4LGDE

Structural basis for autoactivation of human mst2 kinase and its regulation by rassf5
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
47
Chain Sequence
VEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Serine/threonine-protein kinase 3
total genus 13
structure length 47
sequence length 47
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16517 Nore1-SARAH Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4lgdE00
2NPSC 2N1TB 1GL2B 4W7YA 3VOPA 4JF7A 4WY4B 1URQA 5KJ7C 1KILC 1L4AC 5CCHD 1N7SC 3RK2C 1L4AD 5CCHC 2N1TC 2WZ7A 1GL2C 3RK3D 4OH8B 4W7ZA 3RL0C 1SFCB 2YMYA 3HD7B 1SFCD 3HD7C 3HD7D 3B5NA 5CCGC 1JTHA 2XDJA 5CCGD 4LGDE 3PP5A 1URQC 1KILA 2N1TD 1N7SA 1SFCA 3RK2D 5CCHA 2N1TA 1GL2A 2NPSD 3TSIA 1GL2D 3RK3C 1N7SB 3M0DC 4WY4A 2NPSA 1URQD 3RK3B 2HFED 1L4AB 2HG5D 1KILD 5KJ7D 3HTKB 5KJ7A 3B5NC 2M8RA 1L4AA 3B5NB 4WY4D 1NHLA 4N78E 2H8PD 1JTHB 3KYQA 3RL0D 3P8CE 1HVVA 1T3JA 1XTGB 4W80A 1URQB 2KOGA 1SFCC 3RL0B 1N7SD 2PP6A 1KILB 2NPSB 3HD7A 3B5ND 3RK2B 5CCGA 4WY4C
chains in the Genus database with same CATH superfamily
1CI6A 1OVUA 2FYUJ 2N1TB 2ZFCA 3H1ID 4HB1A 2GA1A 3MIWA 2W83C 2I1JA 3AE1C 4JF7A 5AW0B 1H0TB 1LTSC 1URQA 2WSCJ 1U57A 2QM7A 1R5LA 3CD6P 1GZLA 1L0NG 4Y99C 3V2QA 1H8AA 1JM0A 1GMJA 4PD4E 1R5SA 2K9JB 3WUUA 5CCHD 2WPQA 1JY3P 1FDMA 4GODA 3WUTA 1K05A 1PP9D 1AJYA 1JMBA 1RF0C 1T6AA 2Y9YA 1KQSO 1J2JB 1EXJA 2IBZI 1L4AD 2ZT9B 1OMIA 1L0NJ 3H25A 2H43A 3H1KG 4QMAA 3G3ZA 2AEMA 2M3BA 1SQXE 1LTIC 4Z1MH 3OW2O 2IBZD 1KQLA 1ZRTD 1GW4A 1JOCA 1NTKJ 2YKQA 5DJUB 1AQ5A 3M06A 3P7KA 3RL0C 3CCJP 4JBZA 2JJLA 2OARA 1LTJB 2WSEJ 2O01N 2FXOA 3H1KD 3L74J 1M1KQ 2LKMA 2K9JA 1J1DC 1CI6B 1LP1B 2HODA 1M1JB 2XNXA 2JWAA 3GW6A 3HD7C 1KZUB 3WMM0 2E42A 3PRJA 1WT6A 3HD7D 3M91A 1S3JA 3VMZA 3Q3DA 4U3FE 4ZKUA 1S5LX 1HWTC 3U1AA 3Q5RA 1L0ND 3JSVC 3NXSA 4PD4H 3SWKA 1EDJA 2CK3H 3SWYA 2JDIH 3FWLA 1SQQD 3OA7A 1H0TA 3L74E 3N4XA 4KJMA 5GTHE 4K35A 2XU6A 1LTGC 1NGMB 1L0LK 1LTBC 3A7OA 3E7KA 4PJ0E 4U3FG 1Q82Q 2HPCB 2GM4A 1KILA 1DEBA 3KXDA 1AV1A 2OYHB 1FS0E 1M8OB 3CL3D 2ZT9C 3M9QA 3PHLA 4H44D 3Q1MA 1JUNA 2B87A 3PJSK 1PGPA 3H1IJ 3CCEP 2MKVA 4GT1A 3GHGB 3H1LE 5GTHH 3V2PA 1FZGA 1VQ4P 1FU1A 1X79B 2YIUB 1GL2A 2QJPB 5GTIH 1IO4A 3L75D 3TSIA 1NTME 1GL2D 3RK3C 4YXWH 1N7SB 4XA4A 5AW8B 1JY2O 3M0DC 1NYHA 4JYCA 3VMAA 4I1LA 1N73B 1URQD 4WBAA 2LR2A 4GOFA 5B5EE 3GF3A 5AVWB 3TGUD 4EOTA 1VQ8P 3A0HH 2FXMA 3FGAD 3L73J 3ZDMA 3N7NA 2Y9ZA 1VQMP 2HG5D 1SQVK 1MUUA 2ZVNB 5KLVG 3TGUE 2FYUE 1LTJA 4R4MA 5KJ7D 2W27A 2Q7CA 1BE3J 4TLFA 1JNMA 1J1EB 3H1LJ 4DZOA 1JCDA 1Y8AA 2MJZA 2OQQA 3L75J 4UB6E 3AE6C 1KQFB 2IPPA 2R3CA 2YNYA 2C9LY 2BCCG 2E5YA 3KQGA 5AVZB 3CPWO 2ZYAA 3MZWB 3L74D 1AVOA 3B5NB 1OIPA 2IZ1A 3AE2C 4WY4D 3TK1A 2E43A 2K37A 1OXZA 2L5GB 2WPVB 4PJ0H 1NHLA 3HRNA 1DEEG 1TU3F 1WRGA 3UIAA 1RE3C 2Y0CA 1NTKK 1JCCA 5KLVD 1FOSF 2W90A 1USDA 4L74A 5KLIC 3G71P 2O01H 4OWFA 2AEFA 2P7JA 1VQ9P 2M5AB 2LXCB 3WUVA 1L0LE 1EDLA 1LT9B 2KSEA 4W80A 2M3EA 3GHGC 1OFCX 2HR3A 5APTA 4C7NA 1Q7YQ 1CW5A 1HBWA 2KOGA 1QX8A 2P2UA 3H1HE 1YTZT 1NTZK 1PP9J 2ZXXA 3CWBD 5KAFH 2C0WA 1NO4A 1N86A 2Y0EA 3LW5J 3FXEA 3SFDC 3W67A 3D71A 3CC2P 1N2DC 3KZIE 1GU4A 1KB9E 1PPJG 2WSFJ 2W6BA 3HD7A 3PTZA 1L2PA 3W68A 3MP7B 5CMZA 4ZNCA 1N73C 4N3YB 2VRSA 2ZYGA 2Q9IA 1NU1G 1YYCA 5AVQB 2HLOA 1X8YA 1USEA 1QEXA 3BVHA 1VPCA 3II6A 3I56P 3L70G 5CJ4A 1GL2B 1BGYD 2OTKE 3G6EP 1X0TA 4Y99B 3V2RA 2PAJA 2FYUD 2FFDB 1KQGB 4HYTB 2POHA 3KPEA 1SQXD 1CZQA 2BCCJ 3QWOC 4EIJA 1IFPA 1ZRTE 4PD4D 2O01J 3L75G 5CBNA 3L71E 4KHXA 1KILC 3WU2E 4YXDC 1AVYA 1HF9A 1L4AC 4H44B 4GKGA 2J58A 2P58A 4IFDK 3I5CA 2D2CD 2OYIB 5AW7B 3RK2C 1RQUA 3VP9A 1LJ2A 3BRVB 1RF1B 1VF5C 2GUSA 3CLQA 2IZ0A 4UB8E 5CCHC 2RKLA 1MFTA 2Q5UA 1HH0A 2WZ7A 3JCUH 3CXHH 1FZBA 4O9BA 4PV1D 1N7LA 1Q81Q 3D6YA 4C46A 1HTLC 1KYOH 4W7ZA 3L71G 3CCVP 1VQKP 1XTCC 1ZR4A 1Q2NA 2H88C 1SQXJ 3CWBE 3V5BA 1KTMA 2E75B 4IL6H 2HODB 3HD7B 5TISE 2RMZA 5C39A 3HE4A 1PGQA 1SQPJ 2QIWA 2W8ZA 5TISH 1UIIA 3AE7C 1G1JA 3NMDA 