4LH5A

Dual inhibition of hiv-1 replication by integrase-ledgf allosteric inhibitors is predominant at post-integration stage during virus production rather than at integration
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
152
structure length
129
Chain Sequence
SPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Dual inhibition of HIV-1 replication by integrase-LEDGF allosteric inhibitors is predominant at the post-integration stage.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 43
structure length 129
sequence length 152
ec nomenclature
pdb deposition date 2013-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lh5A00
1TGOA 3OYLA 3V9XA 3IAYA 1KVBA 4CJWA 2G8IA 4Z4IA 3ITHA 4C8MA 3U3GA 4KHWA 2RKIA 3I0RA 4O0JA 4HTUA 4FLWA 1TKTA 1EP4A 3LAKA 4PQUA 3SYZA 3ZT2A 5C24A 4KTQA 4LSLA 3ISNC 1TV6A 4KHSA 1VSEA 3VQEA 4CJFA 4Z4CA 5HRPA 3KLEA 4CJVA 3SPYA 4CCHA 1VK0A 1J54A 3QLHA 1ASUA 1T8EA 3V1OA 3LPUA 1TK8A 1U04A 1VSFA 4FW1A 4LH4A 2W42A 2D0CA 1ZBHA 2XO7A 1O1WA 1RT4A 2Z1HA 3C6TA 5SZTA 4IG0A 4O55A 3EY1A 3HYFA 1RBVA 3AA5X 3RMCA 1ASWA 1JLCA 3LZIA 4FYDA 3OS0A 3A2FA 3F9KA 5EU7A 4N5SA 3F73A 4FJJA 2HHQA 1W9HA 3KK1A 1FXXA 3LPTA 4I2QA 4FZZA 3NGZA 1DLOA 4KV8A 5HRNA 4I7FA 4B9MA 4RW6A 1IKVA 1YVUA 3SQ4A 1KSPA 1N6QA 1BI4A 4Q0BA 1W0HA 2XRIA 1GOCA 4CFAA 1NK6A 3MEDA 4O0IA 3QNOA 1ZBFA 1S5JA 4DMNA 4E89A 4YNQA 3E01A 3AO2A 1WSFA 5T7BA 3CFPA 1NK9A 1QE1A 2ETJA 3KD5E 3LP1A 5FDLA 3OYBA 3NH0A 1S1TA 1KFSA 5DMRA 1TK5A 3VQ6A 3ZCMA 5J2MA 3NH1A 1QSSA 1C0UA 5CZ1A 3VQ8A 5FRNA 3K57A 1U4BA 2QKKA 1REVA 4E1MA 3VQ9A 3DOKA 1L3SA 4FLVA 3H08A 3ZSXA 3RMBA 4Z4GA 5CYQA 2DFFA 1S1XA 3KK3A 2DFEA 3KKRA 4BDYA 1S1UA 1HJRA 3KIOA 4CEBA 2HW3A 2RF2A 4CGDA 3O3FA 1EXQA 1D9FA 3OYNA 1L3TA 3AVIA 4HHTA 4ELVA 4BE1A 3TAEA 4ZTJA 4EP4A 4Z4HA 3VQ4A 1UAXA 3UIQA 3D0PA 4E3SA 1LV5A 1T03A 2PYLA 2P51A 1C0MA 4CF0A 4F8RA 3M8PA 2A1SA 1WSJA 4LD0A 3SJJA 3DLHA 3K5NA 1TKDA 4KB0A 2E4LA 1TVRA 4E7IA 3ASMA 4KI4A 4FJGA 2YNGA 4KTWA 3RMAA 3NE6A 2G8VA 3G0ZA 3CFRA 4CIFA 3LANA 4E7LA 1SKRA 1VSKA 3T3FA 3SQ2A 3AV9A 2B4JA 3NCIA 3V9WA 3L2WA 4FM1A 4DFPA 1U48A 1X9MA 4CJTA 2BGGA 1HPZA 1RT1A 2YHAA 3OS2A 3K5OA 4IKFA 4AHUA 1JL2A 4BDPA 4Z4FA 2ATQA 1NOYA 2FBXA 2EX3A 3KLIA 3QINA 1TKXA 4N47A 4B8AB 3QEPA 4FJ7A 3HM9A 3LP0A 3QEWA 3SPZA 1Q9XA 3AVBA 2B6AA 3KLFA 1NJYA 1LWFA 1NKCA 4R5PA 1ZBIA 1VSJA 2VWJA 4DU1A 1A5XA 4MFBA 1J9AA 4AHRA 4CK3A 3DLGA 4KAZA 1QS4A 5KTQA 4M42A 4JRPA 1BCMA 3VQCA 2OPQA 1LW2A 3OY9A 4CGGA 3V9ZA 3HP6A 1QHTA 3NH2A 3HPOA 1KLNA 3ZSYA 4BE0A 2OPRA 4N41A 4CEFA 3HJFA 1XC9A 2KZZA 1VSIA 3SCXA 1JLEA 4M3RA 1NKBA 4FJIA 4B9SA 3PV8A 5HROA 1JLBA 1L5UA 4FK4A 1BQNA 1JKHA 1I39A 1JXEA 1WSEA 3O3GA 3HXMA 2B5JA 2WONA 3RWUA 3NBPA 2VWKA 1I3AA 4DFJA 4FW2A 3VQQA 3OYKA 1QSLA 2P1JA 1KLMA 1C6VA 2HB5A 2IS3A 2GV9A 3P5JA 1L3VA 3NDKA 3K2PA 1UA1A 1D8YA 1BISA 1NJXA 3QIPA 4RW8A 1QTMA 4DTXA 1HQUA 4KPYA 4CK2A 1IKYA 4DU3A 4RG8A 3NF8A 4DQPA 3QIOA 3KK2A 3V81A 2QKBA 3AVKA 3OYCA 4DSEA 4K8ZA 2ZQBA 1RNHA 4FM2A 2HHUA 3OYIA 4M3UA 4CECA 4DWIA 2XY5A 4CJKA 4B9LA 4NCGA 3ZSWA 1RT3A 2VG5A 3HT3A 3JSMA 1EETA 4OPJA 4M3XA 3HP9A 4DG1A 4PUOA 1U47A 4UQGA 2KQ2A 4CHZA 4AHCA 4W5TA 3K59A 2YV0X 5HRRA 1CZBA 3MXMA 2HMIA 4J2DA 1U45A 5C25A 2HHTA 2WOMA 4E7HA 3C6UA 4ZTFA 4QAGA 3AA3A 4PWDA 3WNEA 5CZ2A 4DF4A 1SKWA 4B9NA 2YKMA 3QESA 5HRSA 1D5AA 4KRFA 4CF9A 3ZSZA 1RDBA 3QETA 1YTUA 1JL1A 2X78A 3P1GA 4DSIA 4M3ZA 4FJNA 1GOAA 2VG7A 4CJSA 3OYEA 1BCOA 4AHVA 3ZSQA 4OJRA 1UWBA 1KVCA 1JLGA 3MXJA 1IKXA 4F4KA 1KFDA 3WNGA 4E0DA 4CHOA 3HSTB 4YFUA 3M8QA 4Q5VA 3DRRA 1ITGA 3KTQA 4CGIA 1L3UA 2RPIA 3OVNA 3CYMA 4JRQA 4CJLA 4FM0A 4LH5A 4H8KA 4E7KA 1WSIA 3AVLA 3M8RA 3VQDA 5FROA 3VQAA 3AVGA 1HQEA 3I8DA 3PY8A 1RTIA 3PUFA 3V1RA 2P5GA 2HVIA 4W5OA 3AVAA 4CEOA 2FBTA 3RMDA 3KKSA 4I2PA 5K14A 2Z1GA 3AVFA 1X9SA 2O4GA 3DLEA 4J2EA 2G8FA 2BDPA 4O44A 4FCYA 2G8WA 1FKPA 1DTTA 3LAMA 3HVRA 3VA3A 4CJPA 4PA1A 3VQPA 1JLQA 3DRSA 1WSHA 3RTVA 4DTUA 2HVHA 3NFAA 5HP1A 4CFCA 4FJ5A 1IKWA 2Y1JA 4NYNA 3HK2A 3OYHA 3CM6A 4DTSA 4CGFA 4DSLA 4JS5A 2X74A 2DY4A 3U6FA 4XIUA 1TK0A 1XHZA 3OJUA 4FJKA 1HYZA 3DMJA 4KHNA 5JS2A 3LP3A 3V9UA 3O4NA 3L2QA 4HUEA 2OYQA 4B9UA 1NK0A 3MEEA 1LWCA 4ID5A 4CE9A 4CJQA 4F2SA 3L2RA 5HBMA 3LDSA 1T7PA 3DLBA 2QXFA 1BQMA 1GOBA 1KTQA 5KI6A 4BWJA 2PYJA 3HVTA 4BWMA 2OPPA 4N76A 1X9WA 4C8KA 2Y1IA 4ELUA 2Z1JA 5CY4A 4EZ9A 2JGUA 4I9QA 4PY5A 3C94A 3TWHA 3AVHA 3AA4A 3QERA 4KI6A 4NYFA 4OLAA 2AJQA 1C1CA 4W5RA 3LZJA 1BIZA 5CYMA 4DFKA 4DSJA 1RT5A 2R7YA 1SV5A 3AVJA 1S1WA 4JLHA 3ZT4A 4CHQA 3QEIA 5I3UA 2FBVA 5C42A 2IDOA 3CFOA 4CIEA 5KGXA 3L2UA 5D3GA 1ZYQA 1VSDA 1WSGA 3MAQA 1HYVA 1SUQA 1BIUA 1EKEA 1LW0A 3QEXA 2IOCA 4GMJB 1X1PA 4QCLA 4CJ5A 4HUGA 4AHSA 4B8CA 4DSKA 1CZ9A 4DFMA 3ZT1A 2HNYA 5I42A 4F3TA 4ID1A 4QOZB 2HNZA 4OGCA 3IG1A 3RRGA 4RW9A 4DTNA 4GVMA 2G8UA 2P5OA 4KKOA 4LSNA 3ZSRA 5KRTA 2E6MA 4AHTA 4HUFA 1NK5A 1S9GA 4KO0A 2BANA 2KFZA 3NF9A 3RR7A 2A1RA 4Z0UA 1WAFA 3KLGA 3I0SA 4DTMA 1XI1A 4B9VA 4C8NA 4OKKA 3U3YA 3L8BA 4E19A 1RDDA 4DLGA 4DTRA 3AO5A 4AH9A 1KCFA 1QQCA 1WAJA 3OYMA 2JLEA 1Q8IA 4FJHA 2F96A 3L3VA 2ITGA 2KTQA 3ZT3A 4FJ8A 2FC0A 3ZSOA 3O4QA 3SV4A 3T19A 4C8LA 2KZMA 4M45A 1JXBA 1CXUA 3AVMA 4FLXA 4O5BA 3NF6A 4AILC 4FZXC 4HCBA 2YNHA 3AVCA 4Z4EA 4CHYA 4KHYA 1NOZA 4KHUA 4KFBA 4MQ3A 1C0TA 1JLAA 3ZSVA 5J2PA 1C1BA 5J2QA 5J1EA 2G8HA 4C8OA 4CGJA 3HO1A 3WNHA 1CLQA 3VN5A 1A5VA 2RN2A 3B6OA 4CK1A 4F2RA 2KW4A 5HLFA 3AO4A 1LWEA 3LWMA 1NKEA 3TAMA 4FK2A 4B3OA 3S3OA 1BHLA 2BE2A 3K58A 3DLKA 1HYSA 2XY8A 3L2VA 3QEVA 2FBYA 4CEQA 3OYJA 2XY7A 2ZE2A 4K8XA 2OZMA 1SL2A 3OJSA 4H4MA 1RBUA 4KHQA 3M8SA 4BACA 4FLZA 2OA8A 1S6QA 3SI6A 3TAFA 3S3MA 4DS4A 2X6SA 1B92A 1RDAA 5J2NA 3OYAA 3NGIA 1RT2A 4HVJA 1QSYA 3SNNA 3BGRA 4OLBA 1WNSA 4EP5A 3TANA 1NK8A 4CIGA 3S9HA 1WN7A 4O4GA 3NF7A 1XWLA 3TR8A 3K5LA 1Z25A 3V6DA 1TKZA 1CXQA 2G8KA 3DM2A 3OYFA 2IC3A 4E1NA 4H4OA 3TABA 4OPKA 3SZ2A 2NUBA 4FLUA 2EHGA 2IAJA 3NGYA 1RTJA 4HCCA 1HNIA 3D45A 4IFYA 4Y1CA 2ZD1A 4I9LA 3OS1A 4FJMA 4L8RB 4OGEA 3SQ0A 1YTAA 3AVNA 3MEGA 2Z1IA 2Q3SA 4B08A 3AA2A 3OYGA 2XHBA 4E7JA 2YNIA 3TAPA 1NK4A 4M3TA 5JS1A 1RT6A 4DF8A 4IG3A 3TAGA 1JLFA 1N5YA 3MECA 4BDZA 3LP2A 1KVAA 1WLJA 1SKSA 3VQ7A 2QK9A 1G15A 1VSHA 2YKNA 3K5MA 3BDPA 5KRSA 1ZBLA 4Y1DA 1C1AA 1J53A 3TARA 1Q9YA 3EZ5A 2F8SA 4W5NA 4DU4A 1TAUA 1TAQA 3PX0A 3PO5A 1IH7A 4CJ4A 4DTOA 3HPHA 2XY6A 3L3UA 1S1VA 3CQ8A 3V1QA 2GBZA 4CF1A 3NHGA 3RR8A 1VRUA 4DSFA 4FZYA 4TSXA 4JS4A 3HPGA 3MXIA 1RILA 4CEAA 3ALYA 4CJUA 4GW6A 4RW7A 3RRHA 2HHXA 3JYTA 4CFDA 4EZ6A 2DFHA 4G1QA 3LALA 2GUIA 4KB1A 4KREA 3DI6A 3KLHA 4FJXA 1VRTA 3THVA 1SL0A 1HMVA 3FFIA 2X6NA 1LAVA 1B9DA 4OVLA 4CEZA 4LY7A 3VQBA 4CJRA 1TL3A 4M3YA 4CJEA 4DQQA 1RCHA 1VSLA 3S3NA 4FLTA 2E6LA 2PY5A 3VQ5A 3PX6A 2I5JA 1TL1A 3AO3A 1NJWA 1BI4B 3G10A 4FVMA 4OKEA 4FJLA 3DRPA 5DK5A 2YNFA 4IBNA 5E41A 3EYZA 3KD1E 2HHVA 1RBTA 1VSMA 4KTZA 3PO4A 4FJ9A 4DS5A 3LWLA 3WNFA 3IRXA 4J2AA 4CERA 1RTHA 4DTPA 1KRPA 1BGXT 1RT7A 2VG6A 4CFBA 1J5OA 4M41A 3IS9A 4DQRA 1S9EA 4NCBA 2HHSA 2PZSA 1XHXA 3CG7A 2HHWA 5KGWA 4NCAA 4CGHA 1UA0A 4DQIA 1Y97A 3SQ1A 1A5WA 1FKOA 1NJZA 3ULDA 1YT3A 1ZBUA 1RTDA 4CHPA 3PX4A 4OKJA 4CF8A 1LAWA 3V4IA 3VA0A 2OZSA 3SV3A 4N56A 3KJVA 4DQSA 2D0AA 2OPSA 3DLRA 1K6YA 1NK7A 3DYAA 2KFNA 1F21A 4CEEA 1RDCA 1Z26A 2LSNA 2YHBA 3B6PA 1U49A 4CF2A 4CHNA 4FXDA 1UOCA 2D0BA 4ICLA 4CJ3A 4WE1A 3CM5A 4RW4A 3SUQA 3V9SA 3QO9A 1SL1A 2O4IA 3ZT0A 1T05A 3C95A 3DOLA 1DTQA 1S6PA 4W5QA 3O3HA 4ELTA 3P83D 4BE2A 1BL3A 2F8TA 4DTJA 4M3WA 3T1AA 4CESA 2IGIA 4DLEA 3QNNA 1IG9A 4B9TA 2DTUA 3HL8A 1IO2A 1B9FA 4ZHRA 3NAEA 4FK0A 1ASVA 2HNDA 3TI0A 1RBSA 5SWMA 3SUNA 3OYDA 4FLYA 1R0AA 3SUOA 4F3OA 1EX4A 1D9DA 1FK9A 3TAQA 4J2BA 3AO1A 2D5RA 4CEDA 5FRMA 1HRHA 4IDKA 1MU2A 1RBRA 3SUPA 1HNVA 4IFVA
chains in the Genus database with same CATH superfamily
