4LH5A

Dual inhibition of hiv-1 replication by integrase-ledgf allosteric inhibitors is predominant at post-integration stage during virus production rather than at integration
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
152
structure length
129
Chain Sequence
SPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Dual inhibition of HIV-1 replication by integrase-LEDGF allosteric inhibitors is predominant at the post-integration stage.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 43
structure length 129
sequence length 152
ec nomenclature
pdb deposition date 2013-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lh5A00
2VG7A 3AO1A 4CIGA 1REVA 3S9HA 4G1QA 1T05A 3VQ5A 3L2WA 3D0PA 4CEOA 2G8IA 4K8ZA 4Z0UA 4DFMA 1NK7A 3KK2A 4CEQA 3O4QA 4CK1A 4KB1A 1ASWA 3EYZA 1C6VA 3OYIA 4Z4HA 3K58A 3VQ7A 2X6NA 3DRRA 2NUBA 1C0MA 2R7YA 1VSKA 3C6UA 3K2PA 1QQCA 1W9HA 3M8RA 4DSFA 5HLFA 4FJJA 2KFNA 4BDYA 1EKEA 1XHXA 3DM2A 3MEEA 2LSNA 3ZSYA 3O3FA 2FBXA 5KTQA 1DTQA 2XY7A 1TK5A 4O44A 1JL1A 5DMRA 4AILC 3TARA 2ZQBA 1NJZA 1SL1A 4NCBA 3NF7A 4OLAA 1RTDA 2HHTA 4HUGA 1NJXA 4ELUA 3S3NA 4H4MA 1ZBLA 3WNHA 4KAZA 3ITHA 4KTZA 3AVFA 4DS4A 3B6PA 3T19A 1IO2A 1JLBA 4CJFA 3L3VA 3OYKA 3TR8A 2B4JA 2YNIA 3AVBA 4JRQA 3NE6A 2YNGA 3TAQA 2B6AA 1JLEA 1WSIA 1VSEA 4OGCA 3LAMA 4FXDA 5C24A 3PUFA 1IKWA 4FZYA 4HVJA 3TWHA 3QIOA 1FXXA 3AO4A 3CFRA 1TK0A 1KSPA 3QNOA 4ELTA 4B8AB 4UQGA 1KVCA 3LZJA 4KTWA 2XY5A 4CJPA 3A2FA 3OS2A 1UA1A 2KTQA 3LALA 3IAYA 1QS4A 3MECA 3ZT2A 4CEZA 3V9UA 3SUQA 1SKSA 1EX4A 4AH9A 3V9SA 4KHYA 1RCHA 1YT3A 4Z4CA 4B9MA 3AVNA 4DMNA 1BCMA 5HP1A 1I39A 1O1WA 5KGXA 2YKMA 3DLRA 3OS1A 4B9UA 1CZ9A 4CFCA 3VQCA 1RBTA 4CEAA 4W5RA 3OYBA 1YTUA 1BQMA 2X78A 1CXQA 3P1GA 1Q8IA 2DFEA 4I9LA 4RW7A 2HNDA 5CYMA 1K6YA 1J54A 3AVIA 4MQ3A 4CF1A 2P5GA 1HJRA 2D0CA 4M3YA 3LANA 3VQQA 1U45A 3HM9A 3O3HA 4DLGA 3NFAA 4ZHRA 3F73A 4FJHA 2DFHA 4DF4A 1ZBUA 1TKXA 1HRHA 4FLTA 5DK5A 3LDSA 2G8WA 4I9QA 3L2VA 2FBYA 2ZE2A 4I7FA 2G8VA 4E1NA 4AHVA 3VQ6A 3RMBA 4CEEA 1C0UA 4E7HA 1X9SA 1EXQA 4W5QA 4C8OA 5I42A 2HNYA 3DLHA 1U49A 4LH5A 4CF9A 3F9KA 4DQIA 1ITGA 3MAQA 1XWLA 4O55A 3VQEA 4CFAA 3OYFA 2F8SA 1IKXA 3TABA 4CJVA 4CFBA 3KJVA 4DTPA 4LSNA 1RT4A 1T03A 2PY5A 3AO2A 1YTAA 2BE2A 1RBSA 1TVRA 3HVRA 3AVKA 4CGDA 3BDPA 3SPZA 2P1JA 2G8HA 2IC3A 3HK2A 1VK0A 4E3SA 1C1AA 1LAWA 3MXIA 2HW3A 4CE9A 1NOZA 3RR8A 5SZTA 4F3OA 3VQBA 4F4KA 4FLXA 2PYLA 3M8QA 2D0AA 4Y1DA 1TL3A 2RKIA 3V1OA 2EX3A 3S3OA 4NYNA 4CJLA 4WE1A 1NK9A 4DFPA 4KPYA 3AVJA 3OVNA 4ICLA 1S1XA 1S9EA 1X1PA 2JLEA 4GMJB 3L3UA 5FRMA 3ZSRA 4IKFA 4KTQA 4CEFA 4E7IA 3DRPA 4YFUA 1KLNA 1HNVA 1U47A 3ALYA 1GOCA 3ZSQA 1ASVA 4CHOA 1RT2A 4FZXC 3QERA 3MXMA 3CFOA 4BACA 2ETJA 3OYEA 1JLFA 3KK1A 1BIZA 3AVGA 3SYZA 5FDLA 1KRPA 3ZSXA 1C0TA 4FLYA 1WSGA 2KW4A 2FBTA 3E01A 4KHNA 4LSLA 1HPZA 1RT6A 2ATQA 4FM2A 3PX4A 3IS9A 2QK9A 3O4NA 1U4BA 4HCBA 5E41A 3LZIA 4Z4FA 2X74A 3HVTA 1WSHA 1JLCA 5SWMA 3V1RA 3JSMA 1C1BA 4B8CA 2A1SA 3OJSA 3SUPA 4Q0BA 3SUNA 2I5JA 2YHAA 1NKCA 3RRHA 3V6DA 1IKYA 1HMVA 2XY6A 4FLZA 1ZBFA 3QINA 3K5LA 4FJ8A 1GOAA 1RNHA 2HVIA 4FJMA 4N47A 4EP4A 3OY9A 2AJQA 5KRTA 2Z1HA 2RPIA 1VSDA 5CYQA 4CEBA 4FJLA 3K57A 1KVBA 4OLBA 4TSXA 3NF9A 3OYHA 2OZMA 1RDCA 5HRRA 3QESA 3SQ2A 1QSYA 4FJ9A 1D8YA 3KLHA 4M3RA 1L3SA 4PA1A 3KKSA 3VQ4A 3VQAA 1X9MA 2HMIA 4KI4A 1TAQA 4MFBA 5C25A 1NK0A 3RR7A 2IGIA 2QXFA 3ASMA 3OYLA 1L3UA 1YVUA 2Q3SA 3SUOA 4PUOA 3SJJA 5HRNA 3VA3A 2KQ2A 3ZT4A 2HB5A 1NJYA 4RW6A 4LH4A 2YNFA 3K5NA 4CJTA 5KGWA 3RMCA 3THVA 4HCCA 2RF2A 2GBZA 1NK5A 4CJ3A 5HBMA 4CIFA 4E0DA 3AVAA 2OA8A 1BQNA 4C8LA 1S1UA 2DFFA 3V9ZA 3V81A 3QEXA 5D3GA 4FZZA 1W0HA 4IDKA 3TAMA 5CZ2A 4EP5A 2D5RA 1N5YA 2Z1JA 3P5JA 1BL3A 4CGFA 1TAUA 3K5MA 3C95A 1CZBA 1VSFA 2HHSA 5HROA 3SCXA 3ZCMA 1CLQA 1QHTA 1UOCA 4Q5VA 3OYJA 1B9FA 4F2SA 1NJWA 4RW8A 4C8MA 4GW6A 3ULDA 4NCAA 3U3GA 3PO5A 1RT3A 3SZ2A 2OPPA 3AO3A 4IFVA 4XIUA 1TKDA 1Q9YA 4FLVA 4DTJA 1A5XA 1WAJA 3AA5X 3CFPA 3SQ1A 1D9FA 2QKBA 4C8NA 1XI1A 3HPOA 4DF8A 3LPUA 4DU3A 3ZT1A 4CGGA 3AO5A 4BWJA 4CJRA 4FK4A 4ID5A 1IH7A 4IFYA 1FKOA 3LWMA 3ZT0A 3DOLA 1ZBIA 4AHCA 4BE1A 4B08A 1NK4A 4KREA 1LWCA 4IBNA 3SPYA 4PWDA 4M3UA 2Z1GA 4CEDA 3DRSA 1QE1A 3DOKA 3I0SA 1UWBA 4BE2A 3PY8A 1BI4A 4BDZA 2EHGA 1J5OA 3NF8A 3WNGA 2IDOA 4R5PA 3OYDA 4B9VA 1S6QA 3PO4A 4O0IA 4LY7A 3CG7A 2YV0X 1WSEA 1G15A 4CJWA 3JYTA 4HTUA 3QNNA 5HRSA 4KRFA 3L8BA 1R0AA 1XHZA 4KHSA 3OS0A 1BIUA 1JXBA 3AA3A 2P51A 3KKRA 3WNEA 3NH0A 1B9DA 1HQUA 4CGHA 3ZSZA 4N56A 4FW2A 3NCIA 4BWMA 3IG1A 1X9WA 1S1WA 1SUQA 1RBUA 1VRUA 1Z25A 4GVMA 3LWLA 1Z26A 2Y1JA 3NH2A 1IKVA 3V9XA 4CHYA 3PV8A 4M3WA 4CHNA 1HYZA 3NBPA 2XRIA 3G10A 4JS5A 4KFBA 4JRPA 3SI6A 4Z4EA 1BISA 3TAFA 1TKTA 3HPHA 4CJEA 1MU2A 4YNQA 1RDBA 4CGIA 2P5OA 3C6TA 4DTOA 4FJNA 1QSLA 4Z4GA 3OYAA 4IG3A 1HQEA 1RILA 1SV5A 2VG5A 4OKKA 3TAGA 1DTTA 3HSTB 4ZTFA 1JLQA 2E6LA 3LP0A 4OKJA 4CK2A 3B6OA 2W42A 4E7LA 3T3FA 3OYMA 1UAXA 2VG6A 4N76A 3FFIA 3MEDA 4AHUA 2HHUA 1SKRA 3NH1A 1NK8A 3C94A 4DG1A 3D45A 4DSKA 1WLJA 4FLWA 4B9SA 2GV9A 5CZ1A 4CHZA 3OYNA 1WSFA 2IS3A 3QEPA 4DQSA 2HNZA 3NDKA 4PQUA 2YKNA 5FRNA 3CM6A 1JLAA 1RBRA 1RBVA 5EU7A 3VQDA 3LP3A 4FW1A 1S1TA 4QAGA 5KI6A 2FC0A 1RT5A 4OPKA 3U3YA 3KLEA 4H4OA 4FM1A 4RW4A 1JKHA 3LP1A 4CJQA 3MEGA 3KD5E 3KLGA 4DU1A 4KKOA 2Y1IA 3HP6A 4DSIA 4FJXA 1JXEA 5I3UA 3KLIA 4M45A 3KD1E 4CIEA 1J53A 4KO0A 4ID1A 3QEWA 3V9WA 3ZT3A 4CCHA 4J2AA 1WSJA 1B92A 1CXUA 3QLHA 2KFZA 1A5WA 1Y97A 3L2UA 1BCOA 3TAEA 4W5OA 1WN7A 2E4LA 2G8UA 4FJ7A 3RMAA 4CJ4A 4J2BA 4M42A 3M8PA 3VN5A 4B9LA 1F21A 2IAJA 1S6PA 4DTUA 1TGOA 3QETA 1D9DA 1RTHA 3SQ0A 4DSJA 4DS5A 1LAVA 3K5OA 3VQ9A 1RTJA 4I2QA 3AV9A 3LAKA 3NGIA 4KHUA 2G8FA 3DLKA 3DLGA 3H08A 3M8SA 3U6FA 4N5SA 3L2RA 4CHPA 1WAFA 4O5BA 3V1QA 1TL1A 1BGXT 4FJGA 1HYSA 1SL0A 1L5UA 4OKEA 4F8RA 3WNFA 4CHQA 4DU4A 1S1VA 4O0JA 3NAEA 3RTVA 4DFKA 4B9NA 3RWUA 4IG0A 4CFDA 4FJIA 3CQ8A 4DQQA 1Q9XA 1NOYA 4FLUA 4N41A 1SL2A 4L8RB 4W5TA 3V4IA 4KB0A 3HT3A 3DLBA 4QCLA 4AHTA 3KTQA 4O4GA 4CESA 3CM5A 1D5AA 1XC9A 1NKBA 1LW0A 2E6MA 3ISNC 4F3TA 4E19A 2DTUA 4KHQA 5CY4A 1LV5A 2Z1IA 1RDDA 1VSJA 3IRXA 2HHVA 1RT1A 1L3TA 4FM0A 1SKWA 2BDPA 2YHBA 4CERA 3VQPA 5J1EA 3EZ5A 3S3MA 4E89A 5J2MA 4M41A 4M3ZA 3LP2A 2OPSA 4FVMA 2HHQA 2HHWA 3T1AA 1VSIA 3QEVA 1KCFA 4OJRA 4HUFA 4ELVA 1S5JA 4DSEA 5HRPA 1LWEA 1HYVA 3PX6A 4KI6A 4B3OA 5FROA 4BE0A 3NHGA 2OZSA 1T7PA 3EY1A 1BI4B 4M3TA 2WOMA 3ZSVA 1GOBA 2RN2A 4M3XA 3QIPA 4C8KA 4DTNA 1RT7A 3QEIA 3HL8A 3G0ZA 4CGJA 1KFSA 3SQ4A 1U48A 4CJUA 3I0RA 1KTQA 4ZTJA 4JS4A 1T8EA 1U04A 4DSLA 3LPTA 4DLEA 4B9TA 3HXMA 2PZSA 4BDPA 3P83D 2FBVA 3BGRA 1TK8A 4CJKA 2PYJA 2G8KA 4AHRA 1C1CA 2YNHA 3AVHA 3KLFA 3VA0A 4DFJA 4EZ9A 4RG8A 4JLHA 1VRTA 4EZ6A 1DLOA 1VSMA 4H8KA 3NF6A 4CF8A 4E7JA 1LWFA 4DTXA 4PY5A 3TI0A 3DMJA 2IOCA 2GUIA 4FK2A 3OYGA 2O4GA 3HJFA 4LD0A 3L2QA 4HUEA 1RDAA 2O4IA 1LW2A 4FJ5A 3NGZA 1UA0A 1FKPA 4CJSA 3RMDA 1S9GA 3HYFA 4E1MA 4DTSA 5J2NA 1KLMA 1BHLA 4FJKA 3UIQA 1NKEA 2F8TA 2A1RA 2ITGA 4CF2A 1EP4A 2OPQA 4J2DA 5K14A 3OJUA 1TKZA 3KK3A 4DTRA 4DQPA 3AVCA 4OGEA 2BGGA 3TAPA 1ZYQA 4J2EA 1QTMA 3AVLA 3VQ8A 2JGUA 4AHSA 2F96A 2VWKA 5C42A 1IG9A 4I2PA 4QOZB 3MXJA 3ZSWA 3OYCA 4OVLA 3HPGA 3SNNA 2ZD1A 4Z4IA 1VSLA 4CF0A 3PX0A 3HP9A 3TANA 4KHWA 4FYDA 4NCGA 1JLGA 2XHBA 2KZZA 3AA2A 4CK3A 3SV4A 5JS1A 3CYMA 3DI6A 3AA4A 5KRSA 4F2RA 2KZMA 1KVAA 1A5VA 1WNSA 2XY8A 3ZSOA 1RTIA 2VWJA 2OYQA 2HVHA 5J2QA 4Y1CA 1KFDA 4NYFA 3SV3A 2X6SA 4E7KA 4DQRA 4DTMA 3DLEA 3I8DA 1NK6A 3K59A 1HNIA 4FK0A 1I3AA 1ASUA 1ZBHA 1FK9A 1JL2A 3NGYA 1EETA 3RRGA 4DWIA 2DY4A 3HO1A 3KIOA 4CECA 1VSHA 2WONA 2D0BA 4KV8A 4RW9A 3O3GA 4HHTA 3QO9A 1J9AA 2B5JA 4FCYA 1TV6A 4OPJA 2BANA 2XO7A 1QSSA 5JS2A 2OPRA 3AVMA 5T7BA 2QKKA 4K8XA 1N6QA 3DYAA 4W5NA 4CJ5A 1L3VA 2HHXA 5J2PA
chains in the Genus database with same CATH superfamily
