB 3RK2B 2GUSA 3HE4A 1H89A 2P67A 4AYCA 1RF1A 2Q7CA 1J1EC 2XV5A 3TNUA 2FYZA 2GUVA 2FKWB 1FJPA 1KILD 2E42A 1LWUC 1GL2A 3MIWA 3HUSA 3HD7D 3U1AA 4W7ZA 1S9KD 3VMZA 3HD7B 3L4FA 2LKMA 1HTLC 1M7LA 1LTGC 3M91A 3RK3D 1ZV8A 2Q3IA 2WITA 1GZLA 1DH3A 4N78D 2P7JA 1Z56A 3LIDA 2A45H 4C7RA 5CMZA 1NKNA 2YO3A 5AW3B 1JCDA 2HFED 4B86A 2M8RA 1HGVA 1L4AA 5AW0B 5BVZA 1OWAA 1GTWA 5APQA 1HBWA 1A02F 1N7LA 2HODB 1N7SA 2KLVA 3L36A 1ZR4A 1LTBC 1VDFA 2OYHB 2HG5D 3A5TA 2H8PD 3L35A 2J59M 1IFJA 1M1JB 3H32A 2WSEH 1FAVA 4ZKPA 1FOSF 5AVWB 1RF1C 3M0DA 5BU8B 1GU4A 1HUCA 3CL3D 3NTNA 4IFFA 3P8MC 3M9HA 1IC2A 1SFCA 2C9LY 3NMDA 1XTCC 1LTAC 5APXA 3HE5B 1GL2C 1SP4A 4HYTB 1SLQA 3HUSC 1GW4A 1NO4A 4KHXA 1NU1K 4IFDK 3OAKA 2PAJA 2WT7B 1FZCA 5APWA 2N1TD 2I1KA 3V4QA 2C0XA 2N1TB 5APVA 1KFMA 2QM7A 2W27A 5CCGA 1XTGB 1JY2N 3VMYA 3BVHA 1IO4A 3HRNA 1LT9A 2KOGA 5AVQB 1CI6B 2JEEA 1X79B 3TSIA 4GIFA 1HGZA 1J1DC 2CPSA 2WSFH 5CJ0A 2L5GB 3M9QA 1CZQA 1M1JA 3U1CA 1L4AC 1IFMA 2YKQA 3MUDA 4WY4A 3C9IA 2FFDB 2C9NY 4EIJA 1LTJC 2HYNA 2Q5UA 2WSCH 2FYUK 1GU5A 3VTPC 2P1JA 1ZR2A 3GHGB 1RY3A 4LLHA 1SQXK 1N7SC 5CCHA 2KYVA 1E5WA 2OARA 2POHA 1HVVA 2QM8A 1URQC 1G1JA 3HTKB 1T8ZA 3M0DC 1FZAA 4I2LC 2WT7A 2WTYA 1SFCC 2ZFCA 2OYIA 2A45G 1N73B 1RE3A 1JO5A 2NPSA 1KILB 4WBAA 2O01H 3IFMA 1KFNA 1FZCC 5CHXA 4C7NB 2MJZA 3LW5H 5APTA 1NWQA 5KTBA 1T2KD 4AQRD 4XE5B 2R5BA 5CCGC 2HPCB 1WRGA 1LT9C 3RK3B 3GHGA 1N7SD 3R2PA 1SQBK 2C0WA 3MD0A 3B5NA 1SQQK 3V2NA 3M9BA 1KZUB 1URQD 2O1KA 3E1IA 1M1JC 1EQ7A 2E43A 4WY4C 1IFNA 3HTKA 2WPSA 2H43A 1NTZK 3RL0C 5AVXB 1L0NK 1GW3A 1JY2P 1LGHB 1NTMK 3NXSA 4JYCA 5CCHC 1N2DC 1J1EB 1FZFA 3TK1A 4I6MC 1JY2O 2KB7P 3WMM0 3L37A 1FZGA 1JNMA 1H8AA 1KILA 4Y99C 2A45I 2Z5IA 5AW7B 1QL2A 3BASA 1CSBA 1LTIC 3HD7A 1GK4A 2OYIC 1WT6A 1RE3C 2IFNA 2NPSC 1HJBA 1AQ5A 1JY3N 2WPRA 1OXZA 2KSJA 1NH4A 3V4WA 3G3ZA 3RL0D 4W7YA 1FOSE 2Z5HA 3KYQA 1JTHB 2W6AA 5APUA 3MTUE 3GHGC 4ZKUA 2I1JA 2XDJA 1YTZT 3B5NC 4N6JA 1X8YA 3OA7A 4JYBA 2HODA 1G2CB 4DOJA 5AW9B 5BU5A 5APSA 5APYA 1ZLLA 1H88A 2Z4EA 2J58A 2OYHA 1GDTA 3U59A 2YO2A 3RK2C 3SWYA 3A3YB 4JF7A 2XZRA 3V2QA 2YKOA 3HE4B 5AW2B 1RF1B 1RF0A 1JUNA 1FU1A 3O8ZA 3P8CE 4N3YB 3TNUB 2H7HA 3KQGA 2YKPA 1IJDB 3V2PA 3KDPB 1KILC 3N7NA 1GL2D 1KQLA 3HE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCG C;  3HD7 C;  1N7S A;  3RK3 B;  1N7S D;  2HG5 D;  2N1T A;  2H8P D;  3B5N A;  1URQ D;  2YMY A;  4WY4 C;  2NPS D;  3RL0 C;  2NPS B;  4OH8 B;  2PP6 A;  1SFC A;  1L4A D;  1GL2 B;  5CCH C;  4W80 A;  1L4A B;  1GL2 C;  5KJ7 A;  3PP5 A;  5KJ7 D;  4LGD E;  1JTH A;  3VOP A;  3RK3 C;  1KIL A;  1N7S B;  2N1T D;  3B5N D;  2N1T B;  3B5N