4LGDE

Structural basis for autoactivation of human mst2 kinase and its regulation by rassf5
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
47
Chain Sequence
VEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase 3
publication title Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 47
sequence length 47
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16517 Nore1-SARAH Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4lgdE00
3B5ND 1KILC 4WY4D 2NPSB 3HD7A 1N7SD 3M0DC 4JF7A 5CCHC 3RK2D 5CCGA 5KJ7D 3HD7C 3VOPA 5CCGC 3TSIA 1SFCD 1JTHB 1L4AB 2KOGA 2N1TD 1GL2D 3KYQA 1JTHA 1L4AA 3RL0B 4N78E 1URQC 1NHLA 1L4AC 2HG5D 3B5NB 4LGDE 1HVVA 2H8PD 2NPSD 1N7SB 3RK3C 3RK2B 1URQB 2XDJA 3B5NA 4WY4A 1KILD 2WZ7A 3RL0C 1N7SA 3RK3B 1SFCB 1URQA 5CCHD 5KJ7A 4OH8B 2M8RA 3B5NC 4W80A 4WY4C 1GL2B 3HTKB 2PP6A 1N7SC 3HD7D 3RK2C 1SFCA 5KJ7C 5CCGD 3PP5A 4WY4B 4W7YA 1GL2A 4W7ZA 1SFCC 1T3JA 2N1TC 1GL2C 2HFED 3P8CE 1URQD 2N1TB 1L4AD 1KILB 2NPSA 1XTGB 3RK3D 2N1TA 1KILA 2NPSC 3HD7B 3RL0D 2YMYA 5CCHA
chains in the Genus database with same CATH superfamily
2HPCA 1HWTC 1KZUB 1JY2O 2FYUE 1N7SD 3M0DC 5AVZB 1Q81Q 1N73A 3H1IE 5AW3B 3WUUA 1P84E 1EXJA 1J1EB 3SFDC 2N9BA 3W67A 4DT0A 3MP7B 1L0NE 4PV1C 3H32A 2DW3A 3WUTA 1IFDA 2QVAA 5CJ0A 3GW6A 4U3FE 5AW5B 2QJKC 5KLVE 1ZV8A 1BGYE 2ZT9C 2NPSD 2CPBA 1Q7YQ 2IFNA 4HJGH 2P1JA 3GLMA 1N7SA 3S1KA 4R4MA 2D2CC 1ZN5A 1SQQG 2IBZI 2QE7H 3AE9C 1OMIA 2BCCE 1IC2A 2IFMA 1IFPA 3PHLA 1NAFA 2KI7B 5B5EH 2M5AB 4R4LA 4IFMA 2KUBA 2NPSA 1AFOA 1KQSO 2W6BA 2C9LY 1JY2P 1SLQA 2B88A 4HKZH 2WSEH 3SWYA 1Q2NA 1ZLLA 1BE3E 3GHGC 2AEFA 3VMYA 2A45H 3NXSA 2CK3H 1KB9I 2WSCH 1IO4A 4CPGA 3CX5E 3IFMA 4D6TE 1GL2D 3D6YA 3TDKA 3HE4A 1PP9E 3V4QA 3H1KG 1LNQA 1UIXA 1PGQA 5GTHE 3L73D 5AVUB 1JY3O 1NTZD 2BEQD 2HODA 5APSA 4XFJA 1L4AC 3L72G 1SQBD 1L0LG 5AVRB 5APYA 3KQGA 2OYHC 2IYOA 3KPEA 3L37A 3O6QB 1PFIA 2E75D 4PD4E 4LLHA 1KILE 2YKOA 4B86A 1GL2A 1QVFO 1OW8A 1SFCC 3O8ZA 1LTBC 2AXTE 2ZAEB 3L35A 3TGUD 3CCSP 1JMMA 4YXWH 2YIUC 1URQD 1LTGC 2R3SA 3H1LJ 3CWBG 1ZW0A 2K9JA 2M3EA 4L75A 3JCUH 5H2FE 1SQQJ 2Q3IA 3H1HG 3IN6A 1K8AQ 4WY4D 3AEDC 2FYNC 3VP9A 2WITA 4I6MC 3CCJP 1PV3A 1FU1A 2ZFCA 2O01J 5BU5A 1SQXK 1LWUC 3MTUE 1X0TA 2K3RA 1P84I 1YITP 1SQPK 1S2EA 3D6ZA 2UWJE 1JOCA 2G3AA 2PGDA 1NTKK 3L70D 4OWFA 5AW4B 3ZDMA 3CLQA 3F89A 4M3LA 4WY4A 2C0WA 2Q5UA 2IBZD 2WZ7A 3RL0C 1XTCC 1RH5B 5APQA 3H1KJ 2IZ1A 1YYCA 4OGQB 1CSBA 3AE2C 2WPSA 1PPJG 1EDKA 2FBWC 2XNDH 2Z5HA 3L72J 1L0LJ 3V2QA 3CL3D 1IK9A 4WBAA 1NTMG 4NPEA 2N1TC 2KB7P 1NTZE 2YMKA 3U1AA 1SQBE 4NPDA 5AW1B 1VQOP 3CXHE 1VQ9P 1X9VA 1BCCG 3RK3D 1CZQA 2M5AA 4GDOA 1KB9D 3HD7B 1YQ3C 1RHZB 1S5LH 3PTZA 4L74A 2B87A 2YO3A 2M3BA 4PJ0H 5AW6B 1OX3A 1MFTA 1SQPE 1FOSF 1BSHA 4UB8H 3CWBJ 4C7NB 2WPVB 2LXCB 1FOSE 2KOGA 2BEZF 3CPWO 3TGUE 1DD4A 2QJYB 1SQVK 3H1HJ 4TLFA 1EZVG 1U7JA 1VF5D 3QH9A 2R44A 4ZKPA 1EDIA 3L75G 3TK1A 1ZP0C 4N78E 1DEEG 2Y0EA 4I7ZB 1EDLA 3L75D 1VPCA 3H32B 4H44B 5E79E 1VQPP 3VP8A 2RMZA 2O01N 3GG2A 1LTSC 1BDDA 3R4YA 1OW7A 2YKQA 1RF0A 3E1IA 1K9MQ 3W68A 4BXLA 3Q5RA 3P8CD 1JO5A 2WSEJ 1YJNP 4PD4I 2W83C 1YJWP 3H1JG 3O6QA 1FZCA 1T3JA 3VMXA 1NH4A 3H1JD 4H0LB 3AE7C 3L74G 2WSCJ 3M91A 1KD1Q 1JCCA 2FYUG 3C9IA 1KILB 3BCCD 1NKZB 2GM4A 2IBZE 2JDIH 2I8DA 1N73C 1D7MA 3H1ID 3RBXA 1H89A 1M1JC 3MUDC 1PIXA 2NPSB 1VQ5P 1P84D 4U3FG 5CCHC 5GTIH 5KLVG 1L0ND 3A3YB 3A0HE 1SQVE 1BGYG 1T8ZA 2AEJA 1BCCJ 4BWNA 1FZFA 4OGQD 4DOJA 2M0BA 1OFCX 1NU1K 1U57A 3WU2E 2MKVA 4DJGA 1KN7A 1MUUA 1OIPA 3HUSC 4HB1A 2H43A 2BASA 3AE4C 1FDMA 2BCCG 2XDJA 2BCCD 1NWQA 2M8RA 3L71J 3A0BH 4W80A 2ZJSE 3HTKB 3HD7D 4IL6E 2J59M 1ZR2A 1N8RQ 2P7JA 2WPQA 1J1DB 1PGOA 2JKVA 2YXRB 4C7RA 3U1CA 1YTZI 2LKMA 4LC1A 3Q5PA 1BE3G 1LGHB 2G8YA 3CCRP 1R5LA 2RKLA 1X79B 1HGZA 3JSVC 2A06G 3LW5H 1G1IA 3P8MC 2ZXXA 3CX5D 1FE6A 4D6TD 2K88A 3HD7A 4PV1B 3L74J 2W8ZA 1PP9D 2FYUJ 1NU1E 3II6A 2ZT9B 3TF5A 4C7NA 2E75B 2OYIA 3I5CA 3BCCE 1KTMA 2W6AA 2IZ0A 4U3FJ 5CBOA 4IL6X 5KLVJ 1IFIA 2QM7A 4H0LD 1KYOE 