3AO1A 4CIGA 1REVA 4G1QA 1T05A 3VQ5A 3L2WA 3D0PA 1TYQA 3TSUA 4DFMA 1NK7A 3CJCA 1X9JA 3IUCA 1ASWA 4GKJK 5C2DA 5B8HA 1C0MA 4ISFA 3K2PA 5HLFA 2KFNA 4BDYA 3NVMA 1TK5A 3O3FA 2FBXA 1DTQA 1BA1A 1JL1A 2F9TA 5DMRA 2FF6A 3AAPA 3J7AP 3S3NA 4A57A 4H4MA 4KH6A 3DXMB 2E2NA 4BR9A 1JJ2M 3KWIA 3NE6A 2YNGA 1MWKA 2B6AA 1WSIA 2QW9A 5C24A 3QIOA 3QNOA 4B8AB 3EE8A 4UQGA 3A2FA 5AZJB 4BG9A 1QS4A 3MECA 4CEZA 4AH9A 3V9SA 4JK9A 1YT3A 2AA4A 4B9MA 5HP1A 1JCEA 2CH5A 5EOYA 3VQCA 4CEAA 1YTUA 3OYBA 1BQMA 3P1GA 2DFEA 3FFKB 4I9LA 4M63C 4QS8A 4RW7A 4IOCL 3CD6N 3O1BA 1BU6O 1J54A 1W2BM 4JI3K 3F9MA 3LANA 3HM9A 4DLGA 4ZHRA 3F73A 1ZBUA 4FLTA 5DK5A 4BRIA 5F1XA 2G8VA 4H5VA 3R3LA 3WQTA 5GAEP 1C0UA 1X3NA 4FWSA 1X9SA 3THYB 4JI4K 4W5QA 1U49A 3O6WA 1ITGA 3MAQA 1NG9A 1KD1O 4CJVA 4CFBA 1T03A 4DTPA 4B1YB 5C0YA 4WQ4C 4JKGA 3BDPA 1Q81O 4JHDA 1VK0A 2HW3A 5LY3A 4CE9A 1NOZA 5SZTA 3O9SA 2PYLA 2D0AA 3WUHA 2RKIA 3V1OA 2EX3A 3S3OA 4CJLA 3LDOA 4ICLA 5M1KA 2JLEA 1X1PA 2YI1A 3H3OB 4Y0WA 3ZEUA 1X3MA 3FZHA 4E7IA 3DRPA 1GOCA 3E9PA 1V4SA 1KAZA 4CHOA 1RT2A 4XH1A 4BRAA 1YF5L 5AQIA 3H1VX 3KK1A 1KRPA 3AVGA 3ZSXA 1C0TA 2GELA 4FWNA 2E8AA 2BUPA 1RT6A 4WFNL 5E41A 4DR5K 1JLCA 3V1RA 3JSMA 4B8CA 4B3TK 3OJSA 4Q0BA 2HBKA 3DXKA 3PSFA 4FWLA 5TKYA 1ZBFA 3K5LA 3ATVA 4N47A 2AJQA 4LF8K 3H46O 1NGDA 4C23A 4TSXA 3NF9A 4EFHA 1QSYA 3KKSA 4KI4A 1TAQA 2FLOA 3O9UA 3HSCA 2Q3SA 2CGJA 1GLCG 2Q0RA 2NRTA 3ZX0A 3H1QA 2Q0UA 5AQZA 5HOOA 4C8LA 2DFFA 3MCAB 3V9ZA 3G71N 3V81A 1VQ9N 2NNWA 3K9JA 2D5RA 3CJ9A 3T1HK 3P5JA 1TAUA 4DV3K 1VSFA 5BRHA 2HHSA 4BR5A 3R9PA 4BC5A 4JK8A 3OYJA 4PKGA 4F2SA 1J6ZA 2I7PA 4IEEA 4C8MA 1ATSA 4MO5A 3PO5A 3CXCM 2OPPA 3AO3A 4IFVA 1E4FT 3M1FA 4BRDA 3AA5X 3IKMA 3CFPA 3A5LC 3W0LA 3C6AA 4DF8A 2P9NB 3MN7A 4LF9K 1IH7A 3ZT0A 3DOLA 2YHYA 4AHCA 1NLVA 1NK4A 1LWCA 4CEDA 3DRSA 2Q31A 3I0SA 4BE2A 3NF8A 1SZ2A 5GIOA 4X66K 1I94K 4LY7A 3CG7A 2O8CB 1WSEA 3CQXA 5AQSA 3DJCA 3L8BA 1R0AA 4KHSA 5TKWA 1B9DA 1HQUA 4CGHA 2W6LA 3R8EA 3NCIA 1H1VA 3IG1A 1S1WA 2WBNA 3WXMB 1Z26A 5GINA 3NH2A 3PV8A 3G10A 2IVPA 4KFBA 3SI6A 1W97L 1BISA 4XEIA 1TKTA 1EQYA 4CJEA 1MU2A 4YNQA 4CGIA 1ESVA 2P5OA 1BOTO 4J8FA 5EY4A 1IBLK 4O8UA 3CIPA 1QZ5A 1YJ9N 3VF6A 4CZMA 4BRLA 3T3FA 2VQFK 3PIPL 3MEDA 3CJ7A 4PL8A 3E66A 1NK8A 4DG1A 3FLCO 5CZ1A 4CHZA 3BZKA 3OYNA 4DQSA 1C0GA 5FRNA 3CM6A 1JLAA 1OVQA 1RBRA 5EU7A 3D6RA 3VQDA 2NLXA 2FC0A 1JKHA 4CJQA 2Y1IA 5AQPA 5ADXH 1JXEA 4B3RK 4MDAA 3UKRB 2O8BB 4H0XB 2ZF5O 1J53A 3QEWA 3QFUA 3V9WA 2NRVA 3QLHA 1Y97A 3SMSA 1QHAA 4W5OA 1WN7A 2E4LA 1ATRA 1MDUB 4MLEA 3M8PA 2NRHA 1YIJN 4NLCA 4OX9K 1D9DA 4BRFA 4JAXA 3K5OA 4I2QA 3GDQA 3LAKA 4O8KA 4NXMK 3VENA 4YOTA 4O5BA 4I6MB 3AY9A 4KH5A 4CHQA 3A5NC 4FXDA 4O0JA 4IG0A 5AQRA 1NOYA 4N41A 1SL2A 2RE2A 3HT3A 5JICA 3DLBA 4AHTA 3WXIA 3CM5A 1NKBA 3ISNC 2E6MA 3NMUA 2DTUA 4KHQA 5CY4A 2Z1IA 1RDDA 3DXMA 1YJWN 1L3TA 1SKWA 5J1EA 3EZ5A 1VQ7N 3ENOA 2HHQA 1NGJA 3OA9A 2KKZA 1S5JA 5HRPA 1HYVA 4DV6K 3CMEN 1CZAN 4BE0A 3NHGA 3T1YK 3Q7BA 1T7PA 3HTVA 1KXPA 1GLBG 3G25A 3U9ZA 3N4PA 1RT7A 5AZJA 3QEIA 4CGJA 1U48A 4DLEA 1XNQK 5AJ3K 5C2FA 3HXMA 4JKFA 5AQMA 3BGRA 1VQKN 4AHRA 4FOEA 3AVHA 2FF3B 4DFJA 2V7ZA 4DR7K 1VSMA 3NF6A 4DTXA 3DMJA 3ATUA 2HBLA 3OYGA 2W41A 1LW2A 4FJ5A 1FKPA 3RMDA 4DTSA 3FZKA 1BHLA 1BO5O 3UIQA 2F8TA 3E9OA 3THYA 4CI6A 2NRZA 4CZLA 1VQ8N 2BGGA 4J2EA 4DHYA 3SBTA 5LMNK 4DV7K 4BR7A 4FWPA 4OVLA 4FYDA 2KZZA 3SV4A 2VGNA 5KPRA 5KRSA 4F2RA 2KZMA 1Z05A 4YOYA 1A5VA 2GX9A 3LDNA 4NYFA 2X6SA 1ZBHA 2ZJPL 3NGYA 4NB4A 1EETA 2VGMA 4DWIA 1YUWA 2DY4A 3HO1A 1KC8O 4CECA 4RW9A 4FCYA 1QSSA 1J9AA 4OPJA 2BANA 4DV1K 5JS2A 5ELZA 4JI1K 1N6QA 2FSKA 4CJ5A 3RMCA 4K43A 4FVUA 3S9HA 2G8IA 3O08A 4CEOA 3E9LA 4WCEL 3KK2A 4WYBA 4CZJA 3OYIA 3VQ7A 4DV0K 1OKJA 2NUBA 3C6UA 1W9HA 1ZC6A 5FLXO 3SK3A 5M1OA 4AILC 1N34K 4DKWA 1RTDA 4JD2B 4HUGA 3J81O 3C65A 5C12A 5AQGA 1KAYA 3EN9A 3AVFA 4DS4A 1DGKN 3T19A 5KPTA 1IO2A 2YNIA 3AVBA 3N4QA 5AQOA 3H3NO 3TAQA 4JV5K 4GKKK 5M1PA 4FZYA 4HVJA 5MLCQ 3TWHA 2OCEA 1FXXA 2VWBA 3CFRA 1TK0A 4ELTA 3LZJA 1GLDG 4E1JA 4CJPA 5IT9O 1LOTB 2KTQA 3SUQA 4A62A 3CCEN 1RCHA 4Z4CA 3BF1A 3AVNA 3FE1A 5KGXA 1YVNA 3DLRA 2P9UB 3OS1A 4B9UA 1XMQK 4CFCA 4W5RA 3GOIA 3WXKA 4CZKA 2UXBK 1RFQA 2HNDA 4CF1A 2P5GA 4M3YA 1HJRA 3O3HA 2DFHA 3CCLN 1S22A 5BR9A 4DF4A 2P9NA 1HRHA 1Q86O 2YHWA 4I7FA 1YHQN 2E1ZA 2CGKA 4CEEA 1EXQA 4C8OA 5I42A 4K42A 1GLEG 3DLHA 3F9KA 4A59A 2V51B 3D7EO 2O8CA 2BE2A 1RBSA 3HVRA 4DQ8A 3MXIA 1C1AA 5AQFA 3ZETB 5AFUA 3RR8A 2E2PA 4DR4K 1Q82O 3VQBA 4F4KA 4WFAL 4JK7A 4DCHA 3RSEB 2QWLA 3OVNA 1S1XA 1S9EA 5AR0A 1HLUA 5FRMA 3ZSRA 4IKFA 4KTQA 3VESA 2PBDA 1KLNA 1HNVA 5AQTA 3UB5A 3ZSQA 3MK6A 4FZXC 3WT0A 4B9QA 1Q18A 3SYZA 4BQLA 3FR0A 1SS6A 4EAHD 2IIRA 4DV5K 3F2KA 3ZX2A 4GNIA 4BRQA 2X74A 5SWMA 1WSHA 3FGUA 3SUPA 2A1SA 4X65K 3MWTA 1QZ6A 2I5JA 3RRHA 2OANA 4FLZA 3QINA 1RNHA 4LF4K 3HRGA 5KRTA 2Z1HA 3K9KA 3THWB 5CYQA 4A2AA 4FWQA 3UKRA 1KVBA 4YOUA 3OYHA 4OLBA 2O8BA 5HRRA 3SQ2A 1HJOA 1L3SA 4FWOA 4PA1A 2O8FB 3VQAA 5E26A 5C25A 1NK0A 4JI7K 2QXFA 3OYLA 1L3UA 2F9WA 1YVUA 2NRXA 3HOSA 4PUOA 5HRNA 2YJEA 1NJYA 4RW6A 4LH4A 4HCCA 1S3XA 1NK5A 3J8AA 1QVFM 1BQNA 3L4QA 3QEXA 1W0HA 1BA0A 3TAMA 4I6MA 1VQ6N 4JI5K 2UXDK 3IMXA 5BN9A 2E2OA 1UOCA 1XNRK 2Q97A 3CHWA 1N36K 2NRRA 3CJBA 3O8MA 1NJWA 3IFRA 4GW6A 3ULDA 3FZMA 3DWLA 3U3GA 3SZ2A 2ZJQL 4XIUA 3L4IA 4CZEA 4YDUC 4DTJA 4JN4A 1D9FA 1XI1A 5BR8K 1LCUA 4CJRA 1FKOA 1DKGD 1IG8A 1ZBIA 4QS7A 4B08A 4PWDA 3H45C 4JI8K 1NGAA 2OTLN 3EL2A 3KK7A 3MMVA 4B9VA 1VQ5N 2A41A 4CJWA 5BREA 2D0OA 2ZGYA 3QBXA 4XH5A 3JYTA 3QNNA 4KRFA 1NGEA 1WUAA 3KKRA 4JYAK 2QEXN 1Q7YO 3ZSZA 1TUUA 4LF5K 3EO3A 1X9WA 1Z25A 1SUQA 1VRUA 1M1KO 3WQUA 4FOIA 4WQ5A 3V9XA 4M3WA 4LFAK 3NBPA 1K8KB 3TSPA 4Z4EA 4LF7K 3TAFA 1OH6A 3C6TA 4DTOA 4KHPK 1QSLA 3CMAN 4IG3A 1HQEA 4LC9B 4Z94A 1RILA 2VG5A 1DTTA 4ZTFA 4EIAA 1JLQA 4MLHA 4OKJA 4CK2A 3B6OA 2W42A 3OYMA 4UY8O 2VG6A 4ILGB 3D45A 3BP8A 4DSKA 4B9SA 3FZFA 1WSFA 4H0PA 3NDKA 4PQUA 2EWSA 2YKNA 2PAVA 1RBVA 2O8EB 4FW1A 1S1TA 4CD3A 3U3YA 4FM1A 4CBUA 4F9OA 3KD5E 4FWMA 2FSNA 4KKOA 4DU1A 4DSIA 1NM1A 4FJXA 5I3UA 3SAGA 3VF4A 1WSJA 1B92A 1IBMK 3M6GA 2KFZA 4BC4A 3EKSA 1RDUA 2WC9A 2QWOA 3MN9A 4CJ4A 4J2BA 4BR0A 4M42A 1QQMA 3VF2A 5M1QA 1S6PA 3QETA 5AQVA 1RTHA 4DSJA 3ZYYX 4CBXA 1RTJA 3AV9A 4A5AA 5AQYA 3NGIA 1TUYA 3DLKA 2D0PA 3L2RA 4CHPA 3VGMA 1NGBA 3V1QA 1TL1A 4FJGA 3HI0A 3I55N 3QMLA 4NXNK 3WNFA 4DU4A 2E88A 4DV4K 4JKBA 3RTVA 3RWUA 4FJIA 2CH6A 3AAQA 1U2VB 1Q9XA 1G99A 2HHHK 3GBTA 4WF9L 4L8RB 3KTQA 4O4GA 3SBGA 4OO1J 4JD2A 1LW0A 4H5TA 2GEMA 2HHVA 2YHBA 3S3MA 1HKCA 4M41A 2OPSA 4FVMA 3T1AA 3QEVA 3HZ6A 4OJRA 4HUFA 4BRMA 4JKHA 3EY1A 2WOMA 4M3XA 1JCFA 2HF3A 4C8KA 2FXUA 1KFSA 3G0ZA 4CJUA 1RGIA 1KTQA 4ZTJA 1T8EA 1U04A 3LPTA 1N33K 4A2BA 2P9UA 2FBVA 2E20A 3LDLA 4IWVA 3P39A 3VA0A 4EZ9A 5JLFA 4RG8A 1VRTA 4BRPA 1LWFA 3TI0A 2IOCA 2GUIA 5DM6L 4H5NA 1VAZA 3S41A 1RDAA 2O4IA 1UA0A 3QFPA 4DR3K 3HYFA 1NKEA 5HL7L 2A1RA 4CF2A 1VQNN 2PFUA 5K14A 3RVCA 4J2DA 2A5XA 1TKZA 2P9IB 4K25A 3KK3A 3AVCA 4OGEA 4CJ7A 3AVLA 2JGUA 2F96A 5C42A 2P9SB 4QOZB 3MXJA 3O80A 3ZSWA 3J7YP 3OYCA 4Z4IA 1VSLA 3PX0A 3VEXA 4KHWA 3AA2A 3KWGA 4CK3A 5JS1A 3ZETA 3CYMA 3G4SN 2XY8A 3ZSOA 2VWJA 5M1FA 2OYQA 2QI2A 5J2QA 1E4GT 4FPBA 3SV3A 4DQRA 3QDKA 4K41A 1NBWA 3T7ZA 4FK0A 1ASUA 3RSEA 2UXCK 4JKEA 3RRGA 4HHTA 3QO9A 3O9RA 2XO7A 2OPRA 2QKKA 1FW6A 4K8XA 3DYAA 5C10A 4B1WB 2VG7A 5CE3A 2HF4A 4BVOA 3HM8A 3CF5L 4K8ZA 1VHXA 2V7YA 3O4QA 3W3DA 1T3VA 4KB1A 3JAMO 3ENHA 4BR2A 1NGGA 2X6NA 4DSFA 2QTDA 2DPNA 3M8RA 1HKGA 1EKEA 3DM2A 2LSNA 4O44A 2ZQBA 4NCBA 3ID6A 4H0VB 2HHTA 3THWA 4BG8A 1NGFA 3EEQA 4C1NK 4KBOA 1ZBLA 3WNHA 2A3ZA 1GLLO 1ZBSA 3ITHA 3CCMN 2IVNA 2O8FA 1MA9B 2I7NA 3R6MA 3CCJN 3IDHA 5GAHP 3M3ZA 1HR0K 4OGCA 1HKBA 3PUFA 1IKWA 4BRGA 5ADXA 1W7AA 1KSPA 4BY9C 3U9DA 4KTWA 3OS2A 1UA1A 3LALA 3V9UA 4KHYA 4DMNA 1BCMA 3WEEB 2YKMA 1CZ9A 3L6QA 1RBTA 4BC2A 5GAGP 2X78A 1CXQA 4DUYK 1Q8IA 3VETA 5CYMA 4MQ3A 2D0CA 3EE9A 4FJHA 4FL9A 1TKXA 3LDSA 2ZE2A 1R59O 4GY2B 4IDHA 4E1NA 5AQHA 4H0TB 3RMBA 4E7HA 4LH5A 2F7TA 5KQDA 4DQIA 1XWLA 2QWPA 2P9LB 4O55A 4CFAA 1HX1A 1IKXA 4DR1K 3TABA 2QWMA 2PY5A 2CGLA 1YTAA 1TVRA 4G9ZA 3AVKA 4CGDA 2P1JA 2G8HA 2IC3A 3HK2A 1LAWA 3UE5A 5LJWA 4IJAA 3AARA 4F3OA 5AQWA 4FLXA 4FPAA 5AQKA 3KHYA 3WXLA 5GADP 4NYNA 3M5RA 4IFEA 1NK9A 4KPYA 5A2QO 3GE1A 2P9KB 1K8KA 1T6DA 3SLCA 2ASOA 2ZJRL 3VTIA 3ZX3A 3ALYA 1YAGA 3TTDA 1ASVA 3CERA 2BH1A 4RCHA 4BACA 3OYEA 1JLFA 1NMNA 1BIZA 5F2RA 5BRFA 5BPLA 1EWRA 4FLYA 3AGRA 2KW4A 3I56N 2FBTA 4KHNA 2ATQA 3PX4A 4FM2A 3IS9A 1U4BA 3LZIA 4Z4FA 1C1BA 3UKUB 1NKCA 2O8EA 1EO1A 1IKYA 2XY6A 3TTFA 2HVIA 4EP4A 3OY9A 2RPIA 1WBDA 4FJLA 4IZ9A 4FJ9A 1RDCA 3LM2A 3QESA 1D8YA 3VQ4A 1X9MA 4K0KK 3RR7A 3ASMA 5AQNA 1KAXA 2UUAK 3SUOA 3SJJA 1YJNN 3VA3A 2KQ2A 3ZT4A 3GG4A 2YNFA 3K5NA 1Z6RA 3CJAA 3VGKA 4CJ3A 4PL7A 3MDQA 4CIFA 4E0DA 2OA8A 5D3GA 4QS9A 4IDKA 2P9PB 5CZ2A 5C15A 1BL3A 4BRCA 3K5MA 3C95A 3SCXA 3ZCMA 1B9FA 1U2VA 4RW8A 3VEOA 4NCAA 1RT3A 2Q1NA 1Q9YA 2QKBA 3VTHA 3HPOA 4AQYK 3LPUA 4DU3A 3THXB 2VYPA 4YHHK 3U4LA 4ID5A 3BF3A 4YOWA 4BE1A 4LFBK 2NRWA 4IBNA 4U7BA 4M3UA 1QE1A 2ZWHA 3QICA 1NGCA 4DR2K 3PY8A 1J5OA 3WNGA 4R5PA 5AQLA 3OYDA 3I33A 4O0IA 3PO4A 4LF6K 2YV0X 1IBKK 1GLAG 2KLAA 3ID8A 4HTUA 4PHTX 1IJJA 1BIUA 1VQLN 3MX5A 3CPEA 4BWMA 3LWLA 1RBUA 2A40A 2E5LK 4GV9A 5IWAK 4CHYA 2GTDA 5JMVA 4A5BA 4JS5A 4JRPA 1RDBA 4M7XA 3CCSN 1NNEA 4OKKA 2JWLA 3HSTB 3LP0A 2E6LA 3J80O 5KQ8A 4E7LA 1UAXA 2P9IA 4N76A 2HHUA 5AQXA 3NH1A 1J5EK 3C94A 3MCPA 1WLJA 4FLWA 1N8RO 2GV9A 3VEYA 2HNZA 2P9SA 3SAHA 2NZTA 4QAGA 3KLEA 4RW4A 2QWRA 1MWMA 3BUZB 2VCPA 3KLGA 4PKIA 3HP6A 2GWKA 4H03B 3KLIA 4CIEA 4KO0A 4B1UB 2IVOA 3ZT3A 1CXUA 3L2UA 1BCOA 4MDBA 4BREA 5AZIB 4FWKA 2G8UA 3RMAA 3C7NB 2VQEK 4B9LA 2YHXA 3LM9A 2IAJA 4DTUA 1TGOA 2W40A 4DS5A 4DB3A 3O9TA 3U6FA 1HUXA 4N5SA 1E3MA 3CCVN 3JS6A 1SL0A 2W6KA 4WFBL 1L5UA 3MN6A 4OKEA 4F8RA 4KH4A 4CVNE 4DFKA 4CFDA 3CQ8A 4DQQA 3R1XA 4FLUA 3HBTA 4QCLA 3V4IA 3CCQN 2HMPA 3G6EN 2UU9K 2WUSA 1D5AA 1DEJA 4B1ZA 3O4WA 4F3TA 4E19A 5GIPA 4MO4A 4DR6K 3IRXA 4ILHA 4FM0A 2BDPA 5JVHL 4CERA 4E89A 5J2MA 1QVGM 3LP2A 3VGLA 4BQZA 4X64K 4B3OA 4AM6A 1LWEA 3PX6A 5FROA 4H0OA 3VEZA 1BI4B 4XH4A 1NJIO 1O13A 1GOBA 