1TGOA 3U3GA 2RKIA 1QVGM 4PQUA 3LAKA 4FWQA 3CJ1A 3ISNC 1VSEA 3CMEN 1J54A 1ASUA 1T8EA 1HKGA 4FW1A 2XO7A 2Z1HA 3AGKA 3C6TA 4EAHD 4IG0A 1RBVA 3AA5X 1ASWA 3E9OA 5GADP 1FW6A 4JHDB 2HHQA 1SAZA 1XNQK 1FXXA 4FZZA 1DLOA 4KV8A 1GLFO 4I7FA 4RW6A 1YVUA 1M90O 1DGKN 4LFBK 3FGUA 1GOCA 3ZEUB 2I7PA 1TUYA 1YI2N 3ZETB 4BG9A 4A5BA 1NMNA 1QE1A 3NH0A 4NB4A 1KFSA 1G99A 3P39A 5DMRA 1TK5A 2YI1A 4A57A 2Q97A 5CZ1A 1NGFA 4K42A 1U4BA 2QKKA 3VQ9A 2QW9A 4GVEA 3H08A 3BF1A 5CYQA 5LJWA 2IVNA 1EWRA 3GG4A 4DR4K 4BDYA 3AAQA 1GLAG 2Q2RA 2HW3A 2VQEK 1E4GT 3OYNA 3AVIA 3RSEA 1IBMK 4EP4A 1UAXA 4I6MB 4C1NI 3SJJA 2F4VK 4GKJK 4KB0A 3U9ZA 4NLBA 2YNGA 3RMAA 1HNXK 2G8VA 3G0ZA 5C2FA 2GEMA 3T3FA 4DR5K 1U48A 1X9MA 2CGKA 2EX3A 3GL1A 2W6LA 4HTLA 3QEWA 4ILGB 1QZ6A 1KAYA 1Q9XA 4YOVA 2B6AA 3KLFA 3UE5A 4R5PA 5GAEP 1ZBIA 2O8BA 4DU1A 3CJAA 1DKGD 4XEIA 4KAZA 3CXCM 4JRPA 3VQCA 2WTUA 3V9ZA 2NRWA 3IKMA 3UKUB 2OPRA 4N41A 4CEFA 1MWKA 2KZZA 3SCXA 4M3RA 4FJIA 4B9SA 5HROA 5M1KA 1LOTB 4YOTA 4DFJA 4JHDA 3C7NB 2P1JA 1KLMA 2HB5A 4BC2A 2GV9A 5IWAK 1D8YA 1HQUA 2AP1A 3MX2A 4DU3A 4DQPA 2QKBA 4DSEA 4DR1K 2HHUA 1RNHA 4DHYA 4M3XA 1RT3A 2VG5A 3VMFB 4OPJA 3HP9A 1XUPO 3MX5A 2OTLN 4DG1A 4CVNE 3SK3A 4YORA 4CHZA 4K25A 4PHTX 4A5AA 5HRRA 4JEPA 1CZBA 5AQXA 1U45A 5C25A 4H5RA 4E7HA 4JKHA 2VWBA 4WCEL 1SKWA 3QESA 3FR0A 3I8BA 5HRSA 1D5AA 4AM7A 4CF9A 2QWOA 4EHTA 5H1SQ 1JL1A 4FSVA 3AARA 4DSIA 1GOAA 4CJSA 4I6MA 1JLGA 3MXJA 3CQXA 3PIPL 4JI0K 1HNWK 1X3NA 4CHOA 4YFUA 3M8QA 3HTVA 1ITGA 1L3UA 2RPIA 3OVNA 3VF6A 3IFRA 5AQKA 4E7KA 4X66K 1VQON 3VQDA 3VQAA 2P5GA 1HQEA 2HVIA 1KXPA 3QICA 3ULEB 3AVAA 2HBJA 2FBTA 4V19S 3DLEA 5JVGL 1W7AA 1S3XA 2W6KA 4YDUC 2ITMA 3RTVA 4DTUA 4FJ5A 5AQPA 4CFCA 2ASPA 3PIOL 3ID6A 1Q81O 4NYNA 1N32K 4OX9K 3GE1A 4DSLA 5BN8A 1NGJA 1HYZA 5JS2A 5B8HA 3O4NA 2KLAA 3LM9A 3L4QA 3L2RA 5HBMA 2QXFA 1BQMA 1GOBA 5KI6A 2PYJA 2OPPA 4BRMA 4C8KA 4CZJA 2Z1JA 1J6ZA 2W41A 4B1ZA 4KI6A 5TKYA 4JK9A 3O8MA 1BIZA 3CJ7A 3MN6A 3LZJA 4DSJA 2UYTA 3BEXA 1KRPA 5I3UA 3QEIA 3E9LA 4M63C 2A40A 3HRGA 1GLDG 3IMXA 1WSGA 4DV6K 1SUQA 1EKEA 3PSFA 4GMJB 4QCLA 4CJ5A 4WQ4A 4B8CA 4EHUA 4DR3K 4DFMA 3ZT1A 1QQOA 1JJ2M 4F3TA 1LCUA 2JWLA 1GLLO 4OGCA 5AQHA 3TTFA 4RTFD 2O8EB 3RRGA 4DTNA 2P9IB 2G8UA 5KRTA 2E6MA 3VEWA 1TYQB 2WFBA 2A1RA 4Z0UA 1NGDA 1WAFA 3I0SA 4DQ8A 4C8NA 3JS6A 4PL8A 3TTCA 1BG3A 4DTRA 4DLGA 4BR9A 1KCFA 4IEIA 1K8AO 2F96A 2YHYA 3SV4A 4M45A 5C10A 4YY3K 1CXUA 4A2AA 4AILC 3NF6A 3FLCO 2YNHA 3AVCA 3EN9A 4C8OA 3HO1A 4IWVA 2QEXN 3B6OA 4F2RA 3ULEA 3OA9A 5HLFA 1LWEA 3LWMA 1U2VB 3TAMA 1T44A 2XY8A 5AQNA 2Q31A 2A5XA 2FBYA 4ISEA 2ZE2A 3CCMN 1GLCG 1SL2A 2HMPA 4BACA 5EVZA 3TAFA 2X6SA 4FWRA 1RDAA 2E1YA 1RT2A 4B3SK 1RDWX 3SNNA 4OLBA 1WUAA 4O4GA 4MO5A 4IJNA 2IC3A 4OPKA 2NUBA 4JKCA 4FLUA 3N4PA 2QWNA 2IAJA 3NGYA 1HNIA 4IFYA 4CI6A 3OS1A 3A8YA 3M3ZA 4L8RB 4OGEA 3SQ0A 1BWFO 3VGKA 3MEGA 3AA2A 3R3LA 2YNIA 3TAPA 3TPQA 4BY9C 4PKIA 1HKCA 4BC3A 1N5YA 5KQDA 2D1KA 4B1XB 1G15A 1VSHA 4FWNA 1HNZK 1ZBLA 5AQMA 1HX1A 4W5NA 1TAUA 5MLCQ 2O8EA 3KHYA 3HPHA 2XY6A 3L3UA 5BR9A 2GBZA 4CF1A 1TYQA 3NHGA 4DSFA 3CIPA 5GAHP 4JS4A 1RILA 3LDNA 3WXKA 3KWGA 1CZAN 3WXMB 3O1BA 1RDUA 2QA4N 3DI6A 3DXKB 3P38A 5LJVA 1HMVA 3FFIA 1B9DA 4LY7A 4YHHK 3H3NO 5FPDA 4FLTA 3J7AP 3VTHA 2E2NA 2PY5A 3VQ5A 1TL1A 1BI4B 3CI5A 5DK5A 1HUXA 1RBTA 3LWLA 3WNFA 5AQZA 3VEXA 2VG6A 1RT7A 4IOCL 3IS9A 4NCBA 2YJFA 5LMNK 2HHWA 4CGHA 1Y97A 4AF1A 1YT3A 4IJAA 4CHPA 4CF8A 4JI6K 2OZSA 1K8KB 4N56A 4DQSA 4H5TA 3O5BA 4GKKK 1F21A 2BTFA 3CCRN 2YHBA 2D4WA 3B6PA 4U67L 3SBTA 1X3MA 4QS9A 5IT9O 4ICLA 4DV1K 4WE1A 2O8DB 3SUQA 1M1KO 1J5EK 1SL1A 1NGAA 4BRLA 3LDQA 3P83D 3C6AA 1BL3A 2IIRA 4BE2A 4XH4A 2IGIA 1ZC6A 3Q7BA 4ZHRA 3CPEA 3E9PA 1VQ7N 1DEJA 1R0AA 4F3OA 4K0KK 3AO1A 4CEDA 1HRHA 1RBRA 3SUPA 3FZMA 1HNVA 3PLAA 1V4SA 4C8MA 1K9MO 1TKTA 4A61A 1TV6A 4KHSA 5HRPA 1OH7A 5HL7L 3SAFA 2YHWA 5DM6L 1VK0A 2AA4A 4CCHA 3V1OA 1U04A 4DR2K 4LH4A 2W42A 1ZBHA 3O9SA 1O1WA 1RT4A 1P8ZA 3HYFA 3RMCA 1JLCA 3DXKA 2UXBK 3LZIA 4FYDA 3A2FA 5BRDA 4CZIA 4FJJA 3ZX2A 4BRAA 5BRFA 3KK1A 2FF3B 2GTDA 2HBMA 2E2PA 4I2QA 3VTIA 1BOTO 1KSPA 1O13A 1BI4A 4Q0BA 2XRIA 4CFAA 3MEDA 4O0IA 1S5JA 3MK6A 1BO5O 4DMNA 3U8XA 2HBKA 1WSFA 2V7ZA 2E2QA 4H0TB 5FDLA 3CC4N 4CZMA 1QHAA 4JN4A 4K43A 3ZCMA 4BC5A 3VQ8A 3D2FB 2YJEA 4DV0K 4ILHA 1L3SA 4Z4GA 3THWA 3OW2M 1S1XA 2DFEA 3FFKB 1S1UA 4QS7A 3KIOA 3O3FA 4CGDA 4ELVA 3TAEA 4Z4HA 3VQ4A 2FSNA 3J8AA 1NGHA 2O8DA 3CMAN 2A1SA 2UXDK 1WSJA 5LL6Z 2E4LA 3L0QA 4E7IA 1YJWN 3ASMA 3MMVA 3A5OC 3NE6A 3UB5A 1ESVA 1SKRA 1U6ZA 3AV9A 2FF6A 3NCIA 3KK7A 5KPTA 1YIJN 2QWMA 5EXWA 3E1YA 3J80O 1HPZA 5AQTA 4DV7K 4DV3K 3K5OA 2BGGA 4Z4FA 4H0VB 1NOYA 2FBXA 3QINA 1IBLK 4FJ7A 3EE9A 3AVBA 4FWOA 3CD6N 1SQKA 4CK3A 3DLGA 1S72N 4M42A 3JAMO 3BZKA 1LW2A 3H45C 4CGGA 3HP6A 1QHTA 3RSEB 1I94K 1KLNA 3LM2A 1NGEA 1YJ9N 3QFUA 3CC2N 2ZJPL 2A3ZA 3PV8A 4BVOA 1JXEA 3HXMA 2B5JA 2WONA 3J7YP 2VGNA 2VWKA 4H03B 3J81O 3PSIA 3J7ZO 5KQ8A 1L3VA 3P5JA 3VEOA 3VENA 3G6EN 1NNEA 3WQTA 4FPBA 4FL9A 3S41A 4KPYA 1QTMA 4DTXA 4NLCA 4LFCK 3OYCA 2ZQBA 5AZIB 4FM2A 3OYIA 4JKEA 4CECA 4DWIA 2O8BB 1NG9A 1TUUA 3JSMA 1EETA 3FZKA 4FWPA 4PUOA 2NRRA 1HLUA 3D2FA 3MDQA 3CJCA 2YV0X 2HMIA 2P9KB 2HHTA 3C6UA 4QAGA 3AA3A 2P9LA 3WNEA 3QMLA 2CH5A 3TSPA 1QZ5A 3ZSZA 5AQFA 3HBTA 2HF4A 1BCOA 4BR0A 5ADXA 1KVCA 4AQYK 4M7YA 5AFUH 3LDOA 4LH5A 4H8KA 3M8RA 1Q82O 2A42A 3AVGA 3PY8A 1RTIA 2V51B 3RMDA 2Z1GA 2O4GA 4FCYA 3HI0A 3H1VX 1DTTA 5AQLA 3VA3A 2G8WA 2HVHA 2W40A 2E5LK 2Y1JA 3HK2A 3OYHA 3HSCA 4DTSA 5AQIA 2CGJA 3BP8A 1XHZA 4DV4K 1H1VA 3DMJA 3F5TA 3L2QA 3MEEA 3D7EO 1VQ5N 4LF8K 2PBDA 5C2DA 4JYAK 2UXCK 3ATUA 4DKWA 5CY4A 3TWHA 4U7BA 4DFKA 3ZT4A 3O9QA 1ZBSA 2FBVA 5C42A 4CD3A 1OH5A 3P31A 4GY2B 5AZIA 1ZYQA 3SMPA 1VSDA 3MAQA 5AQQA 2NRVA 1X1PA 2BUPA 4AHSA 4ILJA 3WXJA 1BUPA 1VQPN 5I42A 4QOZB 4ID1A 3FZHA 3IG1A 2P9KA 4H0OA 1N8RO 1NK5A 4HUFA 4KO0A 1Y64A 2J4RA 2JWKA 4DTMA 5AR0A 5BPNA 4CW7B 1NWKA 5AQRA 3AO5A 1QQNA 1NLVA 1QQCA 1WAJA 2RE2A 1YITN 3CCLN 3NMUA 3ZT3A 3ZSOA 3T19A 1YUWA 1JXBA 5JICA 1XC3A 3L4IA 1JLAA 1C1BA 2G8HA 5FPEA 3WNHA 3VN5A 3AO4A 1NKEA 3A5LC 1BHLA 2BE2A 4BR4A 1GLBG 5F2RA 3ATVA 1YVNA 3K0SA 4CEQA 2OZMA 1ATSA 4IDHA 3VEZA 4C1NK 4JI8K 2E20A 3M8SA 4KHQA 1VQKN 3SI6A 3HM8A 3O6WA 3S3MA 4R79A 3OYAA 4HVJA 3NVKA 1QSYA 5M1QA 1WNSA 4BQZA 3S9HA 1C0FA 3V6DA 1Z25A 2G8KA 3OYFA 4E1NA 1W97L 2ZD1A 4FJMA 4DV5K 2RHKA 3AVNA 4BR5A 1RFQA 3OBWA 4B08A 3OYGA 4CJ7A 2XHBA 1EO1A 5JS1A 4M3TA 4DF8A 1NGIA 4BRNA 1JLFA 2HF3A 5KPZA 4LFAK 1WLJA 1MWMA 3VQ7A 2QK9A 2YKNA 3TSUA 1J53A 2QTDA 3EZ5A 4DU4A 1WBBA 5KPRA 3PO5A 1IH7A 1HPMA 2GELA 2ZWHA 5CE3A 4DTOA 1S1VA 4FZYA 2E1ZA 3MXIA 4CEAA 3ALYA 4FOEA 4GW6A 1IV0A 4EZ6A 4Y0WA 2DFHA 2FSJA 4KREA 3KLHA 1LAVA 4CEZA 4M3YA 4DQQA 3S3NA 4YOXA 4KHPK 4H5VA 3PX6A 1YXQA 2I5JA 4OKEA 4FVMA 5E41A 3H3OB 5E84A 1VSMA 4FJ9A 4H0YB 3IRXA 4IO9L 4J2AA 4CFBA 1J5OA 4M41A 4CZHA 2PZSA 3CG7A 3R8EA 2OCEA 4NCAA 2YHXA 3I56N 3SQ1A 1OVQA 1NJZA 3M1FA 3PX4A 1LAWA 4XH1A 5AQGA 1V4TA 3V4IA 3VA0A 3DLLL 4BRGA 1K6YA 1NK7A 1RDCA 1U49A 4BRFA 4FXDA 2KKZA 2F9WA 3QO9A 3ZT0A 3DOLA 4WQ5C 4IFEA 4CZKA 2F8TA 2GWKA 3QNNA 4CD1A 1B9FA 1NGCA 2HNDA 2QWRA 3TI0A 4OPAA 5SWMA 3SUNA 4FWMA 4FLYA 3ENBA 4XH5A 1EX4A 1D9DA 4J2BA 1JCGA 5FRMA 1GLJO 4IDKA 2NLXA 3U9DA 4WF9L 4IFVA 3OYLA 1KVBA 4CJWA 4KHWA 3I0RA 1EP4A 3ZT2A 4KTQA 4LSLA 3VQEA 4Z4CA 4CJVA 3SPYA 2D0OA 1TK8A 3CCSN 4O55A 3F9KA 5EU7A 3AGRA 1NMDA 1P90A 3E66A 3NGZA 5HRNA 4B9MA 3SQ4A 3A5MC 3U4LA 1W0HA 1NK6A 3SAGA 3QNOA 4KH5A 4PL7A 3E01A 3AO2A 3CFPA 1NK9A 2ETJA 3VEYA 1S1TA 3SAHA 3VQ6A 1C0UA 1ATNA 3K57A 1REVA 3T69A 3DOKA 5ELZA 4DUZK 3ZSXA 3RMBA 2DFFA 3KK3A 3P4IA 3KKRA 4BVPA 2F9TA 2WBNA 1HJRA 4M7XA 1D9FA 1NM1A 1L3TA 4HHTA 3UIQA 3D0PA 4E3SA 2NRZA 1LV5A 1T03A 2PYLA 4F8RA 1C0MA 3M8PA 4LD0A 5BREA 5BR8K 2UUAK 4JKDA 4KI4A 5C12A 4BRIA 5GINA 4KTWA 3LANA 4E7LA 3WXIA 3SQ2A 3V9WA 3GDQA 3L2WA 1VQLN 4FPAA 4CJTA 2YHAA 3OS2A 4AHUA 1JL2A 4CBXA 4L3QA 3QEPA 3LP0A 3FE1A 5GIOA 2HHHK 3SPZA 3CC7N 1NJYA 1LWFA 3THWB 1VSJA 2VWJA 3H46O 5I9EB 4MFBA 1BA0A 1J9AA 4AHRA 5KTQA 2P9SB 1T6DA 2O8FA 3QBXA 4C23A 4YDUA 4X65K 3OY9A 3KWIA 3M5RA 3NH2A 3ZSYA 4BE0A 2DPNA 3HJFA 3QBWA 1VSIA 1JLEA 1XMOK 1JLBA 1L5UA 1BQNA 1JKHA 1WSEA 3ENOA 4DCHA 3O3GA 5EX5A 1I3AA 1RGIA 3OYKA 1WOQA 4LF6K 1C6VA 2GUPA 2P9UA 3K2PA 3VETA 4MO4A 1NJXA 3QIPA 4RW8A 5E26A 1X9JA 3QIOA 3V81A 3MN5A 3AVKA 4JD2B 4G9ZA 3DXMA 4NCGA 3ZSWA 3HT3A 4YOUA 4BRQA 1NJIO 3ZX0A 2VGMA 3VESA 4J2DA 3W0LA 1N36K 1K73O 4DF4A 5CZ2A 2A6AA 4CBUA 3OBYA 4KRFA 3G71N 1YTUA 4H5WA 4FOIA 2X78A 5FLXO 4FJNA 2QWQA 4A59A 2O8CB 3ZSQA 1UWBA 2Q36A 2NRXA 4F4KA 3WXLA 3WNGA 3HSTB 4Q5VA 4CGIA 4JI1K 5EY4A 5AQJA 4FM0A 1WB9A 1WSIA 3CCQN 4ISFA 3I8DA 3V1RA 4W5OA 4CEOA 4HWIA 2D0PA 3KKSA 2GX9A 4I2PA 3AVFA 2G8FA 2BDPA 4J8FA 1FKPA 3LAMA 1HR0K 2IVPA 4CJPA 3DRSA 1WSHA 4WQ5A 2UU9K 5HP1A 3WQUA 3GOIA 2IVOA 2P9LB 2EWSA 3CM6A 4CGFA 2X74A 2DY4A 2P9SA 4XIUA 1TK0A 4CZFA 4FJKA 3VGMA 4KHNA 3IDHA 3R6MA 3CCEN 3V9UA 4HUEA 3CQYA 1NK0A 4F2SA 1LWCA 1NGGA 3DLBA 1E3MA 1KTQA 4PKHA 1X9WA 2Y1IA 5JVHL 3VERA 3ZLJA 3QERA 4OLAA 2AJQA 1C1CA 1BU6O 3KVGA 3CJ9A 1SV5A 3AVJA 4JLHA 2ZGZA 4CHQA 2IDOA 4CIEA 4BGAA 5D3GA 4JD2A 4B3RK 3CETA 4DB3A 1BIUA 4FWLA 2IOCA 4FWKA 4HUGA 4BGBA 4DSKA 1CZ9A 1MA9B 2HNZA 3LDPA 4RW9A 1ATRA 1WBDA 1BA1A 1S9GA 2BANA 4LF5K 3RR7A 5C15A 1JCFA 4OO1J 2P9PB 3KLGA 1XI1A 4B9VA 3MWTA 3BZCA 5AQSA 4OKKA 4X62K 3L8BA 2O8CA 4FJHA 3A0IX 2JLEA 1Q8IA 5JLHA 3L3VA 2ITGA 2KTQA 4FJ8A 2FC0A 1Q7YO 3O4QA 4C8LA 3AVMA 4FLXA 1NOZA 4KHUA 4KFBA 3ZX3A 3ZSVA 5J2QA 5J1EA 4CGJA 1CLQA 1A5VA 2RN2A 3O1WA 4FO0A 4FK2A 5AQWA 1HYSA 3L2VA 1SZ2A 4K8XA 3OYJA 2QXLA 3F2KA 5M1OA 3OJSA 1RBUA 2OA8A 3SLCA 1S6QA 3T1YK 1B92A 4KH6A 5J2NA 5AQVA 1EWQA 4DV2K 4EP5A 3TANA 3NVMA 3WEEA 1NK8A 2YX6A 4CIGA 1WN7A 1XWLA 3LDLA 3L6QA 3TR8A 4RWTA 3K5LA 4BR7A 1CXQA 3C0BA 1C0GA 3TABA 3SZ2A 1ZXOA 3ZYYX 3THYA 4BREA 2EHGA 1RTJA 4HCCA 1XQSC 3D45A 4Y1CA 4I9LA 1FJGK 2OTJN 4LF4K 1YTAA 4JNEA 2Z1IA 4WQ4C 4E7JA 1RT6A 5FPMA 1YJNN 4FVUA 3TAGA 4NXMK 1YF5L 3LP2A 1SKSA 3AY9A 3K5MA 5KRSA 4Y1DA 1C1AA 4IO8A 2F8SA 1TAQA 2P9NA 3OHRA 3C65A 4BG8A 1VRUA 4TSXA 3RRHA 2P9PA 2HHXA 3JYTA 4CFDA 4G1QA 3LALA 4B3TK 4KB1A 4WYBA 2CH6A 3THXB 5BPMA 5F0XA 