1ZRTD 5M1BA 1URQB 2K1AA 2OYOA 1E79H 1SVFA 4PD4D 1ZR4A 1M1KQ 1KILD 1VQ7P 3OW2O 2JEEA 1FZEA 2FFDC 2YO2A 3BATA 3RK2C 5KLIC 1A02J 1USEA 4WY4B 1FS0E 1CI6B 2E74D 3HE5B 3MHVA 2I1KA 3PRJA 2WQYC 2WWWA 1IZNB 2GUSA 3P32A 3GHGB 1M7LA 1JUNA 1LTJC 1KILA 4QMAA 1S4XA 4GODA 3CC4P 1AV1A 3IF4A 4A7PA 2RN0A 4RJTA 4RKUJ 1ZXGA 1BE3J 3H1LD 3MD0A 1J1EC 5TJHA 2B87B 2XU6A 1L4AB 2JWAA 2A45I 3OA7A 3AECC 3EWKA 3AE8C 5B66E 2OYHB 3KZIE 1Q82Q 2FXPA 2KSJA 3LIDA 1FJPA 2R32A 1JCDA 1NGMB 2IDBA 1LT1A 5APWA 3L73G 3RK3B 1NTZG 1SFCB 1H8AA 3B5NC 5C39A 3KHUA 1SQBG 4Z1MH 1VQKP 1NO4A 2E76C 5KJ7C 2OARA 2FXMA 2YIUB 2NRGA 3IAOA 4W7YA 4H13C 3HTKA 4ZMDA 3CXHD 4PV1D 1KB9H 3G4SP 3CMEP 1SQQK 2GUVA 1S5LX 2R5DA 2OTKE 3CCVP 1QEXA 2OQQA 1ZRTE 2MJZA 2ZT9D 2OTLP 2WTYA 1RE4A 3A5TA 1SQXD 1FZCB 1W5CE 1VF5B 4AUWA 3QWOC 1PZQA 3FWLA 1VQNP 1SQPD 3TGUG 3M0DA 1R5SA 1LWUB 1YIJP 1NTKD 2V7QH 2D2CD 1SP4A 1T3UA 4JYCA 3CCQP 1HBWA 4BRYB 1X8YA 4UB6E 4N78D 1S3JA 5KAFH 2ZYAA 1FZBA 5AW7B 1WRGA 3RBZA 2K9YA 3RL0B 1HH0A 1QLED 5KAIE 1S9KE 3VYIA 1KYOI 1GD2E 1EQ7A 3H1LE 3V6IA 1L0LK 1URQA 3L70G 2IX7C 1OW6A 2PP6A 3LW5J 3FX0A 1RF1B 3B4SA 1SQQE 4WVZA 4L76A 2IBZG 1IFJA 2XNXA 3NTNA 3GMAA 3L73J 1L4AD 1P84H 3AEEC 1SQBJ 3FWNA 1CI6A 3HE5A 3V5BA 4EOTA 2KK7A 1GK4A 1SQVD 2VRSA 3H25A 3GHGA 1R8EA 1KQGB 3A2AA 5CMZA 1JM0A 5TISE 5CCGC 1AA0A 1SFCD 1EXIA 2QM8A 2Y9YA 3H1KE 3TGUJ 4WWIA 1X22A 1SQXE 1L4AA 4I2LC 3BASA 3L72E 4Y99C 1FZGA 1L0LE 2H8PD 4K35A 2OYHA 2ZXEB 2OYIB 3SSUA 1YQ4C 1NTKE 2C0XA 3AE6C 4ASVA 5AW0B 1AQTA 4C46A 2YKPA 1ZMEC 3V2NA 1H0TB 1SFCA 1DH3A 3BRVB 3B71A 3CMAP 1FBMA 2L5GB 3CX5H 3L70J 1M1JB 1NTMK 1LTIC 4U7JA 3AE1C 3BRTB 4TT3H 1GU5A 2P67A 1E5WA 3H1HE 3OJAB 3M9BA 5GTHH 3RL0D 1BSNA 5APTA 3C8VA 1NU1D 1KFMA 1YHQP 3BCCG 1LWUA 3NFQA 3EFFK 1Y8AA 1NAYA 2QJYC 2ZYDA 2H88C 3TSIA 3H1IG 5B5EE 1JTHB 3AEBC 2Q9IA 2RH0A 3HUSB 2N1TD 2Q7CA 2KZIA 1VQ4P 2KS1B 1LT9B 1L0NG 1KYOD 4PD4H 4BRYA 1T2KC 1NTMJ 1MZ9A 2QJPC 5AVWB 1JB0J 2N9YB 1DX7A 4H44C 2E74B 1LTAC 2AXTH 2FY8A 2LXBA 1OVRA 2H89C 5CHXA 2WT7B 2PAJA 5H2FH 1PPJE 2QRXA 3SWKA 1N7SC 2I1JA 3M06A 3MIWA 2YXQB 2C9NY 3AEAC 1Y47A 2V7QJ 1RF1A 1YJ9P 1RE3A 1Z56A 1JMBA 1OZHA 3MZWB 1VQLP 1K05A 3H6PA 1BCCE 2AEMA 3FXEA 3L75J 3NMDA 2FYUK 2NPSC 3GF7A 3VMAA 4N6JA 1LJ2A 2AXCA 5KTBA 1VDFA 3PH0A 1L2PA 2KLVA 3I55P 5KLVK 1NOHA 4D6TG 3H1JJ 2Q1KA 3L71E 1KORA 5BVZA 3P7KA 3JCUE 1EZVE 2QG4A 1PP9G 3M9HA 5AVTB 3BCCJ 1IJDB 1KMIZ 1GDTA 1HVVA 2FFDB 2QJKB 3RK2B 5KLIB 1IFMA 5EFWB 3H1IJ 3CXHH 2E5TA 2WSFH 3MGNA 5CCHD 1L0NJ 2FKWB 4OH8B 2L91A 3PP5A 4JQ0D 1BGYJ 2D2CB 1H0TA 3FXDA 1GL2C 4IFDK 2KZJA 3L74E 3CCMP 1LTJB 4L73A 4WB4A 2KSEA 3G71P 5CJ4A 5AVXB 3G6EP 1YBKA 4AYCA 3WMM0 1M1JA 3MUDA 3G3ZA 5AVVB 1HJ0A 5CCHA 2BCCJ 1VL2A 5BU8B 2POHA 1DD3A 1CW5A 2KXPB 5K5GB 4KT0J 1PL5A 1S72P 1S1CX 5E79H 1GTWA 2E75C 1G2CB 5KKZC 3FGAD 5L8RJ 2WSSH 1A02F 4K3AA 1S9KD 1JTHA 3H1LG 1U7MA 1N2DC 3HUSA 4GIFA 2KS1A 1LT9A 1S5LE 3LIEA 1URQC 2B89A 3B5NB 4LGDE 1M8OB 3PJSK 1KC8Q 2KLUA 4PJ0E 2E76B 4XA4A 2IPPA 1T6AA 2XV5A 1SQQD 4UB8E 3PLNA 4D6TJ 4H13B 2W6JH 4YTPC 4NPFX 1PP9J 1M90Q 4WY4C 3L4FA 2WT7A 3N7NA 3Q5SA 4W7ZA 1OWAA 1LTTC 1NKNA 4EDFA 3V4WA 3A0HH 2KNCA 3B8EB 2HFED 1RY3A 2HR3A 2HLOA 2A06E 1VQMP 2W90A 1AVYA 4ZNCA 2K37A 2PRRA 3WU2H 1N86A 2V4HA 1MKMA 3Q2YA 1SQXG 1UIIA 4RO0A 4JF7A 1NYHA 3RGUA 3RK2D 3H1KD 3D71A 1SQPG 2FYNB 2JWDA 1RQVA 3EQ2A 3L72D 1NTKG 3Q3DA 3K5BA 1BDCA 1KQLA 1L0LD 5AVSB 5AVYB 4IL6H 1AVOA 2PFXA 1EZVI 3U59A 4I1LA 5AW2B 4N3YB 2R3CA 4YPCA 3HRNA 1W2EA 3RK3C 5GTIE 1Q90D 2W27A 1W2BO 1EC5A 4EYYQ 1GW4A 2OTJP 1AJYA 1JEKA 2Q6QA 2FFDA 2P58A 4JYBA 4EI2A 2E42A 1HUCA 2JJLA 2XKMA 2JR8A 3V2PA 1GW3A 1KFNA 1OVVA 5AW8B 1QL1A 1FC2C 1NTZK 3AEFC 3CWBD 1RF0C 3ITKA 5DJTB 1SQBK 1KQFB 1J2JB 4AQRD 3VTPC 4RESB 3H1HD 1FZCC 1VQ8P 2R5BA 3CD6P 1VF5C 2N1TB 1LTJA 2QIWA 3A0BE 1IK7A 1JY3P 3TYYA 1MFZA 2OGUA 1GZLA 3G9RA 3B5ND 2QA4P 1KYOH 1NTZJ 2E76D 5KJ7D 1QVGO 1M56D 1SQVG 4IFFA 4H13D 5APVA 1TU3F 1JY2N 2KP8A 2WSFJ 1WT6A 4Y99B 2A45G 1GU4A 1G2CA 3E1RA 2KYVA 