2RN2A 3QIPA 4DTNA 4DUZK 3SMPA 2V52B 3CCRN 4B9TA 3WEEA 2PZSA 3I8BA 4BDPA 1OVYA 4CJKA 2G8KA 1C1CA 3JXUA 1DLOA 4H8KA 4E7JA 3B8AX 4CF8A 3J7ZO 1BUPA 2QA4N 4FK2A 4LD0A 3L2QA 4HUEA 3CJ1A 1S72N 3NGZA 1VQPN 4CJSA 3TU5A 1OH5A 5J2NA 2YJFA 4FJKA 2QWNA 2WFBA 4CD1A 3DLLL 1N32K 1EP4A 3OJUA 4DQPA 1ZYQA 2HSTA 2P9LA 1QTMA 3C0BA 2VWKA 1ATNA 2ITMA 1IG9A 3O5BA 2UUCK 1HNWK 3HPGA 4JKCA 3SNNA 4CF0A 3HP9A 3TANA 4NCGA 1JLGA 2XHBA 2YCHA 1FJGK 3DI6A 3AA4A 3ULEB 2A6AA 5AQJA 1WNSA 3TTCA 2HVHA 4Y1CA 1KFDA 4DTMA 4E7KA 3DLEA 1NK6A 3BEXA 1NMDA 1U6ZA 1JL2A 2P9KA 2ZGZA 3KIOA 4KV8A 1SKSA 2D0BA 3SJHA 1TV6A 3AVMA 5T7BA 4YOVA 3L0QA 5LJVA 1GLJO 2HHXA 5J2PA 4HTLA 4Z0UA 1P8ZA 4CEQA 3MN5A 4CK1A 3CETA 1C6VA 3EYZA 3A5MC 4Z4HA 3K58A 1YI2N 3DRRA 3E1YA 2R7YA 1VSKA 3BY5A 3UKUA 1QQCA 4FJJA 1SAZA 2UUBK 5KPZA 1XHXA 3MEEA 3ZSYA 3A8YA 2XY7A 5KTQA 4YOXA 3CC7N 3OBWA 3TARA 1NJZA 1SL1A 1WBBA 3NF7A 4CZGA 4OLAA 4GV6A 1NJXA 4OPHA 4ELUA 4KAZA 1JCGA 4KTZA 3B6PA 1SQKA 1JLBA 4CJFA 3L3VA 3OYKA 3TR8A 2B4JA 3U8XA 3D2FB 4JRQA 1JLEA 1IV0A 1VSEA 3LAMA 3Q7CA 3AO4A 1KVCA 2QWQA 2XY5A 5LMUK 3IAYA 3ZT2A 1EX4A 2D1KA 2P9PA 1I39A 1O1WA 1BWFO 4A61A 4BVPA 5LL6Z 1ZXOA 1T6CA 2O8DB 4BGAA 3O9QA 1K6YA 3AVIA 1WB9A 3VQQA 1U45A 3NFAA 4R79A 2WTUA 4LFCK 2G8WA 3THXA 4I9QA 3L2VA 2FBYA 4C1NI 1OH7A 4AHVA 3VQ6A 4RTFD 2HNYA 4YY3K 3P31A 4CF9A 3OYFA 3VQEA 2F8SA 2QM1A 3OTOK 3KJVA 4LSNA 1RT4A 3AO2A 3F5TA 1VQMN 4IOXA 3SPZA 4E3SA 4BRHA 4OPAA 3M8QA 3TPQA 4Y1DA 1TL3A 5FPMA 4IO8A 4WE1A 4DFPA 1ILYA 3AVJA 3CC4N 4GMJB 3L3UA 4CZHA 1WOQA 4CEFA 3D2EB 4YFUA 1YITN 2Q36A 1U47A 1VQ4N 3VEWA 4WQ5C 1K8AO 3QERA 2GWJA 3CFOA 3MXMA 2ETJA 5M1NA 1NGIA 5FDLA 4H0YB 3LDPA 1WSGA 1TYQB 3H6EA 3E01A 1K73O 4LSLA 1HPZA 2D4WA 2QK9A 3KZBA 3O4NA 4HCBA 4AM7A 1VQON 3HVTA 3DAWA 1T44A 4FSVA 1QQOA 3SUNA 2YHAA 4NO7A 3V6DA 1HMVA 5H1SQ 4JKDA 4FJ8A 1GOAA 4EHTA 4FJMA 2JWKA 3PLAA 1VSDA 4CEBA 3OBYA 3K57A 2OZMA 4JNEA 3CCUN 2ASPA 3KLHA 4M3RA 4IJNA 5F0XA 4JI2K 2HMIA 4AF1A 4MFBA 2IGIA 5AZIA 3TSQA 3C7NA 2HB5A 4CJTA 5KGWA 3HOTA 3THVA 4M7YA 2RF2A 2GBZA 5HBMA 4BGBA 3A5OC 3AVAA 1S1UA 4FZZA 5CR4A 3FZLA 2ASMA 4EP5A 1N5YA 2Z1JA 4CGFA 1CZBA 5HROA 1CLQA 5BN8A 3P38A 4O5FA 1QHTA 5BRDA 4Q5VA 4JEPA 3EZWA 4ISEA 1TKDA 1QQNA 4FLVA 1A5XA 1WAJA 4L3QA 3SQ1A 4C8NA 4CZFA 3VPZA 2HBJA 3ZT1A 4CGGA 3AO5A 4BWJA 4FK4A 4DV2K 4IFYA 3VEVA 4BRKA 1NWKA 3LWMA 4KREA 5FPEA 3SPYA 4V19S 2Z1GA 3DOKA 1UWBA 1NU0A 1BI4A 4BDZA 2EHGA 4FWRA 2IDOA 1S6QA 3EKUA 5EVZA 1P90A 1G15A 4JKGB 4PKHA 3K0SA 2Q2RA 5HRSA 4JHDB 1BG3A 3CQYA 1XHZA 3OS0A 5BPNA 1JXBA 3AA3A 2P51A 3WNEA 3NH0A 2BTFA 4N56A 4FW2A 4GVEA 4GVMA 2Y1JA 4H5WA 3ZLJA 1IKVA 4JI0K 4CHNA 1HYZA 1HNZK 2XRIA 1C0FA 3ZEUB 3HPHA 4CW7B 5CHIA 4FJNA 4Z4GA 3OYAA 3ENBA 3TAGA 1SV5A 2E1YA 1YXQA 4BR4A 2E2QA 2A42A 2UYTA 1EWQA 3FFIA 1K9MO 4AHUA 3A0IX 1SKRA 4B3MK 2YX6A 3PIOL 2IS3A 1XMOK 3QEPA 3DXKB 3LP3A 3VERA 4OPKA 5KI6A 1RT5A 2F4VK 3P4IA 4IO9L 4H4OA 1RDWX 3LP1A 3MEGA 3ULEA 1M90O 1DT9A 2HOEA 4B3SK 5JLHA 5DM7L 4M45A 3KD1E 4ID1A 4YORA 4CCHA 4J2AA 1A5WA 5FPNA 3TAEA 4HWIA 4FJ7A 3MWPA 3VN5A 2J4RA 1F21A 3PSIA 3WXJA 3SQ0A 1GLFO 1LAVA 3LL3A 3VQ9A 1Y64A 4KHUA 2ZM6K 2G8FA 3H08A 3DLGA 3M8SA 1WAFA 1BGXT 1HYSA 1D4XA 3VOVA 5EX5A 4YDUA 4H5RA 1S1VA 3NAEA 4B9NA 3OW2M 1BDGA 2HBMA 4W5TA 4KB0A 3CC2N 4CESA 1XC9A 4GV3A 4IXCA 1LV5A 4ILJA 1VSJA 1RT1A 4M3ZA 3VQPA 2HHWA 3MX2A 1VSIA 3D2FA 5AFUH 3O1WA 1KCFA 3CI5A 4IEIA 4U67L 4ELVA 4DSEA 4KI6A 4BROA 2AP1A 2OZSA 4FO0A 4WQ4A 1XQSC 4M3TA 1XUPO 3ZSVA 3SAFA 2H3GX 3HL8A 3SQ4A 1V4TA 3I0RA 2QXLA 4JS4A 4DSLA 5FPDA 3VMFB 2RHKA 4ISGA 3P83D 5I9EB 1TK8A 2PYJA 2YNHA 4CZIA 3KLFA 5JVGL 4JLHA 2O8DA 3QBWA 4EZ6A 5E84A 4EHUA 3OHRA 4PY5A 2O4GA 3HJFA 4B1XB 1XC3A 2OTJN 1S9GA 4B1VA 4E1MA 4BC3A 5EXWA 1KLMA 4JKAA 3NVKA 2GUPA 2ITGA 2OPQA 4IOAL 4DTRA 2KHOA 3CPWM 3KVGA 4RWTA 3TAPA 5BPMA 4NLBA 3VQ8A 4AHSA 4CBWA 4I2PA 2ZD1A 3GL1A 3T69A 3QB0A 3LDQA 1OH8A 1NGHA 2FSJA 5AQUA 1KVAA 4BRNA 1RTIA 4X62K 3C6HA 4JI6K 3I8DA 3K59A 1HNIA 1I3AA 1FK9A 3BZCA 3AGKA 1KQSM 1VSHA 2WONA 3O3GA 1HNXK 3D2EA 2B5JA 1HPMA 4W5NA 5AQQA 1L3VA
chains in the Genus database with same CATH topology
2VG7A 3AO1A 4CIGA 1REVA 3S9HA 4G1QA 1T05A 3VQ5A 3L2WA 3D0PA 4CEOA 2G8IA 4K8ZA 4Z0UA 4DFMA 1NK7A 3KK2A 4CEQA 3O4QA 4CK1A 4KB1A 1ASWA 3EYZA 1C6VA 3OYIA 4Z4HA 3K58A 3VQ7A 2X6NA 3DRRA 2NUBA 1C0MA 2R7YA 1VSKA 3C6UA 3K2PA 1QQCA 1W9HA 3M8RA 4DSFA 5HLFA 4FJJA 2KFNA 4BDYA 1EKEA 1XHXA 3DM2A 3MEEA 2LSNA 3ZSYA 3O3FA 2FBXA 5KTQA 1DTQA 2XY7A 1TK5A 4O44A 1JL1A 5DMRA 4AILC 3TARA 2ZQBA 1NJZA 1SL1A 4NCBA 3NF7A 4OLAA 1RTDA 2HHTA 4HUGA 1NJXA 4ELUA 3S3NA 4H4MA 1ZBLA 3WNHA 4KAZA 3ITHA 4KTZA 3AVFA 4DS4A 3B6PA 3T19A 1IO2A 1JLBA 4CJFA 3L3VA 3OYKA 3TR8A 2B4JA 2YNIA 3AVBA 4JRQA 3NE6A 2YNGA 3TAQA 2B6AA 1JLEA 1WSIA 1VSEA 4OGCA 3LAMA 4FXDA 5C24A 3PUFA 1IKWA 4FZYA 4HVJA 3TWHA 3QIOA 1FXXA 3AO4A 3CFRA 1TK0A 1KSPA 3QNOA 4ELTA 4B8AB 4UQGA 1KVCA 3LZJA 4KTWA 2XY5A 4CJPA 3A2FA 3OS2A 1UA1A 2KTQA 3LALA 3IAYA 1QS4A 3MECA 3ZT2A 4CEZA 3V9UA 3SUQA 1SKSA 1EX4A 4AH9A 3V9SA 4KHYA 1RCHA 1YT3A 4Z4CA 4B9MA 3AVNA 4DMNA 1BCMA 5HP1A 1I39A 1O1WA 5KGXA 2YKMA 3DLRA 3OS1A 4B9UA 1CZ9A 4CFCA 3VQCA 1RBTA 4CEAA 4W5RA 3OYBA 1YTUA 1BQMA 2X78A 1CXQA 3P1GA 1Q8IA 2DFEA 4I9LA 4RW7A 2HNDA 5CYMA 1K6YA 1J54A 3AVIA 4MQ3A 4CF1A 2P5GA 1HJRA 2D0CA 4M3YA 3LANA 3VQQA 1U45A 3HM9A 3O3HA 4DLGA 3NFAA 4ZHRA 3F73A 4FJHA 2DFHA 4DF4A 1ZBUA 1TKXA 1HRHA 4FLTA 5DK5A 3LDSA 2G8WA 4I9QA 3L2VA 2FBYA 2ZE2A 4I7FA 2G8VA 4E1NA 4AHVA 3VQ6A 3RMBA 4CEEA 1C0UA 4E7HA 1X9SA 1EXQA 4W5QA 4C8OA 5I42A 2HNYA 3DLHA 1U49A 4LH5A 4CF9A 3F9KA 4DQIA 1ITGA 3MAQA 1XWLA 4O55A 3VQEA 4CFAA 3OYFA 2F8SA 1IKXA 3TABA 4CJVA 4CFBA 3KJVA 4DTPA 4LSNA 1RT4A 1T03A 2PY5A 3AO2A 1YTAA 2BE2A 1RBSA 1TVRA 3HVRA 3AVKA 4CGDA 3BDPA 3SPZA 2P1JA 2G8HA 2IC3A 3HK2A 1VK0A 4E3SA 1C1AA 1LAWA 3MXIA 2HW3A 4CE9A 1NOZA 3RR8A 5SZTA 4F3OA 3VQBA 4F4KA 4FLXA 2PYLA 3M8QA 2D0AA 4Y1DA 1TL3A 2RKIA 3V1OA 2EX3A 3S3OA 4NYNA 4CJLA 4WE1A 1NK9A 4DFPA 4KPYA 3AVJA 3OVNA 4ICLA 1S1XA 1S9EA 1X1PA 2JLEA 4GMJB 3L3UA 5FRMA 3ZSRA 4IKFA 4KTQA 4CEFA 4E7IA 3DRPA 4YFUA 1KLNA 1HNVA 1U47A 3ALYA 1GOCA 3ZSQA 1ASVA 4CHOA 1RT2A 4FZXC 3QERA 3MXMA 3CFOA 4BACA 2ETJA 3OYEA 1JLFA 3KK1A 1BIZA 3AVGA 3SYZA 5FDLA 1KRPA 3ZSXA 1C0TA 4FLYA 1WSGA 2KW4A 2FBTA 3E01A 4KHNA 4LSLA 1HPZA 1RT6A 2ATQA 4FM2A 3PX4A 3IS9A 2QK9A 3O4NA 1U4BA 4HCBA 5E41A 3LZIA 4Z4FA 2X74A 3HVTA 1WSHA 1JLCA 5SWMA 3V1RA 3JSMA 1C1BA 4B8CA 2A1SA 3OJSA 3SUPA 4Q0BA 3SUNA 2I5JA 2YHAA 1NKCA 3RRHA 3V6DA 1IKYA 1HMVA 2XY6A 4FLZA 1ZBFA 3QINA 3K5LA 4FJ8A 1GOAA 1RNHA 2HVIA 4FJMA 4N47A 4EP4A 3OY9A 2AJQA 5KRTA 2Z1HA 2RPIA 1VSDA 5CYQA 4CEBA 4FJLA 3K57A 1KVBA 4OLBA 4TSXA 3NF9A 3OYHA 2OZMA 1RDCA 5HRRA 3QESA 3SQ2A 1QSYA 4FJ9A 1D8YA 3KLHA 4M3RA 1L3SA 4PA1A 3KKSA 3VQ4A 3VQAA 1X9MA 2HMIA 4KI4A 1TAQA 4MFBA 5C25A 1NK0A 3RR7A 2IGIA 2QXFA 3ASMA 3OYLA 1L3UA 1YVUA 2Q3SA 3SUOA 4PUOA 3SJJA 5HRNA 3VA3A 2KQ2A 3ZT4A 2HB5A 1NJYA 4RW6A 4LH4A 2YNFA 3K5NA 4CJTA 5KGWA 3RMCA 3THVA 4HCCA 2RF2A 2GBZA 1NK5A 4CJ3A 5HBMA 4CIFA 4E0DA 3AVAA 2OA8A 1BQNA 4C8LA 1S1UA 2DFFA 3V9ZA 3V81A 3QEXA 5D3GA 4FZZA 1W0HA 4IDKA 3TAMA 5CZ2A 4EP5A 2D5RA 1N5YA 2Z1JA 3P5JA 1BL3A 4CGFA 1TAUA 3K5MA 3C95A 1CZBA 1VSFA 2HHSA 5HROA 3SCXA 3ZCMA 1CLQA 1QHTA 1UOCA 4Q5VA 3OYJA 1B9FA 4F2SA 1NJWA 4RW8A 4C8MA 4GW6A 3ULDA 4NCAA 3U3GA 3PO5A 1RT3A 3SZ2A 2OPPA 3AO3A 4IFVA 4XIUA 1TKDA 1Q9YA 4FLVA 4DTJA 1A5XA 1WAJA 3AA5X 3CFPA 3SQ1A 1D9FA 2QKBA 4C8NA 1XI1A 3HPOA 4DF8A 3LPUA 4DU3A 3ZT1A 4CGGA 3AO5A 4BWJA 4CJRA 4FK4A 4ID5A 1IH7A 4IFYA 1FKOA 3LWMA 3ZT0A 3DOLA 1ZBIA 4AHCA 4BE1A 4B08A 1NK4A 4KREA 1LWCA 4IBNA 3SPYA 4PWDA 4M3UA 2Z1GA 4CEDA 3DRSA 1QE1A 3DOKA 3I0SA 1UWBA 4BE2A 3PY8A 1BI4A 4BDZA 2EHGA 1J5OA 3NF8A 3WNGA 2IDOA 4R5PA 3OYDA 4B9VA 1S6QA 3PO4A 4O0IA 4LY7A 3CG7A 2YV0X 1WSEA 1G15A 4CJWA 3JYTA 4HTUA 3QNNA 5HRSA 4KRFA 3L8BA 1R0AA 1XHZA 4KHSA 3OS0A 1BIUA 1JXBA 3AA3A 2P51A 3KKRA 3WNEA 3NH0A 1B9DA 1HQUA 4CGHA 3ZSZA 4N56A 4FW2A 3NCIA 4BWMA 3IG1A 1X9WA 1S1WA 1SUQA 1RBUA 1VRUA 1Z25A 4GVMA 3LWLA 1Z26A 2Y1JA 3NH2A 1IKVA 3V9XA 4CHYA 3PV8A 4M3WA 4CHNA 1HYZA 3NBPA 2XRIA 3G10A 4JS5A 4KFBA 4JRPA 3SI6A 4Z4EA 1BISA 3TAFA 1TKTA 3HPHA 4CJEA 1MU2A 4YNQA 1RDBA 4CGIA 2P5OA 3C6TA 4DTOA 4FJNA 1QSLA 4Z4GA 3OYAA 4IG3A 1HQEA 1RILA 1SV5A 2VG5A 4OKKA 3TAGA 1DTTA 3HSTB 4ZTFA 1JLQA 2E6LA 3LP0A 4OKJA 4CK2A 3B6OA 2W42A 4E7LA 3T3FA 3OYMA 1UAXA 2VG6A 4N76A 3FFIA 3MEDA 4AHUA 2HHUA 1SKRA 3NH1A 1NK8A 3C94A 4DG1A 3D45A 4DSKA 1WLJA 4FLWA 4B9SA 2GV9A 5CZ1A 4CHZA 3OYNA 1WSFA 2IS3A 3QEPA 4DQSA 2HNZA 3NDKA 4PQUA 2YKNA 5FRNA 3CM6A 1JLAA 1RBRA 1RBVA 5EU7A 3VQDA 3LP3A 4FW1A 1S1TA 4QAGA 5KI6A 2FC0A 1RT5A 4OPKA 3U3YA 3KLEA 4H4OA 4FM1A 4RW4A 1JKHA 3LP1A 4CJQA 3MEGA 3KD5E 3KLGA 4DU1A 4KKOA 2Y1IA 3HP6A 4DSIA 4FJXA 1JXEA 5I3UA 3KLIA 4M45A 3KD1E 4CIEA 1J53A 4KO0A 4ID1A 3QEWA 3V9WA 3ZT3A 4CCHA 4J2AA 1WSJA 1B92A 1CXUA 3QLHA 2KFZA 1A5WA 1Y97A 3L2UA 1BCOA 3TAEA 4W5OA 1WN7A 2E4LA 2G8UA 4FJ7A 3RMAA 4CJ4A 4J2BA 4M42A 3M8PA 3VN5A 4B9LA 1F21A 2IAJA 