3O9UA 2X6NA 1VQ6N 1QVFM 1RCHA 1VSLA 1Z6RA 3MN7A 2I7NA 3G10A 1NJWA 1IBKK 3TU5A 2HHVA 4IBNA 4MLEA 4KTZA 3AAPA 4CERA 3A5NC 1RTHA 4DTPA 1BGXT 4MDAA 4DQRA 1XHXA 1T6CA 5KGWA 4DQIA 1A5WA 4O5FA 2D0AA 2OPSA 3DYAA 3KZBA 1OKJA 4CEEA 1Z26A 2LSNA 4JKGB 4LF7K 1E4FT 3HZ6A 5ADXH 4CF2A 2F7TA 4CHNA 3H6EA 2OANA 1UOCA 2NRTA 3EO3A 4RW4A 4IXCA 3V9SA 1GLEG 1T05A 3C95A 1DTQA 1S6PA 3T7ZA 4W5QA 4GV3A 2A41A 5FPNA 1VQ4N 4ELTA 4DTJA 4M3WA 2VYPA 1NGBA 5AJ3K 1IG9A 4B9TA 2DTUA 3HL8A 3K9KA 1IO2A 4FK0A 4PKGA 4JI7K 3OYDA 3SUOA 2D5RA 5BN9A 1MU2A 3VGLA 3ZEUA 2ZF5O 3ZETA 4O8KA 3V9XA 3IAYA 5DM7L 2G8IA 4Z4IA 3ITHA 5FRNA 4O8UA 4O0JA 4HTUA 4FLWA 3SYZA 5C24A 4B9QA 4IEEA 4CJFA 3KLEA 1BDGA 3QLHA 3BY5A 3LPUA 5AQOA 1VSFA 4BRDA 2YCHA 1QQMA 1EQYA 2D0CA 4GV9A 3VF2A 5SZTA 1Q86O 3EY1A 1JCEA 3THXA 4WFAL 3F9MA 2BH1A 3OS0A 3MCPA 4N5SA 3F73A 1W9HA 4UY8O 2NRHA 3LPTA 2KHOA 1NU0A 1IKVA 1N6QA 4BROA 3RVCA 4WFBL 2E2OA 1ZBFA 4YNQA 4E89A 3IUCA 2QWPA 5T7BA 3KD5E 3LP1A 4JKAA 3OYBA 3UKRB 3WUHA 1QSSA 5J2MA 3NH1A 5AQYA 4JK8A 1KAZA 4E1MA 4B1WB 4FLVA 5JLFA 3EL2A 1KQSM 4CEBA 3VOVA 2RF2A 4JKGA 1EXQA 3G25A 4BE1A 1W2BM 4ZTJA 3UKUA 3QFPA 2P51A 4CF0A 1IJJA 3DLHA 2NNWA 2ASMA 4MDBA 3K5NA 1TKDA 1TVRA 4H5NA 4FJGA 3EKSA 2HSTA 4GNIA 3CFRA 4CIFA 3C7NA 1VSKA 5CHIA 2B4JA 4FM1A 4DFPA 4KBOA 1KD1O 4F9OA 1RT1A 4IKFA 4BDPA 2H3GX 2ATQA 5C0YA 1VQNN 3KLIA 2Q0RA 1TKXA 4N47A 4B8AB 3R9PA 3HM9A 2Q0UA 1NKCA 1T3VA 1KC8O 4NO7A 5TKWA 2UUBK 4ISGA 4BRCA 2QM1A 1A5XA 4JKFA 3HOTA 1QS4A 1BCMA 2FLOA 2OPQA 2ZJQL 3VPZA 3HPOA 1YHQN 4BQLA 4EFHA 1DT9A 1XC9A 3ID8A 1NKBA 2ASOA 4FK4A 1Q18A 1I39A 1OH8A 3RWUA 3NBPA 4FW2A 3VQQA 2WUSA 1QSLA 2IS3A 3NDKA 1UA1A 3HOSA 3I33A 1BISA 3CHWA 4IOAL 3CCUN 2HOEA 4CK2A 1IKYA 4RG8A 3NF8A 3KK2A 4K8ZA 4M3UA 3VEVA 5GIPA 2E88A 2NZTA 3SBGA 4CJKA 2XY5A 4B9LA 4FWSA 2ZM6K 3UKRA 3FZLA 4X64K 1U47A 4UQGA 2KQ2A 2O8FB 4AHCA 4W5TA 3K59A 3MXMA 2WOMA 4ZTFA 3QB0A 4PWDA 4B9NA 2YKMA 2WC9A 2UUCK 1Z05A 4BRKA 3BF3A 1RDBA 3QETA 3P1GA 4M3ZA 2P9UB 1ILYA 2VG7A 3OYEA 4AHVA 3Q7CA 4OJRA 1IKXA 4K41A 1KFDA 4E0DA 3O80A 3DRRA 3KTQA 3DWLA 1XMQK 1VHXA 3CYMA 3M6GA 4RCHA 4JRQA 4CJLA 5A2QO 1R59O 4Z94A 4B1VA 3AVLA 3DXMB 5BPLA 5FROA 4DUYK 2QI2A 3PUFA 5BRHA 4B1UB 5K14A 4J2EA 1HJOA 1X9SA 4O44A 3N4QA 3HVRA 4PA1A 3VQPA 1JLQA 4LF9K 3NFAA 1IKWA 3TTDA 4CZGA 3MWPA 4DR6K 4JS5A 3U6FA 3OJUA 3LP3A 2OYQA 4B9UA 2P9IA 4ID5A 4CE9A 4CJQA 1OH6A 4JI2K 3LDSA 1T7PA 4JI5K 3DJCA 4JI3K 2HBLA 4BWJA 4N76A 3HVTA 4BWMA 1XNRK 4ELUA 4EZ9A 4I9QA 2JGUA 4PY5A 3O4WA 3C94A 2PAVA 3AVHA 3AA4A 3SMSA 4NYFA 4W5RA 4BRHA 5CYMA 3DAWA 1YAGA 1RT5A 2R7YA 1S1WA 2V52B 3BUZB 3CFOA 5KGXA 3L2UA 1HYVA 2ZGYA 1LW0A 3QEXA 4CZEA 3D6RA 1N33K 3TSQA 1U2VA 2HNYA 3VF4A 1IG8A 4GVMA 2P5OA 4KKOA 4LSNA 4A62A 3ZSRA 4AHTA 2KFZA 3I55N 3NF9A 3EEQA 4B3MK 3D2EB 3OTOK 3U3YA 3GBTA 4E19A 1RDDA 5CR4A 4AH9A 3OYMA 2KZMA 4JAXA 4QS8A 4HCBA 3MN9A 5HOOA 4O5BA 4FZXC 4Z4EA 4CHYA 4KHYA 4MQ3A 1C0TA 5J2PA 3ENHA 4CK1A 5LY3A 2KW4A 4B3OA 3S3OA 3CCVN 1N34K 3K58A 3DLKA 4BR2A 3QEVA 2XY7A 3R1XA 3T1HK 4H4MA 4KH4A 4FLZA 1KAXA 1HKBA 4DS4A 2E8AA 3K9JA 4AM6A 3NGIA 2PFUA 2FSKA 3BGRA 5JMVA 3NF7A 2ZJRL 1TKZA 3DM2A 4H4OA 4CBWA 5M1FA 4DR7K 4B1YB 4YOYA 4CZLA 2QWLA 5M1NA 2Q3SA 4JI4K 1NK4A 3WT0A 3CERA 4IG3A 5AZJB 4IZ9A 4MLHA 3O9TA 3MECA 4LC9B 3C6HA 4BDZA 1KVAA 4NXNK 4GV6A 3BDPA 3CCJN 2GWJA 3TARA 1Q9YA 4WFNL 1VAZA 3PX0A 4CJ4A 3WEEB 4E1JA 3MCAB 3CQ8A 3V1QA 3RR8A 3CPWM 1VQ8N 3W3DA 3HPGA 4CJUA 4RW7A 3THYB 4JV5K 3EE8A 2GUIA 1K8KA 3D2EA 5M1PA 4FJXA 1VRTA 3THVA 4A2BA 1SL0A 4JK7A 4OVLA 2V7YA 4YOWA 3VQBA 4CJRA 1TL3A 4CJEA 2E6LA 5AQUA 3EKUA 3O08A 3QDKA 1D4XA 4FJLA 3AO3A 3DRPA 2YNFA 3EYZA 3KD1E 3CF5L 3PO4A 3H1QA 5AFUA 4DS5A 4JKBA 2VQFK 5GAGP 1VQMN 1S22A 1S9EA 2P9NB 3FZFA 2HHSA 2FXUA 1UA0A 3LL3A 1FKOA 3ULDA 1ZBUA 1RTDA 1OVYA 4OKJA 3SV3A 1NBWA 3KJVA 3DLRA 5F1XA 2KFNA 1SS6A 3CJBA 1VQ9N 2D0BA 4CJ3A 5EOYA 3G4SN 3CM5A 3SJHA 2O4IA 4H0PA 4OPHA 3O3HA 2VCPA 3B8AX 4BRPA 3EZWA 3JXUA 3T1AA 4CESA 4DLEA 1MDUB 4IOXA 4BC4A 4EIAA 3NAEA 5LMUK 4H0XB 1ASVA 3O9RA 1RBSA 5AZJA 2Q1NA 2CGLA 1FK9A 3TAQA
chains in the Genus database with same CATH topology
1TGOA 3OYLA 3V9XA 3IAYA 1KVBA 4CJWA 2G8IA 4Z4IA 3ITHA 4C8MA 3U3GA 4KHWA 2RKIA 3I0RA 4O0JA 4HTUA 4FLWA 1TKTA 1EP4A 3LAKA 4PQUA 3SYZA 3ZT2A 5C24A 4KTQA 4LSLA 3ISNC 1TV6A 4KHSA 1VSEA 3VQEA 4CJFA 4Z4CA 5HRPA 3KLEA 4CJVA 3SPYA 4CCHA 1VK0A 1J54A 3QLHA 1ASUA 1T8EA 3V1OA 3LPUA 1TK8A 1U04A 1VSFA 4FW1A 4LH4A 2W42A 2D0CA 1ZBHA 2XO7A 1O1WA 1RT4A 2Z1HA 3C6TA 5SZTA 4IG0A 4O55A 3EY1A 3HYFA 1RBVA 3AA5X 3RMCA 1ASWA 1JLCA 3LZIA 4FYDA 3OS0A 3A2FA 3F9KA 5EU7A 4N5SA 3F73A 4FJJA 2HHQA 1W9HA 3KK1A 1FXXA 3LPTA 4I2QA 4FZZA 3NGZA 1DLOA 4KV8A 5HRNA 4I7FA 4B9MA 4RW6A 1IKVA 1YVUA 3SQ4A 1KSPA 1N6QA 1BI4A 4Q0BA 1W0HA 2XRIA 1GOCA 4CFAA 1NK6A 3MEDA 4O0IA 3QNOA 1ZBFA 1S5JA 4DMNA 4E89A 4YNQA 3E01A 3AO2A 1WSFA 5T7BA 3CFPA 1NK9A 1QE1A 2ETJA 3KD5E 3LP1A 5FDLA 3OYBA 3NH0A 1S1TA 1KFSA 5DMRA 1TK5A 3VQ6A 3ZCMA 5J2MA 3NH1A 1QSSA 1C0UA 5CZ1A 3VQ8A 5FRNA 3K57A 1U4BA 2QKKA 1REVA 4E1MA 3VQ9A 3DOKA 1L3SA 4FLVA 3H08A 3ZSXA 3RMBA 4Z4GA 5CYQA 2DFFA 1S1XA 3KK3A 2DFEA 3KKRA 4BDYA 1S1UA 1HJRA 3KIOA 4CEBA 2HW3A 2RF2A 4CGDA 3O3FA 1EXQA 1D9FA 3OYNA 1L3TA 3AVIA 4HHTA 4ELVA 4BE1A 3TAEA 4ZTJA 4EP4A 4Z4HA 3VQ4A 1UAXA 3UIQA 3D0PA 4E3SA 1LV5A 1T03A 2PYLA 2P51A 1C0MA 4CF0A 4F8RA 3M8PA 2A1SA 1WSJA 4LD0A 3SJJA 3DLHA 3K5NA 1TKDA 4KB0A 2E4LA 1TVRA 4E7IA 3ASMA 4KI4A 4FJGA 2YNGA 4KTWA 3RMAA 3NE6A 2G8VA 3G0ZA 3CFRA 4CIFA 3LANA 4E7LA 1SKRA 1VSKA 3T3FA 3SQ2A 3AV9A 2B4JA 3NCIA 3V9WA 3L2WA 4FM1A 4DFPA 1U48A 1X9MA 4CJTA 2BGGA 1HPZA 1RT1A 2YHAA 3OS2A 3K5OA 4IKFA 4AHUA 1JL2A 4BDPA 4Z4FA 2ATQA 1NOYA 2FBXA 2EX3A 3KLIA 3QINA 1TKXA 4N47A 4B8AB 3QEPA 4FJ7A 3HM9A 3LP0A 3QEWA 3SPZA 1Q9XA 3AVBA 2B6AA 3KLFA 1NJYA 1LWFA 1NKCA 4R5PA 1ZBIA 1VSJA 2VWJA 4DU1A 1A5XA 4MFBA 1J9AA 4AHRA 4CK3A 3DLGA 4KAZA 1QS4A 5KTQA 4M42A 4JRPA 1BCMA 3VQCA 2OPQA 1LW2A 3OY9A 4CGGA 3V9ZA 3HP6A 1QHTA 3NH2A 3HPOA 1KLNA 3ZSYA 4BE0A 2OPRA 4N41A 4CEFA 3HJFA 1XC9A 2KZZA 1VSIA 3SCXA 1JLEA 4M3RA 1NKBA 4FJIA 4B9SA 3PV8A 5HROA 1JLBA 1L5UA 4FK4A 1BQNA 1JKHA 1I39A 1JXEA 1WSEA 3O3GA 3HXMA 2B5JA 2WONA 3RWUA 3NBPA 2VWKA 1I3AA 4DFJA 4FW2A 3VQQA 3OYKA 1QSLA 2P1JA 1KLMA 1C6VA 2HB5A 2IS3A 2GV9A 3P5JA 1L3VA 3NDKA 3K2PA 1UA1A 1D8YA 1BISA 1NJXA 3QIPA 4RW8A 1QTMA 4DTXA 1HQUA 4KPYA 4CK2A 1IKYA 4DU3A 4RG8A 3NF8A 4DQPA 3QIOA 3KK2A 3V81A 2QKBA 3AVKA 3OYCA 4DSEA 4K8ZA 2ZQBA 1RNHA 4FM2A 2HHUA 3OYIA 4M3UA 4CECA 4DWIA 2XY5A 4CJKA 4B9LA 4NCGA 3ZSWA 1RT3A 2VG5A 3HT3A 3JSMA 1EETA 4OPJA 4M3XA 3HP9A 4DG1A 4PUOA 1U47A 4UQGA 2KQ2A 4CHZA 4AHCA 4W5TA 3K59A 2YV0X 5HRRA 1CZBA 3MXMA 2HMIA 4J2DA 1U45A 5C25A 2HHTA 2WOMA 4E7HA 3C6UA 4ZTFA 4QAGA 3AA3A 4PWDA 3WNEA 5CZ2A 4DF4A 1SKWA 4B9NA 2YKMA 3QESA 5HRSA 1D5AA 4KRFA 4CF9A 3ZSZA 1RDBA 3QETA 1YTUA 1JL1A 2X78A 3P1GA 4DSIA 4M3ZA 4FJNA 1GOAA 2VG7A 4CJSA 3OYEA 1BCOA 4AHVA 3ZSQA 4OJRA 1UWBA 1KVCA 1JLGA 3MXJA 1IKXA 4F4KA 1KFDA 3WNGA 4E0DA 4CHOA 3HSTB 4YFUA 3M8QA 4Q5VA 3DRRA 1ITGA 3KTQA 4CGIA 1L3UA 2RPIA 3OVNA 3CYMA 4JRQA 4CJLA 4FM0A 4LH5A 4H8KA 4E7KA 1WSIA 3AVLA 3M8RA 3VQDA 5FROA 3VQAA 3AVGA 1HQEA 3I8DA 3PY8A 1RTIA 3PUFA 3V1RA 2P5GA 2HVIA 4W5OA 3AVAA 4CEOA 2FBTA 3RMDA 3KKSA 4I2PA 5K14A 2Z1GA 3AVFA 1X9SA 2O4GA 3DLEA 4J2EA 2G8FA 2BDPA 4O44A 4FCYA 2G8WA 1FKPA 1DTTA 3LAMA 3HVRA 3VA3A 4CJPA 4PA1A 3VQPA 1JLQA 3DRSA 1WSHA 3RTVA 4DTUA 2HVHA 3NFAA 5HP1A 4CFCA 4FJ5A 1IKWA 2Y1JA 4NYNA 3HK2A 3OYHA 3CM6A 4DTSA 4CGFA 4DSLA 4JS5A 2X74A 2DY4A 3U6FA 4XIUA 1TK0A 1XHZA 3OJUA 4FJKA 1HYZA 3DMJA 4KHNA 5JS2A 3LP3A 3V9UA 3O4NA 3L2QA 4HUEA 2OYQA 4B9UA 1NK0A 3MEEA 1LWCA 4ID5A 4CE9A 4CJQA 4F2SA 3L2RA 5HBMA 3LDSA 1T7PA 3DLBA 2QXFA 1BQMA 1GOBA 1KTQA 5KI6A 4BWJA 2PYJA 3HVTA 4BWMA 2OPPA 4N76A 1X9WA 4C8KA 2Y1IA 4ELUA 2Z1JA 5CY4A 4EZ9A 2JGUA 4I9QA 4PY5A 3C94A 3TWHA 3AVHA 3AA4A 3QERA 4KI6A 4NYFA 4OLAA 2AJQA 1C1CA 4W5RA 3LZJA 1BIZA 5CYMA 4DFKA 4DSJA 1RT5A 2R7YA 1SV5A 3AVJA 1S1WA 4JLHA 3ZT4A 4CHQA 3QEIA 5I3UA 2FBVA 5C42A 2IDOA 3CFOA 4CIEA 5KGXA 3L2UA 5D3GA 1ZYQA 1VSDA 1WSGA 3MAQA 1HYVA 1SUQA 1BIUA 1EKEA 1LW0A 3QEXA 2IOCA 4GMJB 1X1PA 4QCLA 4CJ5A 4HUGA 4AHSA 4B8CA 4DSKA 1CZ9A 4DFMA 3ZT1A 2HNYA 5I42A 4F3TA 4ID1A 4QOZB 2HNZA 4OGCA 3IG1A 3RRGA 4RW9A 4DTNA 4GVMA 2G8UA 2P5OA 4KKOA 4LSNA 3ZSRA 5KRTA 2E6MA 4AHTA 4HUFA 1NK5A 1S9GA 4KO0A 2BANA 2KFZA 3NF9A 3RR7A 2A1RA 4Z0UA 1WAFA 3KLGA 3I0SA 4DTMA 1XI1A 4B9VA 4C8NA 4OKKA 3U3YA 3L8BA 4E19A 1RDDA 4DLGA 4DTRA 3AO5A 4AH9A 1KCFA 1QQCA 1WAJA 3OYMA 2JLEA 1Q8IA 4FJHA 2F96A 3L3VA 2ITGA 2KTQA 3ZT3A 4FJ8A 2FC0A 3ZSOA 3O4QA 3SV4A 3T19A 4C8LA 2KZMA 4M45A 1JXBA 1CXUA 3AVMA 4FLXA 4O5BA 3NF6A 4AILC 4FZXC 4HCBA 2YNHA 3AVCA 4Z4EA 4CHYA 4KHYA 1NOZA 4KHUA 4KFBA 4MQ3A 1C0TA 1JLAA 3ZSVA 5J2PA 1C1BA 5J2QA 5J1EA 2G8HA 4C8OA 4CGJA 3HO1A 3WNHA 1CLQA 3VN5A 1A5VA 2RN2A 3B6OA 4CK1A 4F2RA 2KW4A 5HLFA 3AO4A 1LWEA 3LWMA 1NKEA 3TAMA 4FK2A 4B3OA 3S3OA 1BHLA 2BE2A 3K58A 3DLKA 1HYSA 2XY8A 3L2VA 3QEVA 2FBYA 4CEQA 3OYJA 2XY7A 2ZE2A 