3L36A 2QSIA 1SQXJ 4JPZB 4HH2A 3JC22 5AW9B 4HYTB 1NJIQ 1SQPJ 4GKGA 1PPJD 1KV4A 2P10A 2CPSA 2P2UA 3B5NA 4DZOA 3L73E 1NTKJ 1IFNA 3GF3A 1LP1B 1RQUA 1RF1C 2WMMA 5KJ7A 1FDIA 5AVQB 1NTMD 1RE3C 1Q86Q 1SS1A 3RL0g 2E43A 2QEXP 1H88A 2Y9ZA 2YNYA 3T97B 2ZYGA 5DJUB 4ASWA 1BCCD 1WMKA 2ZVNB 3AE3C 4OGQC 3N4XA 2O1JA 2O3JA 2IYPA 3S9OA 4IOIH 2H7HA 1QGKB 1N7LA 1XTGB 3TNUB 3R2PA 1USDA 2HPCB 3CX5I 5B66H 3M9QA 2YMYA 3KZIH 3L71G 1HGVA 2NZ2A 1N73B 2FXOA 3IR9A 3V2RA 4YXDC 3CWBE 3L71D 1EZVD 3SWFA 2QJPB 3HD7C 3VOPA 4ZKUA 2JO1A 1NU1G 1NVOA 1QL2A 3CCEP 3KYQA 1QX8A 5APXA 1GK6A 2JP3A 4DCKA 2SPZA 2OYIC 1NHLA 2ZVOB 3EFGA 1G1JA 1OXZA 2Z5IA 1SQVJ 3USSA 1N7SB 1OVUA 1JY3N 2B9BA 2WVRA 1ZOYC 3L70E 3I56P 4I7ZC 2Q3EA 1VQ6P 3BVHA 3L74D 5CCGD 2FYUD 3VN0A 1PGPA 3F5HA 2E5YA 5APUA 4JBZA 1DIPA 1YTZT 3D70A 1PGJA 2J5UA 1MV8A 4UB6H 4GOFA 2WPRA 4U3FD 5KLVD 2N1TA 2KNCB 4H0LC 1BGYD 2O1KA 1EDJA 4EIJA 1NTME 5CBNA 1KILC 1FJKA 5KAIH 3RK3E 1AQ5A 3UIAA 5CCGA 3A7OA 1KB9E 1FDOA 3HE4B 1HF9A 4XE5B 1LT9C 3CC7P 2HODB 2HYNA 3KXDA 2FYZA 3OAKA 2GA1A 4OVNF 2E74C 1DEBA 1FZAA 4GT1A 2HG5D 3VMZA 1L0NK 1YI2P 3Q1MA 3E7KA 3S4RA 3KDPB 1NU1J 2O01H 3CCUP 3AEGC 2XZRA 3L75E 1GL2B 1HTLC 1LP1A 1FAVA 3CXHI 5KAFE 3CI9A 1BE3D 3M0AA 2Y0DA 2ITAA 1GMJA 1M57D 1HJBA 3WUVA 3AE5C 2A06D 1T2KD 1K73Q 3T97A 2K9JB 3P8CE 5TISH 3SFEC 1JNMA 4MN4C 4H44D 2KIKA 3CCLP 2LR2A 3C1LA 1J1DC 4GOEA 2Z4EA 1Y9BA 1K04A 3H1JE 3ABVC 2J58A 4KHXA 1RE4C 4O9BA 4Y28J 2Y0CA 3CC2P 3TNUA 4KJMA 5KKZB
chains in the Genus database with same CATH topology
2HPCA 1M1JC 2NPSB 1HWTC 1KZUB 3A2AA 1JY2O 1N7SD 3M0DC 4JF7A 5CCHC 5CMZA 3RK2D 3A3YB 5AVZB 1T8ZA 1N73A 5CCGC 5AW3B 1SFCD 2QM8A 3EQ2A 1FZFA 1J1EB 2N9BA 4DOJA 1KQLA 5AVSB 5AVYB 3H32A 1L4AA 4I2LC 1IFDA 5AW5B 5CJ0A 3U59A 1NU1K 4I1LA 1ZV8A 5AW2B 4N3YB 3BASA 2R3CA 1MUUA 4Y99C 3HUSC 3HRNA 1FZGA 2H8PD 1W2EA 2NPSD 2H43A 2BASA 2CPBA 3TNUA 2OYHA 3RK3C 2ZXEB 2W27A 2OYIB 1FDMA 1GW4A 2IFNA 2XDJA 2P1JA 2C0XA 5AW0B 2FFDA 4JYBA 4C46A 1N7SA 2E42A 1HUCA 2JJLA 2XKMA 3V2PA 1NWQA 2M8RA 4W80A 2YKPA 1GW3A 3V2NA 3HTKB 1KFNA 3HD7D 5AW8B 2J59M 1SFCA 1ZR2A 1QL1A 1NTZK 2P7JA 1ZN5A 2WPQA 1RF0C 1DH3A 1SQBK 1J1DB 3BRVB 1J2JB 1IC2A 2IFMA 4AQRD 3VTPC 4C7RA 3U1CA 1YTZI 2LKMA 1FBMA 4LC1A 4RESB 1NAFA 1FZCC 2L5GB 1LGHB 2R5BA 2N1TB 1M1JB 1NTMK 4IFMA 1LTJA 2NPSA 1AFOA 1LTIC 2W6BA 1X79B 2C9LY 1HGZA 1JY2P 1SLQA 3LW5H 1GU5A 2P67A 1G1IA 1E5WA 3OJAB 1JY3P 3TYYA 3M9BA 1MFZA 3RL0D 1GZLA 3P8MC 2WSEH 5APTA 1KFMA 3SWYA 3B5ND 1ZLLA 3HD7A 3GHGC 3VMYA 5KJ7D 1LWUA 2A45H 3NFQA 3NXSA 2WSCH 4IFFA 1IO4A 5APVA 3TSIA 1JY2N 2KP8A 1JTHB 3II6A 3IFMA 2Q9IA 1WT6A 4Y99B 3HUSB 2Q7CA 2N1TD 1GL2D 2A45G 3HE4A 1GU4A 4C7NA 1LT9B 3V4QA 1G2CA 2OYIA 3I5CA 1T2KC 2KYVA 3L36A 1MZ9A 5AVWB 2W6AA 5AVUB 1JY3O 1DX7A 5APSA 2HODA 4HH2A 1L4AC 5AW9B 4HYTB 1IFIA 2QM7A 1LTAC 4GKGA 2CPSA 1URQB 5AVRB 2P2UA 1SVFA 5APYA 3B5NA 4DZOA 3KQGA 1ZR4A 1KILD 1IFNA 2OYHC 5CHXA 1RF1C 2WT7B 5KJ7A 2JEEA 5AVQB 2PAJA 1RE3C 1FZEA 2FFDC 2YO2A 3KPEA 2E43A 1N7SC 3BATA 3L37A 2I1JA 3RK2C 1H88A 1PFIA 3M06A 3MIWA 1A02J 2YNYA 2C9NY 4LLHA 2YKOA 4WY4B 4B86A 1GL2A 1SFCC 3O8ZA 1RF1A 1LTBC 1RE3A 1Z56A 3N4XA 1CI6B 3L35A 3HE5B 2O1JA 2I1KA 1JMMA 1URQD 1LTGC 3H6PA 2WWWA 2H7HA 2GUSA 1N7LA 1XTGB 3P32A 3TNUB 3NMDA 3GHGB 3R2PA 1M7LA 2HPCB 1JUNA 2FYUK 1LTJC 1KILA 2NPSC 2Q3IA 3M9QA 2YMYA 4N6JA 1HGVA 4WY4D 1N73B 3VP9A 2WITA 3IR9A 3V2RA 5KTBA 1VDFA 4I6MC 2KLVA 1J1EC 3MD0A 1FU1A 3SWFA 2ZFCA 3HD7C 3VOPA 5BU5A 1SQXK 4ZKUA 1LWUC 3MTUE 2XU6A 1QL2A 5KLVK 1L4AB 1NOHA 2A45I 3OA7A 3KYQA 5BVZA 1SQPK 3P7KA 5APXA 1GK6A 1JOCA 3M9HA 5AVTB 1NTKK 2OYHB 2OYIC 1IJDB 2KSJA 1NHLA 3LIDA 1GDTA 3EFGA 1HVVA 1G1JA 1OXZA 2Z5IA 2FFDB 1FJPA 5AW4B 2R32A 1JCDA 1N7SB 3RK2B 1IFMA 1JY3N 3CLQA 4M3LA 4WY4A 2C0WA 2Q5UA 2WZ7A 5APWA 3RL0C 3RK3B 1XTCC 1SFCB 2WSFH 5APQA 3MGNA 5CCHD 1H8AA 4OH8B 2FKWB 3B5NC 1YYCA 1CSBA 1NO4A 2WPSA 3BVHA 5KJ7C 5CCGD 3PP5A 2OARA 2FXMA 2Z5HA 4W7YA 3HTKA 3VN0A 3V2QA 3CL3D 1IK9A 4WBAA 5APUA 2N1TC 1GL2C 4IFDK 2KB7P 1LTJB 1SQQK 