1S6PA 4DTUA 1TGOA 3QETA 1D9DA 1RTHA 3SQ0A 4DSJA 4DS5A 1LAVA 3K5OA 3VQ9A 1RTJA 4I2QA 3AV9A 3LAKA 3NGIA 4KHUA 2G8FA 3DLKA 3DLGA 3H08A 3M8SA 3U6FA 4N5SA 3L2RA 4CHPA 1WAFA 4O5BA 3V1QA 1TL1A 1BGXT 4FJGA 1HYSA 1SL0A 1L5UA 4OKEA 4F8RA 3WNFA 4CHQA 4DU4A 1S1VA 4O0JA 3NAEA 3RTVA 4DFKA 4B9NA 3RWUA 4IG0A 4CFDA 4FJIA 3CQ8A 4DQQA 1Q9XA 1NOYA 4FLUA 4N41A 1SL2A 4L8RB 4W5TA 3V4IA 4KB0A 3HT3A 3DLBA 4QCLA 4AHTA 3KTQA 4O4GA 4CESA 3CM5A 1D5AA 1XC9A 1NKBA 1LW0A 2E6MA 3ISNC 4F3TA 4E19A 2DTUA 4KHQA 5CY4A 1LV5A 2Z1IA 1RDDA 1VSJA 3IRXA 2HHVA 1RT1A 1L3TA 4FM0A 1SKWA 2BDPA 2YHBA 4CERA 3VQPA 5J1EA 3EZ5A 3S3MA 4E89A 5J2MA 4M41A 4M3ZA 3LP2A 2OPSA 4FVMA 2HHQA 2HHWA 3T1AA 1VSIA 3QEVA 1KCFA 4OJRA 4HUFA 4ELVA 1S5JA 4DSEA 5HRPA 1LWEA 1HYVA 3PX6A 4KI6A 4B3OA 5FROA 4BE0A 3NHGA 2OZSA 1T7PA 3EY1A 1BI4B 4M3TA 2WOMA 3ZSVA 1GOBA 2RN2A 4M3XA 3QIPA 4C8KA 4DTNA 1RT7A 3QEIA 3HL8A 3G0ZA 4CGJA 1KFSA 3SQ4A 1U48A 4CJUA 3I0RA 1KTQA 4ZTJA 4JS4A 1T8EA 1U04A 4DSLA 3LPTA 4DLEA 4B9TA 3HXMA 2PZSA 4BDPA 3P83D 2FBVA 3BGRA 1TK8A 4CJKA 2PYJA 2G8KA 4AHRA 1C1CA 2YNHA 3AVHA 3KLFA 3VA0A 4DFJA 4EZ9A 4RG8A 4JLHA 1VRTA 4EZ6A 1DLOA 1VSMA 4H8KA 3NF6A 4CF8A 4E7JA 1LWFA 4DTXA 4PY5A 3TI0A 3DMJA 2IOCA 2GUIA 4FK2A 3OYGA 2O4GA 3HJFA 4LD0A 3L2QA 4HUEA 1RDAA 2O4IA 1LW2A 4FJ5A 3NGZA 1UA0A 1FKPA 4CJSA 3RMDA 1S9GA 3HYFA 4E1MA 4DTSA 5J2NA 1KLMA 1BHLA 4FJKA 3UIQA 1NKEA 2F8TA 2A1RA 2ITGA 4CF2A 1EP4A 2OPQA 4J2DA 5K14A 3OJUA 1TKZA 3KK3A 4DTRA 4DQPA 3AVCA 4OGEA 2BGGA 3TAPA 1ZYQA 4J2EA 1QTMA 3AVLA 3VQ8A 2JGUA 4AHSA 2F96A 2VWKA 5C42A 1IG9A 4I2PA 4QOZB 3MXJA 3ZSWA 3OYCA 4OVLA 3HPGA 3SNNA 2ZD1A 4Z4IA 1VSLA 4CF0A 3PX0A 3HP9A 3TANA 4KHWA 4FYDA 4NCGA 1JLGA 2XHBA 2KZZA 3AA2A 4CK3A 3SV4A 5JS1A 3CYMA 3DI6A 3AA4A 5KRSA 4F2RA 2KZMA 1KVAA 1A5VA 1WNSA 2XY8A 3ZSOA 1RTIA 2VWJA 2OYQA 2HVHA 5J2QA 4Y1CA 1KFDA 4NYFA 3SV3A 2X6SA 4E7KA 4DQRA 4DTMA 3DLEA 3I8DA 1NK6A 3K59A 1HNIA 4FK0A 1I3AA 1ASUA 1ZBHA 1FK9A 1JL2A 3NGYA 1EETA 3RRGA 4DWIA 2DY4A 3HO1A 3KIOA 4CECA 1VSHA 2WONA 2D0BA 4KV8A 4RW9A 3O3GA 4HHTA 3QO9A 1J9AA 2B5JA 4FCYA 1TV6A 4OPJA 2BANA 2XO7A 1QSSA 5JS2A 2OPRA 3AVMA 5T7BA 2QKKA 4K8XA 1N6QA 3DYAA 4W5NA 4CJ5A 1L3VA 2HHXA 5J2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VG7 A;  3AO1 A;  4CIG A;  1REV A;  3S9H A;  4G1Q A;  1T05 A;  3VQ5 A;  3L2W A;  3D0P A;  4CEO A;  2G8I A;  4K8Z A;  4Z0U A;  4DFM A;  1NK7 A;  3KK2 A;  4CEQ A;  3O4Q A;  4CK1 A;  4KB1 A;  1ASW A;  3EYZ A;  1C6V A;  3OYI A;  4Z4H A;  3K58 A;  3VQ7 A;  2X6N A;  3DRR A;  2NUB A;  1C0M A;  2R7Y A;  1VSK A;  3C6U A;  3K2P A;  1QQC A;  1W9H A;  3M8R A;  4DSF A;  5HLF A;  4FJJ A;  2KFN A;  4BDY A;  1EKE A;  1XHX A;  3DM2 A;  3MEE A;  2LSN A;  3ZSY A;  3O3F A;  2FBX A;  5KTQ A;  1DTQ A;  2XY7 A;  1TK5 A;  4O44 A;  1JL1 A;  5DMR A;  4AIL C;  3TAR A;  2ZQB A;  1NJZ A;  1SL1 A;  4NCB A;  3NF7 A;  4OLA A;  1RTD A;  2HHT A;  4HUG A;  1NJX A;  4ELU A;  3S3N A;  4H4M A;  1ZBL A;  3WNH A;  4KAZ A;  3ITH A;  4KTZ A;  3AVF A;  4DS4 A;  3B6P A;  3T19 A;  1IO2 A;  1JLB A;  4CJF A;  3L3V A;  3OYK A;  3TR8 A;  2B4J A;  2YNI A;  3AVB A;  4JRQ A;  3NE6 A;  2YNG A;  3TAQ A;  2B6A A;  1JLE A;  1WSI A;  1VSE A;  4OGC A;  3LAM A;  4FXD A;  5C24 A;  3PUF A;  1IKW A;  4FZY A;  4HVJ A;  3TWH A;  3QIO A;  1FXX A;  3AO4 A;  3CFR A;  1TK0 A;  1KSP A;  3QNO A;  4ELT A;  4B8A B;  4UQG A;  1KVC A;  3LZJ A;  4KTW A;  2XY5 A;  4CJP A;  3A2F A;  3OS2 A;  1UA1 A;  2KTQ A;  3LAL A;  3IAY A;  1QS4 A;  3MEC A;  3ZT2 A;  4CEZ A;  3V9U A;  3SUQ A;  1SKS A;  1EX4 A;  4AH9 A;  3V9S A;  4KHY A;  1RCH A;  1YT3 A;  4Z4C A;  4B9M A;  3AVN A;  4DMN A;  1BCM A;  5HP1 A;  1I39 A;  1O1W A;  5KGX A;  2YKM A;  3DLR A;  3OS1 A;  4B9U A;  1CZ9 A;  4CFC A;  3VQC A;  1RBT A;  4CEA A;  4W5R A;  3OYB A;  1YTU A;  1BQM A;  2X78 A;  1CXQ A;  3P1G A;  1Q8I A;  2DFE A;  4I9L A;  4RW7 A;  2HND A;  5CYM A;  1K6Y A;  1J54 A;  3AVI A;  4MQ3 A;  4CF1 A;  2P5G A;  1HJR A;  2D0C A;  4M3Y A;  3LAN A;  3VQQ A;  1U45 A;  3HM9 A;  3O3H A;  4DLG A;  3NFA A;  4ZHR A;  3F73 A;  4FJH A;  2DFH A;  4DF4 A;  1ZBU A;  1TKX A;  1HRH A;  4FLT A;  5DK5 A;  3LDS A;  2G8W A;  4I9Q A;  3L2V A;  2FBY A;  2ZE2 A;  4I7F A;  2G8V A;  4E1N A;  4AHV A;  3VQ6 A;  3RMB A;  4CEE A;  1C0U A;  4E7H A;  1X9S A;  1EXQ A;  4W5Q A;  4C8O A;  5I42 A;  2HNY A;  3DLH A;  1U49 A;  4LH5 A;  4CF9 A;  3F9K A;  4DQI A;  1ITG A;  3MAQ A;  1XWL A;  4O55 A;  3VQE A;  4CFA A;  3OYF A;  2F8S A;  1IKX A;  3TAB A;  4CJV A;  4CFB A;  3KJV A;  4DTP A;  4LSN A;  1RT4 A;  1T03 A;  2PY5 A;  3AO2 A;  1YTA A;  2BE2 A;  1RBS A;  1TVR A;  3HVR A;  3AVK A;  4CGD A;  3BDP A;  3SPZ A;  2P1J A;  2G8H A;  2IC3 A;  3HK2 A;  1VK0 A;  4E3S A;  1C1A A;  1LAW A;  3MXI A;  2HW3 A;  4CE9 A;  1NOZ A;  3RR8 A;  5SZT A;  4F3O A;  3VQB A;  4F4K A;  4FLX A;  2PYL A;  3M8Q A;  2D0A A;  4Y1D A;  1TL3 A;  2RKI A;  3V1O A;  2EX3 A;  3S3O A;  4NYN A;  4CJL A;  4WE1 A;  1NK9 A;  4DFP A;  4KPY A;  3AVJ A;  3OVN A;  4ICL A;  1S1X A;  1S9E A;  1X1P A;  2JLE A;  4GMJ B;  3L3U A;  5FRM A;  3ZSR A;  4IKF A;  4KTQ A;  4CEF A;  4E7I A;  3DRP A;  4YFU A;  1KLN A;  1HNV A;  1U47 A;  3ALY A;  1GOC A;  3ZSQ A;  1ASV A;  4CHO A;  1RT2 A;  4FZX C;  3QER A;  3MXM A;  3CFO A;  4BAC A;  2ETJ A;  3OYE A;  1JLF A;  3KK1 A;  1BIZ A;  3AVG A;  3SYZ A;  5FDL A;  1KRP A;  3ZSX A;  1C0T A;  4FLY A;  1WSG A;  2KW4 A;  2FBT A;  3E01 A;  4KHN A;  4LSL A;  1HPZ A;  1RT6 A;  2ATQ A;  4FM2 A;  3PX4 A;  3IS9 A;  2QK9 A;  3O4N A;  1U4B A;  4HCB A;  5E41 A;  3LZI A;  4Z4F A;  2X74 A;  3HVT A;  1WSH A;  1JLC A;  5SWM A;  3V1R A;  3JSM A;  1C1B A;  4B8C A;  2A1S A;  3OJS A;  3SUP A;  4Q0B A;  3SUN A;  2I5J A;  2YHA A;  1NKC A;  3RRH A;  3V6D A;  1IKY A;  1HMV A;  2XY6 A;  4FLZ A;  1ZBF A;  3QIN A;  3K5L A;  4FJ8 A;  1GOA A;  1RNH A;  2HVI A;  4FJM A;  4N47 A;  4EP4 A;  3OY9 A;  2AJQ A;  5KRT A;  2Z1H A;  2RPI A;  1VSD A;  5CYQ A;  4CEB A;  4FJL A;  3K57 A;  1KVB A;  4OLB A;  4TSX A;  3NF9 A;  3OYH A;  2OZM A;  1RDC A;  5HRR A;  3QES A;  3SQ2 A;  1QSY A;  4FJ9 A;  1D8Y A;  3KLH A;  4M3R A;  1L3S A;  4PA1 A;  3KKS A;  3VQ4 A;  3VQA A;  1X9M A;  2HMI A;  4KI4 A;  1TAQ A;  4MFB A;  5C25 A;  1NK0 A;  3RR7 A;  2IGI A;  2QXF A;  3ASM A;  3OYL A;  1L3U A;  1YVU A;  2Q3S A;  3SUO A;  4PUO A;  3SJJ A;  5HRN A;  3VA3 A;  2KQ2 A;  3ZT4 A;  2HB5 A;  1NJY A;  4RW6 A;  4LH4 A;  2YNF A;  3K5N A;  4CJT A;  5KGW A;  3RMC A;  3THV A;  4HCC A;  2RF2 A;  2GBZ A;  1NK5 A;  4CJ3 A;  5HBM A;  4CIF A;  4E0D A;  3AVA A;  2OA8 A;  1BQN A;  4C8L A;  1S1U A;  2DFF A;  3V9Z A;  3V81 A;  3QEX A;  5D3G A;  4FZZ A;  1W0H A;  4IDK A;  3TAM A;  5CZ2 A;  4EP5 A;  2D5R A;  1N5Y A;  2Z1J A;  3P5J A;  1BL3 A;  4CGF A;  1TAU A;  3K5M A;  3C95 A;  1CZB A;  1VSF A;  2HHS A;  5HRO A;  3SCX A;  3ZCM A;  1CLQ A;  1QHT A;  1UOC A;  4Q5V A;  3OYJ A;  1B9F A;  4F2S A;  1NJW A;  4RW8 A;  4C8M A;  4GW6 A;  3ULD A;  4NCA A;  3U3G A;  3PO5 A;  1RT3 A;  3SZ2 A;  2OPP A;  3AO3 A;  4IFV A;  4XIU A;  1TKD A;  1Q9Y A;  4FLV A;  4DTJ A;  1A5X A;  1WAJ A;  3AA5 X;  3CFP A;  3SQ1 A;  1D9F A;  2QKB A;  4C8N A;  1XI1 A;  3HPO A;  4DF8 A;  3LPU A;  4DU3 A;  3ZT1 A;  4CGG A;  3AO5 A;  4BWJ A;  4CJR A;  4FK4 A;  4ID5 A;  1IH7 A;  4IFY A;  1FKO A;  3LWM A;  3ZT0 A;  3DOL A;  1ZBI A;  4AHC A;  4BE1 A;  4B08 A;  1NK4 A;  4KRE A;  1LWC A;  4IBN A;  3SPY A;  4PWD A;  4M3U A;  2Z1G A;  4CED A;  3DRS A;  1QE1 A;  3DOK A;  3I0S A;  1UWB A;  4BE2 A;  3PY8 A;  1BI4 A;  4BDZ A;  2EHG A;  1J5O A;  3NF8 A;  3WNG A;  2IDO A;  4R5P A;  3OYD A;  4B9V A;  1S6Q A;  3PO4 A;  4O0I A;  4LY7 A;  3CG7 A;  2YV0 X;  1WSE A;  1G15 A;  4CJW A;  3JYT A;  4HTU A;  3QNN A;  5HRS A;  4KRF A;  3L8B A;  1R0A A;  1XHZ A;  4KHS A;  3OS0 A;  1BIU A;  1JXB A;  3AA3 A;  2P51 A;  3KKR A;  3WNE A;  3NH0 A;  1B9D A;  1HQU A;  4CGH A;  3ZSZ A;  4N56 A;  4FW2 A;  3NCI A;  4BWM A;  3IG1 A;  1X9W A;  1S1W A;  1SUQ A;  1RBU A;  1VRU A;  1Z25 A;  4GVM A;  3LWL A;  1Z26 A;  2Y1J A;  3NH2 A;  1IKV A;  3V9X A;  4CHY A;  3PV8 A;  4M3W A;  4CHN A;  1HYZ A;  3NBP A;  2XRI A;  3G10 A;  4JS5 A;  4KFB A;  4JRP A;  3SI6 A;  4Z4E A;  1BIS A;  3TAF A;  1TKT A;  3HPH A;  4CJE A;  1MU2 A;  4YNQ A;  1RDB A;  4CGI A;  2P5O A;  3C6T A;  4DTO A;  4FJN A;  1QSL A;  4Z4G A;  3OYA A;  4IG3 A;  1HQE A;  1RIL A;  1SV5 A;  2VG5 A;  4OKK A;  3TAG A;  1DTT A;  3HST B;  4ZTF A;  1JLQ A;  2E6L A;  3LP0 A;  4OKJ A;  4CK2 A;  3B6O A;  2W42 A;  4E7L A;  3T3F A;  3OYM A;  1UAX A;  2VG6 A;  4N76 A;  3FFI A;  3MED A;  4AHU A;  2HHU A;  1SKR A;  3NH1 A;  1NK8 A;  3C94 A;  4DG1 A;  3D45 A;  4DSK A;  1WLJ A;  4FLW A;  4B9S A;  2GV9 A;  5CZ1 A;  4CHZ A;  3OYN A;  1WSF A;  2IS3 A;  3QEP A;  4DQS A;  2HNZ A;  3NDK A;  4PQU A;  2YKN A;  5FRN A;  3CM6 A;  1JLA A;  1RBR A;  1RBV A;  5EU7 A;  3VQD A;  3LP3 A;  4FW1 A;  1S1T A;  4QAG A;  5KI6 