3VMXA 3K5BA 1NTKD 1SQBD 3GMAA 4RO0A 5AVTB 2LXBA 5KLVK 1R8EA 1H88A 2WT7A 2WITA 3KZIH 3HUSB 1PP9G 3NFQA 4WWIA 2FFDC 2QA4P 1S72P 2KXPB 1VQOP 1BGYE 2D2CB 3AECC 5AVSB 2ZAEB 3TNUB 5AVUB 1JTHA 1HGZA 1GW3A 3CWBJ 2HPCA 2P1JA 3F5HA 3TGUJ 1NTZJ 1RQVA 3IF4A 2FYNC 2J5UA 3H1HG 5CCGD 3CX5I 1KN7A 2W6JH 3L73E 4I7ZC 1RE3A 2E76C 1JEKA 2J59M 4UB8H 1A02F 2IBZG 3F89A 2KNCB 3E1IA 2PGDA 4NPFX 1S4XA 1EZVE 5L8RJ 1IFMA 1Q86Q 4HJGH 2O3JA 5APUA 1N7SA 4WB4A 1IFNA 2R3SA 3AEFC 4BRYA 1FJKA 4BWNA 2N1TA 1JMMA 2QJKC 3B4SA 4L73A 2E75D 3L72D 2BASA 2XNDH 1X22A 2R32A 2KUBA 2RH0A 3A0BE 4H0LD 1YQ3C 3JCUE 3L37A 4H13C 3AEEC 2IFMA 3AE5C 4WY4A 3T97B 2NPSA 1S1CX 1SQVE 1BSHA 5B66E 4PV1B 2N9YB 2IYPA 2QM8A 3H1IG 1NU1J 1YBKA 3VTPC 2K3RA 4IL6E 4HKZH 3MTUE 4D6TE 4OGQC 3R4YA 1S5LH 3RBXA 1BCCE 4DJGA 5APXA 3O8ZA 1KILE 3B5NC 3JC22 2M8RA 3A2AA 3L72J 4U3FJ 4D6TD 5KAIH 1L4AA 5AW6B 2XZRA 2I8DA 2OGUA 2WTYA 2L91A 2WSSH 2BCCE 3CXHE 2QG4A 1EXIA 1LNQA 5TJHA 3Q5PA 4U3FD 3M0AA 4MN4C 5DJTB 1BCCG 1D7MA 3R2PA 4RESB 1EZVD 2FKWB 2YO3A 3TDKA 3WU2H 3CCRP 3V4WA 1M90Q 1NTZE 3U59A 2E74C 4RJTA 1URQB 1YITP 2N9BA 3RGUA 1YI2P 3A0HE 1YIJP 1GU5A 1SQVG 2KP8A 4PD4I 1K8AQ 5KKZC 1N7SD 2BEZF 2PP6A 3LIDA 1LWUA 1PPJD 3AEGC 1NKZB 1FDOA 2V4HA 1G1IA 3IR9A 3MGNA 4PV1C 2WSFH 1NJIQ 1OWAA 2PRRA 3H1LG 4N6JA 1VF5D 3V2NA 3M9HA 1YQ4C 1SQPD 2NZ2A 2OYHC 4I2LC 1M56D 2H89C 1SS1A 1VQ7P 2KK7A 5BU8B 1SQQG 2JO1A 3AEBC 4WY4B 4ASWA 2C9NY 4U7JA 4UB6H 5AVYB 3HE5B 1RHZB 2B87B 3AEAC 2WVRA 3L72G 4I6MC 4JQ0D 2OYIA 1BE3D 1OVRA 1HJBA 5AW3B 5EFWB 4K3AA 2B9BA 1EQ7A 1NVOA 2Q1KA 1RE4A 1KYOI 1CSBA 1RH5B 1SQQJ 2QJYB 2Z5HA 3ABVC 3BCCD 3KDPB 1N7SC 3L70J 4H0LB 3VYIA 1KC8Q 5AW9B 1NU1K 3H1IE 1QVGO 4H13D 2N1TC 2FXPA 2XKMA 3CCQP 2ZYDA 4OH8B 2K1AA 5APVA 3HE4B 2NRGA 1FZCB 1ZXGA 2YMYA 2WPRA 3PH0A 1LGHB 1KFNA 1SQPG 3CC4P 1G2CA 2PFXA 3MD0A 1DX7A 2V7QH 2K88A 3D6ZA 1SQBE 4EDFA 4EYYQ 5BVZA 2R5BA 1S9KD 2Q3EA 5CHXA 2CPSA 2UWJE 1P84I 1OW6A 3B5NA 1IFIA 1VDFA 3AE9C 2AXTE 4N78D 4BXLA 2K9YA 2Y0DA 5CCGC 5KLVE 3ITKA 1YJNP 3H32B 1YHQP 3G9RA 4JPZB 4XE5B 4AUWA 1KB9I 1IFJA 1YTZI 2OYOA 3RBZA 1W2BO 2YO2A 4NPEA 2Z4EA 1KFMA 1ZMEC 2WT7B 3T97A 1FJPA 3HUSA 1LT9C 4GDOA 2G8YA 3PP5A 5APYA 1W2EA 2FBWC 4IFMA 2C0XA 2QJYC 1SVFA 3FWNA 1J1DB 1GD2E 2WPSA 3CMEP 1RY3A 2Q6QA 5KLVJ 4EI2A 2H7HA 2N1TD 3HE5A 5M1BA 4ASVA 2P67A 1KD1Q 3S4RA 1W5CE 1BDDA 3GG2A 3MUDC 5APSA 3H1KJ 4B86A 1EDIA 1H89A 1ZR2A 5CCHA 1FZFA 1FZCA 3CCLP 3AE4C 2A06E 2IDBA 1SQXK 1PL5A 3CCMP 3CCSP 2NPSD 1GTWA 3TYYA 3NTNA 5AVRB 2KZJA 1DD3A 5CBOA 1BDCA 1L0LJ 1PPJE 2JEEA 3L36A 1FZAA 1PV3A 3CMAP 1LT1A 2FYUG 1YJWP 3O6QA 2E76D 2ZJSE 1IC2A 3CXHD 3L71D 2B88A 4OGQB 4IL6X 3L70D 1BSNA 5AW4B 3A5TA 2OYHA 2WSEH 3S9OA 5B66H 1L4AB 2ZT9D 5KLIB 2OTJP 1M57D 1KILD 1NTMJ 1SLQA 4R4LA 2QRXA 1LTTC 4ZKPA 2OYIC 1L0LD 3HTKB 3L75E 2YIUC 2FFDA 1IZNB 2QJPC 2KB7P 1IK9A 2BCCD 1BE3E 5KAIE 4BRYB 2JKVA 2KLVA 1ZLLA 1A02J 3CWBG 3L4FA 1NAFA 1BCCJ 1QVFO 1FBMA 4IFFA 3L35A 1HUCA 2H8PD 3KYQA 3AEDC 4D6TJ 1SQBK 3P8CE 3E1RA 1MKMA 1GK6A 3TGUG 1L0NK 1T3JA 3GLMA 1MV8A 1VQ6P 3L74G 4AYCA 1Q90D 1OX3A 3LIEA 1SFCC 1SQQK 2YKPA 3U1CA 1Z56A 3BCCJ 1N8RQ 2XV5A 1KILB 2A45H 2D2CC 1PFIA 4LLHA 1NTKG 2WQYC 1DH3A 1L0LG 2SPZA 1KORA 1VQ5P 1KMIZ 2WMMA 3B5ND 1SQBJ 1PIXA 2FYNB 4RKUJ 5AW2B 3AE3C 3CX5E 3RK2B 3RL0g 2IFNA 5CCGA 1JB0J 3IN6A 4WY4C 1RF1C 1T8ZA 2NPSC 1QL1A 2R5DA 4W7YA 1OZHA 3VOPA 2WSCH 4C7RA 1S5LE 3H1HD 1EZVG 1NU1E 2QSIA 4L75A 1ZW0A 1OVVA 2Q3IA 1JY3O 1U7MA 2AXTH 3H1LD 5KJ7C 2RN0A 1LTAC 1VQPP 1LP1A 3M9BA 3EFFK 5AW5B 1IK7A 3BATA 4DOJA 1NTMD 2QJKB 3SSUA 2JP3A 1DD4A 1ZV8A 1EZVI 2P10A 1VL2A 3HTKA 3MUDA 1J1EC 2HYNA 1OW8A 1SQVD 4C7NB 3TF5A 1FZCC 3B8EB 1NAYA 2ZXEB 1PP9E 3H1KE 1WMKA 3FXDA 1GL2C 2QVAA 3RK3D 2YXQB 3P8CD 3D70A 2YMKA 4XFJA 1M7LA 3P8MC 4M3LA 3VMYA 1FZEA 3RK3E 1SFCB 1ZOYC 3PLNA 3SFEC 1DIPA 1BCCD 2IYOA 1JY2N 1P84H 1S9KE 5APWA 1BGYJ 1PZQA 1SFCD 4H44C 3BASA 1NOHA 3OJAB 1PGJA 3L70E 1FOSE 1LWUC 5BU5A 3G4SP 1LTJC 3S1KA 5AVXB 1HGVA 2CPBA 5KTBA 4TT3H 3CXHI 3SWFA 4OVNF 1U7JA 