4K8XA 2OZMA 1SL2A 3OJSA 4H4MA 1RBUA 4KHQA 3M8SA 4BACA 4FLZA 2OA8A 1S6QA 3SI6A 3TAFA 3S3MA 4DS4A 2X6SA 1B92A 1RDAA 5J2NA 3OYAA 3NGIA 1RT2A 4HVJA 1QSYA 3SNNA 3BGRA 4OLBA 1WNSA 4EP5A 3TANA 1NK8A 4CIGA 3S9HA 1WN7A 4O4GA 3NF7A 1XWLA 3TR8A 3K5LA 1Z25A 3V6DA 1TKZA 1CXQA 2G8KA 3DM2A 3OYFA 2IC3A 4E1NA 4H4OA 3TABA 4OPKA 3SZ2A 2NUBA 4FLUA 2EHGA 2IAJA 3NGYA 1RTJA 4HCCA 1HNIA 3D45A 4IFYA 4Y1CA 2ZD1A 4I9LA 3OS1A 4FJMA 4L8RB 4OGEA 3SQ0A 1YTAA 3AVNA 3MEGA 2Z1IA 2Q3SA 4B08A 3AA2A 3OYGA 2XHBA 4E7JA 2YNIA 3TAPA 1NK4A 4M3TA 5JS1A 1RT6A 4DF8A 4IG3A 3TAGA 1JLFA 1N5YA 3MECA 4BDZA 3LP2A 1KVAA 1WLJA 1SKSA 3VQ7A 2QK9A 1G15A 1VSHA 2YKNA 3K5MA 3BDPA 5KRSA 1ZBLA 4Y1DA 1C1AA 1J53A 3TARA 1Q9YA 3EZ5A 2F8SA 4W5NA 4DU4A 1TAUA 1TAQA 3PX0A 3PO5A 1IH7A 4CJ4A 4DTOA 3HPHA 2XY6A 3L3UA 1S1VA 3CQ8A 3V1QA 2GBZA 4CF1A 3NHGA 3RR8A 1VRUA 4DSFA 4FZYA 4TSXA 4JS4A 3HPGA 3MXIA 1RILA 4CEAA 3ALYA 4CJUA 4GW6A 4RW7A 3RRHA 2HHXA 3JYTA 4CFDA 4EZ6A 2DFHA 4G1QA 3LALA 2GUIA 4KB1A 4KREA 3DI6A 3KLHA 4FJXA 1VRTA 3THVA 1SL0A 1HMVA 3FFIA 2X6NA 1LAVA 1B9DA 4OVLA 4CEZA 4LY7A 3VQBA 4CJRA 1TL3A 4M3YA 4CJEA 4DQQA 1RCHA 1VSLA 3S3NA 4FLTA 2E6LA 2PY5A 3VQ5A 3PX6A 2I5JA 1TL1A 3AO3A 1NJWA 1BI4B 3G10A 4FVMA 4OKEA 4FJLA 3DRPA 5DK5A 2YNFA 4IBNA 5E41A 3EYZA 3KD1E 2HHVA 1RBTA 1VSMA 4KTZA 3PO4A 4FJ9A 4DS5A 3LWLA 3WNFA 3IRXA 4J2AA 4CERA 1RTHA 4DTPA 1KRPA 1BGXT 1RT7A 2VG6A 4CFBA 1J5OA 4M41A 3IS9A 4DQRA 1S9EA 4NCBA 2HHSA 2PZSA 1XHXA 3CG7A 2HHWA 5KGWA 4NCAA 4CGHA 1UA0A 4DQIA 1Y97A 3SQ1A 1A5WA 1FKOA 1NJZA 3ULDA 1YT3A 1ZBUA 1RTDA 4CHPA 3PX4A 4OKJA 4CF8A 1LAWA 3V4IA 3VA0A 2OZSA 3SV3A 4N56A 3KJVA 4DQSA 2D0AA 2OPSA 3DLRA 1K6YA 1NK7A 3DYAA 2KFNA 1F21A 4CEEA 1RDCA 1Z26A 2LSNA 2YHBA 3B6PA 1U49A 4CF2A 4CHNA 4FXDA 1UOCA 2D0BA 4ICLA 4CJ3A 4WE1A 3CM5A 4RW4A 3SUQA 3V9SA 3QO9A 1SL1A 2O4IA 3ZT0A 1T05A 3C95A 3DOLA 1DTQA 1S6PA 4W5QA 3O3HA 4ELTA 3P83D 4BE2A 1BL3A 2F8TA 4DTJA 4M3WA 3T1AA 4CESA 2IGIA 4DLEA 3QNNA 1IG9A 4B9TA 2DTUA 3HL8A 1IO2A 1B9FA 4ZHRA 3NAEA 4FK0A 1ASVA 2HNDA 3TI0A 1RBSA 5SWMA 3SUNA 3OYDA 4FLYA 1R0AA 3SUOA 4F3OA 1EX4A 1D9DA 1FK9A 3TAQA 4J2BA 3AO1A 2D5RA 4CEDA 5FRMA 1HRHA 4IDKA 1MU2A 1RBRA 3SUPA 1HNVA 4IFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TGO A;  3OYL A;  3V9X A;  3IAY A;  1KVB A;  4CJW A;  2G8I A;  4Z4I A;  3ITH A;  4C8M A;  3U3G A;  4KHW A;  2RKI A;  3I0R A;  4O0J A;  4HTU A;  4FLW A;  1TKT A;  1EP4 A;  3LAK A;  4PQU A;  3SYZ A;  3ZT2 A;  5C24 A;  4KTQ A;  4LSL A;  3ISN C;  1TV6 A;  4KHS A;  1VSE A;  3VQE A;  4CJF A;  4Z4C A;  5HRP A;  3KLE A;  4CJV A;  3SPY A;  4CCH A;  1VK0 A;  1J54 A;  3QLH A;  1ASU A;  1T8E A;  3V1O A;  3LPU A;  1TK8 A;  1U04 A;  1VSF A;  4FW1 A;  4LH4 A;  2W42 A;  2D0C A;  1ZBH A;  2XO7 A;  1O1W A;  1RT4 A;  2Z1H A;  3C6T A;  5SZT A;  4IG0 A;  4O55 A;  3EY1 A;  3HYF A;  1RBV A;  3AA5 X;  3RMC A;  1ASW A;  1JLC A;  3LZI A;  4FYD A;  3OS0 A;  3A2F A;  3F9K A;  5EU7 A;  4N5S A;  3F73 A;  4FJJ A;  2HHQ A;  1W9H A;  3KK1 A;  1FXX A;  3LPT A;  4I2Q A;  4FZZ A;  3NGZ A;  1DLO A;  4KV8 A;  5HRN A;  4I7F A;  4B9M A;  4RW6 A;  1IKV A;  1YVU A;  3SQ4 A;  1KSP A;  1N6Q A;  1BI4 A;  4Q0B A;  1W0H A;  2XRI A;  1GOC A;  4CFA A;  1NK6 A;  3MED A;  4O0I A;  3QNO A;  1ZBF A;  1S5J A;  4DMN A;  4E89 A;  4YNQ A;  3E01 A;  3AO2 A;  1WSF A;  5T7B A;  3CFP A;  1NK9 A;  1QE1 A;  2ETJ A;  3KD5 E;  3LP1 A;  5FDL A;  3OYB A;  3NH0 A;  1S1T A;  1KFS A;  5DMR A;  1TK5 A;  3VQ6 A;  3ZCM A;  5J2M A;  3NH1 A;  1QSS A;  1C0U A;  5CZ1 A;  3VQ8 A;  5FRN A;  3K57 A;  1U4B A;  2QKK A;  1REV A;  4E1M A;  3VQ9 A;  3DOK A;  1L3S A;  4FLV A;  3H08 A;  3ZSX A;  3RMB A;  4Z4G A;  5CYQ A;  2DFF A;  1S1X A;  3KK3 A;  2DFE A;  3KKR A;  4BDY A;  1S1U A;  1HJR A;  3KIO A;  4CEB A;  2HW3 A;  2RF2 A;  4CGD A;  3O3F A;  1EXQ A;  1D9F A;  3OYN A;  1L3T A;  3AVI A;  4HHT A;  4ELV A;  4BE1 A;  3TAE A;  4ZTJ A;  4EP4 A;  4Z4H A;  3VQ4 A;  1UAX A;  3UIQ A;  3D0P A;  4E3S A;  1LV5 A;  1T03 A;  2PYL A;  2P51 A;  1C0M A;  4CF0 A;  4F8R A;  3M8P A;  2A1S A;  1WSJ A;  4LD0 A;  3SJJ A;  3DLH A;  3K5N A;  1TKD A;  4KB0 A;  2E4L A;  1TVR A;  4E7I A;  3ASM A;  4KI4 A;  4FJG A;  2YNG A;  4KTW A;  3RMA A;  3NE6 A;  2G8V A;  3G0Z A;  3CFR A;  4CIF A;  3LAN A;  4E7L A;  1SKR A;  1VSK A;  3T3F A;  3SQ2 A;  3AV9 A;  2B4J A;  3NCI A;  3V9W A;  3L2W A;  4FM1 A;  4DFP A;  1U48 A;  1X9M A;  4CJT A;  2BGG A;  1HPZ A;  1RT1 A;  2YHA A;  3OS2 A;  3K5O A;  4IKF A;  4AHU A;  1JL2 A;  4BDP A;  4Z4F A;  2ATQ A;  1NOY A;  2FBX A;  2EX3 A;  3KLI A;  3QIN A;  1TKX A;  4N47 A;  4B8A B;  3QEP A;  4FJ7 A;  3HM9 A;  3LP0 A;  3QEW A;  3SPZ A;  1Q9X A;  3AVB A;  2B6A A;  3KLF A;  1NJY A;  1LWF A;  1NKC A;  4R5P A;  1ZBI A;  1VSJ A;  2VWJ A;  4DU1 A;  1A5X A;  4MFB A;  1J9A A;  4AHR A;  4CK3 A;  3DLG A;  4KAZ A;  1QS4 A;  5KTQ A;  4M42 A;  4JRP A;  1BCM A;  3VQC A;  2OPQ A;  1LW2 A;  3OY9 A;  4CGG A;  3V9Z A;  3HP6 A;  1QHT A;  3NH2 A;  3HPO A;  1KLN A;  3ZSY A;  4BE0 A;  2OPR A;  4N41 A;  4CEF A;  3HJF A;  1XC9 A;  2KZZ A;  1VSI A;  3SCX A;  1JLE A;  4M3R A;  1NKB A;  4FJI A;  4B9S A;  3PV8 A;  5HRO A;  1JLB A;  1L5U A;  4FK4 A;  1BQN A;  1JKH A;  1I39 A;  1JXE A;  1WSE A;  3O3G A;  3HXM A;  2B5J A;  2WON A;  3RWU A;  3NBP A;  2VWK A;  1I3A A;  4DFJ A;  4FW2 A;  3VQQ A;  3OYK A;  1QSL A;  2P1J A;  1KLM A;  1C6V A;  2HB5 A;  2IS3 A;  2GV9 A;  3P5J A;  1L3V A;  3NDK A;  3K2P A;  1UA1 A;  1D8Y A;  1BIS A;  1NJX A;  3QIP A;  4RW8 A;  1QTM A;  4DTX A;  1HQU A;  4KPY A;  4CK2 A;  1IKY A;  4DU3 A;  4RG8 A;  3NF8 A;  4DQP A;  3QIO A;  3KK2 A;  3V81 A;  2QKB A;  3AVK A;  3OYC A;  4DSE A;  4K8Z A;  2ZQB A;  1RNH A;  4FM2 A;  2HHU A;  3OYI A;  4M3U A;  4CEC A;  4DWI A;  2XY5 A;  4CJK A;  4B9L A;  4NCG A;  3ZSW A;  1RT3 A;  2VG5 A;  3HT3 A;  3JSM A;  1EET A;  4OPJ A;  4M3X A;  3HP9 A;  4DG1 A;  4PUO A;  1U47 A;  4UQG A;  2KQ2 A;  4CHZ A;  4AHC A;  4W5T A;  3K59 A;  2YV0 X;  5HRR A;  1CZB A;  3MXM A;  2HMI A;  4J2D A;  1U45 A;  5C25 A;  2HHT A;  2WOM A;  4E7H A;  3C6U A;  4ZTF A;  4QAG A;  3AA3 A;  4PWD A;  3WNE A;  5CZ2 A;  4DF4 A;  1SKW A;  4B9N A;  2YKM A;  3QES A;  5HRS A;  1D5A A;  4KRF A;  4CF9 A;  3ZSZ A;  1RDB A;  3QET A;  1YTU A;  1JL1 A;  2X78 A;  3P1G A;  4DSI A;  4M3Z A;  4FJN A;  1GOA A;  2VG7 A;  4CJS A;  3OYE A;  1BCO A;  4AHV A;  3ZSQ A;  4OJR A;  1UWB A;  1KVC A;  1JLG A;  3MXJ A;  1IKX A;  4F4K A;  1KFD A;  3WNG A;  4E0D A;  4CHO A;  3HST B;  4YFU A;  3M8Q A;  4Q5V A;  3DRR A;  1ITG A;  3KTQ A;  4CGI A;  1L3U A;  2RPI A;  3OVN A;  3CYM A;  4JRQ A;  4CJL A;  4FM0 A;  4LH5 A;  4H8K A;  4E7K A;  1WSI A;  3AVL A;  3M8R A;  3VQD A;  5FRO A;  3VQA A;  3AVG A;  1HQE A;  3I8D A;  3PY8 A;  1RTI A;  3PUF A;  3V1R A;  2P5G A;  2HVI A;  4W5O A;  3AVA A;  4CEO A;  2FBT A;  3RMD A;  3KKS A;  4I2P A;  5K14 A;  2Z1G A;  3AVF A;  1X9S A;  2O4G A;  3DLE A;  4J2E A;  2G8F A;  2BDP A;  4O44 A;  4FCY A;  2G8W A;  1FKP A;  1DTT A;  3LAM A;  3HVR A;  3VA3 A;  4CJP A;  4PA1 A;  3VQP A;  1JLQ A;  3DRS A;  1WSH A;  3RTV A;  4DTU A;  2HVH A;  3NFA A;  5HP1 A;  4CFC A;  4FJ5 A;  1IKW A;  2Y1J A;  4NYN A;  3HK2 A;  3OYH A;  3CM6 A;  4DTS A;  4CGF A;  4DSL A;  4JS5 A;  2X74 A;  2DY4 A;  3U6F A;  4XIU A;  1TK0 A;  1XHZ A;  3OJU A;  4FJK A;  1HYZ A;  3DMJ A;  4KHN A;  5JS2 A;  3LP3 A;  3V9U A;  3O4N A;  3L2Q A;  4HUE A;  2OYQ A;  4B9U A;  1NK0 A;  3MEE A;  1LWC A;  4ID5 A;  4CE9 A;  4CJQ A;  4F2S A;  3L2R A;  5HBM A;  3LDS A;  1T7P A;  3DLB A;  2QXF A;  1BQM A;  1GOB A;  1KTQ A;  5KI6 A;  4BWJ A;  2PYJ A;  3HVT A;  4BWM A;  2OPP A;  4N76 A;  1X9W A;  4C8K A;  2Y1I A;  4ELU A;  2Z1J A;  5CY4 A;  4EZ9 A;  2JGU A;  4I9Q A;  4PY5 A;  3C94 A;  3TWH A;  3AVH A;  3AA4 A;  3QER A;  4KI6 A;  4NYF A;  4OLA A;  2AJQ A;  1C1C A;  4W5R A;  3LZJ A;  1BIZ A;  5CYM A;  4DFK A;  4DSJ A;  1RT5 A;  2R7Y A;  1SV5 A;  3AVJ A;  1S1W A;  4JLH A;  3ZT4 A;  4CHQ A;  3QEI A;  5I3U A;  2FBV A;  5C42 A;  2IDO A;  3CFO A;  4CIE A;  5KGX A;  3L2U A;  5D3G A;  1ZYQ A;  1VSD A;  1WSG A;  3MAQ A;  1HYV A;  1SUQ A;  1BIU A;  1EKE A;  1LW0 A;  3QEX A;  2IOC A;  4GMJ B;  1X1P A;  4QCL A;  4CJ5 A;  4HUG A;  4AHS A;  4B8C A;  4DSK A;  1CZ9 A;  4DFM A;  3ZT1 A;  2HNY A;  5I42 A;  4F3T A;  4ID1 A;  4QOZ B;  2HNZ A;  4OGC A;  3IG1 A;  3RRG A;  4RW9 A;  4DTN A;  4GVM A;  2G8U A;  2P5O A;  4KKO A;  4LSN A;  3ZSR A;  5KRT A;  2E6M A;  4AHT A;  4HUF A;  1NK5 A;  1S9G A;  4KO0 A;  2BAN A;  2KFZ A;  3NF9 A;  3RR7 A;  2A1R A;  4Z0U A;  1WAF A;  3KLG A;  3I0S A;  4DTM A;  1XI1 A;  4B9V A;  4C8N A;  4OKK A;  3U3Y A;  3L8B A;  4E19 A;  1RDD A;  4DLG A;  4DTR A;  3AO5 A;  4AH9 A;  1KCF A;  1QQC A;  1WAJ A;  3OYM A;  2JLE A;  1Q8I A;  4FJH A;  2F96 A;  3L3V A;  2ITG A;  2KTQ A;  3ZT3 A;  4FJ8 A;  2FC0 A;  3ZSO A;  3O4Q A;  3SV4 A;  3T19 A;  4C8L A;  2KZM A;  4M45 A;  1JXB A;  1CXU