A;  2FC0 A;  1RT5 A;  4OPK A;  3U3Y A;  3KLE A;  4H4O A;  4FM1 A;  4RW4 A;  1JKH A;  3LP1 A;  4CJQ A;  3MEG A;  3KD5 E;  3KLG A;  4DU1 A;  4KKO A;  2Y1I A;  3HP6 A;  4DSI A;  4FJX A;  1JXE A;  5I3U A;  3KLI A;  4M45 A;  3KD1 E;  4CIE A;  1J53 A;  4KO0 A;  4ID1 A;  3QEW A;  3V9W A;  3ZT3 A;  4CCH A;  4J2A A;  1WSJ A;  1B92 A;  1CXU A;  3QLH A;  2KFZ A;  1A5W A;  1Y97 A;  3L2U A;  1BCO A;  3TAE A;  4W5O A;  1WN7 A;  2E4L A;  2G8U A;  4FJ7 A;  3RMA A;  4CJ4 A;  4J2B A;  4M42 A;  3M8P A;  3VN5 A;  4B9L A;  1F21 A;  2IAJ A;  1S6P A;  4DTU A;  1TGO A;  3QET A;  1D9D A;  1RTH A;  3SQ0 A;  4DSJ A;  4DS5 A;  1LAV A;  3K5O A;  3VQ9 A;  1RTJ A;  4I2Q A;  3AV9 A;  3LAK A;  3NGI A;  4KHU A;  2G8F A;  3DLK A;  3DLG A;  3H08 A;  3M8S A;  3U6F A;  4N5S A;  3L2R A;  4CHP A;  1WAF A;  4O5B A;  3V1Q A;  1TL1 A;  1BGX T;  4FJG A;  1HYS A;  1SL0 A;  1L5U A;  4OKE A;  4F8R A;  3WNF A;  4CHQ A;  4DU4 A;  1S1V A;  4O0J A;  3NAE A;  3RTV A;  4DFK A;  4B9N A;  3RWU A;  4IG0 A;  4CFD A;  4FJI A;  3CQ8 A;  4DQQ A;  1Q9X A;  1NOY A;  4FLU A;  4N41 A;  1SL2 A;  4L8R B;  4W5T A;  3V4I A;  4KB0 A;  3HT3 A;  3DLB A;  4QCL A;  4AHT A;  3KTQ A;  4O4G A;  4CES A;  3CM5 A;  1D5A A;  1XC9 A;  1NKB A;  1LW0 A;  2E6M A;  3ISN C;  4F3T A;  4E19 A;  2DTU A;  4KHQ A;  5CY4 A;  1LV5 A;  2Z1I A;  1RDD A;  1VSJ A;  3IRX A;  2HHV A;  1RT1 A;  1L3T A;  4FM0 A;  1SKW A;  2BDP A;  2YHB A;  4CER A;  3VQP A;  5J1E A;  3EZ5 A;  3S3M A;  4E89 A;  5J2M A;  4M41 A;  4M3Z A;  3LP2 A;  2OPS A;  4FVM A;  2HHQ A;  2HHW A;  3T1A A;  1VSI A;  3QEV A;  1KCF A;  4OJR A;  4HUF A;  4ELV A;  1S5J A;  4DSE A;  5HRP A;  1LWE A;  1HYV A;  3PX6 A;  4KI6 A;  4B3O A;  5FRO A;  4BE0 A;  3NHG A;  2OZS A;  1T7P A;  3EY1 A;  1BI4 B;  4M3T A;  2WOM A;  3ZSV A;  1GOB A;  2RN2 A;  4M3X A;  3QIP A;  4C8K A;  4DTN A;  1RT7 A;  3QEI A;  3HL8 A;  3G0Z A;  4CGJ A;  1KFS A;  3SQ4 A;  1U48 A;  4CJU A;  3I0R A;  1KTQ A;  4ZTJ A;  4JS4 A;  1T8E A;  1U04 A;  4DSL A;  3LPT A;  4DLE A;  4B9T A;  3HXM A;  2PZS A;  4BDP A;  3P83 D;  2FBV A;  3BGR A;  1TK8 A;  4CJK A;  2PYJ A;  2G8K A;  4AHR A;  1C1C A;  2YNH A;  3AVH A;  3KLF A;  3VA0 A;  4DFJ A;  4EZ9 A;  4RG8 A;  4JLH A;  1VRT A;  4EZ6 A;  1DLO A;  1VSM A;  4H8K A;  3NF6 A;  4CF8 A;  4E7J A;  1LWF A;  4DTX A;  4PY5 A;  3TI0 A;  3DMJ A;  2IOC A;  2GUI A;  4FK2 A;  3OYG A;  2O4G A;  3HJF A;  4LD0 A;  3L2Q A;  4HUE A;  1RDA A;  2O4I A;  1LW2 A;  4FJ5 A;  3NGZ A;  1UA0 A;  1FKP A;  4CJS A;  3RMD A;  1S9G A;  3HYF A;  4E1M A;  4DTS A;  5J2N A;  1KLM A;  1BHL A;  4FJK A;  3UIQ A;  1NKE A;  2F8T A;  2A1R A;  2ITG A;  4CF2 A;  1EP4 A;  2OPQ A;  4J2D A;  5K14 A;  3OJU A;  1TKZ A;  3KK3 A;  4DTR A;  4DQP A;  3AVC A;  4OGE A;  2BGG A;  3TAP A;  1ZYQ A;  4J2E A;  1QTM A;  3AVL A;  3VQ8 A;  2JGU A;  4AHS A;  2F96 A;  2VWK A;  5C42 A;  1IG9 A;  4I2P A;  4QOZ B;  3MXJ A;  3ZSW A;  3OYC A;  4OVL A;  3HPG A;  3SNN A;  2ZD1 A;  4Z4I A;  1VSL A;  4CF0 A;  3PX0 A;  3HP9 A;  3TAN A;  4KHW A;  4FYD A;  4NCG A;  1JLG A;  2XHB A;  2KZZ A;  3AA2 A;  4CK3 A;  3SV4 A;  5JS1 A;  3CYM A;  3DI6 A;  3AA4 A;  5KRS A;  4F2R A;  2KZM A;  1KVA A;  1A5V A;  1WNS A;  2XY8 A;  3ZSO A;  1RTI A;  2VWJ A;  2OYQ A;  2HVH A;  5J2Q A;  4Y1C A;  1KFD A;  4NYF A;  3SV3 A;  2X6S A;  4E7K A;  4DQR A;  4DTM A;  3DLE A;  3I8D A;  1NK6 A;  3K59 A;  1HNI A;  4FK0 A;  1I3A A;  1ASU A;  1ZBH A;  1FK9 A;  1JL2 A;  3NGY A;  1EET A;  3RRG A;  4DWI A;  2DY4 A;  3HO1 A;  3KIO A;  4CEC A;  1VSH A;  2WON A;  2D0B A;  4KV8 A;  4RW9 A;  3O3G A;  4HHT A;  3QO9 A;  1J9A A;  2B5J A;  4FCY A;  1TV6 A;  4OPJ A;  2BAN A;  2XO7 A;  1QSS A;  5JS2 A;  2OPR A;  3AVM A;  5T7B A;  2QKK A;  4K8X A;  1N6Q A;  3DYA A;  4W5N A;  4CJ5 A;  1L3V A;  2HHX A;  5J2P A; 
#chains in the Genus database with same CATH topology
 3AO1 A;  4CIG A;  1REV A;  4G1Q A;  1T05 A;  3VQ5 A;  3L2W A;  3D0P A;  1TYQ A;  3TSU A;  4DFM A;  1NK7 A;  3CJC A;  1X9J A;  3IUC A;  1ASW A;  4GKJ K;  5C2D A;  5B8H A;  1C0M A;  4ISF A;  3K2P A;  5HLF A;  2KFN A;  4BDY A;  3NVM A;  1TK5 A;  3O3F A;  2FBX A;  1DTQ A;  1BA1 A;  1JL1 A;  2F9T A;  5DMR A;  2FF6 A;  3AAP A;  3J7A P;  3S3N A;  4A57 A;  4H4M A;  4KH6 A;  3DXM B;  2E2N A;  4BR9 A;  1JJ2 M;  3KWI A;  3NE6 A;  2YNG A;  1MWK A;  2B6A A;  1WSI A;  2QW9 A;  5C24 A;  3QIO A;  3QNO A;  4B8A B;  3EE8 A;  4UQG A;  3A2F A;  5AZJ B;  4BG9 A;  1QS4 A;  3MEC A;  4CEZ A;  4AH9 A;  3V9S A;  4JK9 A;  1YT3 A;  2AA4 A;  4B9M A;  5HP1 A;  1JCE A;  2CH5 A;  5EOY A;  3VQC A;  4CEA A;  1YTU A;  3OYB A;  1BQM A;  3P1G A;  2DFE A;  3FFK B;  4I9L A;  4M63 C;  4QS8 A;  4RW7 A;  4IOC L;  3CD6 N;  3O1B A;  1BU6 O;  1J54 A;  1W2B M;  4JI3 K;  3F9M A;  3LAN A;  3HM9 A;  4DLG A;  4ZHR A;  3F73 A;  1ZBU A;  4FLT A;  5DK5 A;  4BRI A;  5F1X A;  2G8V A;  4H5V A;  3R3L A;  3WQT A;  5GAE P;  1C0U A;  1X3N A;  4FWS A;  1X9S A;  3THY B;  4JI4 K;  4W5Q A;  1U49 A;  3O6W A;  1ITG A;  3MAQ A;  1NG9 A;  1KD1 O;  4CJV A;  4CFB A;  1T03 A;  4DTP A;  4B1Y B;  5C0Y A;  4WQ4 C;  4JKG A;  3BDP A;  1Q81 O;  4JHD A;  1VK0 A;  2HW3 A;  5LY3 A;  4CE9 A;  1NOZ A;  5SZT A;  3O9S A;  2PYL A;  2D0A A;  3WUH A;  2RKI A;  3V1O A;  2EX3 A;  3S3O A;  4CJL A;  3LDO A;  4ICL A;  5M1K A;  2JLE A;  1X1P A;  2YI1 A;  3H3O B;  4Y0W A;  3ZEU A;  1X3M A;  3FZH A;  4E7I A;  3DRP A;  1GOC A;  3E9P A;  1V4S A;  1KAZ A;  4CHO A;  1RT2 A;  4XH1 A;  4BRA A;  1YF5 L;  5AQI A;  3H1V X;  3KK1 A;  1KRP A;  3AVG A;  3ZSX A;  1C0T A;  2GEL A;  4FWN A;  2E8A A;  2BUP A;  1RT6 A;  4WFN L;  5E41 A;  4DR5 K;  1JLC A;  3V1R A;  3JSM A;  4B8C A;  4B3T K;  3OJS A;  4Q0B A;  2HBK A;  3DXK A;  3PSF A;  4FWL A;  5TKY A;  1ZBF A;  3K5L A;  3ATV A;  4N47 A;  2AJQ A;  4LF8 K;  3H46 O;  1NGD A;  4C23 A;  4TSX A;  3NF9 A;  4EFH A;  1QSY A;  3KKS A;  4KI4 A;  1TAQ A;  2FLO A;  3O9U A;  3HSC A;  2Q3S A;  2CGJ A;  1GLC G;  2Q0R A;  2NRT A;  3ZX0 A;  3H1Q A;  2Q0U A;  5AQZ A;  5HOO A;  4C8L A;  2DFF A;  3MCA B;  3V9Z A;  3G71 N;  3V81 A;  1VQ9 N;  2NNW A;  3K9J A;  2D5R A;  3CJ9 A;  3T1H K;  3P5J A;  1TAU A;  4DV3 K;  1VSF A;  5BRH A;  2HHS A;  4BR5 A;  3R9P A;  4BC5 A;  4JK8 A;  3OYJ A;  4PKG A;  4F2S A;  1J6Z A;  2I7P A;  4IEE A;  4C8M A;  1ATS A;  4MO5 A;  3PO5 A;  3CXC M;  2OPP A;  3AO3 A;  4IFV A;  1E4F T;  3M1F A;  4BRD A;  3AA5 X;  3IKM A;  3CFP A;  3A5L C;  3W0L A;  3C6A A;  4DF8 A;  2P9N B;  3MN7 A;  4LF9 K;  1IH7 A;  3ZT0 A;  3DOL A;  2YHY A;  4AHC A;  1NLV A;  1NK4 A;  1LWC A;  4CED A;  3DRS A;  2Q31 A;  3I0S A;  4BE2 A;  3NF8 A;  1SZ2 A;  5GIO A;  4X66 K;  1I94 K;  4LY7 A;  3CG7 A;  2O8C B;  1WSE A;  3CQX A;  5AQS A;  3DJC A;  3L8B A;  1R0A A;  4KHS A;  5TKW A;  1B9D A;  1HQU A;  4CGH A;  2W6L A;  3R8E A;  3NCI A;  1H1V A;  3IG1 A;  1S1W A;  2WBN A;  3WXM B;  1Z26 A;  5GIN A;  3NH2 A;  3PV8 A;  3G10 A;  2IVP A;  4KFB A;  3SI6 A;  1W97 L;  1BIS A;  4XEI A;  1TKT A;  1EQY A;  4CJE A;  1MU2 A;  4YNQ A;  4CGI A;  1ESV A;  2P5O A;  1BOT O;  4J8F A;  5EY4 A;  1IBL K;  4O8U A;  3CIP A;  1QZ5 A;  1YJ9 N;  3VF6 A;  4CZM A;  4BRL A;  3T3F A;  2VQF K;  3PIP L;  3MED A;  3CJ7 A;  4PL8 A;  3E66 A;  1NK8 A;  4DG1 A;  3FLC O;  5CZ1 A;  4CHZ A;  3BZK A;  3OYN A;  4DQS A;  1C0G A;  5FRN A;  3CM6 A;  1JLA A;  1OVQ A;  1RBR A;  5EU7 A;  3D6R A;  3VQD A;  2NLX A;  2FC0 A;  1JKH A;  4CJQ A;  2Y1I A;  5AQP A;  5ADX H;  1JXE A;  4B3R K;  4MDA A;  3UKR B;  2O8B B;  4H0X B;  2ZF5 O;  1J53 A;  3QEW A;  3QFU A;  3V9W A;  2NRV A;  3QLH A;  1Y97 A;  3SMS A;  1QHA A;  4W5O A;  1WN7 A;  2E4L A;  1ATR A;  1MDU B;  4MLE A;  3M8P A;  2NRH A;  1YIJ N;  4NLC A;  4OX9 K;  1D9D A;  4BRF A;  4JAX A;  3K5O A;  4I2Q A;  3GDQ A;  3LAK A;  4O8K A;  4NXM K;  3VEN A;  4YOT A;  4O5B A;  4I6M B;  3AY9 A;  4KH5 A;  4CHQ A;  3A5N C;  4FXD A;  4O0J A;  4IG0 A;  5AQR A;  1NOY A;  4N41 A;  1SL2 A;  2RE2 A;  3HT3 A;  5JIC A;  3DLB A;  4AHT A;  3WXI A;  3CM5 A;  1NKB A;  3ISN C;  2E6M A;  3NMU A;  2DTU A;  4KHQ A;  5CY4 A;  2Z1I A;  1RDD A;  3DXM A;  1YJW N;  1L3T A;  1SKW A;  5J1E A;  3EZ5 A;  1VQ7 N;  3ENO A;  2HHQ A;  1NGJ A;  3OA9 A;  2KKZ A;  1S5J A;  5HRP A;  1HYV A;  4DV6 K;  3CME N;  1CZA N;  4BE0 A;  3NHG A;  3T1Y K;  3Q7B A;  1T7P A;  3HTV A;  1KXP A;  1GLB G;  3G25 A;  3U9Z A;  3N4P A;  1RT7 A;  5AZJ A;  3QEI A;  4CGJ A;  1U48 A;  4DLE A;  1XNQ K;  5AJ3 K;  5C2F A;  3HXM A;  4JKF A;  5AQM A;  3BGR A;  1VQK N;  4AHR A;  4FOE A;  3AVH A;  2FF3 B;  4DFJ A;  2V7Z A;  4DR7 K;  1VSM A;  3NF6 A;  4DTX A;  3DMJ A;  3ATU A;  2HBL A;  3OYG A;  2W41 A;  1LW2 A;  4FJ5 A;  1FKP A;  3RMD A;  4DTS A;  3FZK A;  1BHL A;  1BO5 O;  3UIQ A;  2F8T A;  3E9O A;  3THY A;  4CI6 A;  2NRZ A;  4CZL A;  1VQ8 N;  2BGG A;  4J2E A;  4DHY A;  3SBT A;  5LMN K;  4DV7 K;  4BR7 A;  4FWP A;  4OVL A;  4FYD A;  2KZZ A;  3SV4 A;  2VGN