4D6TG 1M1JA 1FAVA 2IBZE 5H2FE 3V6IA 1FDIA 4GIFA 2JWDA 1K9MQ 5K5GB 3H1JE 1ZN5A 2BEQD 3Q2YA 1NTZD 1X9VA 1E5WA 2W6AA 4L76A 2E74D 4JYBA 1QLED 2XDJA 1OW7A 3GF7A 2E74B 3H1JD 3L71J 4LGDE 2IX7C 4YTPC 4H13B 1BGYG 1URQC 2QEXP 1AFOA 1E79H 2KIKA 4WVZA 2FY8A 3H6PA 1HJ0A 2KI7B 4NPDA 1AQTA 3GHGA 1RE4C 1QGKB 1NWQA 1UIXA 3EQ2A 1EC5A 3LW5H 2A06D 2KS1B 1RF0A 1SFCA 1EDKA 2FYUK 3C9IA 1NH4A 3BRTB 3RK2D 2DW3A 1AA0A 4A7PA 1VQLP 3C8VA 1SQPE 2E5TA 1BE3G 3B71A 3TNUA 4DT0A 5KAFE 3CX5H 3H32A 1KYOE 5E79E 3EFGA 3O6QB 3BCCE 2YKOA 1JY2P 4KT0J 4YPCA 1VQNP 3L73G 4I7ZB 1VF5B 2AXCA 3EWKA 1KYOD 2AEJA 1RF1A 1GK4A 1Y47A 4ZMDA 1NTMK 1SQVJ 1P84D 1LWUB 1IJDB 2HFED 3RK3B 3VP8A 3H1JG 1ZP0C 3I55P 3AE8C 3V4QA 1NTZG 1SP4A 4GOEA 1GDTA 1JO5A 4Y28J 4IOIH 5H2FH 2E75C 3CI9A 2OTLP 5KJ7A 2Z5IA 1MFZA 3BCCG 5CJ0A 1N73A 1L0NE 3L72E 3P32A 2WWWA 2O1KA 1SQBG 5KKZB 3FX0A 3H1HJ 1SQPK 2KNCA 4DCKA 1Y9BA 2JR8A 1SQQE 2A45G 3A3YB 3C1LA 3QH9A 1JY3N 4LC1A 3USSA 2O1JA 2KYVA 1LT9A 2QE7H 3HUSC 3IFMA 3CCUP 4N78E 1K73Q 4AQRD 1JTHB 3VN0A 2KSJA 3CC7P 1SQXG 3A0BH 3RL0D 5GTIE 2G3AA 2YXRB 2A45I 5E79H 2GUVA 1HVVA 1S2EA 5AVVB 5AW1B 1NTKE 1XTGB 2I1KA 3Q5SA 1YJ9P 1IFDA 1K04A 1MZ9A 2V7QJ 2E76B 3H1JJ 4OGQD 1PGOA 2ITAA 4CPGA 3L73D 1T2KD 1T2KC 1NU1D 5APQA 3OAKA 3RL0B 3M0DA 5B5EH 1QL2A 2M5AA 1KB9H 2KZIA 2ZVOB 2FYZA 3MHVA 3IAOA 1FE6A 1KV4A 2KLUA 2NPSB 3CX5D 1NKNA 1NTMG 2M0BA 2R44A 1G2CB 2B89A 2KS1A 4H0LC 1M1JC 1KB9D 1T3UA 1P84E 2A06G 1FC2C 3KHUA 4HH2A
chains in the Genus database with same CATH topology
1CI6A 2N1TB 2ZFCA 3MIWA 2I1JA 4JF7A 5AW0B 1LTSC 1URQA 2QM7A 1GZLA 4Y99C 3V2QA 1H8AA 5CCHD 2WPQA 1JY3P 1FDMA 1RF0C 1J2JB 1L4AD 2H43A 3G3ZA 2M3BA 1LTIC 1KQLA 1GW4A 1JOCA 2YKQA 1AQ5A 3M06A 3P7KA 3RL0C 2JJLA 2OARA 1LTJB 2LKMA 1J1DC 1CI6B 2HODA 1M1JB 2XNXA 3HD7C 3WMM0 1KZUB 2E42A 1WT6A 3HD7D 3M91A 3VMZA 4ZKUA 1HWTC 3U1AA 3NXSA 3SWYA 3OA7A 3N4XA 2XU6A 1LTGC 1L0LK 1LTBC 3A7OA 2GM4A 2HPCB 1KILA 1DEBA 3CL3D 3M9QA 1JUNA 3V2PA 4GT1A 3GHGB 1FZGA 1FU1A 1X79B 1GL2A 1IO4A 3TSIA 1GL2D 3RK3C 1N7SB 4XA4A 5AW8B 1JY2O 3M0DC 4JYCA 4I1LA 1N73B 1URQD 4WBAA 5AVWB 4EOTA 2FXMA 3N7NA 2HG5D 1SQVK 1MUUA 1FZFA 1JNMA 1LTJA 5KJ7D 2W27A 2Q7CA 1J1EB 4DZOA 1JCDA 2MJZA 2C9LY 2IPPA 2R3CA 2YNYA 3KQGA 5AVZB 3B5NB 3TK1A 4WY4D 2E43A 1OXZA 2L5GB 3UIAA 1NHLA 3HRNA 1FOSF 1WRGA 1RE3C 1NTKK 1JCCA 2O01H 2P7JA 1LT9B 4W80A 3GHGC 5APTA 4C7NA 1CW5A 1HBWA 2KOGA 2P2UA 1YTZT 1NTZK 2C0WA 1NO4A 1N86A 1N2DC 1GU4A 3HD7A 2W6BA 1N73C 5CMZA 4N3YB 2VRSA 5AVQB 1YYCA 3BVHA 2HLOA 1X8YA 1VPCA 3II6A 5CJ4A 1GL2B 2FFDB 4Y99B 3V2RA 2PAJA 4HYTB 2POHA 3KPEA 4EIJA 1CZQA 4KHXA 1KILC 1L4AC 4GKGA 2J58A 4IFDK 3I5CA 2OYIB 5AW7B 3RK2C 3VP9A 3BRVB 1RF1B 2GUSA 3CLQA 5CCHC 2Q5UA 4O9BA 1HH0A 2WZ7A 1FZBA 1N7LA 4C46A 1HTLC 4W7ZA 1XTCC 1ZR4A 3V5BA 2HODB 3HD7B 3HE4A 1G1JA 3NMDA 3VMXA 5KLVK 5AVTB 1H88A 2WT7A 2WITA 3HUSB 3NFQA 2FFDC 5AVSB 3TNUB 5AVUB 1JTHA 1HGZA 1GW3A 2HPCA 2P1JA 5CCGD 1A02F 1RE3A 2J59M 3E1IA 1IFMA 5APUA 1N7SA 4WB4A 1IFNA 1FJKA 2N1TA 1JMMA 2BASA 1N73A 2R32A 3L37A 2IFMA 4WY4A 2NPSA 2QM8A 3VTPC 3MTUE 5APXA 3O8ZA 3B5NC 2M8RA 3A2AA 1L4AA 5AW6B 2XZRA 2WTYA 3M0AA 4RESB 3R2PA 2FKWB 2YO3A 3V4WA 1URQB 2N9BA 1GU5A 2KP8A 1N7SD 2PP6A 3LIDA 1LWUA 1NKZB 3MGNA 1G1IA 3IR9A 2WSFH 1OWAA 4N6JA 3V2NA 3M9HA 2OYHC 4I2LC 5BU8B 2C9NY 4WY4B 5AVYB 3HE5B 4I6MC 2OYIA 1HJBA 5AW3B 1EQ7A 3L35A 3H6PA 1RE4A 2Z5HA 1CSBA 3VYIA 3KDPB 1N7SC 5AW9B 1NU1K 2N1TC 2XKMA 4OH8B 5APVA 3HE4B 1FZCB 2YMYA 2WPRA 1LGHB 1KFNA 1G2CA 3MD0A 1DX7A 5BVZA 2R5BA 1S9KD 5CHXA 2CPSA 3B5NA 1IFIA 1VDFA 4N78D 5CCGC 3H32B 4XE5B 4AUWA 1YTZI 1IFJA 2Z4EA 2YO2A 1KFMA 2WT7B 3T97A 1FJPA 3HUSA 1LT9C 3PP5A 5APYA 1W2EA 4IFMA 2C0XA 1SVFA 1GD2E 1J1DB 2WPSA 1RY3A 2H7HA 2N1TD 3HE5A 2P67A 5APSA 4B86A 1H89A 1ZR2A 5CCHA 1FZCA 1SQXK 1GTWA 2NPSD 3TYYA 3NTNA 5AVRB 2JEEA 3L36A 1FZAA 5AW4B 1IC2A 3A5TA 2OYHA 2WSEH 1L4AB 1KILD 1SLQA 1LTTC 4ZKPA 2OYIC 3HTKB 2FFDA 2KB7P 1IK9A 2KLVA 1ZLLA 1A02J 3L4FA 1NAFA 1FBMA 4IFFA 1HUCA 2H8PD 3KYQA 1SQBK 3P8CE 