B;  5CCG A;  1XTG B;  1URQ B;  3HD7 A;  2KOG A;  3TSI A;  3RK2 D;  2NPS C;  1SFC D;  3RK2 B;  1SFC B;  1L4A C;  4WY4 A;  1NHL A;  3RL0 D;  4W7Y A;  3KYQ A;  1KIL D;  1JTH B;  2WZ7 A;  1N7S C;  5CCH A;  2XDJ A;  1T3J A;  1GL2 A;  2N1T C;  5CCG D;  3B5N C;  4N78 E;  1HVV A;  3HD7 D;  4W7Z A;  1URQ C;  3HD7 B;  3HTK B;  3RK3 D;  3M0D C;  3RK2 C;  4JF7 A;  1SFC C;  1URQ A;  4WY4 D;  4WY4 B;  2HFE D;  3P8C E;  5KJ7 C;  3RL0 B;  2NPS A;  1KIL B;  2M8R A;  5CCH D;  1KIL C;  1L4A A;  1GL2 D; 
#chains in the Genus database with same CATH topology
 2HLO A;  3ZDM A;  4EI2 A;  5AW4 B;  1YTZ I;  4YPC A;  1YQ4 C;  1MZ9 A;  3CX5 I;  4JBZ A;  3Q5P A;  2D2C B;  1M56 D;  1NKZ B;  2PP6 A;  2FYU D;  4M3L A;  1FDM A;  2FFD A;  3W68 A;  4EOT A;  2A06 D;  1K04 A;  1N7S B;  5KLV G;  2OYH C;  2AEF A;  2R32 A;  1NTZ J;  3A2A A;  3VMX A;  3S1K A;  2R5D A;  1OZH A;  2QRX A;  2KLU A;  2B89 A;  4RKU J;  1SFC D;  1NYH A;  2FXO A;  1DD4 A;  1MUU A;  4OWF A;  5KKZ B;  1R5S A;  1NHL A;  1W2B O;  4ASW A;  1T3J A;  4C7N A;  5CBO A;  2XU6 A;  2NZ2 A;  4PV1 B;  5GTH H;  5AVS B;  1MFZ A;  4KJM A;  1LTT C;  3SFE C;  1KYO E;  1HWT C;  2ZVN B;  2ZXE B;  2H89 C;  1NTZ D;  1URQ A;  4L73 A;  2A06 G;  1EZV D;  2O1J A;  5KLV K;  4XFJ A;  4XA4 A;  1LJ2 A;  3TYY A;  1QEX A;  2L91 A;  3O6Q A;  1PFI A;  2ITA A;  2KSE A;  2ZYG A;  3P7K A;  1L0N E;  2LR2 A;  1YYC A;  2W90 A;  1BSH A;  1SQX J;  2IX7 C;  3H25 A;  2FXM A;  4PJ0 H;  2OYI B;  1N73 C;  3P32 A;  1HH0 A;  2IBZ E;  2D2C C;  1GL2 B;  3EQ2 A;  1NJI Q;  2QJK C;  3H1H E;  3PP5 A;  3CCS P;  3H1I E;  2WSF J;  3VOP A;  2RH0 A;  1Q90 D;  1NTZ G;  3B5N D;  3GW6 A;  2N9B A;  2DW3 A;  1N86 A;  1ZN5 A;  1VPC A;  3OJA B;  2O01 N;  3B8E B;  1PV3 A;  1YBK A;  1OIP A;  1VL2 A;  1KN7 A;  1VQ7 P;  3ABV C;  3KZI E;  1FJP A;  2BEZ F;  3WUT A;  3WUU A;  2Y9Y A;  2E42 A;  1L0N J;  2AEM A;  4H44 D;  2ZT9 C;  2LKM A;  1M7L A;  1LTG C;  2ZAE B;  2K9J B;  2OQQ A;  3B71 A;  3E7K A;  4WVZ A;  5CMZ A;  1RQV A;  2YXQ B;  2QEX P;  1KYO D;  3RK3 E;  3H1L E;  2IYO A;  3H1H J;  3H1I J;  1OMI A;  3CCR P;  2Y9Z A;  1P84 I;  2KK7 A;  3W67 A;  1N7S A;  2KLV A;  2Q3E A;  3Q5S A;  1PGO A;  1SQX G;  1VQN P;  1IFJ A;  4ZKP A;  1FAV A;  5AVW B;  5KAF E;  1RF1 C;  2G8Y A;  1R8E A;  1HUC A;  2O3J A;  3CL3 D;  2KUB A;  2C9L Y;  4DCK A;  4YTP C;  1XTC C;  3L72 E;  1ZME C;  1FS0 E;  1S5L E;  3HE5 B;  1GL2 C;  1OW8 A;  1GW4 A;  1NO4 A;  1OVU A;  3WUV A;  2E5Y A;  2IBZ D;  4HJG H;  2WT7 B;  1BGY D;  5APW A;  2E76 D;  3V4Q A;  2N1T B;  3CXH E;  3H1I D;  3HRN A;  3CME P;  1QVF O;  3JC2 2;  5B66 