1YTZT 4WB4A 3U1AA 1MV8A 2GUVA 2R5DA 5AW1B 2MJZA 2WTYA 1RE4A 3A5TA 2WPRA 5CJ4A 5AVXB 1X9VA 3RK3D 1CZQA 1FZCB 4AYCA 4AUWA 2N1TA 3WMM0 1M1JA 3MUDA 2O1KA 3G3ZA 3HD7B 5AVVB 4EIJA 3M0DA 5CCHA 1LWUB 5BU8B 1KILC 2POHA 1FJKA 2YO3A 1CW5A 2M3BA 1AQ5A 1SP4A 3UIAA 5AW6B 5CCGA 3A7OA 1T3UA 1FOSF 4JYCA 3HE4B 4XE5B 4C7NB 1GTWA 1HBWA 1LT9C 1G2CB 1FOSE 1X8YA 4N78D 2KOGA 1SQVK 1A02F 1S9KD 1FZBA 2HODB 5AW7B 1WRGA 1JTHA 2HYNA 3OAKA 2FYZA 1N2DC 3HUSA 4GIFA 4ZKPA 3TK1A 3RL0B 1DEBA 1LT9A 4N78E 1HH0A 3LIEA 1URQC 1FZAA 4GT1A 2HG5D 3B5NB 1L0NK 4LGDE 3VMZA 1S9KE 3VYIA 1VPCA 3H32B 4XA4A 2IPPA 3KDPB 1GD2E 2O01H 2XV5A 3VP8A 1LTSC 1EQ7A 2XZRA 1L0LK 1URQA 4WY4C 2IX7C 1GL2B 1HTLC 2YKQA 2PP6A 1RF0A 3E1IA 1FAVA 3L4FA 3CI9A 3P8CD 2WT7A 1RF1B 1JO5A 3M0AA 3N7NA 4W7ZA 1IFJA 1HJBA 1OWAA 1LTTC 2XNXA 1NKNA 1FZCA 3V4WA 1T3JA 1T2KD 3VMXA 1NH4A 3B8EB 3T97A 2HFED 3P8CE 3NTNA 3M91A 1RY3A 1JNMA 1JCCA 1L4AD 3C9IA 1KILB 1J1DC 1CI6A 3HE5A 2HLOA 3V5BA 2Z4EA 4EOTA 1NKZB 2J58A 4KHXA 2GM4A 1GK4A 1RE4C 4O9BA 1N73C 2VRSA 1N86A 3BRTB 3GHGA 1H89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B5N D;  1KIL C;  4WY4 D;  2NPS B;  3HD7 A;  1N7S D;  3M0D C;  4JF7 A;  5CCH C;  3RK2 D;  5CCG A;  5KJ7 D;  3HD7 C;  3VOP A;  5CCG C;  3TSI A;  1SFC D;  1JTH B;  1L4A B;  2KOG A;  2N1T D;  1GL2 D;  3KYQ A;  1JTH A;  1L4A A;  3RL0 B;  4N78 E;  1URQ C;  1NHL A;  1L4A C;  2HG5 D;  3B5N B;  4LGD E;  1HVV A;  2H8P D;  2NPS D;  1N7S B;  3RK3 C;  3RK2 B;  1URQ B;  2XDJ A;  3B5N A;  4WY4 A;  1KIL D;  2WZ7 A;  3RL0 C;  1N7S A;  3RK3 B;  1SFC B;  1URQ A;  5CCH D;  5KJ7 A;  4OH8 B;  2M8R A;  3B5N C;  4W80 A;  4WY4 C;  1GL2 B;  3HTK B;  2PP6 A;  1N7S C;  3HD7 D;  3RK2 C;  1SFC A;  5KJ7 C;  5CCG D;  3PP5 A;  4WY4 B;  4W7Y A;  1GL2 A;  4W7Z A;  1SFC C;  1T3J A;  2N1T C;  1GL2 C;  2HFE D;  3P8C E;  1URQ D;  2N1T B;  1L4A D;  1KIL B;  2NPS A;  1XTG B;  3RK3 D;  2N1T A;  1KIL A;  2NPS C;  3HD7 B;  3RL0 D;  2YMY A;  5CCH A; 
#chains in the Genus database with same CATH topology
 2HPC A;  1HWT C;  1KZU B;  1JY2 O;  2FYU E;  1N7S D;  3M0D C;  5AVZ B;  1Q81 Q;  1N73 A;  3H1I E;  5AW3 B;  3WUU A;  1P84 E;  1EXJ A;  1J1E B;  3SFD C;  2N9B A;  3W67 A;  4DT0 A;  3MP7 B;  1L0N E;  4PV1 C;  3H32 A;  2DW3 A;  3WUT A;  1IFD A;  2QVA A;  5CJ0 A;  3GW6 A;  4U3F E;  5AW5 B;  2QJK C;  5KLV E;  1ZV8 A;  1BGY E;  2ZT9 C;  2NPS D;  2CPB A;  1Q7Y Q;  2IFN A;  4HJG H;  2P1J A;  3GLM A;  1N7S A;  3S1K A;  4R4M A;  2D2C C;  1ZN5 A;  1SQQ G;  2IBZ I;  2QE7 H;  3AE9 C;  1OMI A;  2BCC E;  1IC2 A;  2IFM A;  1IFP A;  3PHL A;  1NAF A;  2KI7 B;  5B5E H;  2M5A B;  4R4L A;  4IFM A;  2KUB A;  2NPS A;  1AFO A;  1KQS O;  2W6B A;  2C9L Y;  1JY2 P;  1SLQ A;  2B88 A;  4HKZ H;  2WSE H;  3SWY A;  1Q2N A;  1ZLL A;  1BE3 E;  3GHG C;  2AEF A;  3VMY A;  2A45 H;  3NXS A;  2CK3 H;  1KB9 I;  2WSC H;  1IO4 A;  4CPG A;  3CX5 E;  3IFM A;  4D6T E;  1GL2 D;  3D6Y A;  3TDK A;  3HE4 A;  1PP9 E;  3V4Q A;  3H1K G;  1LNQ A;  1UIX A;  1PGQ A;  5GTH E;  3L73 D;  5AVU B;  1JY3 O;  1NTZ D;  2BEQ D;  2HOD A;  5APS A;  4XFJ A;  1L4A C;  3L72 G;  1SQB D;  1L0L G;  5AVR B;  5APY A;  3KQG A;  2OYH C;  2IYO A;  3KPE A;  3L37 A;  3O6Q B;  1PFI A;  2E75 D;  4PD4 E;  4LLH A;  1KIL E;  2YKO A;  4B86 A;  1GL2 A;  1QVF O;  1OW8 A;  1SFC C;  3O8Z A;  1LTB C;  2AXT E;  2ZAE B;  3L35 A;  3TGU D;  3CCS P;  1JMM A;  4YXW H;  2YIU C;  1URQ D;  1LTG C;  2R3S A;  3H1L J;  3CWB G;  1ZW0 A;  2K9J A;  2M3E A;  4L75 A;  3JCU H;  5H2F E;  1SQQ J;  2Q3I A;  3H1H G;  3IN6 A;  1K8A Q;  4WY4 D;  3AED C;  2FYN C;  3VP9 A;  2WIT A;  4I6M C;  3CCJ P;  1PV3 A;  1FU1 A;  2ZFC A;  2O01 J;  5BU5 A;  1SQX K;  1LWU C;  3MTU E;  1X0T A;  2K3R A;  1P84 I;  1YIT P;  1SQP K;  1S2E A;  3D6Z A;  2UWJ E;  1JOC A;  2G3A A;  2PGD A;  1NTK K;  3L70 D;  4OWF A;  5AW4 B;  3ZDM A;  3CLQ A;  3F89 A;  4M3L A;  4WY4 A;  2C0W A;  2Q5U A;  2IBZ D;  2WZ7 A;  3RL0 C;  1XTC C;  1RH5 B;  5APQ A;  3H1K