1GK6A 1L0NK 1T3JA 1MV8A 4AYCA 3LIEA 1SFCC 1SQQK 2YKPA 3U1CA 1Z56A 2XV5A 1KILB 2A45H 1PFIA 4LLHA 1DH3A 3B5ND 5AW2B 3RK2B 5CCGA 2IFNA 1RF1C 4WY4C 1T8ZA 2NPSC 1QL1A 2R5DA 4W7YA 3VOPA 2WSCH 4C7RA 2Q3IA 1JY3O 5KJ7C 1LTAC 3M9BA 5AW5B 3BATA 4DOJA 1ZV8A 3HTKA 3MUDA 1J1EC 2HYNA 4C7NB 1FZCC 3B8EB 2ZXEB 1GL2C 3RK3D 3P8CD 3VMYA 1M7LA 3P8MC 4M3LA 1FZEA 1SFCB 1JY2N 1S9KE 5APWA 1SFCD 3BASA 1NOHA 3OJAB 1FOSE 1LWUC 5BU5A 1LTJC 5AVXB 1HGVA 2CPBA 5KTBA 3SWFA 1M1JA 1FAVA 4GIFA 1ZN5A 1X9VA 2W6AA 1E5WA 4JYBA 2XDJA 1GDTA 4LGDE 2IX7C 1URQC 1AFOA 3GHGA 1RE4C 1NWQA 3EQ2A 3LW5H 1RF0A 1SFCA 2FYUK 3C9IA 3RK2D 1NH4A 3BRTB 3U59A 3TNUA 3H32A 3EFGA 2YKOA 1JY2P 1RF1A 1GK4A 1NTMK 1LWUB 1IJDB 2HFED 3RK3B 3VP8A 3V4QA 1SP4A 1JO5A 3CI9A 5KJ7A 2Z5IA 1MFZA 5CJ0A 3P32A 2WWWA 2O1KA 2Q9IA 1SQPK 2A45G 3A3YB 1JY3N 4LC1A 2O1JA 2KYVA 1LT9A 3HUSC 3IFMA 4N78E 4AQRD 1JTHB 3VN0A 2KSJA 3RL0D 5AVVB 2OYHB 2A45I 2GUVA 1HVVA 5AW1B 1XTGB 2I1KA 1IFDA 1MZ9A 1T2KD 1T2KC 5APQA 3RL0B 3OAKA 1QL2A 2FYZA 2NPSB 1NKNA 1G2CB 1M1JC 3M0DA 1T3UA 4HH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPS C;  2N1T B;  1GL2 B;  4W7Y A;  3VOP A;  4JF7 A;  4WY4 B;  1URQ A;  5KJ7 C;  1KIL C;  1L4A C;  5CCH D;  1N7S C;  3RK2 C;  1L4A D;  5CCH C;  2N1T C;  2WZ7 A;  1GL2 C;  3RK3 D;  4OH8 B;  4W7Z A;  3RL0 C;  1SFC B;  2YMY A;  3HD7 B;  1SFC D;  3HD7 C;  3HD7 D;  3B5N A;  5CCG C;  1JTH A;  2XDJ A;  5CCG D;  4LGD E;  3PP5 A;  1URQ C;  1KIL A;  2N1T D;  1N7S A;  1SFC A;  3RK2 D;  5CCH A;  2N1T A;  1GL2 A;  2NPS D;  3TSI A;  1GL2 D;  3RK3 C;  1N7S B;  3M0D C;  4WY4 A;  2NPS A;  1URQ D;  3RK3 B;  2HFE D;  1L4A B;  2HG5 D;  1KIL D;  5KJ7 D;  3HTK B;  5KJ7 A;  3B5N C;  2M8R A;  1L4A A;  3B5N B;  4WY4 D;  1NHL A;  4N78 E;  2H8P D;  1JTH B;  3KYQ A;  3RL0 D;  3P8C E;  1HVV A;  1T3J A;  1XTG B;  4W80 A;  1URQ B;  2KOG A;  1SFC C;  3RL0 B;  1N7S D;  2PP6 A;  1KIL B;  2NPS B;  3HD7 A;  3B5N D;  3RK2 B;  5CCG A;  4WY4 C; 
#chains in the Genus database with same CATH topology
 1CI6 A;  1OVU A;  2FYU J;  2N1T B;  2ZFC A;  3H1I D;  4HB1 A;  2GA1 A;  3MIW A;  2W83 C;  2I1J A;  3AE1 C;  4JF7 A;  5AW0 B;  1H0T B;  1LTS C;  1URQ A;  2WSC J;  1U57 A;  2QM7 A;  1R5L A;  3CD6 P;  1GZL A;  1L0N G;  4Y99 C;  3V2Q A;  1H8A A;  1JM0 A;  1GMJ A;  4PD4 E;  1R5S A;  2K9J B;  3WUU A;  5CCH D;  2WPQ A;  1JY3 P;  1FDM A;  4GOD A;  3WUT A;  1K05 A;  1PP9 D;  1AJY A;  1JMB A;  1RF0 C;  1T6A A;  2Y9Y A;  1KQS O;  1J2J B;  1EXJ A;  2IBZ I;  1L4A D;  2ZT9 B;  1OMI A;  1L0N J;  3H25 A;  2H43 A;  3H1K G;  4QMA A;  3G3Z A;  2AEM A;  2M3B A;  1SQX E;  1LTI C;  4Z1M H;  3OW2 O;  2IBZ D;  1KQL A;  1ZRT D;  1GW4 A;  1JOC A;  1NTK J;  2YKQ A;  5DJU B;  1AQ5 A;  3M06 A;  3P7K A;  3RL0 C;  3CCJ P;  4JBZ A;  2JJL A;  2OAR A;  1LTJ B;  2WSE J;  2O01 N;  2FXO A;  3H1K D;  3L74 J;  1M1K Q;  2LKM A;  2K9J A;  1J1D C;  1CI6 B;  1LP1 B;  2HOD A;  1M1J B;  2XNX A;  2JWA A;  3GW6 A;  3HD7 C;  1KZU B;  3WMM 0;  2E42 A;  3PRJ A;  1WT6 A;  3HD7 D;  3M91 A;  1S3J A;  3VMZ A;  3Q3D A;  4U3F E;  4ZKU A;  1S5L X;  1HWT C;  3U1A A;  3Q5R A;  1L0N D;  3JSV C;  3NXS A;  4PD4 H;  3SWK A;  1EDJ A;  2CK3 H;  3SWY A;  2JDI H;  3FWL A;  1SQQ D;  3OA7 A;  1H0T A;  3L74 E;  3N4X A;  4KJM A;  5GTH E;  4K35 A;  2XU6 A;  1LTG C;  1NGM B;  1L0L K;  1LTB C;  3A7O A;  3E7K A;  4PJ0 E;  4U3F G;  1Q82 Q;  2HPC B;  2GM4 A;  1KIL A;  1DEB A;  3KXD A;  1AV1 A;  2OYH B;  1FS0 E;  1M8O B;  3CL3 D;  2ZT9 C;  3M9Q A;  3PHL A;  4H44 D;  3Q1M A;  1JUN A;  2B87 A;  3PJS K;  1PGP A;  3H1I J;  3CCE P;  2MKV A;  4GT1 A;  3GHG B;  3H1L E;  5GTH H;  3V2P A;  1FZG A;  1VQ4 P;  1FU1 A;  1X79 B;  2YIU B;  1GL2 A;  2QJP B;  5GTI H;  1IO4 A;  3L75 D;  3TSI A;  1NTM E;  1GL2 D;  3RK3 C;  4YXW H;  1N7S B;  4XA4 A;  5AW8 B;  1JY2 O;  3M0D C;  1NYH A;  4JYC A;  3VMA A;  4I1L A;  1N73 B;  1URQ D;  4WBA A;  2LR2 A;  4GOF A;  5B5E E;  3GF3 A;  5AVW B;  3TGU D;  4EOT A;  1VQ8 P;  