E;  4IL6 X;  3F5H A;  2WSF H;  1M1J A;  5H2F E;  1L4A C;  3C9I A;  1LTJ C;  2HYN A;  2Q5U A;  3E1R A;  1GU5 A;  2P1J A;  3H1L J;  1RY3 A;  2BCC E;  1KYO H;  1SQX K;  2WSC J;  1EDJ A;  4K35 A;  1L0N G;  2POH A;  1KMI Z;  1ZOY C;  1NU1 D;  2ZVO B;  1T8Z A;  2CK3 H;  2ZFC A;  2OYI A;  1OX3 A;  4KT0 J;  4WBA A;  3H1H G;  1KFN A;  3CCU P;  1U7J A;  1X0T A;  5KTB A;  2O01 J;  2R5B A;  1OW6 A;  1LT9 C;  1M8O B;  1USD A;  1QVG O;  3FXD A;  3V2N A;  1KZU B;  3CX5 D;  3E1I A;  4NPE A;  3HTK A;  1OW7 A;  2WPS A;  3TDK A;  3RL0 C;  1PL5 A;  3AE4 C;  2WVR A;  3FX0 A;  3G6E P;  1VF5 C;  1L0N K;  3NXS A;  4R4L A;  1N2D C;  2KZJ A;  2BCC J;  3TK1 A;  4I6M C;  1KIL A;  3L72 D;  1QL2 A;  1PGJ A;  1GK4 A;  3AEC C;  1SQQ D;  2K9J A;  3D70 A;  1RE3 C;  2NPS C;  1PGP A;  1NH4 A;  3H1L G;  3G3Z A;  3RL0 D;  1SQB E;  1FOS E;  1JTH B;  2ZYA A;  4TLF A;  3MTU E;  1VF5 D;  4ZKU A;  3TGU E;  3BCC E;  1T6A A;  1UII A;  1PGQ A;  2PFX A;  5AW9 B;  2BCC D;  1H88 A;  3CMA P;  1L0L G;  2OGU A;  2YO2 A;  1NTM E;  1FDO A;  3RK2 C;  3AE2 C;  3A3Y B;  3HE4 B;  1RF0 A;  4H0L C;  1VQK P;  3CWB E;  1AA0 A;  2H88 C;  2FBW C;  3P8C E;  3CX5 H;  3TNU B;  1P84 E;  2YKP A;  1IJD B;  3MZW B;  4UB8 H;  3HE5 A;  2JO1 A;  3HUS B;  5KAF H;  3H1J D;  3HD7 C;  3VP9 A;  4I1L A;  2N1T A;  1S5L H;  3USS A;  5GTH E;  5AVU B;  3CCV P;  3H6P A;  2RKL A;  2YIU C;  2J5U A;  4W80 A;  1YI2 P;  4H0L D;  1SQB J;  1L0L K;  3TGU J;  1IFD A;  3BCC J;  5M1B A;  3L73 D;  2IPP A;  5H2F H;  1URQ B;  3H32 B;  1MV8 A;  1OFC X;  3BAT A;  3VP8 A;  2N9Y B;  3CCQ P;  2I8D A;  3CWB J;  3CC7 P;  1SFC B;  4YXW H;  1NAF A;  2PGD A;  5AW6 B;  1S9K E;  1IZN B;  3CI9 A;  4RES B;  4GDO A;  1NTK K;  1NAY A;  5CCG D;  4N78 E;  1SQB D;  2E74 B;  1RE4 A;  3A7O A;  3TGU D;  2Y0D A;  3AEE C;  5KLI C;  4PD4 I;  4WY4 D;  1U57 A;  2FFD C;  4JPZ B;  1SQV E;  1NTM D;  3K5B A;  2NRG A;  5CCH D;  1EDL A;  1RHZ B;  1G1I A;  3P8C D;  1P84 D;  1SVF A;  3M0A A;  2Q1K A;  4Y99 B;  1NOH A;  2FYU J;  4GKG A;  1VQ9 P;  2WWW A;  2YMY A;  1KQS O;  3BRT B;  4H13 D;  1VQ8 P;  4WB4 A;  4LC1 A;  1SQB G;  1M57 D;  3TGU G;  3JCU E;  3BCC G;  1T2K C;  2W6B A;  2ZXX A;  1JTH A;  2JWD A;  2IFM A;  3D6Z A;  1BCC D;  2JP3 A;  3B5N B;  1W2E A;  3AE8 C;  3II6 A;  2KS1 B;  3V5B A;  2FYN C;  3CWB G;  2GUS A;  3HE4 A;  1H89 A;  3GMA A;  1KB9 I;  1SQV J;  2Q7C A;  1N8R Q;  3TNU A;  2B87 B;  2FYZ A;  2GUV A;  1KD1 Q;  4U3F E;  2QSI A;  1BDD A;  3ITK A;  3HUS A;  1VQM P;  1S1C X;  4W7Z A;  1S9K D;  1SQP E;  4H44 B;  2R3S A;  1P84 H;  2Q6Q A;  2G3A A;  2Q3I A;  2Y0E A;  1GZL