J;  2IZ1 A;  1YYC A;  4OGQ B;  1CSB A;  3AE2 C;  2WPS A;  1PPJ G;  1EDK A;  2FBW C;  2XND H;  2Z5H A;  3L72 J;  1L0L J;  3V2Q A;  3CL3 D;  1IK9 A;  4WBA A;  1NTM G;  4NPE A;  2N1T C;  2KB7 P;  1NTZ E;  2YMK A;  3U1A A;  1SQB E;  4NPD A;  5AW1 B;  1VQO P;  3CXH E;  1VQ9 P;  1X9V A;  1BCC G;  3RK3 D;  1CZQ A;  2M5A A;  4GDO A;  1KB9 D;  3HD7 B;  1YQ3 C;  1RHZ B;  1S5L H;  3PTZ A;  4L74 A;  2B87 A;  2YO3 A;  2M3B A;  4PJ0 H;  5AW6 B;  1OX3 A;  1MFT A;  1SQP E;  1FOS F;  1BSH A;  4UB8 H;  3CWB J;  4C7N B;  2WPV B;  2LXC B;  1FOS E;  2KOG A;  2BEZ F;  3CPW O;  3TGU E;  1DD4 A;  2QJY B;  1SQV K;  3H1H J;  4TLF A;  1EZV G;  1U7J A;  1VF5 D;  3QH9 A;  2R44 A;  4ZKP A;  1EDI A;  3L75 G;  3TK1 A;  1ZP0 C;  4N78 E;  1DEE G;  2Y0E A;  4I7Z B;  1EDL A;  3L75 D;  1VPC A;  3H32 B;  4H44 B;  5E79 E;  1VQP P;  3VP8 A;  2RMZ A;  2O01 N;  3GG2 A;  1LTS C;  1BDD A;  3R4Y A;  1OW7 A;  2YKQ A;  1RF0 A;  3E1I A;  1K9M Q;  3W68 A;  4BXL A;  3Q5R A;  3P8C D;  1JO5 A;  2WSE J;  1YJN P;  4PD4 I;  2W83 C;  1YJW P;  3H1J G;  3O6Q A;  1FZC A;  1T3J A;  3VMX A;  1NH4 A;  3H1J D;  4H0L B;  3AE7 C;  3L74 G;  2WSC J;  3M91 A;  1KD1 Q;  1JCC A;  2FYU G;  3C9I A;  1KIL B;  3BCC D;  1NKZ B;  2GM4 A;  2IBZ E;  2JDI H;  2I8D A;  1N73 C;  1D7M A;  3H1I D;  3RBX A;  1H89 A;  1M1J C;  3MUD C;  1PIX A;  2NPS B;  1VQ5 P;  1P84 D;  4U3F G;  5CCH C;  5GTI H;  5KLV G;  1L0N D;  3A3Y B;  3A0H E;  1SQV E;  1BGY G;  1T8Z A;  2AEJ A;  1BCC J;  4BWN A;  1FZF A;  4OGQ D;  4DOJ A;  2M0B A;  1OFC X;  1NU1 K;  1U57 A;  3WU2 E;  2MKV A;  4DJG A;  1KN7 A;  1MUU A;  1OIP A;  3HUS C;  4HB1 A;  2H43 A;  2BAS A;  3AE4 C;  1FDM A;  2BCC G;  2XDJ A;  2BCC D;  1NWQ A;  2M8R A;  3L71 J;  3A0B H;  4W80 A;  2ZJS E;  3HTK B;  3HD7 D;  4IL6 E;  2J59 M;  1ZR2 A;  1N8R Q;  2P7J A;  2WPQ A;  1J1D B;  1PGO A;  2JKV A;  2YXR B;  4C7R A;  3U1C A;  1YTZ I;  2LKM A;  4LC1 A;  3Q5P A;  1BE3 G;  1LGH B;  2G8Y A;  3CCR P;  1R5L A;  2RKL A;  1X79 B;  1HGZ A;  3JSV C;  2A06 G;  3LW5 H;  1G1I A;  3P8M C;  2ZXX A;  3CX5 D;  1FE6 A;  4D6T D;  2K88 A;  3HD7 A;  4PV1 B;  3L74 J;  2W8Z A;  1PP9 D;  2FYU J;  1NU1 E;  3II6 A;  2ZT9 B;  3TF5 A;  4C7N A;  2E75 B;  2OYI A;  3I5C A;  3BCC E;  1KTM A;  2W6A A;  2IZ0 A;  4U3F J;  5CBO A;  4IL6 X;  5KLV J;  1IFI A;  2QM7 A;  4H0L D;  1KYO E;  1ZRT D;  5M1B A;  1URQ B;  2K1A A;  2OYO A;  1E79 H;  1SVF A;  4PD4 D;  1ZR4 A;  1M1K Q;  1KIL D;  1VQ7 P;  3OW2 O;  2JEE A;  1FZE A;  2FFD C;  2YO2 A;  3BAT A;  3RK2 C;  5KLI C;  1A02 J;  1USE A;  4WY4 B;  1FS0 E;  1CI6 B;  2E74 D;  3HE5 B;  3MHV A;  2I1K A;  3PRJ A;  2WQY C;  2WWW A;  1IZN B;  2GUS A;  3P32 A;  3GHG B;  1M7L A;  1JUN A;  1LTJ C;  1KIL A;  4QMA A;  1S4X A;  4GOD A;  3CC4 P;  1AV1 A;  3IF4 A;  4A7P A;  2RN0 A;  4RJT A;  4RKU J;  1ZXG A;  1BE3 J;  3H1L D;  3MD0 A;  1J1E C;  5TJH A;  2B87 B;  2XU6 A;  1L4A B;  2JWA A;  2A45 I;  3OA7 A;  3AEC C;  3EWK A;  3AE8 C;  5B66 E;  2OYH B;  3KZI E;  1Q82 Q;  2FXP A;  2KSJ A;  3LID A;  1FJP A;  2R32 A;  1JCD A;  1NGM B;  2IDB A;  1LT1 A;  5APW A;  3L73 G;  3RK3 B;  1NTZ G;  1SFC B;  1H8A A;  3B5N C;  5C39 A;  3KHU A;  1SQB G;  4Z1M H;  1VQK P;  1NO4 A;  2E76 C;  5KJ7 C;  2OAR A;  2FXM A;  2YIU B;  2NRG A;  3IAO A;  4W7Y A;  4H13 C;  3HTK A;  4ZMD A;  3CXH D;  4PV1 D;  1KB9 H;  3G4S P;  3CME P;  1SQQ K;  2GUV A;  1S5L X;  2R5D A;  2OTK E;  3CCV P;  1QEX A;  2OQQ A;  1ZRT E;  2MJZ A;  2ZT9 D;  2OTL P;  2WTY A;  1RE4 A;  3A5T A;  1SQX D;  1FZC B;  1W5C E;  1VF5 B;  4AUW A;  3QWO C;  1PZQ A;  3FWL A;  1VQN P;  1SQP D;  3TGU G;  3M0D A;  1R5S A;  1LWU B;  1YIJ P;  1NTK D;  2V7Q H;  2D2C D;  1SP4 A;  1T3U A;  4JYC A;  3CCQ P;  1HBW A;  4BRY B;  1X8Y A;  4UB6 E;  4N78 D;  1S3J A;  5KAF H;  2ZYA A;  1FZB A;  5AW7 B;  1WRG A;  3RBZ A;  2K9Y A;  3RL0 B;  1HH0 A;  1QLE D;  5KAI E;  1S9K E;  3VYI A;  1KYO I;  1GD2 E;  1EQ7 A;  3H1L E;  3V6I A;  1L0L K;  1URQ A;  