3A0H H;  2FXM A;  3FGA D;  3L73 J;  3ZDM A;  3N7N A;  2Y9Z A;  1VQM P;  2HG5 D;  1SQV K;  1MUU A;  2ZVN B;  5KLV G;  3TGU E;  2FYU E;  1LTJ A;  4R4M A;  5KJ7 D;  2W27 A;  2Q7C A;  1BE3 J;  4TLF A;  1JNM A;  1J1E B;  3H1L J;  4DZO A;  1JCD A;  1Y8A A;  2MJZ A;  2OQQ A;  3L75 J;  4UB6 E;  3AE6 C;  1KQF B;  2IPP A;  2R3C A;  2YNY A;  2C9L Y;  2BCC G;  2E5Y A;  3KQG A;  5AVZ B;  3CPW O;  2ZYA A;  3MZW B;  3L74 D;  1AVO A;  3B5N B;  1OIP A;  2IZ1 A;  3AE2 C;  4WY4 D;  3TK1 A;  2E43 A;  2K37 A;  1OXZ A;  2L5G B;  2WPV B;  4PJ0 H;  1NHL A;  3HRN A;  1DEE G;  1TU3 F;  1WRG A;  3UIA A;  1RE3 C;  2Y0C A;  1NTK K;  1JCC A;  5KLV D;  1FOS F;  2W90 A;  1USD A;  4L74 A;  5KLI C;  3G71 P;  2O01 H;  4OWF A;  2AEF A;  2P7J A;  1VQ9 P;  2M5A B;  2LXC B;  3WUV A;  1L0L E;  1EDL A;  1LT9 B;  2KSE A;  4W80 A;  2M3E A;  3GHG C;  1OFC X;  2HR3 A;  5APT A;  4C7N A;  1Q7Y Q;  1CW5 A;  1HBW A;  2KOG A;  1QX8 A;  2P2U A;  3H1H E;  1YTZ T;  1NTZ K;  1PP9 J;  2ZXX A;  3CWB D;  5KAF H;  2C0W A;  1NO4 A;  1N86 A;  2Y0E A;  3LW5 J;  3FXE A;  3SFD C;  3W67 A;  3D71 A;  3CC2 P;  1N2D C;  3KZI E;  1GU4 A;  1KB9 E;  1PPJ G;  2WSF J;  2W6B A;  3HD7 A;  3PTZ A;  1L2P A;  3W68 A;  3MP7 B;  5CMZ A;  4ZNC A;  1N73 C;  4N3Y B;  2VRS A;  2ZYG A;  2Q9I A;  1NU1 G;  1YYC A;  5AVQ B;  2HLO A;  1X8Y A;  1USE A;  1QEX A;  3BVH A;  1VPC A;  3II6 A;  3I56 P;  3L70 G;  5CJ4 A;  1GL2 B;  1BGY D;  2OTK E;  3G6E P;  1X0T A;  4Y99 B;  3V2R A;  2PAJ A;  2FYU D;  2FFD B;  1KQG B;  4HYT B;  2POH A;  3KPE A;  1SQX D;  1CZQ A;  2BCC J;  3QWO C;  4EIJ A;  1IFP A;  1ZRT E;  4PD4 D;  2O01 J;  3L75 G;  5CBN A;  3L71 E;  4KHX A;  1KIL C;  3WU2 E;  4YXD C;  1AVY A;  1HF9 A;  1L4A C;  4H44 B;  4GKG A;  2J58 A;  2P58 A;  4IFD K;  3I5C A;  2D2C D;  2OYI B;  5AW7 B;  3RK2 C;  1RQU A;  3VP9 A;  1LJ2 A;  3BRV B;  1RF1 B;  1VF5 C;  2GUS A;  3CLQ A;  2IZ0 A;  4UB8 E;  5CCH C;  2RKL A;  1MFT A;  2Q5U A;  1HH0 A;  2WZ7 A;  3JCU H;  3CXH H;  1FZB A;  4O9B A;  4PV1 D;  1N7L A;  1Q81 Q;  3D6Y A;  4C46 A;  1HTL C;  1KYO H;  4W7Z A;  3L71 G;  3CCV P;  1VQK P;  1XTC C;  1ZR4 A;  1Q2N A;  2H88 C;  1SQX J;  3CWB E;  3V5B A;  1KTM A;  2E75 B;  4IL6 H;  2HOD B;  3HD7 B;  5TIS E;  2RMZ A;  5C39 A;  3HE4 A;  1PGQ A;  1SQP J;  2QIW A;  2W8Z A;  5TIS H;  1UII A;  3AE7 C;  1G1J A;  3NMD A;  3VMX A;  3K5B A;  1NTK D;  1SQB D;  3GMA A;  4RO0 A;  5AVT B;  2LXB A;  5KLV K;  1R8E A;  1H88 A;  2WT7 A;  2WIT A;  3KZI H;  3HUS B;  1PP9 G;  3NFQ A;  4WWI A;  2FFD C;  2QA4 P;  1S72 P;  2KXP B;  1VQO P;  1BGY E;  2D2C B;  3AEC C;  5AVS B;  2ZAE B;  3TNU B;  5AVU B;  1JTH A;  1HGZ A;  1GW3 A;  3CWB J;  2HPC A;  2P1J A;  3F5H A;  3TGU J;  1NTZ J;  1RQV A;  3IF4 A;  2FYN C;  2J5U A;  3H1H G;  5CCG D;  3CX5 I;  1KN7 A;  2W6J H;  3L73 E;  4I7Z C;  1RE3 A;  2E76 C;  1JEK A;  2J59 M;  4UB8 H;  1A02 F;  2IBZ G;  3F89 A;  2KNC B;  3E1I A;  2PGD A;  4NPF X;  1S4X A;  1EZV E;  5L8R J;  1IFM A;  1Q86 Q;  4HJG H;  2O3J A;  5APU A;  1N7S A;  4WB4 A;  1IFN A;  2R3S A;  3AEF C;  4BRY A;  1FJK A;  4BWN A;  2N1T A;  1JMM A;  2QJK C;  3B4S A;  4L73 A;  2E75 D;  3L72 D;  2BAS A;  2XND H;  1X22 A;  2R32 A;  2KUB A;  2RH0 A;  3A0B E;  4H0L D;  1YQ3 C;  3JCU E;  3L37 A;  4H13 C;  3AEE C;  2IFM A;  3AE5 C;  4WY4 A;  3T97 B;  2NPS A;  1S1C X;  1SQV E;  1BSH A;  5B66 E;  4PV1 B;  2N9Y B;  2IYP A;  2QM8 A;  3H1I G;  1NU1 J;  1YBK A;  3VTP C;  2K3R A;  4IL6 E;  4HKZ H;  3MTU E;  4D6T E;  4OGQ C;  3R4Y A;  1S5L H;  3RBX A;  1BCC E;  4DJG A;  5APX A;  3O8Z A;  1KIL E;  3B5N C;  3JC2 2;  2M8R A;  3A2A A;  3L72 J;  4U3F J;  4D6T D;  5KAI H;  1L4A A;  5AW6 B;  2XZR A;  2I8D A;  2OGU A;  2WTY A;  2L91 A;  2WSS H;  2BCC E;  3CXH E;  2QG4 A;  1EXI A;  1LNQ A;  5TJH A;  3Q5P A;  4U3F D;  3M0A A;  4MN4 C;  5DJT B;  1BCC G;  1D7M A;  3R2P A;  4RES B;  1EZV D;  2FKW B;  2YO3 A;  3TDK A;  3WU2 H;  3CCR P;  3V4W A;  1M90 Q;  1NTZ E;  3U59 