A;  4N78 D;  2P7J A;  2W6J H;  2QA4 P;  2A45 H;  4C7R A;  3RL0 g;  1NKN A;  5AW3 B;  1JCD A;  1PPJ E;  3C8V A;  2P10 A;  2YMK A;  2K1A A;  4CPG A;  3AE9 C;  5BVZ A;  3L74 D;  1OWA A;  5APQ A;  1HBW A;  3GG2 A;  1FDI A;  1SQV D;  3AEB C;  1ZR4 A;  1VDF A;  2FYU G;  2HG5 D;  3A5T A;  2J59 M;  2W83 C;  1M1J B;  3H32 A;  3M0D A;  1FE6 A;  1GU4 A;  2OTK E;  3D71 A;  4IFF A;  3P8M C;  1SFC A;  3FWL A;  5APX A;  1SP4 A;  4ZNC A;  2E5T A;  4U3F J;  5TIS H;  3OAK A;  2I1K A;  1SQP J;  2E76 B;  2W27 A;  1DD3 A;  3BVH A;  4IL6 E;  2UWJ E;  1CI6 B;  3G71 P;  1X79 B;  3TSI A;  3A0H H;  1TU3 F;  3B4S A;  2CPS A;  1BGY E;  1CZQ A;  3MUD A;  1DEE G;  2FYU K;  2K37 A;  3IF4 A;  1ZR2 A;  1N7S C;  2M5A B;  2KYV A;  1EZV G;  1HVV A;  2QJY B;  1G1J A;  4PD4 E;  5DJT B;  2W8Z A;  3L75 E;  3HTK B;  4U3F D;  4I2L C;  2B9B A;  2WTY A;  2RN0 A;  1YIT P;  1SQP D;  3FWN A;  2RMZ A;  2OTL P;  5KKZ C;  1NU1 E;  3I55 P;  1KIL B;  1Q86 Q;  1ZP0 C;  2D2C D;  3IFM A;  1PPJ D;  2KXP B;  4AQR D;  2AXT E;  4PV1 C;  2HPC B;  5KAI E;  1WRG A;  3RK3 B;  4Z1M H;  1N7S D;  3R2P A;  2C0W A;  1EDI A;  3B5N A;  3M9B A;  2KS1 A;  1D7M A;  1M1J C;  3JCU H;  2E43 A;  1BGY J;  1NTZ K;  3MP7 B;  5AVX B;  1JY2 P;  1LGH B;  1J1E B;  1JY2 O;  2B87 A;  2KB7 P;  2E75 B;  3CX5 E;  3L37 A;  1JNM A;  2A45 I;  4UB8 E;  1EXJ A;  2KZI A;  3RBX A;  1LTI C;  2ZT9 D;  3GLM A;  1KB9 E;  1RH5 B;  2OYI C;  4L74 A;  2IFN A;  1NU1 J;  2WPR A;  3Q2Y A;  2Z5H A;  1KC8 Q;  2JDI H;  5B5E E;  5APU A;  3SSU A;  1SQQ E;  2XDJ A;  5C39 A;  4N6J A;  1X8Y A;  2IZ1 A;  5APY A;  4EDF A;  3CC4 P;  4OGQ B;  1PIX A;  2J58 A;  5TJH A;  3SWY A;  2WSS H;  2YKO A;  4PD4 D;  3L75 D;  3L70 D;  1JUN A;  1FU1 A;  1LNQ A;  1R5L A;  3O8Z A;  4N3Y B;  2H7H A;  3KQG A;  4WWI A;  2YXR B;  3KXD A;  1KIL C;  1GL2 D;  1KOR A;  3VMA A;  1PP9 E;  1MKM A;  1X22 A;  3KHU A;  3MHV A;  3I56 P;  5AVR B;  1ZXG A;  3CLQ A;  2Q9I A;  4BXL A;  2XND H;  1K8A Q;  2IBZ G;  1CI6 A;  1BGY G;  3H1J E;  3L72 J;  3H1I G;  3BRV B;  1L4A D;  3QH9 A;  4A7P A;  1GK6 A;  2P2U A;  4L76 A;  5KJ7 A;  1QLE D;  1K73 Q;  4IL6 H;  1SQQ J;  5EFW B;  4IFM A;  4UB6 H;  2M5A A;  3I5C A;  1AVO A;  1JY3 P;  1KQG B;  1JY3 O;  3LIE A;  1RF0 C;  4I7Z B;  1DX7 A;  3UIA A;  2WPV B;  4YXD C;  1NU1 G;  3L73 E;  1JOC A;  2GA1 A;  1KB9 D;  3EFG A;  1JM0 A;  4PD4 H;  3AEA C;  1DIP A;  1PP9 J;  2WZ7 A;  3VN0 A;  1FZC B;  3PTZ A;  1NVO A;  1W5C E;  2N1T C;  3R4Y A;  3OW2 O;  1M90 Q;  2HPC A;  1LTJ A;  3NFQ A;  2BAS A;  5AW5 B;  3VYI A;  3SWK A;  4OGQ C;  3F89 A;  3AEF C;  3H1J J;  1EXI A;  1YJN