A;  3AVM A;  4FLX A;  4O5B A;  3NF6 A;  4AIL C;  4FZX C;  4HCB A;  2YNH A;  3AVC A;  4Z4E A;  4CHY A;  4KHY A;  1NOZ A;  4KHU A;  4KFB A;  4MQ3 A;  1C0T A;  1JLA A;  3ZSV A;  5J2P A;  1C1B A;  5J2Q A;  5J1E A;  2G8H A;  4C8O A;  4CGJ A;  3HO1 A;  3WNH A;  1CLQ A;  3VN5 A;  1A5V A;  2RN2 A;  3B6O A;  4CK1 A;  4F2R A;  2KW4 A;  5HLF A;  3AO4 A;  1LWE A;  3LWM A;  1NKE A;  3TAM A;  4FK2 A;  4B3O A;  3S3O A;  1BHL A;  2BE2 A;  3K58 A;  3DLK A;  1HYS A;  2XY8 A;  3L2V A;  3QEV A;  2FBY A;  4CEQ A;  3OYJ A;  2XY7 A;  2ZE2 A;  4K8X A;  2OZM A;  1SL2 A;  3OJS A;  4H4M A;  1RBU A;  4KHQ A;  3M8S A;  4BAC A;  4FLZ A;  2OA8 A;  1S6Q A;  3SI6 A;  3TAF A;  3S3M A;  4DS4 A;  2X6S A;  1B92 A;  1RDA A;  5J2N A;  3OYA A;  3NGI A;  1RT2 A;  4HVJ A;  1QSY A;  3SNN A;  3BGR A;  4OLB A;  1WNS A;  4EP5 A;  3TAN A;  1NK8 A;  4CIG A;  3S9H A;  1WN7 A;  4O4G A;  3NF7 A;  1XWL A;  3TR8 A;  3K5L A;  1Z25 A;  3V6D A;  1TKZ A;  1CXQ A;  2G8K A;  3DM2 A;  3OYF A;  2IC3 A;  4E1N A;  4H4O A;  3TAB A;  4OPK A;  3SZ2 A;  2NUB A;  4FLU A;  2EHG A;  2IAJ A;  3NGY A;  1RTJ A;  4HCC A;  1HNI A;  3D45 A;  4IFY A;  4Y1C A;  2ZD1 A;  4I9L A;  3OS1 A;  4FJM A;  4L8R B;  4OGE A;  3SQ0 A;  1YTA A;  3AVN A;  3MEG A;  2Z1I A;  2Q3S A;  4B08 A;  3AA2 A;  3OYG A;  2XHB A;  4E7J A;  2YNI A;  3TAP A;  1NK4 A;  4M3T A;  5JS1 A;  1RT6 A;  4DF8 A;  4IG3 A;  3TAG A;  1JLF A;  1N5Y A;  3MEC A;  4BDZ A;  3LP2 A;  1KVA A;  1WLJ A;  1SKS A;  3VQ7 A;  2QK9 A;  1G15 A;  1VSH A;  2YKN A;  3K5M A;  3BDP A;  5KRS A;  1ZBL A;  4Y1D A;  1C1A A;  1J53 A;  3TAR A;  1Q9Y A;  3EZ5 A;  2F8S A;  4W5N A;  4DU4 A;  1TAU A;  1TAQ A;  3PX0 A;  3PO5 A;  1IH7 A;  4CJ4 A;  4DTO A;  3HPH A;  2XY6 A;  3L3U A;  1S1V A;  3CQ8 A;  3V1Q A;  2GBZ A;  4CF1 A;  3NHG A;  3RR8 A;  1VRU A;  4DSF A;  4FZY A;  4TSX A;  4JS4 A;  3HPG A;  3MXI A;  1RIL A;  4CEA A;  3ALY A;  4CJU A;  4GW6 A;  4RW7 A;  3RRH A;  2HHX A;  3JYT A;  4CFD A;  4EZ6 A;  2DFH A;  4G1Q A;  3LAL A;  2GUI A;  4KB1 A;  4KRE A;  3DI6 A;  3KLH A;  4FJX A;  1VRT A;  3THV A;  1SL0 A;  1HMV A;  3FFI A;  2X6N A;  1LAV A;  1B9D A;  4OVL A;  4CEZ A;  4LY7 A;  3VQB A;  4CJR A;  1TL3 A;  4M3Y A;  4CJE A;  4DQQ A;  1RCH A;  1VSL A;  3S3N A;  4FLT A;  2E6L A;  2PY5 A;  3VQ5 A;  3PX6 A;  2I5J A;  1TL1 A;  3AO3 A;  1NJW A;  1BI4 B;  3G10 A;  4FVM A;  4OKE A;  4FJL A;  3DRP A;  5DK5 A;  2YNF A;  4IBN A;  5E41 A;  3EYZ A;  3KD1 E;  2HHV A;  1RBT A;  1VSM A;  4KTZ A;  3PO4 A;  4FJ9 A;  4DS5 A;  3LWL A;  3WNF A;  3IRX A;  4J2A A;  4CER A;  1RTH A;  4DTP A;  1KRP A;  1BGX T;  1RT7 A;  2VG6 A;  4CFB A;  1J5O A;  4M41 A;  3IS9 A;  4DQR A;  1S9E A;  4NCB A;  2HHS A;  2PZS A;  1XHX A;  3CG7 A;  2HHW A;  5KGW A;  4NCA A;  4CGH A;  1UA0 A;  4DQI A;  1Y97 A;  3SQ1 A;  1A5W A;  1FKO A;  1NJZ A;  3ULD A;  1YT3 A;  1ZBU A;  1RTD A;  4CHP A;  3PX4 A;  4OKJ A;  4CF8 A;  1LAW A;  3V4I A;  3VA0 A;  2OZS A;  3SV3 A;  4N56 A;  3KJV A;  4DQS A;  2D0A A;  2OPS A;  3DLR A;  1K6Y A;  1NK7 A;  3DYA A;  2KFN A;  1F21 A;  4CEE A;  1RDC A;  1Z26 A;  2LSN A;  2YHB A;  3B6P A;  1U49 A;  4CF2 A;  4CHN A;  4FXD A;  1UOC A;  2D0B A;  4ICL A;  4CJ3 A;  4WE1 A;  3CM5 A;  4RW4 A;  3SUQ A;  3V9S A;  3QO9 A;  1SL1 A;  2O4I A;  3ZT0 A;  1T05 A;  3C95 A;  3DOL A;  1DTQ A;  1S6P A;  4W5Q A;  3O3H A;  4ELT A;  3P83 D;  4BE2 A;  1BL3 A;  2F8T A;  4DTJ A;  4M3W A;  3T1A A;  4CES A;  2IGI A;  4DLE A;  3QNN A;  1IG9 A;  4B9T A;  2DTU A;  3HL8 A;  1IO2 A;  1B9F A;  4ZHR A;  3NAE A;  4FK0 A;  1ASV A;  2HND A;  3TI0 A;  1RBS A;  5SWM A;  3SUN A;  3OYD A;  4FLY A;  1R0A A;  3SUO A;  4F3O A;  1EX4 A;  1D9D A;  1FK9 A;  3TAQ A;  4J2B A;  3AO1 A;  2D5R A;  4CED A;  5FRM A;  1HRH A;  4IDK A;  1MU2 A;  1RBR A;  3SUP A;  1HNV A;  4IFV A; 
#chains in the Genus database with same CATH topology
 1TGO A;  3U3G A;  2RKI A;  1QVG M;  4PQU A;  3LAK A;  4FWQ A;  3CJ1 A;  3ISN C;  1VSE A;  3CME N;  1J54 A;  1ASU A;  1T8E A;  1HKG A;  4FW1 A;  2XO7 A;  2Z1H A;  3AGK A;  3C6T A;  4EAH D;  4IG0 A;  1RBV A;  3AA5 X;  1ASW A;  3E9O A;  5GAD P;  1FW6 A;  4JHD B;  2HHQ A;  1SAZ A;  1XNQ K;  1FXX A;  4FZZ A;  1DLO A;  4KV8 A;  1GLF O;  4I7F A;  4RW6 A;  1YVU A;  1M90 O;  1DGK N;  4LFB K;  3FGU A;  1GOC A;  3ZEU B;  2I7P A;  1TUY A;  1YI2 N;  3ZET B;  4BG9 A;  4A5B A;  1NMN A;  1QE1 A;  3NH0 A;  4NB4 A;  1KFS A;  1G99 A;  3P39 A;  5DMR A;  1TK5 A;  2YI1 A;  4A57 A;  2Q97 A;  5CZ1 A;  1NGF A;  4K42 A;  1U4B A;  2QKK A;  3VQ9 A;  2QW9 A;  4GVE A;  3H08 A;  3BF1 A;  5CYQ A;  5LJW A;  2IVN A;  1EWR A;  3GG4 A;  4DR4 K;  4BDY A;  3AAQ A;  1GLA G;  2Q2R A;  2HW3 A;  2VQE K;  1E4G T;  3OYN A;  3AVI A;  3RSE A;  1IBM K;  4EP4 A;  1UAX A;  4I6M B;  4C1N I;  3SJJ A;  2F4V K;  4GKJ K;  4KB0 A;  3U9Z A;  4NLB A;  2YNG A;  3RMA A;  1HNX K;  2G8V A;  3G0Z A;  5C2F A;  2GEM A;  3T3F A;  4DR5 K;  1U48 A;  1X9M A;  2CGK A;  2EX3 A;  3GL1 A;  2W6L A;  4HTL A;  3QEW A;  4ILG B;  1QZ6 A;  1KAY A;  1Q9X A;  4YOV A;  2B6A A;  3KLF A;  3UE5 A;  4R5P A;  5GAE P;  1ZBI A;  2O8B A;  4DU1 A;  3CJA A;  1DKG D;  4XEI A;  4KAZ A;  3CXC M;  4JRP A;  3VQC A;  2WTU A;  3V9Z A;  2NRW A;  3IKM A;  3UKU B;  2OPR A;  4N41 A;  4CEF A;  1MWK A;  2KZZ A;  3SCX A;  4M3R A;  4FJI A;  4B9S A;  5HRO A;  5M1K A;  1LOT B;  4YOT A;  4DFJ A;  4JHD A;  3C7N B;  2P1J A;  1KLM A;  2HB5 A;  4BC2 A;  2GV9 A;  5IWA K;  1D8Y A;  1HQU A;  2AP1 A;  3MX2 A;  4DU3 A;  4DQP A;  2QKB A;  4DSE A;  4DR1 K;  2HHU A;  1RNH A;  4DHY A;  4M3X A;  1RT3 A;  2VG5 A;  3VMF B;  4OPJ A;  3HP9 A;  1XUP O;  3MX5 A;  2OTL N;  4DG1 A;  4CVN E;  3SK3 A;  4YOR A;  4CHZ A;  4K25 A;  4PHT X;  4A5A A;  5HRR A;  4JEP A;  1CZB A;  5AQX A;  1U45 A;  5C25 A;  4H5R A;  4E7H A;  4JKH A;  2VWB A;  4WCE L;  1SKW A;  3QES A;  3FR0 A;  3I8B A;  5HRS A;  1D5A A;  4AM7 A;  4CF9 A;  2QWO A;  4EHT A;  5H1S Q;  1JL1 A;  4FSV A;  3AAR A;  4DSI A;  1GOA A;  4CJS A;  4I6M A;  1JLG A;  3MXJ A;  3CQX A;  3PIP L;  4JI0 K;  1HNW K;  1X3N A;  4CHO A;  4YFU A;  3M8Q A;  3HTV A;  1ITG A;  1L3U A;  2RPI A;  3OVN A;  3VF6 A;  3IFR A;  5AQK A;  4E7K A;  4X66 K;  1VQO N;  3VQD A;  3VQA A;  2P5G A;  1HQE A;  2HVI A;  1KXP A;  3QIC A;  3ULE B;  3AVA A;  2HBJ A;  2FBT A;  4V19 S;  3DLE A;  5JVG L;  1W7A A;  1S3X A;  2W6K A;  4YDU C;  2ITM A;  3RTV A;  4DTU A;  4FJ5 A;  5AQP A;  4CFC A;  2ASP A;  3PIO L;  3ID6 A;  1Q81 O;  4NYN A;  1N32 K;  4OX9 K;  3GE1 A;  4DSL A;  5BN8 A;  1NGJ A;  1HYZ A;  5JS2 A;  5B8H A;  3O4N A;  2KLA A;  3LM9 A;  3L4Q A;  3L2R A;  5HBM A;  2QXF A;  1BQM A;  1GOB A;  5KI6 A;  2PYJ A;  2OPP A;  4BRM A;  4C8K A;  4CZJ A;  2Z1J A;  1J6Z A;  2W41 A;  4B1Z A;  4KI6 A;  5TKY A;  4JK9 A;  3O8M A;  1BIZ A;  3CJ7 A;  3MN6 A;  3LZJ A;  4DSJ A;  2UYT A;  3BEX A;  1KRP A;  5I3U A;  3QEI A;  3E9L A;  4M63 C;  2A40 A;  3HRG A;  1GLD G;  3IMX A;  1WSG A;  4DV6 K;  1SUQ A;  1EKE A;  3PSF A;  4GMJ B;  4QCL A;  4CJ5 A;  4WQ4 A;  4B8C A;  4EHU A;  4DR3 K;  4DFM A;  3ZT1 A;  1QQO A;  1JJ2 M;  4F3T A;  1LCU A;  2JWL A;  1GLL O;  4OGC A;  5AQH A;  3TTF A;  4RTF D;  2O8E B;  3RRG A;  4DTN A;  2P9I B;  2G8U A;  5KRT A;  2E6M A;  3VEW A;  1TYQ B;  2WFB A;  2A1R A;  4Z0U A;  1NGD A;  1WAF A;  3I0S A;  4DQ8 A;  4C8N A;  3JS6 A;  4PL8 A;  3TTC A;  1BG3 A;  4DTR A;  4DLG A;  4BR9 A;  1KCF A;  4IEI A;  1K8A O;  2F96 A;  2YHY A;  3SV4 A;  4M45 A;  5C10 A;  4YY3 K;  1CXU A;  4A2A A;  4AIL C;  3NF6 A;  3FLC O;  2YNH A;  3AVC A;  3EN9 A;  4C8O A;  3HO1 A;  4IWV A;  2QEX N;  3B6O A;  4F2R A;  3ULE A;  3OA9 A;  5HLF A;  1LWE A;  3LWM A;  1U2V B;  3TAM A;  1T44 A;  2XY8 A;  5AQN A;  2Q31 A;  2A5X A;  2FBY A;  4ISE A;  2ZE2 A;  3CCM N;  1GLC G;  1SL2 A;  2HMP A;  4BAC A;  5EVZ A;  3TAF A;  2X6S A;  4FWR A;  1RDA A;  2E1Y A;  1RT2 A;  4B3S K;  1RDW X;  3SNN A;  4OLB A;  1WUA A;  4O4G A;  4MO5 A;  4IJN A;  2IC3 A;  4OPK A;  2NUB A;  4JKC A;  4FLU A;  3N4P A;  2QWN A;  2IAJ A;  3NGY A;  1HNI A;  4IFY A;  4CI6 A;  3OS1 A;  3A8Y A;  3M3Z A;  4L8R B;  4OGE A;  3SQ0 A;  1BWF O;  3VGK A;  3MEG A;  3AA2 A;  3R3L A;  2YNI A;  3TAP A;  3TPQ A;  4BY9 C;  4PKI A;  1HKC A;  4BC3 A;  1N5Y A;  5KQD A;  2D1K A;  4B1X B;  1G15 A;  1VSH A;  4FWN A;  1HNZ K;  1ZBL A;  5AQM A;  1HX1 A;  4W5N A;  1TAU A;  5MLC Q;  2O8E A;  3KHY A;  3HPH A;  2XY6 A;  3L3U A;  5BR9 A;  2GBZ A;  4CF1 A;  1TYQ A;  3NHG A;  4DSF A;  3CIP A;  5GAH P;  4JS4 A;  1RIL A;  3LDN A;  3WXK A;  3KWG A;  1CZA N;  3WXM B;  3O1B A;  1RDU A;  2QA4 N;  3DI6 A;  3DXK B;  3P38 A;  5LJV A;  1HMV A;  3FFI A;  1B9D A;  4LY7 A;  4YHH K;  3H3N O;  5FPD A;  4FLT A;  3J7A P;  3VTH A;  2E2N A;  2PY5 A;  3VQ5 A;  1TL1 A;  1BI4 B;  3CI5 A;  5DK5 A;  1HUX A;  1RBT A;  3LWL A;  3WNF A;  5AQZ A;  3VEX A;  2VG6 A;  1RT7 A;  4IOC L;  3IS9 A;  4NCB A;  2YJF A;  5LMN K;  2HHW A;  4CGH