A;  2E74 C;  4RJT A;  1URQ B;  1YIT P;  2N9B A;  3RGU A;  1YI2 P;  3A0H E;  1YIJ P;  1GU5 A;  1SQV G;  2KP8 A;  4PD4 I;  1K8A Q;  5KKZ C;  1N7S D;  2BEZ F;  2PP6 A;  3LID A;  1LWU A;  1PPJ D;  3AEG C;  1NKZ B;  1FDO A;  2V4H A;  1G1I A;  3IR9 A;  3MGN A;  4PV1 C;  2WSF H;  1NJI Q;  1OWA A;  2PRR A;  3H1L G;  4N6J A;  1VF5 D;  3V2N A;  3M9H A;  1YQ4 C;  1SQP D;  2NZ2 A;  2OYH C;  4I2L C;  1M56 D;  2H89 C;  1SS1 A;  1VQ7 P;  2KK7 A;  5BU8 B;  1SQQ G;  2JO1 A;  3AEB C;  4WY4 B;  4ASW A;  2C9N Y;  4U7J A;  4UB6 H;  5AVY B;  3HE5 B;  1RHZ B;  2B87 B;  3AEA C;  2WVR A;  3L72 G;  4I6M C;  4JQ0 D;  2OYI A;  1BE3 D;  1OVR A;  1HJB A;  5AW3 B;  5EFW B;  4K3A A;  2B9B A;  1EQ7 A;  1NVO A;  2Q1K A;  1RE4 A;  1KYO I;  1CSB A;  1RH5 B;  1SQQ J;  2QJY B;  2Z5H A;  3ABV C;  3BCC D;  3KDP B;  1N7S C;  3L70 J;  4H0L B;  3VYI A;  1KC8 Q;  5AW9 B;  1NU1 K;  3H1I E;  1QVG O;  4H13 D;  2N1T C;  2FXP A;  2XKM A;  3CCQ P;  2ZYD A;  4OH8 B;  2K1A A;  5APV A;  3HE4 B;  2NRG A;  1FZC B;  1ZXG A;  2YMY A;  2WPR A;  3PH0 A;  1LGH B;  1KFN A;  1SQP G;  3CC4 P;  1G2C A;  2PFX A;  3MD0 A;  1DX7 A;  2V7Q H;  2K88 A;  3D6Z A;  1SQB E;  4EDF A;  4EYY Q;  5BVZ A;  2R5B A;  1S9K D;  2Q3E A;  5CHX A;  2CPS A;  2UWJ E;  1P84 I;  1OW6 A;  3B5N A;  1IFI A;  1VDF A;  3AE9 C;  2AXT E;  4N78 D;  4BXL A;  2K9Y A;  2Y0D A;  5CCG C;  5KLV E;  3ITK A;  1YJN P;  3H32 B;  1YHQ P;  3G9R A;  4JPZ B;  4XE5 B;  4AUW A;  1KB9 I;  1IFJ A;  1YTZ I;  2OYO A;  3RBZ A;  1W2B O;  2YO2 A;  4NPE A;  2Z4E A;  1KFM A;  1ZME C;  2WT7 B;  3T97 A;  1FJP A;  3HUS A;  1LT9 C;  4GDO A;  2G8Y A;  3PP5 A;  5APY A;  1W2E A;  2FBW C;  4IFM A;  2C0X A;  2QJY C;  1SVF A;  3FWN A;  1J1D B;  1GD2 E;  2WPS A;  3CME P;  1RY3 A;  2Q6Q A;  5KLV J;  4EI2 A;  2H7H A;  2N1T D;  3HE5 A;  5M1B A;  4ASV A;  2P67 A;  1KD1 Q;  3S4R A;  1W5C E;  1BDD A;  3GG2 A;  3MUD C;  5APS A;  3H1K J;  4B86 A;  1EDI A;  1H89 A;  1ZR2 A;  5CCH A;  1FZF A;  1FZC A;  3CCL P;  3AE4 C;  2A06 E;  2IDB A;  1SQX K;  1PL5 A;  3CCM P;  3CCS P;  2NPS D;  1GTW A;  3TYY A;  3NTN A;  5AVR B;  2KZJ A;  1DD3 A;  5CBO A;  1BDC A;  1L0L J;  1PPJ E;  2JEE A;  3L36 A;  1FZA A;  1PV3 A;  3CMA P;  1LT1 A;  2FYU G;  1YJW P;  3O6Q A;  2E76 D;  2ZJS E;  1IC2 A;  3CXH D;  3L71 D;  2B88 A;  4OGQ B;  4IL6 X;  3L70 D;  1BSN A;  5AW4 B;  3A5T A;  2OYH A;  2WSE H;  3S9O A;  5B66 H;  1L4A B;  2ZT9 D;  5KLI B;  2OTJ P;  1M57 D;  1KIL D;  1NTM J;  1SLQ A;  4R4L A;  2QRX A;  1LTT C;  4ZKP A;  2OYI C;  1L0L D;  3HTK B;  3L75 E;  2YIU C;  2FFD A;  1IZN B;  2QJP C;  2KB7 P;  1IK9 A;  2BCC D;  1BE3 E;  5KAI E;  4BRY B;  2JKV A;  2KLV A;  1ZLL A;  1A02 J;  3CWB G;  3L4F A;  1NAF A;  1BCC J;  1QVF O;  1FBM A;  4IFF A;  3L35 A;  1HUC A;  2H8P D;  3KYQ A;  3AED C;  4D6T J;  1SQB K;  3P8C E;  3E1R A;  1MKM A;  1GK6 A;  3TGU G;  1L0N K;  1T3J A;  3GLM A;  1MV8 A;  1VQ6 P;  3L74 G;  4AYC A;  1Q90 D;  1OX3 A;  3LIE A;  1SFC C;  1SQQ K;  2YKP A;  3U1C A;  1Z56 A;  3BCC J;  1N8R Q;  2XV5 A;  1KIL B;  2A45 H;  2D2C C;  1PFI A;  4LLH A;  1NTK G;  2WQY C;  1DH3 A;  1L0L G;  2SPZ A;  1KOR A;  1VQ5 P;  1KMI Z;  2WMM A;  3B5N D;  1SQB J;  1PIX A;  2FYN B;  4RKU J;  5AW2 B;  3AE3 C;  3CX5 E;  3RK2 B;  3RL0 g;  2IFN A;  5CCG A;  1JB0 J;  3IN6 A;  4WY4 C;  1RF1 C;  1T8Z A;  2NPS C;  1QL1 A;  2R5D A;  4W7Y A;  1OZH A;  3VOP A;  2WSC H;  4C7R A;  1S5L E;  3H1H D;  1EZV G;  1NU1 E;  2QSI A;  4L75 A;  1ZW0 A;  1OVV A;  2Q3I A;  1JY3 O;  1U7M A;  2AXT H;  3H1L D;  5KJ7 C;  2RN0 A;  1LTA C;  1VQP P;  1LP1 A;  3M9B A;  3EFF K;  5AW5 B;  1IK7 A;  3BAT A;  4DOJ A;  1NTM D;  2QJK B;  3SSU A;  2JP3 A;  1DD4 A;  1ZV8 A;  1EZV I;  2P10 A;  1VL2 A;  3HTK A;  3MUD A;  1J1E C;  2HYN A;  1OW8 A;  1SQV D;  4C7N B;  3TF5 A;  1FZC C;  3B8E B;  1NAY A;  2ZXE B;  1PP9 E;  3H1K E;  1WMK A;  3FXD A;  1GL2 C;  2QVA A;  3RK3 D;  2YXQ B;  3P8C D;  3D70 A;  2YMK A;  4XFJ A;  1M7L A;  