3L70 G;  2IX7 C;  1OW6 A;  2PP6 A;  3LW5 J;  3FX0 A;  1RF1 B;  3B4S A;  1SQQ E;  4WVZ A;  4L76 A;  2IBZ G;  1IFJ A;  2XNX A;  3NTN A;  3GMA A;  3L73 J;  1L4A D;  1P84 H;  3AEE C;  1SQB J;  3FWN A;  1CI6 A;  3HE5 A;  3V5B A;  4EOT A;  2KK7 A;  1GK4 A;  1SQV D;  2VRS A;  3H25 A;  3GHG A;  1R8E A;  1KQG B;  3A2A A;  5CMZ A;  1JM0 A;  5TIS E;  5CCG C;  1AA0 A;  1SFC D;  1EXI A;  2QM8 A;  2Y9Y A;  3H1K E;  3TGU J;  4WWI A;  1X22 A;  1SQX E;  1L4A A;  4I2L C;  3BAS A;  3L72 E;  4Y99 C;  1FZG A;  1L0L E;  2H8P D;  4K35 A;  2OYH A;  2ZXE B;  2OYI B;  3SSU A;  1YQ4 C;  1NTK E;  2C0X A;  3AE6 C;  4ASV A;  5AW0 B;  1AQT A;  4C46 A;  2YKP A;  1ZME C;  3V2N A;  1H0T B;  1SFC A;  1DH3 A;  3BRV B;  3B71 A;  3CMA P;  1FBM A;  2L5G B;  3CX5 H;  3L70 J;  1M1J B;  1NTM K;  1LTI C;  4U7J A;  3AE1 C;  3BRT B;  4TT3 H;  1GU5 A;  2P67 A;  1E5W A;  3H1H E;  3OJA B;  3M9B A;  5GTH H;  3RL0 D;  1BSN A;  5APT A;  3C8V A;  1NU1 D;  1KFM A;  1YHQ P;  3BCC G;  1LWU A;  3NFQ A;  3EFF K;  1Y8A A;  1NAY A;  2QJY C;  2ZYD A;  2H88 C;  3TSI A;  3H1I G;  5B5E E;  1JTH B;  3AEB C;  2Q9I A;  2RH0 A;  3HUS B;  2N1T D;  2Q7C A;  2KZI A;  1VQ4 P;  2KS1 B;  1LT9 B;  1L0N G;  1KYO D;  4PD4 H;  4BRY A;  1T2K C;  1NTM J;  1MZ9 A;  2QJP C;  5AVW B;  1JB0 J;  2N9Y B;  1DX7 A;  4H44 C;  2E74 B;  1LTA C;  2AXT H;  2FY8 A;  2LXB A;  1OVR A;  2H89 C;  5CHX A;  2WT7 B;  2PAJ A;  5H2F H;  1PPJ E;  2QRX A;  3SWK A;  1N7S C;  2I1J A;  3M06 A;  3MIW A;  2YXQ B;  2C9N Y;  3AEA C;  1Y47 A;  2V7Q J;  1RF1 A;  1YJ9 P;  1RE3 A;  1Z56 A;  1JMB A;  1OZH A;  3MZW B;  1VQL P;  1K05 A;  3H6P A;  1BCC E;  2AEM A;  3FXE A;  3L75 J;  3NMD A;  2FYU K;  2NPS C;  3GF7 A;  3VMA A;  4N6J A;  1LJ2 A;  2AXC A;  5KTB A;  1VDF A;  3PH0 A;  1L2P A;  2KLV A;  3I55 P;  5KLV K;  1NOH A;  4D6T G;  3H1J J;  2Q1K A;  3L71 E;  1KOR A;  5BVZ A;  3P7K A;  3JCU E;  1EZV E;  2QG4 A;  1PP9 G;  3M9H A;  5AVT B;  3BCC J;  1IJD B;  1KMI Z;  1GDT A;  1HVV A;  2FFD B;  2QJK B;  3RK2 B;  5KLI B;  1IFM A;  5EFW B;  3H1I J;  3CXH H;  2E5T A;  2WSF H;  3MGN A;  5CCH D;  1L0N J;  2FKW B;  4OH8 B;  2L91 A;  3PP5 A;  4JQ0 D;  1BGY J;  2D2C B;  1H0T A;  3FXD A;  1GL2 C;  4IFD K;  2KZJ A;  3L74 E;  3CCM P;  1LTJ B;  4L73 A;  4WB4 A;  2KSE A;  3G71 P;  5CJ4 A;  5AVX B;  3G6E P;  1YBK A;  4AYC A;  3WMM 0;  1M1J A;  3MUD A;  3G3Z A;  5AVV B;  1HJ0 A;  5CCH A;  2BCC J;  1VL2 A;  5BU8 B;  2POH A;  1DD3 A;  1CW5 A;  2KXP B;  5K5G B;  4KT0 J;  1PL5 A;  1S72 P;  1S1C X;  5E79 H;  1GTW A;  2E75 C;  1G2C B;  5KKZ C;  3FGA D;  5L8R J;  2WSS H;  1A02 F;  4K3A A;  1S9K D;  1JTH A;  3H1L G;  1U7M A;  1N2D C;  3HUS A;  4GIF A;  2KS1 A;  1LT9 A;  1S5L E;  3LIE A;  1URQ C;  2B89 A;  3B5N B;  4LGD E;  1M8O B;  3PJS K;  1KC8 Q;  2KLU A;  4PJ0 E;  2E76 B;  4XA4 A;  2IPP A;  1T6A A;  2XV5 A;  1SQQ D;  4UB8 E;  3PLN A;  4D6T J;  4H13 B;  2W6J H;  4YTP C;  4NPF X;  1PP9 J;  1M90 Q;  4WY4 C;  3L4F A;  2WT7 A;  3N7N A;  3Q5S A;  4W7Z A;  1OWA A;  1LTT C;  1NKN A;  4EDF A;  3V4W A;  3A0H H;  2KNC A;  3B8E B;  2HFE D;  1RY3 A;  2HR3 A;  2HLO A;  2A06 E;  1VQM P;  2W90 A;  1AVY A;  4ZNC A;  2K37 A;  2PRR A;  3WU2 H;  1N86 A;  2V4H A;  1MKM A;  3Q2Y A;  1SQX G;  1UII A;  4RO0 A;  4JF7 A;  1NYH A;  3RGU A;  3RK2 D;  3H1K D;  3D71 A;  1SQP G;  2FYN B;  2JWD A;  1RQV A;  3EQ2 A;  3L72 D;  1NTK G;  3Q3D A;  3K5B A;  1BDC A;  1KQL A;  1L0L D;  5AVS B;  5AVY B;  4IL6 H;  1AVO A;  2PFX A;  1EZV I;  3U59 A;  4I1L A;  5AW2 B;  4N3Y B;  2R3C A;  4YPC A;  3HRN A;  1W2E A;  3RK3 C;  5GTI E;  1Q90 D;  2W27 A;  1W2B O;  1EC5 A;  4EYY Q;  1GW4 A;  2OTJ P;  1AJY A;  1JEK A;  2Q6Q A;  2FFD A;  2P58 A;  4JYB A;  4EI2 A;  2E42 A;  1HUC A;  2JJL A;  2XKM A;  2JR8 A;  3V2P A;  1GW3 A;  1KFN A;  1OVV A;  5AW8 B;  1QL1 A;  1FC2 C;  1NTZ K;  3AEF C;  3CWB D;  1RF0 C;  3ITK A;  5DJT B;  1SQB K;  1KQF B;  1J2J B;  4AQR D;  3VTP C;  4RES B;  3H1H D;  1FZC