A;  5KPR A;  5KRS A;  4F2R A;  2KZM A;  1Z05 A;  4YOY A;  1A5V A;  2GX9 A;  3LDN A;  4NYF A;  2X6S A;  1ZBH A;  2ZJP L;  3NGY A;  4NB4 A;  1EET A;  2VGM A;  4DWI A;  1YUW A;  2DY4 A;  3HO1 A;  1KC8 O;  4CEC A;  4RW9 A;  4FCY A;  1QSS A;  1J9A A;  4OPJ A;  2BAN A;  4DV1 K;  5JS2 A;  5ELZ A;  4JI1 K;  1N6Q A;  2FSK A;  4CJ5 A;  3RMC A;  4K43 A;  4FVU A;  3S9H A;  2G8I A;  3O08 A;  4CEO A;  3E9L A;  4WCE L;  3KK2 A;  4WYB A;  4CZJ A;  3OYI A;  3VQ7 A;  4DV0 K;  1OKJ A;  2NUB A;  3C6U A;  1W9H A;  1ZC6 A;  5FLX O;  3SK3 A;  5M1O A;  4AIL C;  1N34 K;  4DKW A;  1RTD A;  4JD2 B;  4HUG A;  3J81 O;  3C65 A;  5C12 A;  5AQG A;  1KAY A;  3EN9 A;  3AVF A;  4DS4 A;  1DGK N;  3T19 A;  5KPT A;  1IO2 A;  2YNI A;  3AVB A;  3N4Q A;  5AQO A;  3H3N O;  3TAQ A;  4JV5 K;  4GKK K;  5M1P A;  4FZY A;  4HVJ A;  5MLC Q;  3TWH A;  2OCE A;  1FXX A;  2VWB A;  3CFR A;  1TK0 A;  4ELT A;  3LZJ A;  1GLD G;  4E1J A;  4CJP A;  5IT9 O;  1LOT B;  2KTQ A;  3SUQ A;  4A62 A;  3CCE N;  1RCH A;  4Z4C A;  3BF1 A;  3AVN A;  3FE1 A;  5KGX A;  1YVN A;  3DLR A;  2P9U B;  3OS1 A;  4B9U A;  1XMQ K;  4CFC A;  4W5R A;  3GOI A;  3WXK A;  4CZK A;  2UXB K;  1RFQ A;  2HND A;  4CF1 A;  2P5G A;  4M3Y A;  1HJR A;  3O3H A;  2DFH A;  3CCL N;  1S22 A;  5BR9 A;  4DF4 A;  2P9N A;  1HRH A;  1Q86 O;  2YHW A;  4I7F A;  1YHQ N;  2E1Z A;  2CGK A;  4CEE A;  1EXQ A;  4C8O A;  5I42 A;  4K42 A;  1GLE G;  3DLH A;  3F9K A;  4A59 A;  2V51 B;  3D7E O;  2O8C A;  2BE2 A;  1RBS A;  3HVR A;  4DQ8 A;  3MXI A;  1C1A A;  5AQF A;  3ZET B;  5AFU A;  3RR8 A;  2E2P A;  4DR4 K;  1Q82 O;  3VQB A;  4F4K A;  4WFA L;  4JK7 A;  4DCH A;  3RSE B;  2QWL A;  3OVN A;  1S1X A;  1S9E A;  5AR0 A;  1HLU A;  5FRM A;  3ZSR A;  4IKF A;  4KTQ A;  3VES A;  2PBD A;  1KLN A;  1HNV A;  5AQT A;  3UB5 A;  3ZSQ A;  3MK6 A;  4FZX C;  3WT0 A;  4B9Q A;  1Q18 A;  3SYZ A;  4BQL A;  3FR0 A;  1SS6 A;  4EAH D;  2IIR A;  4DV5 K;  3F2K A;  3ZX2 A;  4GNI A;  4BRQ A;  2X74 A;  5SWM A;  1WSH A;  3FGU A;  3SUP A;  2A1S A;  4X65 K;  3MWT A;  1QZ6 A;  2I5J A;  3RRH A;  2OAN A;  4FLZ A;  3QIN A;  1RNH A;  4LF4 K;  3HRG A;  5KRT A;  2Z1H A;  3K9K A;  3THW B;  5CYQ A;  4A2A A;  4FWQ A;  3UKR A;  1KVB A;  4YOU A;  3OYH A;  4OLB A;  2O8B A;  5HRR A;  3SQ2 A;  1HJO A;  1L3S A;  4FWO A;  4PA1 A;  2O8F B;  3VQA A;  5E26 A;  5C25 A;  1NK0 A;  4JI7 K;  2QXF A;  3OYL A;  1L3U A;  2F9W A;  1YVU A;  2NRX A;  3HOS A;  4PUO A;  5HRN A;  2YJE A;  1NJY A;  4RW6 A;  4LH4 A;  4HCC A;  1S3X A;  1NK5 A;  3J8A A;  1QVF M;  1BQN A;  3L4Q A;  3QEX A;  1W0H A;  1BA0 A;  3TAM A;  4I6M A;  1VQ6 N;  4JI5 K;  2UXD K;  3IMX A;  5BN9 A;  2E2O A;  1UOC A;  1XNR K;  2Q97 A;  3CHW A;  1N36 K;  2NRR A;  3CJB A;  3O8M A;  1NJW A;  3IFR A;  4GW6 A;  3ULD A;  3FZM A;  3DWL A;  3U3G A;  3SZ2 A;  2ZJQ L;  4XIU A;  3L4I A;  4CZE A;  4YDU C;  4DTJ A;  4JN4 A;  1D9F A;  1XI1 A;  5BR8 K;  1LCU A;  4CJR A;  1FKO A;  1DKG D;  1IG8 A;  1ZBI A;  4QS7 A;  4B08 A;  4PWD A;  3H45 C;  4JI8 K;  1NGA A;  2OTL N;  3EL2 A;  3KK7 A;  3MMV A;  4B9V A;  1VQ5 N;  2A41 A;  4CJW A;  5BRE A;  2D0O A;  2ZGY A;  3QBX A;  4XH5 A;  3JYT A;  3QNN A;  4KRF A;  1NGE A;  1WUA A;  3KKR A;  4JYA K;  2QEX N;  1Q7Y O;  3ZSZ A;  1TUU A;  4LF5 K;  3EO3 A;  1X9W A;  1Z25 A;  1SUQ A;  1VRU A;  1M1K O;  3WQU A;  4FOI A;  4WQ5 A;  3V9X A;  4M3W A;  4LFA K;  3NBP A;  1K8K B;  3TSP A;  4Z4E A;  4LF7 K;  3TAF A;  1OH6 A;  3C6T A;  4DTO A;  4KHP K;  1QSL A;  3CMA N;  4IG3 A;  1HQE A;  4LC9 B;  4Z94 A;  1RIL A;  2VG5 A;  1DTT A;  4ZTF A;  4EIA A;  1JLQ A;  4MLH A;  4OKJ A;  4CK2 A;  3B6O A;  2W42 A;  3OYM A;  4UY8 O;  2VG6 A;  4ILG B;  3D45 A;  3BP8 A;  4DSK A;  4B9S A;  3FZF A;  1WSF A;  4H0P A;  3NDK A;  4PQU A;  2EWS A;  2YKN A;  2PAV A;  1RBV A;  2O8E B;  4FW1 A;  1S1T A;  4CD3 A;  3U3Y A;  4FM1 A;  4CBU A;  4F9O A;  3KD5 E;  4FWM A;  2FSN A;  4KKO A;  4DU1 A;  4DSI A;  1NM1 A;  4FJX A;  5I3U A;  3SAG A;  3VF4 A;  1WSJ A;  1B92 A;  1IBM K;  3M6G A;  2KFZ A;  4BC4 A;  3EKS A;  1RDU A;  2WC9 A;  2QWO A;  3MN9 A;  4CJ4 A;  4J2B A;  4BR0 A;  4M42 A;  1QQM A;  3VF2 A;  5M1Q A;  1S6P A;  3QET A;  5AQV A;  1RTH A;  4DSJ A;  3ZYY X;  4CBX A;  1RTJ A;  3AV9 A;  4A5A A;  5AQY A;  3NGI A;  1TUY A;  3DLK A;  2D0P A;  3L2R A;  4CHP A;  3VGM A;  1NGB A;  3V1Q A;  1TL1 A;  4FJG A;  3HI0 A;  3I55 N;  3QML A;  4NXN K;  3WNF A;  4DU4 A;  2E88 A;  4DV4 K;  4JKB A;  3RTV A;  3RWU A;  4FJI A;  2CH6 A;  3AAQ A;  1U2V B;  1Q9X A;  1G99 A;  2HHH K;  3GBT A;  4WF9 L;  4L8R B;  3KTQ A;  4O4G A;  3SBG A;  4OO1 J;  4JD2 A;  1LW0 A;  4H5T A;  2GEM A;  2HHV A;  2YHB A;  3S3M A;  1HKC A;  4M41 A;  2OPS A;  4FVM A;  3T1A A;  3QEV A;  3HZ6 A;  4OJR A;  4HUF A;  4BRM A;  4JKH A;  3EY1 A;  2WOM A;  4M3X A;  1JCF A;  2HF3 A;  4C8K A;  2FXU A;  1KFS A;  3G0Z A;  4CJU A;  1RGI A;  1KTQ A;  4ZTJ A;  1T8E A;  1U04 A;  3LPT A;  1N33 K;  4A2B A;  2P9U A;  2FBV A;  2E20 A;  3LDL A;  4IWV A;  3P39 A;  3VA0 A;  4EZ9 A;  5JLF A;  4RG8 A;  1VRT A;  4BRP A;  1LWF A;  3TI0 A;  2IOC A;  2GUI A;  5DM6 L;  4H5N A;  1VAZ A;  3S41 A;  1RDA A;  2O4I A;  1UA0 A;  3QFP A;  4DR3 K;  3HYF A;  1NKE A;  5HL7 L;  2A1R A;  4CF2 A;  1VQN N;  2PFU A;  5K14 A;  3RVC A;  4J2D A;  2A5X A;  1TKZ A;  2P9I B;  4K25 A;  3KK3 A;  3AVC A;  4OGE A;  4CJ7 A;  3AVL A;  2JGU A;  2F96 A;  5C42 A;  2P9S B;  4QOZ B;  3MXJ A;  3O80 A;  3ZSW A;  3J7Y P;  3OYC A;  4Z4I A;  1VSL A;  3PX0 A;  3VEX A;  4KHW A;  3AA2 A;  3KWG A;  4CK3 A;  5JS1 A;  3ZET A;  3CYM A;  3G4S N;  2XY8 A;  3ZSO A;  2VWJ A;  5M1F A;  2OYQ A;  2QI2 A;  5J2Q A;  1E4G T;  4FPB A;  3SV3 A;  4DQR A;  3QDK A;  4K41 A;  1NBW A;  3T7Z A;  4FK0 A;  1ASU A;  3RSE A;  2UXC K;  4JKE A;  3RRG A;  4HHT A;  3QO9 A;  3O9R A;  2XO7 A;  2OPR A;  2QKK A;  1FW6 A;  4K8X A;  3DYA A;  5C10 A;  4B1W B;  2VG7 A;  5CE3 A;  2HF4 A;  4BVO A;  3HM8 A;  3CF5 L;  4K8Z A;  1VHX A;  2V7Y A;  3O4Q A;  3W3D A;  1T3V A;  4KB1 A;  3JAM O;  3ENH A;  4BR2 A;  1NGG A;  2X6N A;  4DSF A;  2QTD A;  2DPN A;  3M8R A;  1HKG A;  1EKE A;  3DM2 A;  2LSN A;  4O44 A;  2ZQB A;  4NCB A;  3ID6 A;  4H0V B;  2HHT A;  3THW A;  4BG8 A;  1NGF A;  3EEQ A;  4C1N K;  4KBO A;  1ZBL A;  3WNH A;  2A3Z A;  1GLL O;  1ZBS A;  3ITH A;  3CCM N;  2IVN A;  2O8F A;  1MA9 B;  2I7N A;  3R6M A;  3CCJ N;  3IDH A;  5GAH P;  3M3Z A;  1HR0 K;  4OGC A;  1HKB A;  3PUF A;  1IKW A;  4BRG A;  5ADX A;  1W7A A;  1KSP A;  4BY9 C;  3U9D A;  4KTW A;  3OS2 A;  1UA1 A;  3LAL A;  3V9U A;  4KHY A;  4DMN A;  1BCM A;  3WEE B;  2YKM A;  1CZ9 A;  3L6Q A;  1RBT A;  4BC2 A;  5GAG P;  2X78 A;  1CXQ A;  4DUY K;  1Q8I A;  3VET A;  5CYM A;  4MQ3 A;  2D0C A;  3EE9 A;  4FJH A;  4FL9 A;  1TKX A;  3LDS A;  2ZE2 A;  1R59 O;  4GY2 B;  4IDH A;  4E1N A;  5AQH A;  4H0T B;  3RMB A;  4E7H A;  4LH5 A;  2F7T A;  5KQD A;  4DQI A;  1XWL A;  2QWP A;  2P9L B;  4O55 A;  4CFA A;  1HX1 A;  1IKX A;  4DR1 K;  3TAB A;  2QWM A;  2PY5 A;  2CGL A;  1YTA A;  1TVR A;  4G9Z A;  3AVK A;  4CGD A;  2P1J A;  2G8H A;  2IC3 A;  3HK2 A;  1LAW A;  3UE5 A;  5LJW A;  4IJA A;  3AAR A;  4F3O A;  5AQW A;  4FLX A;  4FPA A;  5AQK A;  3KHY A;  3WXL A;  5GAD P;  4NYN A;  3M5R A;  4IFE A;  1NK9 A;  4KPY A;  5A2Q O;  3GE1 A;  2P9K B;  1K8K A;  1T6D A;  3SLC A;  2ASO A;  2ZJR L;  3VTI A;  3ZX3 A;  3ALY A;  1YAG A;  3TTD A;  1ASV A;  3CER A;  2BH1 A;  4RCH A;  4BAC A;  3OYE A;  1JLF A;  1NMN A;  1BIZ A;  5F2R A;  5BRF A;  5BPL A;  1EWR A;  4FLY A;  3AGR A;  2KW4 A;  3I56 N;  2FBT A;  4KHN A;  2ATQ A;  3PX4 A;  4FM2 A;  3IS9 A;  1U4B A;  3LZI A;  4Z4F A;  1C1B A;  3UKU B;  1NKC A;  2O8E A;  1EO1 A;  1IKY A;  2XY6 A;  3TTF A;  2HVI A;  4EP4 A;  3OY9 A;  2RPI A;  1WBD A;  4FJL A;  4IZ9 A;  4FJ9 A;  1RDC A;  3LM2 A;  3QES A;  1D8Y A;  3VQ4 A;  1X9M A;  4K0K K;  3RR7 A;  3ASM A;  5AQN A;  1KAX A;  2UUA K;  3SUO A;  3SJJ A;  1YJN N;  3VA3 A;  2KQ2 A;  3ZT4 A;  3GG4 A;  2YNF A;  3K5N A;  1Z6R A;  3CJA A;  3VGK A;  4CJ3 A;  4PL7 A;  3MDQ A;  4CIF A;  4E0D A;  2OA8 A;  5D3G A;  4QS9 A;  4IDK A;  2P9P B;  5CZ2 A;  5C15 A;  1BL3 A;  4BRC A;  3K5M A;  3C95 A;  3SCX A;  3ZCM A;  1B9F A;  1U2V A;  4RW8 A;  3VEO A;  4NCA A;  1RT3 A;  2Q1N A;  1Q9Y A;  2QKB A;  3VTH A;  3HPO A;  4AQY K;  3LPU A;  4DU3 A;  3THX B;  2VYP A;  4YHH K;  3U4L A;  4ID5 A;  3BF3 A;  4YOW A;  4BE1 A;  4LFB K;  2NRW A;  4IBN A;  4U7B A;  4M3U A;  1QE1 A;  2ZWH A;  3QIC A;  1NGC A;  4DR2 K;  3PY8 A;  1J5O A;  3WNG A;  4R5P A;  5AQL A;  3OYD A;  3I33 A;  4O0I A;  3PO4 A;  4LF6 K;  2YV0 X;  1IBK K;  1GLA G;  2KLA A;  3ID8 A;  4HTU A;  4PHT X;  1IJJ A;  1BIU A;  1VQL N;  3MX5 A;  3CPE A;  4BWM A;  3LWL A;  1RBU A;  2A40 A;  2E5L K;  4GV9 A;  5IWA K;  4CHY A;  2GTD A;  5JMV A;  4A5B A;  4JS5 A;  4JRP A;  1RDB A;  4M7X A;  3CCS N;  1NNE A;  4OKK A;  2JWL A;  3HST B;  3LP0 A;  2E6L A;  