3P8M C;  4M3L A;  3VMY A;  1FZE A;  3RK3 E;  1SFC B;  1ZOY C;  3PLN A;  3SFE C;  1DIP A;  1BCC D;  2IYO A;  1JY2 N;  1P84 H;  1S9K E;  5APW A;  1BGY J;  1PZQ A;  1SFC D;  4H44 C;  3BAS A;  1NOH A;  3OJA B;  1PGJ A;  3L70 E;  1FOS E;  1LWU C;  5BU5 A;  3G4S P;  1LTJ C;  3S1K A;  5AVX B;  1HGV A;  2CPB A;  5KTB A;  4TT3 H;  3CXH I;  3SWF A;  4OVN F;  1U7J A;  4D6T G;  1M1J A;  1FAV A;  2IBZ E;  5H2F E;  3V6I A;  1FDI A;  4GIF A;  2JWD A;  1K9M Q;  5K5G B;  3H1J E;  1ZN5 A;  2BEQ D;  3Q2Y A;  1NTZ D;  1X9V A;  1E5W A;  2W6A A;  4L76 A;  2E74 D;  4JYB A;  1QLE D;  2XDJ A;  1OW7 A;  3GF7 A;  2E74 B;  3H1J D;  3L71 J;  4LGD E;  2IX7 C;  4YTP C;  4H13 B;  1BGY G;  1URQ C;  2QEX P;  1AFO A;  1E79 H;  2KIK A;  4WVZ A;  2FY8 A;  3H6P A;  1HJ0 A;  2KI7 B;  4NPD A;  1AQT A;  3GHG A;  1RE4 C;  1QGK B;  1NWQ A;  1UIX A;  3EQ2 A;  1EC5 A;  3LW5 H;  2A06 D;  2KS1 B;  1RF0 A;  1SFC A;  1EDK A;  2FYU K;  3C9I A;  1NH4 A;  3BRT B;  3RK2 D;  2DW3 A;  1AA0 A;  4A7P A;  1VQL P;  3C8V A;  1SQP E;  2E5T A;  1BE3 G;  3B71 A;  3TNU A;  4DT0 A;  5KAF E;  3CX5 H;  3H32 A;  1KYO E;  5E79 E;  3EFG A;  3O6Q B;  3BCC E;  2YKO A;  1JY2 P;  4KT0 J;  4YPC A;  1VQN P;  3L73 G;  4I7Z B;  1VF5 B;  2AXC A;  3EWK A;  1KYO D;  2AEJ A;  1RF1 A;  1GK4 A;  1Y47 A;  4ZMD A;  1NTM K;  1SQV J;  1P84 D;  1LWU B;  1IJD B;  2HFE D;  3RK3 B;  3VP8 A;  3H1J G;  1ZP0 C;  3I55 P;  3AE8 C;  3V4Q A;  1NTZ G;  1SP4 A;  4GOE A;  1GDT A;  1JO5 A;  4Y28 J;  4IOI H;  5H2F H;  2E75 C;  3CI9 A;  2OTL P;  5KJ7 A;  2Z5I A;  1MFZ A;  3BCC G;  5CJ0 A;  1N73 A;  1L0N E;  3L72 E;  3P32 A;  2WWW A;  2O1K A;  1SQB G;  5KKZ B;  3FX0 A;  3H1H J;  1SQP K;  2KNC A;  4DCK A;  1Y9B A;  2JR8 A;  1SQQ E;  2A45 G;  3A3Y B;  3C1L A;  3QH9 A;  1JY3 N;  4LC1 A;  3USS A;  2O1J A;  2KYV A;  1LT9 A;  2QE7 H;  3HUS C;  3IFM A;  3CCU P;  4N78 E;  1K73 Q;  4AQR D;  1JTH B;  3VN0 A;  2KSJ A;  3CC7 P;  1SQX G;  3A0B H;  3RL0 D;  5GTI E;  2G3A A;  2YXR B;  2A45 I;  5E79 H;  2GUV A;  1HVV A;  1S2E A;  5AVV B;  5AW1 B;  1NTK E;  1XTG B;  2I1K A;  3Q5S A;  1YJ9 P;  1IFD A;  1K04 A;  1MZ9 A;  2V7Q J;  2E76 B;  3H1J J;  4OGQ D;  1PGO A;  2ITA A;  4CPG A;  3L73 D;  1T2K D;  1T2K C;  1NU1 D;  5APQ A;  3OAK A;  3RL0 B;  3M0D A;  5B5E H;  1QL2 A;  2M5A A;  1KB9 H;  2KZI A;  2ZVO B;  2FYZ A;  3MHV A;  3IAO A;  1FE6 A;  1KV4 A;  2KLU A;  2NPS B;  3CX5 D;  1NKN A;  1NTM G;  2M0B A;  2R44 A;  1G2C B;  2B89 A;  2KS1 A;  4H0L C;  1M1J C;  1KB9 D;  1T3U A;  1P84 E;  2A06 G;  1FC2 C;  3KHU A;  4HH2 A; 
#chains in the Genus database with same CATH homology
 1CI6 A;  2N1T B;  2ZFC A;  3MIW A;  2I1J A;  4JF7 A;  5AW0 B;  1LTS C;  1URQ A;  2QM7 A;  1GZL A;  4Y99 C;  3V2Q A;  1H8A A;  5CCH D;  2WPQ A;  1JY3 P;  1FDM A;  1RF0 C;  1J2J B;  1L4A D;  2H43 A;  3G3Z A;  2M3B A;  1LTI C;  1KQL A;  1GW4 A;  1JOC A;  2YKQ A;  1AQ5 A;  3M06 A;  3P7K A;  3RL0 C;  2JJL A;  2OAR A;  1LTJ B;  2LKM A;  1J1D C;  1CI6 B;  2HOD A;  1M1J B;  2XNX A;  3HD7 C;  3WMM 0;  1KZU B;  2E42 A;  1WT6 A;  3HD7 D;  3M91 A;  3VMZ A;  4ZKU A;  1HWT C;  3U1A A;  3NXS A;  3SWY A;  3OA7 A;  3N4X A;  2XU6 A;  1LTG C;  1L0L K;  1LTB C;  3A7O A;  2GM4 A;  2HPC B;  1KIL A;  1DEB A;  3CL3 D;  3M9Q A;  1JUN A;  3V2P A;  4GT1 A;  3GHG B;  1FZG A;  1FU1 A;  1X79 B;  1GL2 A;  1IO4 A;  3TSI A;  1GL2 D;  3RK3 C;  1N7S B;  4XA4 A;  5AW8 B;  1JY2 O;  3M0D C;  4JYC A;  4I1L A;  1N73 B;  1URQ D;  4WBA A;  5AVW B;  4EOT A;  2FXM A;  3N7N A;  2HG5 D;  1SQV K;  1MUU A;  1FZF A;  1JNM A;  1LTJ A;  5KJ7 D;  2W27 A;  2Q7C A;  1J1E B;  4DZO A;  1JCD A;  2MJZ A;  2C9L Y;  2IPP A;  2R3C A;  2YNY A;  3KQG A;  5AVZ B;  3B5N B;  3TK1 A;  4WY4 D;  2E43 A;  1OXZ A;  2L5G B;  3UIA A;  1NHL A;  3HRN A;  1FOS F;  1WRG A;  1RE3 C;  1NTK K;  1JCC A;  2O01 H;  2P7J A;  1LT9 B;  4W80 A;  3GHG C;  5APT A;  4C7N A;  1CW5 A;  1HBW A;  2KOG A;  2P2U A;  1YTZ T;  1NTZ K;  2C0W A;  