A;  1Y97 A;  4AF1 A;  1YT3 A;  4IJA A;  4CHP A;  4CF8 A;  4JI6 K;  2OZS A;  1K8K B;  4N56 A;  4DQS A;  4H5T A;  3O5B A;  4GKK K;  1F21 A;  2BTF A;  3CCR N;  2YHB A;  2D4W A;  3B6P A;  4U67 L;  3SBT A;  1X3M A;  4QS9 A;  5IT9 O;  4ICL A;  4DV1 K;  4WE1 A;  2O8D B;  3SUQ A;  1M1K O;  1J5E K;  1SL1 A;  1NGA A;  4BRL A;  3LDQ A;  3P83 D;  3C6A A;  1BL3 A;  2IIR A;  4BE2 A;  4XH4 A;  2IGI A;  1ZC6 A;  3Q7B A;  4ZHR A;  3CPE A;  3E9P A;  1VQ7 N;  1DEJ A;  1R0A A;  4F3O A;  4K0K K;  3AO1 A;  4CED A;  1HRH A;  1RBR A;  3SUP A;  3FZM A;  1HNV A;  3PLA A;  1V4S A;  4C8M A;  1K9M O;  1TKT A;  4A61 A;  1TV6 A;  4KHS A;  5HRP A;  1OH7 A;  5HL7 L;  3SAF A;  2YHW A;  5DM6 L;  1VK0 A;  2AA4 A;  4CCH A;  3V1O A;  1U04 A;  4DR2 K;  4LH4 A;  2W42 A;  1ZBH A;  3O9S A;  1O1W A;  1RT4 A;  1P8Z A;  3HYF A;  3RMC A;  1JLC A;  3DXK A;  2UXB K;  3LZI A;  4FYD A;  3A2F A;  5BRD A;  4CZI A;  4FJJ A;  3ZX2 A;  4BRA A;  5BRF A;  3KK1 A;  2FF3 B;  2GTD A;  2HBM A;  2E2P A;  4I2Q A;  3VTI A;  1BOT O;  1KSP A;  1O13 A;  1BI4 A;  4Q0B A;  2XRI A;  4CFA A;  3MED A;  4O0I A;  1S5J A;  3MK6 A;  1BO5 O;  4DMN A;  3U8X A;  2HBK A;  1WSF A;  2V7Z A;  2E2Q A;  4H0T B;  5FDL A;  3CC4 N;  4CZM A;  1QHA A;  4JN4 A;  4K43 A;  3ZCM A;  4BC5 A;  3VQ8 A;  3D2F B;  2YJE A;  4DV0 K;  4ILH A;  1L3S A;  4Z4G A;  3THW A;  3OW2 M;  1S1X A;  2DFE A;  3FFK B;  1S1U A;  4QS7 A;  3KIO A;  3O3F A;  4CGD A;  4ELV A;  3TAE A;  4Z4H A;  3VQ4 A;  2FSN A;  3J8A A;  1NGH A;  2O8D A;  3CMA N;  2A1S A;  2UXD K;  1WSJ A;  5LL6 Z;  2E4L A;  3L0Q A;  4E7I A;  1YJW N;  3ASM A;  3MMV A;  3A5O C;  3NE6 A;  3UB5 A;  1ESV A;  1SKR A;  1U6Z A;  3AV9 A;  2FF6 A;  3NCI A;  3KK7 A;  5KPT A;  1YIJ N;  2QWM A;  5EXW A;  3E1Y A;  3J80 O;  1HPZ A;  5AQT A;  4DV7 K;  4DV3 K;  3K5O A;  2BGG A;  4Z4F A;  4H0V B;  1NOY A;  2FBX A;  3QIN A;  1IBL K;  4FJ7 A;  3EE9 A;  3AVB A;  4FWO A;  3CD6 N;  1SQK A;  4CK3 A;  3DLG A;  1S72 N;  4M42 A;  3JAM O;  3BZK A;  1LW2 A;  3H45 C;  4CGG A;  3HP6 A;  1QHT A;  3RSE B;  1I94 K;  1KLN A;  3LM2 A;  1NGE A;  1YJ9 N;  3QFU A;  3CC2 N;  2ZJP L;  2A3Z A;  3PV8 A;  4BVO A;  1JXE A;  3HXM A;  2B5J A;  2WON A;  3J7Y P;  2VGN A;  2VWK A;  4H03 B;  3J81 O;  3PSI A;  3J7Z O;  5KQ8 A;  1L3V A;  3P5J A;  3VEO A;  3VEN A;  3G6E N;  1NNE A;  3WQT A;  4FPB A;  4FL9 A;  3S41 A;  4KPY A;  1QTM A;  4DTX A;  4NLC A;  4LFC K;  3OYC A;  2ZQB A;  5AZI B;  4FM2 A;  3OYI A;  4JKE A;  4CEC A;  4DWI A;  2O8B B;  1NG9 A;  1TUU A;  3JSM A;  1EET A;  3FZK A;  4FWP A;  4PUO A;  2NRR A;  1HLU A;  3D2F A;  3MDQ A;  3CJC A;  2YV0 X;  2HMI A;  2P9K B;  2HHT A;  3C6U A;  4QAG A;  3AA3 A;  2P9L A;  3WNE A;  3QML A;  2CH5 A;  3TSP A;  1QZ5 A;  3ZSZ A;  5AQF A;  3HBT A;  2HF4 A;  1BCO A;  4BR0 A;  5ADX A;  1KVC A;  4AQY K;  4M7Y A;  5AFU H;  3LDO A;  4LH5 A;  4H8K A;  3M8R A;  1Q82 O;  2A42 A;  3AVG A;  3PY8 A;  1RTI A;  2V51 B;  3RMD A;  2Z1G A;  2O4G A;  4FCY A;  3HI0 A;  3H1V X;  1DTT A;  5AQL A;  3VA3 A;  2G8W A;  2HVH A;  2W40 A;  2E5L K;  2Y1J A;  3HK2 A;  3OYH A;  3HSC A;  4DTS A;  5AQI A;  2CGJ A;  3BP8 A;  1XHZ A;  4DV4 K;  1H1V A;  3DMJ A;  3F5T A;  3L2Q A;  3MEE A;  3D7E O;  1VQ5 N;  4LF8 K;  2PBD A;  5C2D A;  4JYA K;  2UXC K;  3ATU A;  4DKW A;  5CY4 A;  3TWH A;  4U7B A;  4DFK A;  3ZT4 A;  3O9Q A;  1ZBS A;  2FBV A;  5C42 A;  4CD3 A;  1OH5 A;  3P31 A;  4GY2 B;  5AZI A;  1ZYQ A;  3SMP A;  1VSD A;  3MAQ A;  5AQQ A;  2NRV A;  1X1P A;  2BUP A;  4AHS A;  4ILJ A;  3WXJ A;  1BUP A;  1VQP N;  5I42 A;  4QOZ B;  4ID1 A;  3FZH A;  3IG1 A;  2P9K A;  4H0O A;  1N8R O;  1NK5 A;  4HUF A;  4KO0 A;  1Y64 A;  2J4R A;  2JWK A;  4DTM A;  5AR0 A;  5BPN A;  4CW7 B;  1NWK A;  5AQR A;  3AO5 A;  1QQN A;  1NLV A;  1QQC A;  1WAJ A;  2RE2 A;  1YIT N;  3CCL N;  3NMU A;  3ZT3 A;  3ZSO A;  3T19 A;  1YUW A;  1JXB A;  5JIC A;  1XC3 A;  3L4I A;  1JLA A;  1C1B A;  2G8H A;  5FPE A;  3WNH A;  3VN5 A;  3AO4 A;  1NKE A;  3A5L C;  1BHL A;  2BE2 A;  4BR4 A;  1GLB G;  5F2R A;  3ATV A;  1YVN A;  3K0S A;  4CEQ A;  2OZM A;  1ATS A;  4IDH A;  3VEZ A;  4C1N K;  4JI8 K;  2E20 A;  3M8S A;  4KHQ A;  1VQK N;  3SI6 A;  3HM8 A;  3O6W A;  3S3M A;  4R79 A;  3OYA A;  4HVJ A;  3NVK A;  1QSY A;  5M1Q A;  1WNS A;  4BQZ A;  3S9H A;  1C0F A;  3V6D A;  1Z25 A;  2G8K A;  3OYF A;  4E1N A;  1W97 L;  2ZD1 A;  4FJM A;  4DV5 K;  2RHK A;  3AVN A;  4BR5 A;  1RFQ A;  3OBW A;  4B08 A;  3OYG A;  4CJ7 A;  2XHB A;  1EO1 A;  5JS1 A;  4M3T A;  4DF8 A;  1NGI A;  4BRN A;  1JLF A;  2HF3 A;  5KPZ A;  4LFA K;  1WLJ A;  1MWM A;  3VQ7 A;  2QK9 A;  2YKN A;  3TSU A;  1J53 A;  2QTD A;  3EZ5 A;  4DU4 A;  1WBB A;  5KPR A;  3PO5 A;  1IH7 A;  1HPM A;  2GEL A;  2ZWH A;  5CE3 A;  4DTO A;  1S1V A;  4FZY A;  2E1Z A;  3MXI A;  4CEA A;  3ALY A;  4FOE A;  4GW6 A;  1IV0 A;  4EZ6 A;  4Y0W A;  2DFH A;  2FSJ A;  4KRE A;  3KLH A;  1LAV A;  4CEZ A;  4M3Y A;  4DQQ A;  3S3N A;  4YOX A;  4KHP K;  4H5V A;  3PX6 A;  1YXQ A;  2I5J A;  4OKE A;  4FVM A;  5E41 A;  3H3O B;  5E84 A;  1VSM A;  4FJ9 A;  4H0Y B;  3IRX A;  4IO9 L;  4J2A A;  4CFB A;  1J5O A;  4M41 A;  4CZH A;  2PZS A;  3CG7 A;  3R8E A;  2OCE A;  4NCA A;  2YHX A;  3I56 N;  3SQ1 A;  1OVQ A;  1NJZ A;  3M1F A;  3PX4 A;  1LAW A;  4XH1 A;  5AQG A;  1V4T A;  3V4I A;  3VA0 A;  3DLL L;  4BRG A;  1K6Y A;  1NK7 A;  1RDC A;  1U49 A;  4BRF A;  4FXD A;  2KKZ A;  2F9W A;  3QO9 A;  3ZT0 A;  3DOL A;  4WQ5 C;  4IFE A;  4CZK A;  2F8T A;  2GWK A;  3QNN A;  4CD1 A;  1B9F A;  1NGC A;  2HND A;  2QWR A;  3TI0 A;  4OPA A;  5SWM A;  3SUN A;  4FWM A;  4FLY A;  3ENB A;  4XH5 A;  1EX4 A;  1D9D A;  4J2B A;  1JCG A;  5FRM A;  1GLJ O;  4IDK A;  2NLX A;  3U9D A;  4WF9 L;  4IFV A;  3OYL A;  1KVB A;  4CJW A;  4KHW A;  3I0R A;  1EP4 A;  3ZT2 A;  4KTQ A;  4LSL A;  3VQE A;  4Z4C A;  4CJV A;  3SPY A;  2D0O A;  1TK8 A;  3CCS N;  4O55 A;  3F9K A;  5EU7 A;  3AGR A;  1NMD A;  1P90 A;  3E66 A;  3NGZ A;  5HRN A;  4B9M A;  3SQ4 A;  3A5M C;  3U4L A;  1W0H A;  1NK6 A;  3SAG A;  3QNO A;  4KH5 A;  4PL7 A;  3E01 A;  3AO2 A;  3CFP A;  1NK9 A;  2ETJ A;  3VEY A;  1S1T A;  3SAH A;  3VQ6 A;  1C0U A;  1ATN A;  3K57 A;  1REV A;  3T69 A;  3DOK A;  5ELZ A;  4DUZ K;  3ZSX A;  3RMB A;  2DFF A;  3KK3 A;  3P4I A;  3KKR A;  4BVP A;  2F9T A;  2WBN A;  1HJR A;  4M7X A;  1D9F A;  1NM1 A;  1L3T A;  4HHT A;  3UIQ A;  3D0P A;  4E3S A;  2NRZ A;  1LV5 A;  1T03 A;  2PYL A;  4F8R A;  1C0M A;  3M8P A;  4LD0 A;  5BRE A;  5BR8 K;  2UUA K;  4JKD A;  4KI4 A;  5C12 A;  4BRI A;  5GIN A;  4KTW A;  3LAN A;  4E7L A;  3WXI A;  3SQ2 A;  3V9W A;  3GDQ A;  3L2W A;  1VQL N;  4FPA A;  4CJT A;  2YHA A;  3OS2 A;  4AHU A;  1JL2 A;  4CBX A;  4L3Q A;  3QEP A;  3LP0 A;  3FE1 A;  5GIO A;  2HHH K;  3SPZ A;  3CC7 N;  1NJY A;  1LWF A;  3THW B;  1VSJ A;  2VWJ A;  3H46 O;  5I9E B;  4MFB A;  1BA0 A;  1J9A A;  4AHR A;  5KTQ A;  2P9S B;  1T6D A;  2O8F A;  3QBX A;  4C23 A;  4YDU A;  4X65 K;  3OY9 A;  3KWI A;  3M5R A;  3NH2 A;  3ZSY A;  4BE0 A;  2DPN A;  3HJF A;  3QBW A;  1VSI A;  1JLE A;  1XMO K;  1JLB A;  1L5U A;  1BQN A;  1JKH A;  1WSE A;  3ENO A;  4DCH A;  3O3G A;  5EX5 A;  1I3A A;  1RGI A;  3OYK A;  1WOQ A;  4LF6 K;  1C6V A;  2GUP A;  2P9U A;  3K2P A;  3VET A;  4MO4 A;  1NJX A;  3QIP A;  4RW8 A;  5E26 A;  1X9J A;  3QIO A;  3V81 A;  3MN5 A;  3AVK A;  4JD2 B;  4G9Z A;  3DXM A;  4NCG A;  3ZSW A;  3HT3 A;  4YOU A;  4BRQ A;  1NJI O;  3ZX0 A;  2VGM A;  3VES A;  4J2D A;  3W0L A;  1N36 K;  1K73 O;  4DF4 A;  5CZ2 A;  2A6A A;  4CBU A;  3OBY A;  4KRF A;  3G71 N;  1YTU A;  4H5W A;  4FOI A;  2X78 A;  5FLX O;  4FJN A;  2QWQ A;  4A59 A;  2O8C B;  3ZSQ A;  1UWB A;  2Q36 A;  2NRX A;  4F4K A;  3WXL A;  3WNG A;  3HST B;  4Q5V A;  4CGI A;  4JI1 K;  5EY4 A;  5AQJ A;  4FM0 A;  1WB9 A;  1WSI A;  3CCQ N;  4ISF A;  3I8D A;  3V1R A;  4W5O A;  4CEO A;  4HWI A;  2D0P A;  3KKS A;  2GX9 A;  4I2P A;  3AVF A;  2G8F A;  2BDP A;  4J8F A;  1FKP A;  3LAM A;  1HR0 K;  2IVP A;  4CJP A;  3DRS A;  1WSH A;  4WQ5 A;  2UU9 K;  5HP1 A;  3WQU A;  3GOI A;  2IVO A;  2P9L B;  2EWS A;  3CM6 A;  4CGF A;  2X74 A;  2DY4 A;  2P9S A;  4XIU A;  1TK0 A;  4CZF A;  4FJK A;  3VGM A;  4KHN A;  3IDH A;  3R6M A;  3CCE N;  3V9U A;  4HUE A;  3CQY A;  1NK0 A;  4F2S A;  1LWC A;  1NGG A;  3DLB A;  1E3M A;  1KTQ A;  4PKH A;  1X9W A;  2Y1I A;  5JVH L;  3VER A;  3ZLJ A;  3QER A;  4OLA A;  2AJQ A;  1C1C A;  1BU6 O;  3KVG A;  3CJ9 A;  1SV5 A;  3AVJ A;  4JLH A;  2ZGZ A;  4CHQ A;  2IDO A;  4CIE A;  4BGA A;  5D3G A;  4JD2 A;  4B3R K;  3CET A;  4DB3 A;  1BIU A;  4FWL A;  2IOC A;  4FWK A;  4HUG A;  4BGB A;  4DSK A;  1CZ9 A;  1MA9 B;  2HNZ A;  3LDP A;  4RW9 A;  1ATR A;  1WBD A;  1BA1 A;  1S9G A;  2BAN A;  4LF5 K;  3RR7 A;  5C15 A;  1JCF A;  4OO1 J;  2P9P B;  3KLG A;  1XI1 A;  4B9V A;  3MWT A;  3BZC A;  5AQS A;  4OKK A;  4X62 K;  3L8B A;  2O8C A;  4FJH A;  3A0I X;  2JLE A;  