3J80 O;  5KQ8 A;  4E7L A;  1UAX A;  2P9I A;  4N76 A;  2HHU A;  5AQX A;  3NH1 A;  1J5E K;  3C94 A;  3MCP A;  1WLJ A;  4FLW A;  1N8R O;  2GV9 A;  3VEY A;  2HNZ A;  2P9S A;  3SAH A;  2NZT A;  4QAG A;  3KLE A;  4RW4 A;  2QWR A;  1MWM A;  3BUZ B;  2VCP A;  3KLG A;  4PKI A;  3HP6 A;  2GWK A;  4H03 B;  3KLI A;  4CIE A;  4KO0 A;  4B1U B;  2IVO A;  3ZT3 A;  1CXU A;  3L2U A;  1BCO A;  4MDB A;  4BRE A;  5AZI B;  4FWK A;  2G8U A;  3RMA A;  3C7N B;  2VQE K;  4B9L A;  2YHX A;  3LM9 A;  2IAJ A;  4DTU A;  1TGO A;  2W40 A;  4DS5 A;  4DB3 A;  3O9T A;  3U6F A;  1HUX A;  4N5S A;  1E3M A;  3CCV N;  3JS6 A;  1SL0 A;  2W6K A;  4WFB L;  1L5U A;  3MN6 A;  4OKE A;  4F8R A;  4KH4 A;  4CVN E;  4DFK A;  4CFD A;  3CQ8 A;  4DQQ A;  3R1X A;  4FLU A;  3HBT A;  4QCL A;  3V4I A;  3CCQ N;  2HMP A;  3G6E N;  2UU9 K;  2WUS A;  1D5A A;  1DEJ A;  4B1Z A;  3O4W A;  4F3T A;  4E19 A;  5GIP A;  4MO4 A;  4DR6 K;  3IRX A;  4ILH A;  4FM0 A;  2BDP A;  5JVH L;  4CER A;  4E89 A;  5J2M A;  1QVG M;  3LP2 A;  3VGL A;  4BQZ A;  4X64 K;  4B3O A;  4AM6 A;  1LWE A;  3PX6 A;  5FRO A;  4H0O A;  3VEZ A;  1BI4 B;  4XH4 A;  1NJI O;  1O13 A;  1GOB A;  2RN2 A;  3QIP A;  4DTN A;  4DUZ K;  3SMP A;  2V52 B;  3CCR N;  4B9T A;  3WEE A;  2PZS A;  3I8B A;  4BDP A;  1OVY A;  4CJK A;  2G8K A;  1C1C A;  3JXU A;  1DLO A;  4H8K A;  4E7J A;  3B8A X;  4CF8 A;  3J7Z O;  1BUP A;  2QA4 N;  4FK2 A;  4LD0 A;  3L2Q A;  4HUE A;  3CJ1 A;  1S72 N;  3NGZ A;  1VQP N;  4CJS A;  3TU5 A;  1OH5 A;  5J2N A;  2YJF A;  4FJK A;  2QWN A;  2WFB A;  4CD1 A;  3DLL L;  1N32 K;  1EP4 A;  3OJU A;  4DQP A;  1ZYQ A;  2HST A;  2P9L A;  1QTM A;  3C0B A;  2VWK A;  1ATN A;  2ITM A;  1IG9 A;  3O5B A;  2UUC K;  1HNW K;  3HPG A;  4JKC A;  3SNN A;  4CF0 A;  3HP9 A;  3TAN A;  4NCG A;  1JLG A;  2XHB A;  2YCH A;  1FJG K;  3DI6 A;  3AA4 A;  3ULE B;  2A6A A;  5AQJ A;  1WNS A;  3TTC A;  2HVH A;  4Y1C A;  1KFD A;  4DTM A;  4E7K A;  3DLE A;  1NK6 A;  3BEX A;  1NMD A;  1U6Z A;  1JL2 A;  2P9K A;  2ZGZ A;  3KIO A;  4KV8 A;  1SKS A;  2D0B A;  3SJH A;  1TV6 A;  3AVM A;  5T7B A;  4YOV A;  3L0Q A;  5LJV A;  1GLJ O;  2HHX A;  5J2P A;  4HTL A;  4Z0U A;  1P8Z A;  4CEQ A;  3MN5 A;  4CK1 A;  3CET A;  1C6V A;  3EYZ A;  3A5M C;  4Z4H A;  3K58 A;  1YI2 N;  3DRR A;  3E1Y A;  2R7Y A;  1VSK A;  3BY5 A;  3UKU A;  1QQC A;  4FJJ A;  1SAZ A;  2UUB K;  5KPZ A;  1XHX A;  3MEE A;  3ZSY A;  3A8Y A;  2XY7 A;  5KTQ A;  4YOX A;  3CC7 N;  3OBW A;  3TAR A;  1NJZ A;  1SL1 A;  1WBB A;  3NF7 A;  4CZG A;  4OLA A;  4GV6 A;  1NJX A;  4OPH A;  4ELU A;  4KAZ A;  1JCG A;  4KTZ A;  3B6P A;  1SQK A;  1JLB A;  4CJF A;  3L3V A;  3OYK A;  3TR8 A;  2B4J A;  3U8X A;  3D2F B;  4JRQ A;  1JLE A;  1IV0 A;  1VSE A;  3LAM A;  3Q7C A;  3AO4 A;  1KVC A;  2QWQ A;  2XY5 A;  5LMU K;  3IAY A;  3ZT2 A;  1EX4 A;  2D1K A;  2P9P A;  1I39 A;  1O1W A;  1BWF O;  4A61 A;  4BVP A;  5LL6 Z;  1ZXO A;  1T6C A;  2O8D B;  4BGA A;  3O9Q A;  1K6Y A;  3AVI A;  1WB9 A;  3VQQ A;  1U45 A;  3NFA A;  4R79 A;  2WTU A;  4LFC K;  2G8W A;  3THX A;  4I9Q A;  3L2V A;  2FBY A;  4C1N I;  1OH7 A;  4AHV A;  3VQ6 A;  4RTF D;  2HNY A;  4YY3 K;  3P31 A;  4CF9 A;  3OYF A;  3VQE A;  2F8S A;  2QM1 A;  3OTO K;  3KJV A;  4LSN A;  1RT4 A;  3AO2 A;  3F5T A;  1VQM N;  4IOX A;  3SPZ A;  4E3S A;  4BRH A;  4OPA A;  3M8Q A;  3TPQ A;  4Y1D A;  1TL3 A;  5FPM A;  4IO8 A;  4WE1 A;  4DFP A;  1ILY A;  3AVJ A;  3CC4 N;  4GMJ B;  3L3U A;  4CZH A;  1WOQ A;  4CEF A;  3D2E B;  4YFU A;  1YIT N;  2Q36 A;  1U47 A;  1VQ4 N;  3VEW A;  4WQ5 C;  1K8A O;  3QER A;  2GWJ A;  3CFO A;  3MXM A;  2ETJ A;  5M1N A;  1NGI A;  5FDL A;  4H0Y B;  3LDP A;  1WSG A;  1TYQ B;  3H6E A;  3E01 A;  1K73 O;  4LSL A;  1HPZ A;  2D4W A;  2QK9 A;  3KZB A;  3O4N A;  4HCB A;  4AM7 A;  1VQO N;  3HVT A;  3DAW A;  1T44 A;  4FSV A;  1QQO A;  3SUN A;  2YHA A;  4NO7 A;  3V6D A;  1HMV A;  5H1S Q;  4JKD A;  4FJ8 A;  1GOA A;  4EHT A;  4FJM A;  2JWK A;  3PLA A;  1VSD A;  4CEB A;  3OBY A;  3K57 A;  2OZM A;  4JNE A;  3CCU N;  2ASP A;  3KLH A;  4M3R A;  4IJN A;  5F0X A;  4JI2 K;  2HMI A;  4AF1 A;  4MFB A;  2IGI A;  5AZI A;  3TSQ A;  3C7N A;  2HB5 A;  4CJT A;  5KGW A;  3HOT A;  3THV A;  4M7Y A;  2RF2 A;  2GBZ A;  5HBM A;  4BGB A;  3A5O C;  3AVA A;  1S1U A;  4FZZ A;  5CR4 A;  3FZL A;  2ASM A;  4EP5 A;  1N5Y A;  2Z1J A;  4CGF A;  1CZB A;  5HRO A;  1CLQ A;  5BN8 A;  3P38 A;  4O5F A;  1QHT A;  5BRD A;  4Q5V A;  4JEP A;  3EZW A;  4ISE A;  1TKD A;  1QQN A;  4FLV A;  1A5X A;  1WAJ A;  4L3Q A;  3SQ1 A;  4C8N A;  4CZF A;  3VPZ A;  2HBJ A;  3ZT1 A;  4CGG A;  3AO5 A;  4BWJ A;  4FK4 A;  4DV2 K;  4IFY A;  3VEV A;  4BRK A;  1NWK A;  3LWM A;  4KRE A;  5FPE A;  3SPY A;  4V19 S;  2Z1G A;  3DOK A;  1UWB A;  1NU0 A;  1BI4 A;  4BDZ A;  2EHG A;  4FWR A;  2IDO A;  1S6Q A;  3EKU A;  5EVZ A;  1P90 A;  1G15 A;  4JKG B;  4PKH A;  3K0S A;  2Q2R A;  5HRS A;  4JHD B;  1BG3 A;  3CQY A;  1XHZ A;  3OS0 A;  5BPN A;  1JXB A;  3AA3 A;  2P51 A;  3WNE A;  3NH0 A;  2BTF A;  4N56 A;  4FW2 A;  4GVE A;  4GVM A;  2Y1J A;  4H5W A;  3ZLJ A;  1IKV A;  4JI0 K;  4CHN A;  1HYZ A;  1HNZ K;  2XRI A;  1C0F A;  3ZEU B;  3HPH A;  4CW7 B;  5CHI A;  4FJN A;  4Z4G A;  3OYA A;  3ENB A;  3TAG A;  1SV5 A;  2E1Y A;  1YXQ A;  4BR4 A;  2E2Q A;  2A42 A;  2UYT A;  1EWQ A;  3FFI A;  1K9M O;  4AHU A;  3A0I X;  1SKR A;  4B3M K;  2YX6 A;  3PIO L;  2IS3 A;  1XMO K;  3QEP A;  3DXK B;  3LP3 A;  3VER A;  4OPK A;  5KI6 A;  1RT5 A;  2F4V K;  3P4I A;  4IO9 L;  4H4O A;  1RDW X;  3LP1 A;  3MEG A;  3ULE A;  1M90 O;  1DT9 A;  2HOE A;  4B3S K;  5JLH A;  5DM7 L;  4M45 A;  3KD1 E;  4ID1 A;  4YOR A;  4CCH A;  4J2A A;  1A5W A;  5FPN A;  3TAE A;  4HWI A;  4FJ7 A;  3MWP A;  3VN5 A;  2J4R A;  1F21 A;  3PSI A;  3WXJ A;  3SQ0 A;  1GLF O;  1LAV A;  3LL3 A;  3VQ9 A;  1Y64 A;  4KHU A;  2ZM6 K;  2G8F A;  3H08 A;  3DLG A;  3M8S A;  1WAF A;  1BGX T;  1HYS A;  1D4X A;  3VOV A;  5EX5 A;  4YDU A;  4H5R A;  1S1V A;  3NAE A;  4B9N A;  3OW2 M;  1BDG A;  2HBM A;  4W5T A;  4KB0 A;  3CC2 N;  4CES A;  1XC9 A;  4GV3 A;  4IXC A;  1LV5 A;  4ILJ A;  1VSJ A;  1RT1 A;  4M3Z A;  3VQP A;  2HHW A;  3MX2 A;  1VSI A;  3D2F A;  5AFU H;  3O1W A;  1KCF A;  3CI5 A;  4IEI A;  4U67 L;  4ELV A;  4DSE A;  4KI6 A;  4BRO A;  2AP1 A;  2OZS A;  4FO0 A;  4WQ4 A;  1XQS C;  4M3T A;  1XUP O;  3ZSV A;  3SAF A;  2H3G X;  3HL8 A;  3SQ4 A;  1V4T A;  3I0R A;  2QXL A;  4JS4 A;  4DSL A;  5FPD A;  3VMF B;  2RHK A;  4ISG A;  3P83 D;  5I9E B;  1TK8 A;  2PYJ A;  2YNH A;  4CZI A;  3KLF A;  5JVG L;  4JLH A;  2O8D A;  3QBW A;  4EZ6 A;  5E84 A;  4EHU A;  3OHR A;  4PY5 A;  2O4G A;  3HJF A;  4B1X B;  1XC3 A;  2OTJ N;  1S9G A;  4B1V A;  4E1M A;  4BC3 A;  5EXW A;  1KLM A;  4JKA A;  3NVK A;  2GUP A;  2ITG A;  2OPQ A;  4IOA L;  4DTR A;  2KHO A;  3CPW M;  3KVG A;  4RWT A;  3TAP A;  5BPM A;  4NLB A;  3VQ8 A;  4AHS A;  4CBW A;  4I2P A;  2ZD1 A;  3GL1 A;  3T69 A;  3QB0 A;  3LDQ A;  1OH8 A;  1NGH A;  2FSJ A;  5AQU A;  1KVA A;  4BRN A;  1RTI A;  4X62 K;  3C6H A;  4JI6 K;  3I8D A;  3K59 A;  1HNI A;  1I3A A;  1FK9 A;  3BZC A;  3AGK A;  1KQS M;  1VSH A;  2WON A;  3O3G A;  1HNX K;  3D2E A;  2B5J A;  1HPM A;  4W5N A;  5AQQ A;  1L3V A; 
#chains in the Genus database with same CATH homology
 2VG7 A;  3AO1 A;  4CIG A;  1REV A;  3S9H A;  4G1Q A;  1T05 A;  3VQ5 A;  3L2W A;  3D0P A;  4CEO A;  2G8I A;  4K8Z A;  4Z0U A;  4DFM A;  1NK7 A;  3KK2 A;  4CEQ A;  3O4Q A;  4CK1 A;  4KB1 A;  1ASW A;  3EYZ A;  1C6V A;  3OYI A;  4Z4H A;  3K58 A;  3VQ7 A;  2X6N A;  3DRR A;  2NUB A;  1C0M A;  2R7Y A;  1VSK A;  3C6U A;  3K2P A;  1QQC A;  1W9H A;  3M8R A;  4DSF A;  5HLF A;  4FJJ A;  2KFN A;  4BDY A;  1EKE A;  1XHX A;  3DM2 A;  3MEE A;  2LSN A;  3ZSY A;  3O3F A;  2FBX A;  5KTQ A;  1DTQ A;  2XY7 A;  1TK5 A;  4O44 A;  1JL1 A;  5DMR A;  4AIL C;  3TAR A;  2ZQB A;  1NJZ A;  1SL1 A;  4NCB A;  3NF7 A;  4OLA A;  1RTD A;  2HHT A;  4HUG A;  1NJX A;  4ELU A;  3S3N A;  4H4M A;  1ZBL A;  3WNH A;  4KAZ A;  3ITH A;  4KTZ A;  3AVF A;  4DS4 A;  3B6P A;  3T19 A;  1IO2 A;  1JLB A;  4CJF A;  3L3V A;  3OYK A;  3TR8 A;  2B4J A;  2YNI A;  3AVB A;  4JRQ A;  3NE6 A;  2YNG A;  3TAQ A;  2B6A A;  1JLE A;  1WSI A;  1VSE A;  4OGC A;  3LAM A;  4FXD A;  5C24 A;  3PUF A;  1IKW A;  4FZY A;  4HVJ A;  3TWH A;  3QIO A;  1FXX A;  3AO4 A;  3CFR A;  1TK0 A;  1KSP A;  3QNO A;  4ELT A;  4B8A B;  4UQG A;  1KVC A;  3LZJ A;  4KTW A;  2XY5 A;  4CJP A;  3A2F A;  3OS2 A;  1UA1 A;  2KTQ A;  3LAL A;  3IAY A;  1QS4 A;  3MEC A;  3ZT2 A;  4CEZ A;  3V9U A;  3SUQ A;  1SKS A;  1EX4 A;  4AH9 A;  3V9S A;  4KHY A;  1RCH A;  1YT3 A;  4Z4C A;  4B9M A;  3AVN A;  4DMN A;  1BCM A;  5HP1 A;  1I39 A;  1O1W A;  5KGX A;  2YKM A;  3DLR A;  3OS1 A;  4B9U A;  1CZ9 A;  4CFC A;  3VQC A;  1RBT A;  4CEA A;  4W5R A;  3OYB A;  1YTU A;  1BQM A;  2X78 A;  1CXQ A;  3P1G A;  1Q8I A;  2DFE A;  4I9L A;  4RW7 A;  2HND A;  