C;  1VQ8 P;  2R5B A;  3CD6 P;  1VF5 C;  2N1T B;  1LTJ A;  2QIW A;  3A0B E;  1IK7 A;  1JY3 P;  3TYY A;  1MFZ A;  2OGU A;  1GZL A;  3G9R A;  3B5N D;  2QA4 P;  1KYO H;  1NTZ J;  2E76 D;  5KJ7 D;  1QVG O;  1M56 D;  1SQV G;  4IFF A;  4H13 D;  5APV A;  1TU3 F;  1JY2 N;  2KP8 A;  2WSF J;  1WT6 A;  4Y99 B;  2A45 G;  1GU4 A;  1G2C A;  3E1R A;  2KYV A;  3L36 A;  2QSI A;  1SQX J;  4JPZ B;  4HH2 A;  3JC2 2;  5AW9 B;  4HYT B;  1NJI Q;  1SQP J;  4GKG A;  1PPJ D;  1KV4 A;  2P10 A;  2CPS A;  2P2U A;  3B5N A;  4DZO A;  3L73 E;  1NTK J;  1IFN A;  3GF3 A;  1LP1 B;  1RQU A;  1RF1 C;  2WMM A;  5KJ7 A;  1FDI A;  5AVQ B;  1NTM D;  1RE3 C;  1Q86 Q;  1SS1 A;  3RL0 g;  2E43 A;  2QEX P;  1H88 A;  2Y9Z A;  2YNY A;  3T97 B;  2ZYG A;  5DJU B;  4ASW A;  1BCC D;  1WMK A;  2ZVN B;  3AE3 C;  4OGQ C;  3N4X A;  2O1J A;  2O3J A;  2IYP A;  3S9O A;  4IOI H;  2H7H A;  1QGK B;  1N7L A;  1XTG B;  3TNU B;  3R2P A;  1USD A;  2HPC B;  3CX5 I;  5B66 H;  3M9Q A;  2YMY A;  3KZI H;  3L71 G;  1HGV A;  2NZ2 A;  1N73 B;  2FXO A;  3IR9 A;  3V2R A;  4YXD C;  3CWB E;  3L71 D;  1EZV D;  3SWF A;  2QJP B;  3HD7 C;  3VOP A;  4ZKU A;  2JO1 A;  1NU1 G;  1NVO A;  1QL2 A;  3CCE P;  3KYQ A;  1QX8 A;  5APX A;  1GK6 A;  2JP3 A;  4DCK A;  2SPZ A;  2OYI C;  1NHL A;  2ZVO B;  3EFG A;  1G1J A;  1OXZ A;  2Z5I A;  1SQV J;  3USS A;  1N7S B;  1OVU A;  1JY3 N;  2B9B A;  2WVR A;  1ZOY C;  3L70 E;  3I56 P;  4I7Z C;  2Q3E A;  1VQ6 P;  3BVH A;  3L74 D;  5CCG D;  2FYU D;  3VN0 A;  1PGP A;  3F5H A;  2E5Y A;  5APU A;  4JBZ A;  1DIP A;  1YTZ T;  3D70 A;  1PGJ A;  2J5U A;  1MV8 A;  4UB6 H;  4GOF A;  2WPR A;  4U3F D;  5KLV D;  2N1T A;  2KNC B;  4H0L C;  1BGY D;  2O1K A;  1EDJ A;  4EIJ A;  1NTM E;  5CBN A;  1KIL C;  1FJK A;  5KAI H;  3RK3 E;  1AQ5 A;  3UIA A;  5CCG A;  3A7O A;  1KB9 E;  1FDO A;  3HE4 B;  1HF9 A;  4XE5 B;  1LT9 C;  3CC7 P;  2HOD B;  2HYN A;  3KXD A;  2FYZ A;  3OAK A;  2GA1 A;  4OVN F;  2E74 C;  1DEB A;  1FZA A;  4GT1 A;  2HG5 D;  3VMZ A;  1L0N K;  1YI2 P;  3Q1M A;  3E7K A;  3S4R A;  3KDP B;  1NU1 J;  2O01 H;  3CCU P;  3AEG C;  2XZR A;  3L75 E;  1GL2 B;  1HTL C;  1LP1 A;  1FAV A;  3CXH I;  5KAF E;  3CI9 A;  1BE3 D;  3M0A A;  2Y0D A;  2ITA A;  1GMJ A;  1M57 D;  1HJB A;  3WUV A;  3AE5 C;  2A06 D;  1T2K D;  1K73 Q;  3T97 A;  2K9J B;  3P8C E;  5TIS H;  3SFE C;  1JNM A;  4MN4 C;  4H44 D;  2KIK A;  3CCL P;  2LR2 A;  3C1L A;  1J1D C;  4GOE A;  2Z4E A;  1Y9B A;  1K04 A;  3H1J E;  3ABV C;  2J58 A;  4KHX A;  1RE4 C;  4O9B A;  4Y28 J;  2Y0C A;  3CC2 P;  3TNU A;  4KJM A;  5KKZ B; 
#chains in the Genus database with same CATH homology
 2HPC A;  1M1J C;  2NPS B;  1HWT C;  1KZU B;  3A2A A;  1JY2 O;  1N7S D;  3M0D C;  4JF7 A;  5CCH C;  5CMZ A;  3RK2 D;  3A3Y B;  5AVZ B;  1T8Z A;  1N73 A;  5CCG C;  5AW3 B;  1SFC D;  2QM8 A;  3EQ2 A;  1FZF A;  1J1E B;  2N9B A;  4DOJ A;  1KQL A;  5AVS B;  5AVY B;  3H32 A;  1L4A A;  4I2L C;  1IFD A;  5AW5 B;  5CJ0 A;  3U59 A;  1NU1 K;  4I1L A;  1ZV8 A;  5AW2 B;  4N3Y B;  3BAS A;  2R3C A;  1MUU A;  4Y99 C;  3HUS C;  3HRN A;  1FZG A;  2H8P D;  1W2E A;  2NPS D;  2H43 A;  2BAS A;  2CPB A;  3TNU A;  2OYH A;  3RK3 C;  2ZXE B;  2W27 A;  2OYI B;  1FDM A;  1GW4 A;  2IFN A;  2XDJ A;  2P1J A;  2C0X A;  5AW0 B;  2FFD A;  4JYB A;  4C46 A;  1N7S A;  2E42 A;  1HUC A;  2JJL A;  2XKM A;  3V2P A;  1NWQ A;  2M8R A;  4W80 A;  2YKP A;  1GW3 A;  3V2N A;  3HTK B;  1KFN A;  3HD7 D;  5AW8 B;  2J59 M;  1SFC A;  1ZR2 A;  1QL1 A;  1NTZ K;  2P7J A;  1ZN5 A;  2WPQ A;  1RF0 C;  1DH3 A;  1SQB K;  1J1D B;  3BRV B;  1J2J B;  1IC2 A;  2IFM A;  4AQR D;  3VTP C;  4C7R A;  3U1C A;  1YTZ I;  2LKM A;  1FBM A;  4LC1 A;  4RES B;  1NAF A;  1FZC C;  2L5G B;  1LGH B;  2R5B A;  2N1T B;  1M1J B;  1NTM K;  4IFM A;  1LTJ A;  2NPS A;  1AFO A;  1LTI C;  2W6B A;  1X79 B;  2C9L Y;  1HGZ A;  1JY2 P;  1SLQ A;  3LW5 H;  1GU5 A;  2P67 A;  1G1I A;  1E5W A;  3OJA B;  1JY3 P;  3TYY A;  3M9B A;  1MFZ A;  3RL0 D;  