P;  2AXT H;  4WY4 B;  3KPE A;  3N4X A;  5KAI H;  1LT1 A;  1M1K Q;  1FZB A;  1X9V A;  2BEQ D;  1LWU A;  1S5L X;  4D6T D;  3RGU A;  1PP9 D;  3SWF A;  1S3J A;  3L72 G;  1AFO A;  3L73 J;  2NPS D;  1IK9 A;  2R3C A;  3M06 A;  4H13 B;  3IN6 A;  1Y47 A;  2XKM A;  3D6Y A;  3IAO A;  1SQQ G;  3MGN A;  1FJK A;  1KB9 H;  1LTS C;  1RE4 C;  1CW5 A;  4HB1 A;  2KIK A;  5GTI E;  5KLV E;  2JKV A;  2WPQ A;  1J1D B;  3V2R A;  3RK2 D;  5B5E H;  4L75 A;  2BCC G;  1BCC E;  2M3E A;  4AYC A;  1EDK A;  1HF9 A;  2XV5 A;  3MIW A;  1YIJ P;  3HD7 D;  1NTM J;  3L4F A;  5TIS E;  1HTL C;  3M91 A;  1YQ3 C;  5E79 E;  2QVA A;  1FC2 C;  3H1J G;  3QWO C;  3PH0 A;  3AED C;  2HFE D;  4HKZ H;  3A0H E;  2OTJ P;  2M8R A;  3FXE A;  5AW0 B;  3TF5 A;  1N7L A;  2KI7 B;  4IOI H;  3AE1 C;  2OYH B;  1VQL P;  1U7M A;  2H8P D;  3L35 A;  3A0B E;  3L74 E;  1FOS F;  5BU8 B;  3L73 G;  3NTN A;  5CBN A;  1BCC J;  3CCM P;  1BE3 E;  3HUS C;  4KHX A;  4EYY Q;  1FZC A;  3AE7 C;  5APV A;  1KFM A;  2QM7 A;  5CCG A;  1XTG B;  1JY2 N;  3VMY A;  1IO4 A;  1KTM A;  2KOG A;  4BWN A;  4GIF A;  1HGZ A;  1J1D C;  5CJ0 A;  5KLV D;  3M9Q A;  1Y9B A;  3U1C A;  1IFM A;  2YKQ A;  4WY4 A;  1PZQ A;  3VTP C;  4BRY B;  5CCH A;  3L71 E;  4RO0 A;  3CCE P;  2OAR A;  1NTM G;  1URQ C;  3FGA D;  1Y8A A;  4JQ0 D;  3PHL A;  3M0D C;  3T97 B;  3L74 J;  3G9R A;  1UIX A;  1SFC C;  3AE5 C;  2A45 G;  2KNC B;  1N73 B;  1S72 P;  1BE3 J;  5CHX A;  2QJK B;  1T2K D;  2E74 C;  3GHG A;  1SQB K;  3MD0 A;  4Y28 J;  1E79 H;  1URQ D;  2P58 A;  3C1L A;  2SPZ A;  3MUD C;  1IFN A;  1BCC G;  1OVR A;  1SQX E;  1L2P A;  4NPD A;  1GW3 A;  1NTM K;  3CXH I;  1VQO P;  5GTI H;  2LXC B;  3L71 J;  2V7Q H;  2IDB A;  4Y99 C;  2Z5I A;  1BE3 D;  3AE6 C;  3BAS A;  1USE A;  1KQF B;  2E74 D;  2ZT9 B;  2IZ0 A;  1WT6 A;  2FY8 A;  1JY3 N;  2KSJ A;  4U7J A;  3V4W A;  4W7Y A;  3WU2 H;  3KYQ A;  5E79 H;  4GOF A;  1YTZ T;  3B5N C;  2B88 A;  4DOJ A;  5APS A;  4UB6 E;  3L71 D;  4QMA A;  1KV4 A;  2OYH A;  1GDT A;  3L74 G;  5L8R J;  1VQ5 P;  1SQV G;  4JF7 A;  3GF7 A;  1Q2N A;  1RF1 B;  1BE3 G;  3KDP B;  3N7N A;  3V2Q A;  1KQL A;  5AVZ B;  3A0B H;  3S4R A;  3L70 E;  4H44 C;  1H0T B;  1ZRT E;  1G2C A;  2QE7 H;  5AW1 B;  2ZYD A;  2CPB A;  1JMM A;  1IFP A;  1ZW0 A;  4GOE A;  1L4A B;  1GD2 E;  1SQX D;  2OYO A;  3L71 G;  1LTJ B;  4LGD E;  4BRY A;  4C46 A;  2JR8 A;  4DT0 A;  3V6I A;  1SQV K;  1FBM A;  1IK7 A;  1S2E A;  4AUW A;  2AEJ A;  3IR9 A;  4ASV A;  3T97 A;  2QIW A;  3CD6 P;  1KIL E;  4GOD A;  1EC5 A;  1WMK A;  1LP1 B;  2KNC A;  4U3F G;  1N73 A;  1GMJ A;  1AQT A;  5AVY B;  1LWU B;  1SQP