5CYM A;  1K6Y A;  1J54 A;  3AVI A;  4MQ3 A;  4CF1 A;  2P5G A;  1HJR A;  2D0C A;  4M3Y A;  3LAN A;  3VQQ A;  1U45 A;  3HM9 A;  3O3H A;  4DLG A;  3NFA A;  4ZHR A;  3F73 A;  4FJH A;  2DFH A;  4DF4 A;  1ZBU A;  1TKX A;  1HRH A;  4FLT A;  5DK5 A;  3LDS A;  2G8W A;  4I9Q A;  3L2V A;  2FBY A;  2ZE2 A;  4I7F A;  2G8V A;  4E1N A;  4AHV A;  3VQ6 A;  3RMB A;  4CEE A;  1C0U A;  4E7H A;  1X9S A;  1EXQ A;  4W5Q A;  4C8O A;  5I42 A;  2HNY A;  3DLH A;  1U49 A;  4LH5 A;  4CF9 A;  3F9K A;  4DQI A;  1ITG A;  3MAQ A;  1XWL A;  4O55 A;  3VQE A;  4CFA A;  3OYF A;  2F8S A;  1IKX A;  3TAB A;  4CJV A;  4CFB A;  3KJV A;  4DTP A;  4LSN A;  1RT4 A;  1T03 A;  2PY5 A;  3AO2 A;  1YTA A;  2BE2 A;  1RBS A;  1TVR A;  3HVR A;  3AVK A;  4CGD A;  3BDP A;  3SPZ A;  2P1J A;  2G8H A;  2IC3 A;  3HK2 A;  1VK0 A;  4E3S A;  1C1A A;  1LAW A;  3MXI A;  2HW3 A;  4CE9 A;  1NOZ A;  3RR8 A;  5SZT A;  4F3O A;  3VQB A;  4F4K A;  4FLX A;  2PYL A;  3M8Q A;  2D0A A;  4Y1D A;  1TL3 A;  2RKI A;  3V1O A;  2EX3 A;  3S3O A;  4NYN A;  4CJL A;  4WE1 A;  1NK9 A;  4DFP A;  4KPY A;  3AVJ A;  3OVN A;  4ICL A;  1S1X A;  1S9E A;  1X1P A;  2JLE A;  4GMJ B;  3L3U A;  5FRM A;  3ZSR A;  4IKF A;  4KTQ A;  4CEF A;  4E7I A;  3DRP A;  4YFU A;  1KLN A;  1HNV A;  1U47 A;  3ALY A;  1GOC A;  3ZSQ A;  1ASV A;  4CHO A;  1RT2 A;  4FZX C;  3QER A;  3MXM A;  3CFO A;  4BAC A;  2ETJ A;  3OYE A;  1JLF A;  3KK1 A;  1BIZ A;  3AVG A;  3SYZ A;  5FDL A;  1KRP A;  3ZSX A;  1C0T A;  4FLY A;  1WSG A;  2KW4 A;  2FBT A;  3E01 A;  4KHN A;  4LSL A;  1HPZ A;  1RT6 A;  2ATQ A;  4FM2 A;  3PX4 A;  3IS9 A;  2QK9 A;  3O4N A;  1U4B A;  4HCB A;  5E41 A;  3LZI A;  4Z4F A;  2X74 A;  3HVT A;  1WSH A;  1JLC A;  5SWM A;  3V1R A;  3JSM A;  1C1B A;  4B8C A;  2A1S A;  3OJS A;  3SUP A;  4Q0B A;  3SUN A;  2I5J A;  2YHA A;  1NKC A;  3RRH A;  3V6D A;  1IKY A;  1HMV A;  2XY6 A;  4FLZ A;  1ZBF A;  3QIN A;  3K5L A;  4FJ8 A;  1GOA A;  1RNH A;  2HVI A;  4FJM A;  4N47 A;  4EP4 A;  3OY9 A;  2AJQ A;  5KRT A;  2Z1H A;  2RPI A;  1VSD A;  5CYQ A;  4CEB A;  4FJL A;  3K57 A;  1KVB A;  4OLB A;  4TSX A;  3NF9 A;  3OYH A;  2OZM A;  1RDC A;  5HRR A;  3QES A;  3SQ2 A;  1QSY A;  4FJ9 A;  1D8Y A;  3KLH A;  4M3R A;  1L3S A;  4PA1 A;  3KKS A;  3VQ4 A;  3VQA A;  1X9M A;  2HMI A;  4KI4 A;  1TAQ A;  4MFB A;  5C25 A;  1NK0 A;  3RR7 A;  2IGI A;  2QXF A;  3ASM A;  3OYL A;  1L3U A;  1YVU A;  2Q3S A;  3SUO A;  4PUO A;  3SJJ A;  5HRN A;  3VA3 A;  2KQ2 A;  3ZT4 A;  2HB5 A;  1NJY A;  4RW6 A;  4LH4 A;  2YNF A;  3K5N A;  4CJT A;  5KGW A;  3RMC A;  3THV A;  4HCC A;  2RF2 A;  2GBZ A;  1NK5 A;  4CJ3 A;  5HBM A;  4CIF A;  4E0D A;  3AVA A;  2OA8 A;  1BQN A;  4C8L A;  1S1U A;  2DFF A;  3V9Z A;  3V81 A;  3QEX A;  5D3G A;  4FZZ A;  1W0H A;  4IDK A;  3TAM A;  5CZ2 A;  4EP5 A;  2D5R A;  1N5Y A;  2Z1J A;  3P5J A;  1BL3 A;  4CGF A;  1TAU A;  3K5M A;  3C95 A;  1CZB A;  1VSF A;  2HHS A;  5HRO A;  3SCX A;  3ZCM A;  1CLQ A;  1QHT A;  1UOC A;  4Q5V A;  3OYJ A;  1B9F A;  4F2S A;  1NJW A;  4RW8 A;  4C8M A;  4GW6 A;  3ULD A;  4NCA A;  3U3G A;  3PO5 A;  1RT3 A;  3SZ2 A;  2OPP A;  3AO3 A;  4IFV A;  4XIU A;  1TKD A;  1Q9Y A;  4FLV A;  4DTJ A;  1A5X A;  1WAJ A;  3AA5 X;  3CFP A;  3SQ1 A;  1D9F A;  2QKB A;  4C8N A;  1XI1 A;  3HPO A;  4DF8 A;  3LPU A;  4DU3 A;  3ZT1 A;  4CGG A;  3AO5 A;  4BWJ A;  4CJR A;  4FK4 A;  4ID5 A;  1IH7 A;  4IFY A;  1FKO A;  3LWM A;  3ZT0 A;  3DOL A;  1ZBI A;  4AHC A;  4BE1 A;  4B08 A;  1NK4 A;  4KRE A;  1LWC A;  4IBN A;  3SPY A;  4PWD A;  4M3U A;  2Z1G A;  4CED A;  3DRS A;  1QE1 A;  3DOK A;  3I0S A;  1UWB A;  4BE2 A;  3PY8 A;  1BI4 A;  4BDZ A;  2EHG A;  1J5O A;  3NF8 A;  3WNG A;  2IDO A;  4R5P A;  3OYD A;  4B9V A;  1S6Q A;  3PO4 A;  4O0I A;  4LY7 A;  3CG7 A;  2YV0 X;  1WSE A;  1G15 A;  4CJW A;  3JYT A;  4HTU A;  3QNN A;  5HRS A;  4KRF A;  3L8B A;  1R0A A;  1XHZ A;  4KHS A;  3OS0 A;  1BIU A;  1JXB A;  3AA3 A;  2P51 A;  3KKR A;  3WNE A;  3NH0 A;  1B9D A;  1HQU A;  4CGH A;  3ZSZ A;  4N56 A;  4FW2 A;  3NCI A;  4BWM A;  3IG1 A;  1X9W A;  1S1W A;  1SUQ A;  1RBU A;  1VRU A;  1Z25 A;  4GVM A;  3LWL A;  1Z26 A;  2Y1J A;  3NH2 A;  1IKV A;  3V9X A;  4CHY A;  3PV8 A;  4M3W A;  4CHN A;  1HYZ A;  3NBP A;  2XRI A;  3G10 A;  4JS5 A;  4KFB A;  4JRP A;  3SI6 A;  4Z4E A;  1BIS A;  3TAF A;  1TKT A;  3HPH A;  4CJE A;  1MU2 A;  4YNQ A;  1RDB A;  4CGI A;  2P5O A;  3C6T A;  4DTO A;  4FJN A;  1QSL A;  4Z4G A;  3OYA A;  4IG3 A;  1HQE A;  1RIL A;  1SV5 A;  2VG5 A;  4OKK A;  3TAG A;  1DTT A;  3HST B;  4ZTF A;  1JLQ A;  2E6L A;  3LP0 A;  4OKJ A;  4CK2 A;  3B6O A;  2W42 A;  4E7L A;  3T3F A;  3OYM A;  1UAX A;  2VG6 A;  4N76 A;  3FFI A;  3MED A;  4AHU A;  2HHU A;  1SKR A;  3NH1 A;  1NK8 A;  3C94 A;  4DG1 A;  3D45 A;  4DSK A;  1WLJ A;  4FLW A;  4B9S A;  2GV9 A;  5CZ1 A;  4CHZ A;  3OYN A;  1WSF A;  2IS3 A;  3QEP A;  4DQS A;  2HNZ A;  3NDK A;  4PQU A;  2YKN A;  5FRN A;  3CM6 A;  1JLA A;  1RBR A;  1RBV A;  5EU7 A;  3VQD A;  3LP3 A;  4FW1 A;  1S1T A;  4QAG A;  5KI6 A;  2FC0 A;  1RT5 A;  4OPK A;  3U3Y A;  3KLE A;  4H4O A;  4FM1 A;  4RW4 A;  1JKH A;  3LP1 A;  4CJQ A;  3MEG A;  3KD5 E;  3KLG A;  4DU1 A;  4KKO A;  2Y1I A;  3HP6 A;  4DSI A;  4FJX A;  1JXE A;  5I3U A;  3KLI A;  4M45 A;  3KD1 E;  4CIE A;  1J53 A;  4KO0 A;  4ID1 A;  3QEW A;  3V9W A;  3ZT3 A;  4CCH A;  4J2A A;  1WSJ A;  1B92 A;  1CXU A;  3QLH A;  2KFZ A;  1A5W A;  1Y97 A;  3L2U A;  1BCO A;  3TAE A;  4W5O A;  1WN7 A;  2E4L A;  2G8U A;  4FJ7 A;  3RMA A;  4CJ4 A;  4J2B A;  4M42 A;  3M8P A;  3VN5 A;  4B9L A;  1F21 A;  2IAJ A;  1S6P A;  4DTU A;  1TGO A;  3QET A;  1D9D A;  1RTH A;  3SQ0 A;  4DSJ A;  4DS5 A;  1LAV A;  3K5O A;  3VQ9 A;  1RTJ A;  4I2Q A;  3AV9 A;  3LAK A;  3NGI A;  4KHU A;  2G8F A;  3DLK A;  3DLG A;  3H08 A;  3M8S A;  3U6F A;  4N5S A;  3L2R A;  4CHP A;  1WAF A;  4O5B A;  3V1Q A;  1TL1 A;  1BGX T;  4FJG A;  1HYS A;  1SL0 A;  1L5U A;  4OKE A;  4F8R A;  3WNF A;  4CHQ A;  4DU4 A;  1S1V A;  4O0J A;  3NAE A;  3RTV A;  4DFK A;  4B9N A;  3RWU A;  4IG0 A;  4CFD A;  4FJI A;  3CQ8 A;  4DQQ A;  1Q9X A;  1NOY A;  4FLU A;  4N41 A;  1SL2 A;  4L8R B;  4W5T A;  3V4I A;  4KB0 A;  3HT3 A;  3DLB A;  4QCL A;  4AHT A;  3KTQ A;  4O4G A;  4CES A;  3CM5 A;  1D5A A;  1XC9 A;  1NKB A;  1LW0 A;  2E6M A;  3ISN C;  4F3T A;  4E19 A;  2DTU A;  4KHQ A;  5CY4 A;  1LV5 A;  2Z1I A;  1RDD A;  1VSJ A;  3IRX A;  2HHV A;  1RT1 A;  1L3T A;  4FM0 A;  1SKW A;  2BDP A;  2YHB A;  4CER A;  3VQP A;  5J1E A;  3EZ5 A;  3S3M A;  4E89 A;  5J2M A;  4M41 A;  4M3Z A;  3LP2 A;  2OPS A;  4FVM A;  2HHQ A;  2HHW A;  3T1A A;  1VSI A;  3QEV A;  1KCF A;  4OJR A;  4HUF A;  4ELV A;  1S5J A;  4DSE A;  5HRP A;  1LWE A;  1HYV A;  3PX6 A;  4KI6 A;  4B3O A;  5FRO A;  4BE0 A;  3NHG A;  2OZS A;  1T7P A;  3EY1 A;  1BI4 B;  4M3T A;  2WOM A;  3ZSV A;  1GOB A;  2RN2 A;  4M3X A;  3QIP A;  4C8K A;  4DTN A;  1RT7 A;  3QEI A;  3HL8 A;  3G0Z A;  4CGJ A;  1KFS A;  3SQ4 A;  1U48 A;  4CJU A;  3I0R A;  1KTQ A;  4ZTJ A;  4JS4 A;  1T8E A;  1U04 A;  4DSL A;  3LPT A;  4DLE A;  4B9T A;  3HXM A;  2PZS A;  4BDP A;  3P83 D;  2FBV A;  3BGR A;  1TK8 A;  4CJK A;  2PYJ A;  2G8K A;  4AHR A;  1C1C A;  2YNH A;  3AVH A;  3KLF A;  3VA0 A;  4DFJ A;  4EZ9 A;  4RG8 A;  4JLH A;  1VRT A;  4EZ6 A;  1DLO A;  1VSM A;  4H8K A;  3NF6 A;  4CF8 A;  4E7J A;  1LWF A;  4DTX A;  4PY5 A;  3TI0 A;  3DMJ A;  2IOC A;  2GUI A;  4FK2 A;  3OYG A;  2O4G A;  3HJF A;  4LD0 A;  3L2Q A;  4HUE A;  1RDA A;  2O4I A;  1LW2 A;  4FJ5 A;  3NGZ A;  1UA0 A;  1FKP A;  4CJS A;  3RMD A;  1S9G A;  3HYF A;  4E1M A;  4DTS A;  5J2N A;  1KLM A;  1BHL A;  4FJK A;  3UIQ A;  1NKE A;  2F8T A;  2A1R A;  2ITG A;  4CF2 A;  1EP4 A;  2OPQ A;  4J2D A;  5K14 A;  3OJU A;  1TKZ A;  3KK3 A;  4DTR A;  4DQP A;  3AVC A;  4OGE A;  2BGG A;  3TAP A;  1ZYQ A;  4J2E A;  1QTM A;  3AVL A;  3VQ8 A;  2JGU A;  4AHS A;  2F96 A;  2VWK A;  5C42 A;  1IG9 A;  4I2P A;  4QOZ B;  3MXJ A;  3ZSW A;  3OYC A;  4OVL A;  3HPG A;  3SNN A;  2ZD1 A;  4Z4I A;  1VSL A;  4CF0 A;  3PX0 A;  3HP9 A;  3TAN A;  4KHW A;  4FYD A;  4NCG A;  1JLG A;  2XHB A;  2KZZ A;  3AA2 A;  4CK3 A;  3SV4 A;  5JS1 A;  3CYM A;  3DI6 A;  3AA4 A;  5KRS A;  4F2R A;  2KZM A;  1KVA A;  1A5V A;  1WNS A;  2XY8 A;  3ZSO A;  1RTI A;  2VWJ A;  2OYQ A;  2HVH A;  5J2Q A;  4Y1C A;  1KFD A;  4NYF A;  3SV3 A;  2X6S A;  4E7K A;  4DQR A;  4DTM A;  3DLE A;  3I8D A;  1NK6 A;  3K59 A;  1HNI A;  4FK0 A;  1I3A A;  1ASU A;  1ZBH A;  1FK9 A;  1JL2 A;  3NGY A;  1EET A;  3RRG A;  4DWI A;  2DY4 A;  3HO1 A;  3KIO A;  4CEC A;  1VSH A;  2WON A;  2D0B A;  4KV8 A;  4RW9 A;  3O3G A;  4HHT A;  3QO9 A;  1J9A A;  2B5J A;  4FCY A;  1TV6 A;  4OPJ A;  2BAN A;  2XO7 A;  1QSS A;  5JS2 A;  2OPR A;  3AVM A;  5T7B A;  2QKK A;  4K8X A;  1N6Q A;  3DYA A;  4W5N A;  4CJ5 A;  1L3V A;  2HHX A;  5J2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...