1Q8I A;  5JLH A;  3L3V A;  2ITG A;  2KTQ A;  4FJ8 A;  2FC0 A;  1Q7Y O;  3O4Q A;  4C8L A;  3AVM A;  4FLX A;  1NOZ A;  4KHU A;  4KFB A;  3ZX3 A;  3ZSV A;  5J2Q A;  5J1E A;  4CGJ A;  1CLQ A;  1A5V A;  2RN2 A;  3O1W A;  4FO0 A;  4FK2 A;  5AQW A;  1HYS A;  3L2V A;  1SZ2 A;  4K8X A;  3OYJ A;  2QXL A;  3F2K A;  5M1O A;  3OJS A;  1RBU A;  2OA8 A;  3SLC A;  1S6Q A;  3T1Y K;  1B92 A;  4KH6 A;  5J2N A;  5AQV A;  1EWQ A;  4DV2 K;  4EP5 A;  3TAN A;  3NVM A;  3WEE A;  1NK8 A;  2YX6 A;  4CIG A;  1WN7 A;  1XWL A;  3LDL A;  3L6Q A;  3TR8 A;  4RWT A;  3K5L A;  4BR7 A;  1CXQ A;  3C0B A;  1C0G A;  3TAB A;  3SZ2 A;  1ZXO A;  3ZYY X;  3THY A;  4BRE A;  2EHG A;  1RTJ A;  4HCC A;  1XQS C;  3D45 A;  4Y1C A;  4I9L A;  1FJG K;  2OTJ N;  4LF4 K;  1YTA A;  4JNE A;  2Z1I A;  4WQ4 C;  4E7J A;  1RT6 A;  5FPM A;  1YJN N;  4FVU A;  3TAG A;  4NXM K;  1YF5 L;  3LP2 A;  1SKS A;  3AY9 A;  3K5M A;  5KRS A;  4Y1D A;  1C1A A;  4IO8 A;  2F8S A;  1TAQ A;  2P9N A;  3OHR A;  3C65 A;  4BG8 A;  1VRU A;  4TSX A;  3RRH A;  2P9P A;  2HHX A;  3JYT A;  4CFD A;  4G1Q A;  3LAL A;  4B3T K;  4KB1 A;  4WYB A;  2CH6 A;  3THX B;  5BPM A;  5F0X A;  3O9U A;  2X6N A;  1VQ6 N;  1QVF M;  1RCH A;  1VSL A;  1Z6R A;  3MN7 A;  2I7N A;  3G10 A;  1NJW A;  1IBK K;  3TU5 A;  2HHV A;  4IBN A;  4MLE A;  4KTZ A;  3AAP A;  4CER A;  3A5N C;  1RTH A;  4DTP A;  1BGX T;  4MDA A;  4DQR A;  1XHX A;  1T6C A;  5KGW A;  4DQI A;  1A5W A;  4O5F A;  2D0A A;  2OPS A;  3DYA A;  3KZB A;  1OKJ A;  4CEE A;  1Z26 A;  2LSN A;  4JKG B;  4LF7 K;  1E4F T;  3HZ6 A;  5ADX H;  4CF2 A;  2F7T A;  4CHN A;  3H6E A;  2OAN A;  1UOC A;  2NRT A;  3EO3 A;  4RW4 A;  4IXC A;  3V9S A;  1GLE G;  1T05 A;  3C95 A;  1DTQ A;  1S6P A;  3T7Z A;  4W5Q A;  4GV3 A;  2A41 A;  5FPN A;  1VQ4 N;  4ELT A;  4DTJ A;  4M3W A;  2VYP A;  1NGB A;  5AJ3 K;  1IG9 A;  4B9T A;  2DTU A;  3HL8 A;  3K9K A;  1IO2 A;  4FK0 A;  4PKG A;  4JI7 K;  3OYD A;  3SUO A;  2D5R A;  5BN9 A;  1MU2 A;  3VGL A;  3ZEU A;  2ZF5 O;  3ZET A;  4O8K A;  3V9X A;  3IAY A;  5DM7 L;  2G8I A;  4Z4I A;  3ITH A;  5FRN A;  4O8U A;  4O0J A;  4HTU A;  4FLW A;  3SYZ A;  5C24 A;  4B9Q A;  4IEE A;  4CJF A;  3KLE A;  1BDG A;  3QLH A;  3BY5 A;  3LPU A;  5AQO A;  1VSF A;  4BRD A;  2YCH A;  1QQM A;  1EQY A;  2D0C A;  4GV9 A;  3VF2 A;  5SZT A;  1Q86 O;  3EY1 A;  1JCE A;  3THX A;  4WFA L;  3F9M A;  2BH1 A;  3OS0 A;  3MCP A;  4N5S A;  3F73 A;  1W9H A;  4UY8 O;  2NRH A;  3LPT A;  2KHO A;  1NU0 A;  1IKV A;  1N6Q A;  4BRO A;  3RVC A;  4WFB L;  2E2O A;  1ZBF A;  4YNQ A;  4E89 A;  3IUC A;  2QWP A;  5T7B A;  3KD5 E;  3LP1 A;  4JKA A;  3OYB A;  3UKR B;  3WUH A;  1QSS A;  5J2M A;  3NH1 A;  5AQY A;  4JK8 A;  1KAZ A;  4E1M A;  4B1W B;  4FLV A;  5JLF A;  3EL2 A;  1KQS M;  4CEB A;  3VOV A;  2RF2 A;  4JKG A;  1EXQ A;  3G25 A;  4BE1 A;  1W2B M;  4ZTJ A;  3UKU A;  3QFP A;  2P51 A;  4CF0 A;  1IJJ A;  3DLH A;  2NNW A;  2ASM A;  4MDB A;  3K5N A;  1TKD A;  1TVR A;  4H5N A;  4FJG A;  3EKS A;  2HST A;  4GNI A;  3CFR A;  4CIF A;  3C7N A;  1VSK A;  5CHI A;  2B4J A;  4FM1 A;  4DFP A;  4KBO A;  1KD1 O;  4F9O A;  1RT1 A;  4IKF A;  4BDP A;  2H3G X;  2ATQ A;  5C0Y A;  1VQN N;  3KLI A;  2Q0R A;  1TKX A;  4N47 A;  4B8A B;  3R9P A;  3HM9 A;  2Q0U A;  1NKC A;  1T3V A;  1KC8 O;  4NO7 A;  5TKW A;  2UUB K;  4ISG A;  4BRC A;  2QM1 A;  1A5X A;  4JKF A;  3HOT A;  1QS4 A;  1BCM A;  2FLO A;  2OPQ A;  2ZJQ L;  3VPZ A;  3HPO A;  1YHQ N;  4BQL A;  4EFH A;  1DT9 A;  1XC9 A;  3ID8 A;  1NKB A;  2ASO A;  4FK4 A;  1Q18 A;  1I39 A;  1OH8 A;  3RWU A;  3NBP A;  4FW2 A;  3VQQ A;  2WUS A;  1QSL A;  2IS3 A;  3NDK A;  1UA1 A;  3HOS A;  3I33 A;  1BIS A;  3CHW A;  4IOA L;  3CCU N;  2HOE A;  4CK2 A;  1IKY A;  4RG8 A;  3NF8 A;  3KK2 A;  4K8Z A;  4M3U A;  3VEV A;  5GIP A;  2E88 A;  2NZT A;  3SBG A;  4CJK A;  2XY5 A;  4B9L A;  4FWS A;  2ZM6 K;  3UKR A;  3FZL A;  4X64 K;  1U47 A;  4UQG A;  2KQ2 A;  2O8F B;  4AHC A;  4W5T A;  3K59 A;  3MXM A;  2WOM A;  4ZTF A;  3QB0 A;  4PWD A;  4B9N A;  2YKM A;  2WC9 A;  2UUC K;  1Z05 A;  4BRK A;  3BF3 A;  1RDB A;  3QET A;  3P1G A;  4M3Z A;  2P9U B;  1ILY A;  2VG7 A;  3OYE A;  4AHV A;  3Q7C A;  4OJR A;  1IKX A;  4K41 A;  1KFD A;  4E0D A;  3O80 A;  3DRR A;  3KTQ A;  3DWL A;  1XMQ K;  1VHX A;  3CYM A;  3M6G A;  4RCH A;  4JRQ A;  4CJL A;  5A2Q O;  1R59 O;  4Z94 A;  4B1V A;  3AVL A;  3DXM B;  5BPL A;  5FRO A;  4DUY K;  2QI2 A;  3PUF A;  5BRH A;  4B1U B;  5K14 A;  4J2E A;  1HJO A;  1X9S A;  4O44 A;  3N4Q A;  3HVR A;  4PA1 A;  3VQP A;  1JLQ A;  4LF9 K;  3NFA A;  1IKW A;  3TTD A;  4CZG A;  3MWP A;  4DR6 K;  4JS5 A;  3U6F A;  3OJU A;  3LP3 A;  2OYQ A;  4B9U A;  2P9I A;  4ID5 A;  4CE9 A;  4CJQ A;  1OH6 A;  4JI2 K;  3LDS A;  1T7P A;  4JI5 K;  3DJC A;  4JI3 K;  2HBL A;  4BWJ A;  4N76 A;  3HVT A;  4BWM A;  1XNR K;  4ELU A;  4EZ9 A;  4I9Q A;  2JGU A;  4PY5 A;  3O4W A;  3C94 A;  2PAV A;  3AVH A;  3AA4 A;  3SMS A;  4NYF A;  4W5R A;  4BRH A;  5CYM A;  3DAW A;  1YAG A;  1RT5 A;  2R7Y A;  1S1W A;  2V52 B;  3BUZ B;  3CFO A;  5KGX A;  3L2U A;  1HYV A;  2ZGY A;  1LW0 A;  3QEX A;  4CZE A;  3D6R A;  1N33 K;  3TSQ A;  1U2V A;  2HNY A;  3VF4 A;  1IG8 A;  4GVM A;  2P5O A;  4KKO A;  4LSN A;  4A62 A;  3ZSR A;  4AHT A;  2KFZ A;  3I55 N;  3NF9 A;  3EEQ A;  4B3M K;  3D2E B;  3OTO K;  3U3Y A;  3GBT A;  4E19 A;  1RDD A;  5CR4 A;  4AH9 A;  3OYM A;  2KZM A;  4JAX A;  4QS8 A;  4HCB A;  3MN9 A;  5HOO A;  4O5B A;  4FZX C;  4Z4E A;  4CHY A;  4KHY A;  4MQ3 A;  1C0T A;  5J2P A;  3ENH A;  4CK1 A;  5LY3 A;  2KW4 A;  4B3O A;  3S3O A;  3CCV N;  1N34 K;  3K58 A;  3DLK A;  4BR2 A;  3QEV A;  2XY7 A;  3R1X A;  3T1H K;  4H4M A;  4KH4 A;  4FLZ A;  1KAX A;  1HKB A;  4DS4 A;  2E8A A;  3K9J A;  4AM6 A;  3NGI A;  2PFU A;  2FSK A;  3BGR A;  5JMV A;  3NF7 A;  2ZJR L;  1TKZ A;  3DM2 A;  4H4O A;  4CBW A;  5M1F A;  4DR7 K;  4B1Y B;  4YOY A;  4CZL A;  2QWL A;  5M1N A;  2Q3S A;  4JI4 K;  1NK4 A;  3WT0 A;  3CER A;  4IG3 A;  5AZJ B;  4IZ9 A;  4MLH A;  3O9T A;  3MEC A;  4LC9 B;  3C6H A;  4BDZ A;  1KVA A;  4NXN K;  4GV6 A;  3BDP A;  3CCJ N;  2GWJ A;  3TAR A;  1Q9Y A;  4WFN L;  1VAZ A;  3PX0 A;  4CJ4 A;  3WEE B;  4E1J A;  3MCA B;  3CQ8 A;  3V1Q A;  3RR8 A;  3CPW M;  1VQ8 N;  3W3D A;  3HPG A;  4CJU A;  4RW7 A;  3THY B;  4JV5 K;  3EE8 A;  2GUI A;  1K8K A;  3D2E A;  5M1P A;  4FJX A;  1VRT A;  3THV A;  4A2B A;  1SL0 A;  4JK7 A;  4OVL A;  2V7Y A;  4YOW A;  3VQB A;  4CJR A;  1TL3 A;  4CJE A;  2E6L A;  5AQU A;  3EKU A;  3O08 A;  3QDK A;  1D4X A;  4FJL A;  3AO3 A;  3DRP A;  2YNF A;  3EYZ A;  3KD1 E;  3CF5 L;  3PO4 A;  3H1Q A;  5AFU A;  4DS5 A;  4JKB A;  2VQF K;  5GAG P;  1VQM N;  1S22 A;  1S9E A;  2P9N B;  3FZF A;  2HHS A;  2FXU A;  1UA0 A;  3LL3 A;  1FKO A;  3ULD A;  1ZBU A;  1RTD A;  1OVY A;  4OKJ A;  3SV3 A;  1NBW A;  3KJV A;  3DLR A;  5F1X A;  2KFN A;  1SS6 A;  3CJB A;  1VQ9 N;  2D0B A;  4CJ3 A;  5EOY A;  3G4S N;  3CM5 A;  3SJH A;  2O4I A;  4H0P A;  4OPH A;  3O3H A;  2VCP A;  3B8A X;  4BRP A;  3EZW A;  3JXU A;  3T1A A;  4CES A;  4DLE A;  1MDU B;  4IOX A;  4BC4 A;  4EIA A;  3NAE A;  5LMU K;  4H0X B;  1ASV A;  3O9R A;  1RBS A;  5AZJ A;  2Q1N A;  2CGL A;  1FK9 A;  3TAQ A; 
#chains in the Genus database with same CATH homology
 1TGO A;  3OYL A;  3V9X A;  3IAY A;  1KVB A;  4CJW A;  2G8I A;  4Z4I A;  3ITH A;  4C8M A;  3U3G A;  4KHW A;  2RKI A;  3I0R A;  4O0J A;  4HTU A;  4FLW A;  1TKT A;  1EP4 A;  3LAK A;  4PQU A;  3SYZ A;  3ZT2 A;  5C24 A;  4KTQ A;  4LSL A;  3ISN C;  1TV6 A;  4KHS A;  1VSE A;  3VQE A;  4CJF A;  4Z4C A;  5HRP A;  3KLE A;  4CJV A;  3SPY A;  4CCH A;  1VK0 A;  1J54 A;  3QLH A;  1ASU A;  1T8E A;  3V1O A;  3LPU A;  1TK8 A;  1U04 A;  1VSF A;  4FW1 A;  4LH4 A;  2W42 A;  2D0C A;  1ZBH A;  2XO7 A;  1O1W A;  1RT4 A;  2Z1H A;  3C6T A;  5SZT A;  4IG0 A;  4O55 A;  3EY1 A;  3HYF A;  1RBV A;  3AA5 X;  3RMC A;  1ASW A;  1JLC A;  3LZI A;  4FYD A;  3OS0 A;  3A2F A;  3F9K A;  5EU7 A;  4N5S A;  3F73 A;  4FJJ A;  2HHQ A;  1W9H A;  3KK1 A;  1FXX A;  3LPT A;  4I2Q A;  4FZZ A;  3NGZ A;  1DLO A;  4KV8 A;  5HRN A;  4I7F A;  4B9M A;  4RW6 A;  1IKV A;  1YVU A;  3SQ4 A;  1KSP A;  1N6Q A;  1BI4 A;  4Q0B A;  1W0H A;  2XRI A;  1GOC A;  4CFA A;  1NK6 A;  3MED A;  4O0I A;  3QNO A;  1ZBF A;  1S5J A;  4DMN A;  4E89 A;  4YNQ A;  3E01 A;  3AO2 A;  1WSF A;  5T7B A;  3CFP A;  1NK9 A;  1QE1 A;  2ETJ A;  3KD5 E;  3LP1 A;  5FDL A;  3OYB A;  3NH0 A;  1S1T A;  1KFS A;  5DMR A;  1TK5 A;  3VQ6 A;  3ZCM A;  5J2M A;  3NH1 A;  1QSS A;  1C0U A;  5CZ1 A;  3VQ8 A;  5FRN A;  3K57 A;  1U4B A;  2QKK A;  1REV A;  4E1M A;  3VQ9 A;  3DOK A;  1L3S A;  4FLV A;  3H08 A;  3ZSX A;  3RMB A;  4Z4G A;  5CYQ A;  2DFF A;  1S1X A;  3KK3 A;  2DFE A;  3KKR A;  4BDY A;  1S1U A;  1HJR A;  3KIO A;  4CEB A;  2HW3 A;  2RF2 A;  4CGD A;  3O3F A;  1EXQ A;  1D9F A;  3OYN A;  1L3T A;  3AVI A;  4HHT A;  4ELV A;  4BE1 A;  