G;  3L75 J;  4K3A A;  3L70 J;  2JJL A;  2E76 C;  4PV1 D;  1J2J B;  1SS1 A;  1LT9 B;  2YNY A;  5CJ4 A;  4HH2 A;  1PPJ G;  5AW8 B;  1AVY A;  4DZO A;  1L0L E;  1T3U A;  3PRJ A;  1L0N D;  5KJ7 C;  3H1K E;  3RL0 B;  5AVT B;  1DEB A;  1IFI A;  1VF5 B;  2WSE J;  1K05 A;  1FZE A;  2QJY C;  1JCC A;  2KP8 A;  3G4S P;  2WMM A;  2V4H A;  4O9B A;  3PJS K;  2XNX A;  2VRS A;  3H1H D;  2MKV A;  1ZRT D;  4R4M A;  1SQP K;  2NPS B;  1NTK E;  2M3B A;  4OH8 B;  4D6T E;  5AVV B;  4GT1 A;  5KJ7 D;  3RK3 C;  3EWK A;  4RJT A;  1BSN A;  1A02 J;  1YJ9 P;  1QL1 A;  2QJP B;  3CCL P;  1QGK B;  2GM4 A;  1L0L J;  3RK2 B;  2P67 A;  3Q3D A;  1RF1 A;  3H1K J;  1YHQ P;  4H0L B;  4TT3 H;  2ZJS E;  3PLN A;  1J1E C;  1YJW P;  2E75 C;  1Q81 Q;  2FKW B;  1KIL D;  3L75 G;  1LWU C;  3L70 G;  1GL2 A;  3U1A A;  3Q1M A;  4MN4 C;  3VMZ A;  3HD7 B;  1H0T A;  3RK3 D;  1ZV8 A;  2K88 A;  3LW5 J;  2WIT A;  3H1L D;  1DH3 A;  1Z56 A;  3LID A;  2Y0C A;  4DJG A;  2YO3 A;  1NTK J;  1AJY A;  4D6T J;  1EZV I;  4B86 A;  2YIU B;  1HGV A;  1L0L D;  1L4A A;  1GTW A;  1A02 F;  3H1K D;  1K9M Q;  3CPW O;  2E75 D;  2HOD B;  3L36 A;  1LTB C;  2JWA A;  2WSE H;  3KZI H;  3M9H A;  1IC2 A;  3NMD A;  3CXH D;  1LTA C;  1LP1 A;  1Q7Y Q;  3S9O A;  4HYT B;  1SLQ A;  2HR3 A;  1VQ4 P;  1NTK D;  3SFD C;  1NU1 K;  4IFD K;  2WQY C;  2PAJ A;  1BDC A;  2N1T D;  2C0X A;  1VQP P;  1LT9 A;  3EFF K;  5AVQ B;  2JEE A;  4OGQ D;  3CC2 P;  2QJP C;  1MFT A;  5KLI B;  2L5G B;  3H1K G;  1VQ6 P;  2C9N Y;  2FFD B;  4EIJ A;  2WSC H;  3AEG C;  3GHG B;  4LLH A;  1E5W A;  3AE3 C;  2K9Y A;  2QM8 A;  3JSV C;  4I7Z C;  1FZA A;  2WT7 A;  1S4X A;  2FXP A;  1NTK G;  4D6T G;  1PP9 G;  1KYO I;  1RE3 A;  1JO5 A;  2NPS A;  2O01 H;  1FZC C;  2QG4 A;  4C7N B;  2MJZ A;  3LW5 H;  5APT A;  1NWQ A;  3CXH H;  4XE5 B;  5CCG C;  3WU2 E;  1NGM B;  5B66 H;  4NPF X;  1SQQ K;  1JEK A;  2O1K A;  2FYU E;  1EQ7 A;  4WY4 C;  2H43 A;  2FYN B;  3CCJ P;  2A06 E;  2LXB A;  3O6Q B;  2K3R A;  5CCH C;  4JYC A;  1FZF A;  1OVV A;  3WMM 0;  4PJ0 E;  1FZG A;  1H8A A;  4OVN F;  2IBZ I;  5KLV J;  5AW7 B;  2V7Q J;  1CSB A;  1JB0 J;  3HD7 A;  1QX8 A;  1JMB A;  3BCC D;  2M0B A;  1HJB A;  1AQ5 A;  4H13 C;  3RBZ A;  1AV1 A;  1OXZ A;  5K5G B;  3GF3 A;  1HJ0 A;  2W6A A;  3GHG C;  2I1J A;  4ZMD A;  2IYP A;  3CWB D;  3OA7 A;  4JYB A;  2HOD A;  1G2C B;  1RQU A;  5BU5 A;  1NTZ E;  1ZLL A;  2Z4E A;  5DJU B;  1EZV E;  3U59 A;  2PRR A;  2XZR A;  5AW2 B;  2AXC A;  2R44 A;  3V2P A;  1Q82 Q;  3Q5R A; 
#chains in the Genus database with same CATH homology