1NO4 A;  1N86 A;  1N2D C;  1GU4 A;  3HD7 A;  2W6B A;  1N73 C;  5CMZ A;  4N3Y B;  2VRS A;  5AVQ B;  1YYC A;  3BVH A;  2HLO A;  1X8Y A;  1VPC A;  3II6 A;  5CJ4 A;  1GL2 B;  2FFD B;  4Y99 B;  3V2R A;  2PAJ A;  4HYT B;  2POH A;  3KPE A;  4EIJ A;  1CZQ A;  4KHX A;  1KIL C;  1L4A C;  4GKG A;  2J58 A;  4IFD K;  3I5C A;  2OYI B;  5AW7 B;  3RK2 C;  3VP9 A;  3BRV B;  1RF1 B;  2GUS A;  3CLQ A;  5CCH C;  2Q5U A;  4O9B A;  1HH0 A;  2WZ7 A;  1FZB A;  1N7L A;  4C46 A;  1HTL C;  4W7Z A;  1XTC C;  1ZR4 A;  3V5B A;  2HOD B;  3HD7 B;  3HE4 A;  1G1J A;  3NMD A;  3VMX A;  5KLV K;  5AVT B;  1H88 A;  2WT7 A;  2WIT A;  3HUS B;  3NFQ A;  2FFD C;  5AVS B;  3TNU B;  5AVU B;  1JTH A;  1HGZ A;  1GW3 A;  2HPC A;  2P1J A;  5CCG D;  1A02 F;  1RE3 A;  2J59 M;  3E1I A;  1IFM A;  5APU A;  1N7S A;  4WB4 A;  1IFN A;  1FJK A;  2N1T A;  1JMM A;  2BAS A;  1N73 A;  2R32 A;  3L37 A;  2IFM A;  4WY4 A;  2NPS A;  2QM8 A;  3VTP C;  3MTU E;  5APX A;  3O8Z A;  3B5N C;  2M8R A;  3A2A A;  1L4A A;  5AW6 B;  2XZR A;  2WTY A;  3M0A A;  4RES B;  3R2P A;  2FKW B;  2YO3 A;  3V4W A;  1URQ B;  2N9B A;  1GU5 A;  2KP8 A;  1N7S D;  2PP6 A;  3LID A;  1LWU A;  1NKZ B;  3MGN A;  1G1I A;  3IR9 A;  2WSF H;  1OWA A;  4N6J A;  3V2N A;  3M9H A;  2OYH C;  4I2L C;  5BU8 B;  2C9N Y;  4WY4 B;  5AVY B;  3HE5 B;  4I6M C;  2OYI A;  1HJB A;  5AW3 B;  1EQ7 A;  3L35 A;  3H6P A;  1RE4 A;  2Z5H A;  1CSB A;  3VYI A;  3KDP B;  1N7S C;  5AW9 B;  1NU1 K;  2N1T C;  2XKM A;  4OH8 B;  5APV A;  3HE4 B;  1FZC B;  2YMY A;  2WPR A;  1LGH B;  1KFN A;  1G2C A;  3MD0 A;  1DX7 A;  5BVZ A;  2R5B A;  1S9K D;  5CHX A;  2CPS A;  3B5N A;  1IFI A;  1VDF A;  4N78 D;  5CCG C;  3H32 B;  4XE5 B;  4AUW A;  1YTZ I;  1IFJ A;  2Z4E A;  2YO2 A;  1KFM A;  2WT7 B;  3T97 A;  1FJP A;  3HUS A;  1LT9 C;  3PP5 A;  5APY A;  1W2E A;  4IFM A;  2C0X A;  1SVF A;  1GD2 E;  1J1D B;  2WPS A;  1RY3 A;  2H7H A;  2N1T D;  3HE5 A;  2P67 A;  5APS A;  4B86 A;  1H89 A;  1ZR2 A;  5CCH A;  1FZC A;  1SQX K;  1GTW A;  2NPS D;  3TYY A;  3NTN A;  5AVR B;  2JEE A;  3L36 A;  1FZA A;  5AW4 B;  1IC2 A;  3A5T A;  2OYH A;  2WSE H;  1L4A B;  1KIL D;  1SLQ A;  1LTT C;  4ZKP A;  2OYI C;  3HTK B;  2FFD A;  2KB7 P;  1IK9 A;  2KLV A;  1ZLL A;  1A02 J;  3L4F A;  1NAF A;  1FBM A;  4IFF A;  1HUC A;  2H8P D;  3KYQ A;  1SQB K;  3P8C E;  1GK6 A;  1L0N K;  1T3J A;  1MV8 A;  4AYC A;  3LIE A;  1SFC C;  1SQQ K;  2YKP A;  3U1C A;  1Z56 A;  2XV5 A;  1KIL B;  2A45 H;  1PFI A;  4LLH A;  1DH3 A;  3B5N D;  5AW2 B;  3RK2 B;  5CCG A;  2IFN A;  1RF1 C;  4WY4 C;  1T8Z A;  2NPS C;  1QL1 A;  2R5D A;  4W7Y A;  3VOP A;  2WSC H;  4C7R A;  2Q3I A;  1JY3 O;  5KJ7 C;  1LTA C;  3M9B A;  5AW5 B;  3BAT A;  4DOJ A;  1ZV8 A;  3HTK A;  3MUD A;  1J1E C;  2HYN A;  4C7N B;  1FZC C;  3B8E B;  2ZXE B;  1GL2 C;  3RK3 D;  3P8C D;  3VMY A;  1M7L A;  3P8M C;  4M3L A;  1FZE A;  1SFC B;  1JY2 N;  1S9K E;  5APW A;  1SFC D;  3BAS A;  1NOH A;  3OJA B;  1FOS E;  1LWU C;  5BU5 A;  1LTJ C;  5AVX B;  1HGV A;  2CPB A;  5KTB A;  3SWF A;  1M1J A;  1FAV A;  4GIF A;  1ZN5 A;  1X9V A;  2W6A A;  1E5W A;  4JYB A;  2XDJ A;  1GDT A;  4LGD E;  2IX7 C;  1URQ C;  1AFO A;  3GHG A;  1RE4 C;  1NWQ A;  3EQ2 A;  3LW5 H;  1RF0 A;  1SFC A;  2FYU K;  3C9I A;  3RK2 D;  1NH4 A;  3BRT B;  3U59 A;  3TNU A;  3H32 A;  3EFG A;  2YKO A;  1JY2 P;  1RF1 A;  1GK4 A;  1NTM K;  1LWU B;  1IJD B;  2HFE D;  3RK3 B;  3VP8 A;  3V4Q A;  1SP4 A;  1JO5 A;  3CI9 A;  5KJ7 A;  2Z5I A;  1MFZ A;  5CJ0 A;  3P32 A;  2WWW A;  2O1K A;  2Q9I A;  1SQP K;  2A45 G;  3A3Y B;  1JY3 N;  4LC1 A;  2O1J A;  2KYV A;  1LT9 A;  3HUS C;  3IFM A;  4N78 E;  4AQR D;  1JTH B;  3VN0 A;  2KSJ A;  3RL0 D;  5AVV B;  2OYH B;  2A45 I;  2GUV A;  1HVV A;  5AW1 B;  1XTG B;  2I1K A;  1IFD A;  1MZ9 A;  1T2K D;  1T2K C;  5APQ A;  3RL0 B;  3OAK A;  1QL2 A;  2FYZ A;  2NPS B;  1NKN A;  1G2C B;  1M1J C;  3M0D A;  1T3U A;  4HH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...