3TAE A;  4ZTJ A;  4EP4 A;  4Z4H A;  3VQ4 A;  1UAX A;  3UIQ A;  3D0P A;  4E3S A;  1LV5 A;  1T03 A;  2PYL A;  2P51 A;  1C0M A;  4CF0 A;  4F8R A;  3M8P A;  2A1S A;  1WSJ A;  4LD0 A;  3SJJ A;  3DLH A;  3K5N A;  1TKD A;  4KB0 A;  2E4L A;  1TVR A;  4E7I A;  3ASM A;  4KI4 A;  4FJG A;  2YNG A;  4KTW A;  3RMA A;  3NE6 A;  2G8V A;  3G0Z A;  3CFR A;  4CIF A;  3LAN A;  4E7L A;  1SKR A;  1VSK A;  3T3F A;  3SQ2 A;  3AV9 A;  2B4J A;  3NCI A;  3V9W A;  3L2W A;  4FM1 A;  4DFP A;  1U48 A;  1X9M A;  4CJT A;  2BGG A;  1HPZ A;  1RT1 A;  2YHA A;  3OS2 A;  3K5O A;  4IKF A;  4AHU A;  1JL2 A;  4BDP A;  4Z4F A;  2ATQ A;  1NOY A;  2FBX A;  2EX3 A;  3KLI A;  3QIN A;  1TKX A;  4N47 A;  4B8A B;  3QEP A;  4FJ7 A;  3HM9 A;  3LP0 A;  3QEW A;  3SPZ A;  1Q9X A;  3AVB A;  2B6A A;  3KLF A;  1NJY A;  1LWF A;  1NKC A;  4R5P A;  1ZBI A;  1VSJ A;  2VWJ A;  4DU1 A;  1A5X A;  4MFB A;  1J9A A;  4AHR A;  4CK3 A;  3DLG A;  4KAZ A;  1QS4 A;  5KTQ A;  4M42 A;  4JRP A;  1BCM A;  3VQC A;  2OPQ A;  1LW2 A;  3OY9 A;  4CGG A;  3V9Z A;  3HP6 A;  1QHT A;  3NH2 A;  3HPO A;  1KLN A;  3ZSY A;  4BE0 A;  2OPR A;  4N41 A;  4CEF A;  3HJF A;  1XC9 A;  2KZZ A;  1VSI A;  3SCX A;  1JLE A;  4M3R A;  1NKB A;  4FJI A;  4B9S A;  3PV8 A;  5HRO A;  1JLB A;  1L5U A;  4FK4 A;  1BQN A;  1JKH A;  1I39 A;  1JXE A;  1WSE A;  3O3G A;  3HXM A;  2B5J A;  2WON A;  3RWU A;  3NBP A;  2VWK A;  1I3A A;  4DFJ A;  4FW2 A;  3VQQ A;  3OYK A;  1QSL A;  2P1J A;  1KLM A;  1C6V A;  2HB5 A;  2IS3 A;  2GV9 A;  3P5J A;  1L3V A;  3NDK A;  3K2P A;  1UA1 A;  1D8Y A;  1BIS A;  1NJX A;  3QIP A;  4RW8 A;  1QTM A;  4DTX A;  1HQU A;  4KPY A;  4CK2 A;  1IKY A;  4DU3 A;  4RG8 A;  3NF8 A;  4DQP A;  3QIO A;  3KK2 A;  3V81 A;  2QKB A;  3AVK A;  3OYC A;  4DSE A;  4K8Z A;  2ZQB A;  1RNH A;  4FM2 A;  2HHU A;  3OYI A;  4M3U A;  4CEC A;  4DWI A;  2XY5 A;  4CJK A;  4B9L A;  4NCG A;  3ZSW A;  1RT3 A;  2VG5 A;  3HT3 A;  3JSM A;  1EET A;  4OPJ A;  4M3X A;  3HP9 A;  4DG1 A;  4PUO A;  1U47 A;  4UQG A;  2KQ2 A;  4CHZ A;  4AHC A;  4W5T A;  3K59 A;  2YV0 X;  5HRR A;  1CZB A;  3MXM A;  2HMI A;  4J2D A;  1U45 A;  5C25 A;  2HHT A;  2WOM A;  4E7H A;  3C6U A;  4ZTF A;  4QAG A;  3AA3 A;  4PWD A;  3WNE A;  5CZ2 A;  4DF4 A;  1SKW A;  4B9N A;  2YKM A;  3QES A;  5HRS A;  1D5A A;  4KRF A;  4CF9 A;  3ZSZ A;  1RDB A;  3QET A;  1YTU A;  1JL1 A;  2X78 A;  3P1G A;  4DSI A;  4M3Z A;  4FJN A;  1GOA A;  2VG7 A;  4CJS A;  3OYE A;  1BCO A;  4AHV A;  3ZSQ A;  4OJR A;  1UWB A;  1KVC A;  1JLG A;  3MXJ A;  1IKX A;  4F4K A;  1KFD A;  3WNG A;  4E0D A;  4CHO A;  3HST B;  4YFU A;  3M8Q A;  4Q5V A;  3DRR A;  1ITG A;  3KTQ A;  4CGI A;  1L3U A;  2RPI A;  3OVN A;  3CYM A;  4JRQ A;  4CJL A;  4FM0 A;  4LH5 A;  4H8K A;  4E7K A;  1WSI A;  3AVL A;  3M8R A;  3VQD A;  5FRO A;  3VQA A;  3AVG A;  1HQE A;  3I8D A;  3PY8 A;  1RTI A;  3PUF A;  3V1R A;  2P5G A;  2HVI A;  4W5O A;  3AVA A;  4CEO A;  2FBT A;  3RMD A;  3KKS A;  4I2P A;  5K14 A;  2Z1G A;  3AVF A;  1X9S A;  2O4G A;  3DLE A;  4J2E A;  2G8F A;  2BDP A;  4O44 A;  4FCY A;  2G8W A;  1FKP A;  1DTT A;  3LAM A;  3HVR A;  3VA3 A;  4CJP A;  4PA1 A;  3VQP A;  1JLQ A;  3DRS A;  1WSH A;  3RTV A;  4DTU A;  2HVH A;  3NFA A;  5HP1 A;  4CFC A;  4FJ5 A;  1IKW A;  2Y1J A;  4NYN A;  3HK2 A;  3OYH A;  3CM6 A;  4DTS A;  4CGF A;  4DSL A;  4JS5 A;  2X74 A;  2DY4 A;  3U6F A;  4XIU A;  1TK0 A;  1XHZ A;  3OJU A;  4FJK A;  1HYZ A;  3DMJ A;  4KHN A;  5JS2 A;  3LP3 A;  3V9U A;  3O4N A;  3L2Q A;  4HUE A;  2OYQ A;  4B9U A;  1NK0 A;  3MEE A;  1LWC A;  4ID5 A;  4CE9 A;  4CJQ A;  4F2S A;  3L2R A;  5HBM A;  3LDS A;  1T7P A;  3DLB A;  2QXF A;  1BQM A;  1GOB A;  1KTQ A;  5KI6 A;  4BWJ A;  2PYJ A;  3HVT A;  4BWM A;  2OPP A;  4N76 A;  1X9W A;  4C8K A;  2Y1I A;  4ELU A;  2Z1J A;  5CY4 A;  4EZ9 A;  2JGU A;  4I9Q A;  4PY5 A;  3C94 A;  3TWH A;  3AVH A;  3AA4 A;  3QER A;  4KI6 A;  4NYF A;  4OLA A;  2AJQ A;  1C1C A;  4W5R A;  3LZJ A;  1BIZ A;  5CYM A;  4DFK A;  4DSJ A;  1RT5 A;  2R7Y A;  1SV5 A;  3AVJ A;  1S1W A;  4JLH A;  3ZT4 A;  4CHQ A;  3QEI A;  5I3U A;  2FBV A;  5C42 A;  2IDO A;  3CFO A;  4CIE A;  5KGX A;  3L2U A;  5D3G A;  1ZYQ A;  1VSD A;  1WSG A;  3MAQ A;  1HYV A;  1SUQ A;  1BIU A;  1EKE A;  1LW0 A;  3QEX A;  2IOC A;  4GMJ B;  1X1P A;  4QCL A;  4CJ5 A;  4HUG A;  4AHS A;  4B8C A;  4DSK A;  1CZ9 A;  4DFM A;  3ZT1 A;  2HNY A;  5I42 A;  4F3T A;  4ID1 A;  4QOZ B;  2HNZ A;  4OGC A;  3IG1 A;  3RRG A;  4RW9 A;  4DTN A;  4GVM A;  2G8U A;  2P5O A;  4KKO A;  4LSN A;  3ZSR A;  5KRT A;  2E6M A;  4AHT A;  4HUF A;  1NK5 A;  1S9G A;  4KO0 A;  2BAN A;  2KFZ A;  3NF9 A;  3RR7 A;  2A1R A;  4Z0U A;  1WAF A;  3KLG A;  3I0S A;  4DTM A;  1XI1 A;  4B9V A;  4C8N A;  4OKK A;  3U3Y A;  3L8B A;  4E19 A;  1RDD A;  4DLG A;  4DTR A;  3AO5 A;  4AH9 A;  1KCF A;  1QQC A;  1WAJ A;  3OYM A;  2JLE A;  1Q8I A;  4FJH A;  2F96 A;  3L3V A;  2ITG A;  2KTQ A;  3ZT3 A;  4FJ8 A;  2FC0 A;  3ZSO A;  3O4Q A;  3SV4 A;  3T19 A;  4C8L A;  2KZM A;  4M45 A;  1JXB A;  1CXU A;  3AVM A;  4FLX A;  4O5B A;  3NF6 A;  4AIL C;  4FZX C;  4HCB A;  2YNH A;  3AVC A;  4Z4E A;  4CHY A;  4KHY A;  1NOZ A;  4KHU A;  4KFB A;  4MQ3 A;  1C0T A;  1JLA A;  3ZSV A;  5J2P A;  1C1B A;  5J2Q A;  5J1E A;  2G8H A;  4C8O A;  4CGJ A;  3HO1 A;  3WNH A;  1CLQ A;  3VN5 A;  1A5V A;  2RN2 A;  3B6O A;  4CK1 A;  4F2R A;  2KW4 A;  5HLF A;  3AO4 A;  1LWE A;  3LWM A;  1NKE A;  3TAM A;  4FK2 A;  4B3O A;  3S3O A;  1BHL A;  2BE2 A;  3K58 A;  3DLK A;  1HYS A;  2XY8 A;  3L2V A;  3QEV A;  2FBY A;  4CEQ A;  3OYJ A;  2XY7 A;  2ZE2 A;  4K8X A;  2OZM A;  1SL2 A;  3OJS A;  4H4M A;  1RBU A;  4KHQ A;  3M8S A;  4BAC A;  4FLZ A;  2OA8 A;  1S6Q A;  3SI6 A;  3TAF A;  3S3M A;  4DS4 A;  2X6S A;  1B92 A;  1RDA A;  5J2N A;  3OYA A;  3NGI A;  1RT2 A;  4HVJ A;  1QSY A;  3SNN A;  3BGR A;  4OLB A;  1WNS A;  4EP5 A;  3TAN A;  1NK8 A;  4CIG A;  3S9H A;  1WN7 A;  4O4G A;  3NF7 A;  1XWL A;  3TR8 A;  3K5L A;  1Z25 A;  3V6D A;  1TKZ A;  1CXQ A;  2G8K A;  3DM2 A;  3OYF A;  2IC3 A;  4E1N A;  4H4O A;  3TAB A;  4OPK A;  3SZ2 A;  2NUB A;  4FLU A;  2EHG A;  2IAJ A;  3NGY A;  1RTJ A;  4HCC A;  1HNI A;  3D45 A;  4IFY A;  4Y1C A;  2ZD1 A;  4I9L A;  3OS1 A;  4FJM A;  4L8R B;  4OGE A;  3SQ0 A;  1YTA A;  3AVN A;  3MEG A;  2Z1I A;  2Q3S A;  4B08 A;  3AA2 A;  3OYG A;  2XHB A;  4E7J A;  2YNI A;  3TAP A;  1NK4 A;  4M3T A;  5JS1 A;  1RT6 A;  4DF8 A;  4IG3 A;  3TAG A;  1JLF A;  1N5Y A;  3MEC A;  4BDZ A;  3LP2 A;  1KVA A;  1WLJ A;  1SKS A;  3VQ7 A;  2QK9 A;  1G15 A;  1VSH A;  2YKN A;  3K5M A;  3BDP A;  5KRS A;  1ZBL A;  4Y1D A;  1C1A A;  1J53 A;  3TAR A;  1Q9Y A;  3EZ5 A;  2F8S A;  4W5N A;  4DU4 A;  1TAU A;  1TAQ A;  3PX0 A;  3PO5 A;  1IH7 A;  4CJ4 A;  4DTO A;  3HPH A;  2XY6 A;  3L3U A;  1S1V A;  3CQ8 A;  3V1Q A;  2GBZ A;  4CF1 A;  3NHG A;  3RR8 A;  1VRU A;  4DSF A;  4FZY A;  4TSX A;  4JS4 A;  3HPG A;  3MXI A;  1RIL A;  4CEA A;  3ALY A;  4CJU A;  4GW6 A;  4RW7 A;  3RRH A;  2HHX A;  3JYT A;  4CFD A;  4EZ6 A;  2DFH A;  4G1Q A;  3LAL A;  2GUI A;  4KB1 A;  4KRE A;  3DI6 A;  3KLH A;  4FJX A;  1VRT A;  3THV A;  1SL0 A;  1HMV A;  3FFI A;  2X6N A;  1LAV A;  1B9D A;  4OVL A;  4CEZ A;  4LY7 A;  3VQB A;  4CJR A;  1TL3 A;  4M3Y A;  4CJE A;  4DQQ A;  1RCH A;  1VSL A;  3S3N A;  4FLT A;  2E6L A;  2PY5 A;  3VQ5 A;  3PX6 A;  2I5J A;  1TL1 A;  3AO3 A;  1NJW A;  1BI4 B;  3G10 A;  4FVM A;  4OKE A;  4FJL A;  3DRP A;  5DK5 A;  2YNF A;  4IBN A;  5E41 A;  3EYZ A;  3KD1 E;  2HHV A;  1RBT A;  1VSM A;  4KTZ A;  3PO4 A;  4FJ9 A;  4DS5 A;  3LWL A;  3WNF A;  3IRX A;  4J2A A;  4CER A;  1RTH A;  4DTP A;  1KRP A;  1BGX T;  1RT7 A;  2VG6 A;  4CFB A;  1J5O A;  4M41 A;  3IS9 A;  4DQR A;  1S9E A;  4NCB A;  2HHS A;  2PZS A;  1XHX A;  3CG7 A;  2HHW A;  5KGW A;  4NCA A;  4CGH A;  1UA0 A;  4DQI A;  1Y97 A;  3SQ1 A;  1A5W A;  1FKO A;  1NJZ A;  3ULD A;  1YT3 A;  1ZBU A;  1RTD A;  4CHP A;  3PX4 A;  4OKJ A;  4CF8 A;  1LAW A;  3V4I A;  3VA0 A;  2OZS A;  3SV3 A;  4N56 A;  3KJV A;  4DQS A;  2D0A A;  2OPS A;  3DLR A;  1K6Y A;  1NK7 A;  3DYA A;  2KFN A;  1F21 A;  4CEE A;  1RDC A;  1Z26 A;  2LSN A;  2YHB A;  3B6P A;  1U49 A;  4CF2 A;  4CHN A;  4FXD A;  1UOC A;  2D0B A;  4ICL A;  4CJ3 A;  4WE1 A;  3CM5 A;  4RW4 A;  3SUQ A;  3V9S A;  3QO9 A;  1SL1 A;  2O4I A;  3ZT0 A;  1T05 A;  3C95 A;  3DOL A;  1DTQ A;  1S6P A;  4W5Q A;  3O3H A;  4ELT A;  3P83 D;  4BE2 A;  1BL3 A;  2F8T A;  4DTJ A;  4M3W A;  3T1A A;  4CES A;  2IGI A;  4DLE A;  3QNN A;  1IG9 A;  4B9T A;  2DTU A;  3HL8 A;  1IO2 A;  1B9F A;  4ZHR A;  3NAE A;  4FK0 A;  1ASV A;  2HND A;  3TI0 A;  1RBS A;  5SWM A;  3SUN A;  3OYD A;  4FLY A;  1R0A A;  3SUO A;  4F3O A;  1EX4 A;  1D9D A;  1FK9 A;  3TAQ A;  4J2B A;  3AO1 A;  2D5R A;  4CED A;  5FRM A;  1HRH A;  4IDK A;  1MU2 A;  1RBR A;  3SUP A;  1HNV A;  4IFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...