 5AVZ B;  3HUS B;  3HD7 C;  2HLO A;  3VP9 A;  4I1L A;  5AVR B;  2N1T A;  3CLQ A;  2Q9I A;  5AW4 B;  1YTZ I;  1G2C A;  5AVU B;  1MZ9 A;  3H6P A;  1CI6 A;  5AW1 B;  2CPB A;  1JMM A;  1NKZ B;  2PP6 A;  3BRV B;  1L4A D;  1GK6 A;  4M3L A;  2P2U A;  4W80 A;  1L4A B;  1FDM A;  2FFD A;  1GD2 E;  5KJ7 A;  1L0L K;  1LTJ B;  4EOT A;  1IFD A;  4LGD E;  4C46 A;  4IFM A;  1N7S B;  3I5C A;  1SQV K;  2OYH C;  1JY3 P;  2IPP A;  2R32 A;  1FBM A;  3A2A A;  3VMX A;  1JY3 O;  1URQ B;  2R5D A;  3H32 B;  4AUW A;  1MV8 A;  3LIE A;  3BAT A;  1RF0 C;  3IR9 A;  3T97 A;  1DX7 A;  3UIA A;  3VP8 A;  1SFC D;  1JOC A;  1SFC B;  1MUU A;  3EFG A;  1NAF A;  1N73 A;  5AW6 B;  1NHL A;  5AVY B;  1S9K E;  1LWU B;  3CI9 A;  2WZ7 A;  3VN0 A;  4RES B;  1FZC B;  1NTK K;  1T3J A;  4C7N A;  2JJL A;  2N1T C;  5CCG D;  4N78 E;  2XU6 A;  1J2J B;  2HPC A;  1LTJ A;  1RE4 A;  5AVS B;  1MFZ A;  3NFQ A;  1LT9 B;  3A7O A;  2BAS A;  2YNY A;  5CJ4 A;  1LTT C;  5AW5 B;  4HH2 A;  3VYI A;  1HWT C;  5AW8 B;  2ZXE B;  4DZO A;  1URQ A;  4WY4 D;  1T3U A;  2FFD C;  4WY4 B;  3KPE A;  3N4X A;  2O1J A;  5KJ7 C;  5KLV K;  3RL0 B;  5AVT B;  4XA4 A;  1DEB A;  1IFI A;  3TYY A;  1FZB A;  5CCH D;  1PFI A;  1FZE A;  1G1I A;  1X9V A;  3P7K A;  3P8C D;  1JCC A;  1SVF A;  2KP8 A;  3M0A A;  4Y99 B;  1LWU A;  1NOH A;  1YYC A;  4GKG A;  4O9B A;  2IX7 C;  2XNX A;  2FXM A;  2VRS A;  2WWW A;  3SWF A;  1AFO A;  2YMY A;  2OYI B;  1N73 C;  1SQP K;  2NPS D;  3P32 A;  1HH0 A;  1IK9 A;  2NPS B;  2M3B A;  2R3C A;  3BRT B;  3M06 A;  4OH8 B;  1GL2 B;  5AVV B;  3EQ2 A;  4WB4 A;  4LC1 A;  2XKM A;  4GT1 A;  3MGN A;  1FJK A;  3PP5 A;  5KJ7 D;  1T2K C;  2W6B A;  1JTH A;  3VOP A;  1LTS C;  1RE4 C;  3RK3 C;  1CW5 A;  2IFM A;  3B5N D;  3B5N B;  1A02 J;  1W2E A;  2N9B A;  3II6 A;  1QL1 A;  1N86 A;  2WPQ A;  1ZN5 A;  3V5B A;  1J1D B;  1VPC A;  3V2R A;  3OJA B;  3RK2 D;  2GM4 A;  3B8E B;  3RK2 B;  2GUS A;  3HE4 A;  1H89 A;  2P67 A;  4AYC A;  1RF1 A;  2Q7C A;  1J1E C;  2XV5 A;  3TNU A;  2FYZ A;  2GUV A;  2FKW B;  1FJP A;  1KIL D;  2E42 A;  1LWU C;  1GL2 A;  3MIW A;  3HUS A;  3HD7 D;  3U1A A;  4W7Z A;  1S9K D;  3VMZ A;  3HD7 B;  3L4F A;  2LKM A;  1HTL C;  1M7L A;  1LTG C;  3M91 A;  3RK3 D;  1ZV8 A;  2Q3I A;  2WIT A;  1GZL A;  1DH3 A;  4N78 D;  2P7J A;  1Z56 A;  3LID A;  2A45 H;  4C7R A;  5CMZ A;  1NKN A;  2YO3 A;  5AW3 B;  1JCD A;  2HFE D;  4B86 A;  2M8R A;  1HGV A;  1L4A A;  5AW0 B;  5BVZ A;  1OWA A;  1GTW A;  5APQ A;  1HBW A;  1A02 F;  1N7L A;  2HOD B;  1N7S A;  2KLV A;  3L36 A;  1ZR4 A;  1LTB C;  1VDF A;  2OYH B;  2HG5 D;  3A5T A;  2H8P D;  3L35 A;  2J59 M;  1IFJ A;  1M1J B;  3H32 A;  2WSE H;  1FAV