1GZL A;  3P8M C;  2WSE H;  5APT A;  1KFM A;  3SWY A;  3B5N D;  1ZLL A;  3HD7 A;  3GHG C;  3VMY A;  5KJ7 D;  1LWU A;  2A45 H;  3NFQ A;  3NXS A;  2WSC H;  4IFF A;  1IO4 A;  5APV A;  3TSI A;  1JY2 N;  2KP8 A;  1JTH B;  3II6 A;  3IFM A;  2Q9I A;  1WT6 A;  4Y99 B;  3HUS B;  2Q7C A;  2N1T D;  1GL2 D;  2A45 G;  3HE4 A;  1GU4 A;  4C7N A;  1LT9 B;  3V4Q A;  1G2C A;  2OYI A;  3I5C A;  1T2K C;  2KYV A;  3L36 A;  1MZ9 A;  5AVW B;  2W6A A;  5AVU B;  1JY3 O;  1DX7 A;  5APS A;  2HOD A;  4HH2 A;  1L4A C;  5AW9 B;  4HYT B;  1IFI A;  2QM7 A;  1LTA C;  4GKG A;  2CPS A;  1URQ B;  5AVR B;  2P2U A;  1SVF A;  5APY A;  3B5N A;  4DZO A;  3KQG A;  1ZR4 A;  1KIL D;  1IFN A;  2OYH C;  5CHX A;  1RF1 C;  2WT7 B;  5KJ7 A;  2JEE A;  5AVQ B;  2PAJ A;  1RE3 C;  1FZE A;  2FFD C;  2YO2 A;  3KPE A;  2E43 A;  1N7S C;  3BAT A;  3L37 A;  2I1J A;  3RK2 C;  1H88 A;  1PFI A;  3M06 A;  3MIW A;  1A02 J;  2YNY A;  2C9N Y;  4LLH A;  2YKO A;  4WY4 B;  4B86 A;  1GL2 A;  1SFC C;  3O8Z A;  1RF1 A;  1LTB C;  1RE3 A;  1Z56 A;  3N4X A;  1CI6 B;  3L35 A;  3HE5 B;  2O1J A;  2I1K A;  1JMM A;  1URQ D;  1LTG C;  3H6P A;  2WWW A;  2H7H A;  2GUS A;  1N7L A;  1XTG B;  3P32 A;  3TNU B;  3NMD A;  3GHG B;  3R2P A;  1M7L A;  2HPC B;  1JUN A;  2FYU K;  1LTJ C;  1KIL A;  2NPS C;  2Q3I A;  3M9Q A;  2YMY A;  4N6J A;  1HGV A;  4WY4 D;  1N73 B;  3VP9 A;  2WIT A;  3IR9 A;  3V2R A;  5KTB A;  1VDF A;  4I6M C;  2KLV A;  1J1E C;  3MD0 A;  1FU1 A;  3SWF A;  2ZFC A;  3HD7 C;  3VOP A;  5BU5 A;  1SQX K;  4ZKU A;  1LWU C;  3MTU E;  2XU6 A;  1QL2 A;  5KLV K;  1L4A B;  1NOH A;  2A45 I;  3OA7 A;  3KYQ A;  5BVZ A;  1SQP K;  3P7K A;  5APX A;  1GK6 A;  1JOC A;  3M9H A;  5AVT B;  1NTK K;  2OYH B;  2OYI C;  1IJD B;  2KSJ A;  1NHL A;  3LID A;  1GDT A;  3EFG A;  1HVV A;  1G1J A;  1OXZ A;  2Z5I A;  2FFD B;  1FJP A;  5AW4 B;  2R32 A;  1JCD A;  1N7S B;  3RK2 B;  1IFM A;  1JY3 N;  3CLQ A;  4M3L A;  4WY4 A;  2C0W A;  2Q5U A;  2WZ7 A;  5APW A;  3RL0 C;  3RK3 B;  1XTC C;  1SFC B;  2WSF H;  5APQ A;  3MGN A;  5CCH D;  1H8A A;  4OH8 B;  2FKW B;  3B5N C;  1YYC A;  1CSB A;  1NO4 A;  2WPS A;  3BVH A;  5KJ7 C;  5CCG D;  3PP5 A;  2OAR A;  2FXM A;  2Z5H A;  4W7Y A;  3HTK A;  3VN0 A;  3V2Q A;  3CL3 D;  1IK9 A;  4WBA A;  5APU A;  2N1T C;  1GL2 C;  4IFD K;  2KB7 P;  1LTJ B;  1SQQ K;  1YTZ T;  4WB4 A;  3U1A A;  1MV8 A;  2GUV A;  2R5D A;  5AW1 B;  2MJZ A;  2WTY A;  1RE4 A;  3A5T A;  2WPR A;  5CJ4 A;  5AVX B;  1X9V A;  3RK3 D;  1CZQ A;  1FZC B;  4AYC A;  4AUW A;  2N1T A;  3WMM 0;  1M1J A;  3MUD A;  2O1K A;  3G3Z A;  3HD7 B;  5AVV B;  4EIJ A;  3M0D A;  5CCH A;  1LWU B;  5BU8 B;  1KIL C;  2POH A;  1FJK A;  2YO3 A;  1CW5 A;  2M3B A;  1AQ5 A;  1SP4 A;  3UIA A;  5AW6 B;  5CCG A;  3A7O A;  1T3U A;  1FOS F;  4JYC A;  3HE4 B;  4XE5 B;  4C7N B;  1GTW A;  1HBW A;  1LT9 C;  1G2C B;  1FOS E;  1X8Y A;  4N78 D;  2KOG A;  1SQV K;  1A02 F;  1S9K D;  1FZB A;  2HOD B;  5AW7 B;  1WRG A;  1JTH A;  2HYN A;  3OAK A;  2FYZ A;  1N2D C;  3HUS A;  4GIF A;  4ZKP A;  3TK1 A;  3RL0 B;  1DEB A;  1LT9 A;  4N78 E;  1HH0 A;  3LIE A;  1URQ C;  1FZA A;  4GT1 A;  2HG5 D;  3B5N B;  1L0N K;  4LGD E;  3VMZ A;  1S9K E;  3VYI A;  1VPC A;  3H32 B;  4XA4 A;  2IPP A;  3KDP B;  1GD2 E;  2O01 H;  2XV5 A;  3VP8 A;  1LTS C;  1EQ7 A;  2XZR A;  1L0L K;  1URQ A;  4WY4 C;  2IX7 C;  1GL2 B;  1HTL C;  2YKQ A;  2PP6 A;  1RF0 A;  3E1I A;  1FAV A;  3L4F A;  3CI9 A;  3P8C D;  2WT7 A;  1RF1 B;  1JO5 A;  3M0A A;  3N7N A;  4W7Z A;  1IFJ A;  1HJB A;  1OWA A;  1LTT C;  2XNX A;  1NKN A;  1FZC A;  3V4W A;  1T3J A;  1T2K D;  3VMX A;  1NH4 A;  3B8E B;  3T97 A;  2HFE D;  3P8C E;  3NTN A;  3M91 A;  1RY3 A;  1JNM A;  1JCC A;  1L4A D;  3C9I A;  1KIL B;  1J1D C;  1CI6 A;  3HE5 A;  2HLO A;  3V5B A;  2Z4E A;  4EOT A;  1NKZ B;  2J58 A;  4KHX A;  2GM4 A;  1GK4 A;  1RE4 C;  4O9B A;  1N73 C;  2VRS A;  1N86 A;  3BRT B;  3GHG A;  1H89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...