A;  4ZKP A;  1FOS F;  5AVW B;  1RF1 C;  3M0D A;  5BU8 B;  1GU4 A;  1HUC A;  3CL3 D;  3NTN A;  4IFF A;  3P8M C;  3M9H A;  1IC2 A;  1SFC A;  2C9L Y;  3NMD A;  1XTC C;  1LTA C;  5APX A;  3HE5 B;  1GL2 C;  1SP4 A;  4HYT B;  1SLQ A;  3HUS C;  1GW4 A;  1NO4 A;  4KHX A;  1NU1 K;  4IFD K;  3OAK A;  2PAJ A;  2WT7 B;  1FZC A;  5APW A;  2N1T D;  2I1K A;  3V4Q A;  2C0X A;  2N1T B;  5APV A;  1KFM A;  2QM7 A;  2W27 A;  5CCG A;  1XTG B;  1JY2 N;  3VMY A;  3BVH A;  1IO4 A;  3HRN A;  1LT9 A;  2KOG A;  5AVQ B;  1CI6 B;  2JEE A;  1X79 B;  3TSI A;  4GIF A;  1HGZ A;  1J1D C;  2CPS A;  2WSF H;  5CJ0 A;  2L5G B;  3M9Q A;  1CZQ A;  1M1J A;  3U1C A;  1L4A C;  1IFM A;  2YKQ A;  3MUD A;  4WY4 A;  3C9I A;  2FFD B;  2C9N Y;  4EIJ A;  1LTJ C;  2HYN A;  2Q5U A;  2WSC H;  2FYU K;  1GU5 A;  3VTP C;  2P1J A;  1ZR2 A;  3GHG B;  1RY3 A;  4LLH A;  1SQX K;  1N7S C;  5CCH A;  2KYV A;  1E5W A;  2OAR A;  2POH A;  1HVV A;  2QM8 A;  1URQ C;  1G1J A;  3HTK B;  1T8Z A;  3M0D C;  1FZA A;  4I2L C;  2WT7 A;  2WTY A;  1SFC C;  2ZFC A;  2OYI A;  2A45 G;  1N73 B;  1RE3 A;  1JO5 A;  2NPS A;  1KIL B;  4WBA A;  2O01 H;  3IFM A;  1KFN A;  1FZC C;  5CHX A;  4C7N B;  2MJZ A;  3LW5 H;  5APT A;  1NWQ A;  5KTB A;  1T2K D;  4AQR D;  4XE5 B;  2R5B A;  5CCG C;  2HPC B;  1WRG A;  1LT9 C;  3RK3 B;  3GHG A;  1N7S D;  3R2P A;  1SQB K;  2C0W A;  3MD0 A;  3B5N A;  1SQQ K;  3V2N A;  3M9B A;  1KZU B;  1URQ D;  2O1K A;  3E1I A;  1M1J C;  1EQ7 A;  2E43 A;  4WY4 C;  1IFN A;  3HTK A;  2WPS A;  2H43 A;  1NTZ K;  3RL0 C;  5AVX B;  1L0N K;  1GW3 A;  1JY2 P;  1LGH B;  1NTM K;  3NXS A;  4JYC A;  5CCH C;  1N2D C;  1J1E B;  1FZF A;  3TK1 A;  4I6M C;  1JY2 O;  2KB7 P;  3WMM 0;  3L37 A;  1FZG A;  1JNM A;  1H8A A;  1KIL A;  4Y99 C;  2A45 I;  2Z5I A;  5AW7 B;  1QL2 A;  3BAS A;  1CSB A;  1LTI C;  3HD7 A;  1GK4 A;  2OYI C;  1WT6 A;  1RE3 C;  2IFN A;  2NPS C;  1HJB A;  1AQ5 A;  1JY3 N;  2WPR A;  1OXZ A;  2KSJ A;  1NH4 A;  3V4W A;  3G3Z A;  3RL0 D;  4W7Y A;  1FOS E;  2Z5H A;  3KYQ A;  1JTH B;  2W6A A;  5APU A;  3MTU E;  3GHG C;  4ZKU A;  2I1J A;  2XDJ A;  1YTZ T;  3B5N C;  4N6J A;  1X8Y A;  3OA7 A;  4JYB A;  2HOD A;  1G2C B;  4DOJ A;  5AW9 B;  5BU5 A;  5APS A;  5APY A;  1ZLL A;  1H88 A;  2Z4E A;  2J58 A;  2OYH A;  1GDT A;  3U59 A;  2YO2 A;  3RK2 C;  3SWY A;  3A3Y B;  4JF7 A;  2XZR A;  3V2Q A;  2YKO A;  3HE4 B;  5AW2 B;  1RF1 B;  1RF0 A;  1JUN A;  1FU1 A;  3O8Z A;  3P8C E;  4N3Y B;  3TNU B;  2H7H A;  3KQG A;  2YKP A;  1IJD B;  3V2P A;  3KDP B;  1KIL C;  3N7N A;  1GL2 D;  1KQL A;  3HE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...