4LH5A

Dual inhibition of hiv-1 replication by integrase-ledgf allosteric inhibitors is predominant at post-integration stage during virus production rather than at integration
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
152
structure length
129
Chain Sequence
SPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual inhibition of HIV-1 replication by integrase-LEDGF allosteric inhibitors is predominant at the post-integration stage.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords Integrase
total genus 43
structure length 129
sequence length 152
ec nomenclature
pdb deposition date 2013-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lh5A00
1C6VA 1LAVA 2YNIA 4DTXA 4CJVA 4CGHA 3RMAA 4DSKA 4FJ5A 4Z4CA 4FYDA 1BGXT 4H4OA 4CJQA 1RTJA 2IC3A 3OYCA 4CJSA 4C8NA 4DTNA 3SV4A 1TGOA 3JYTA 4Q0BA 1YTAA 1FK9A 4CF0A 3QINA 2PYLA 1JLGA 1D9FA 3TR8A 4BE0A 1TKDA 3DLHA 3AA3A 2YV0X 4ID5A 4CEOA 1ZBFA 2WOMA 3TI0A 1TK0A 2RN2A 5J2NA 4W5OA 2A1RA 4M3UA 4O0IA 4KTZA 3ZSVA 3PX6A 4GVMA 2FBTA 3SV3A 4M3XA 1WSHA 3LP1A 1FKPA 4E7KA 4HTUA 3V9ZA 4DSEA 4OKJA 3V9XA 4CJEA 3OYHA 3LDSA 3VQ4A 3SQ2A 4B9VA 4CIFA 4B9MA 5HBMA 4RW8A 3QEIA 4CF2A 4OLBA 4RW4A 3TWHA 4E7LA 1Y97A 3VQCA 4RW6A 4CERA 4B8AB 3OYNA 4ELUA 4CEZA 3SUOA 1VSIA 4CEDA 3DLBA 1J9AA 3LZIA 2GV9A 1DTTA 4E0DA 3RWUA 3LPTA 4O5BA 2HHUA 3K5MA 3MXMA 1IKYA 1ASVA 2X6NA 3DOLA 3WNFA 1CXUA 1HRHA 4HVJA 1LW0A 4ELVA 4N76A 1QQCA 3RR7A 2HNYA 4FZYA 3RMDA 4W5QA 4E7IA 2XY7A 1CZBA 3AA2A 3C6TA 1NKEA 1QTMA 4N56A 4F3OA 1JLAA 4FW2A 4LD0A 1G15A 1UOCA 3P1GA 3VQAA 3L2UA 4FZXC 4KRFA 3L8BA 2I5JA 4DSJA 3VN5A 4HUFA 1TV6A 4EZ6A 4CHPA 3S3OA 2JLEA 2YKNA 3O3GA 1RT5A 2HMIA 4F8RA 3KK2A 2KTQA 1W9HA 1KSPA 1CXQA 1VSFA 3B6OA 3SYZA 2HHQA 3K2PA 4PWDA 3NAEA 3NE6A 1KFDA 1VK0A 3SUPA 2OPRA 1HPZA 3AVAA 4TSXA 4BWJA 3NHGA 4DTMA 3SI6A 1YTUA 1S1XA 1KLMA 4Q5VA 1WAJA 3CQ8A 1KRPA 2AJQA 1LV5A 1C1BA 2HB5A 4DQQA 4AHSA 4CEAA 4R5PA 2X78A 3LAMA 3QNOA 3KTQA 1IKWA 1HYVA 3PX0A 4LY7A 5KGWA 3HVTA 1SKWA 1KCFA 4AHCA 5JS1A 3C94A 4BWMA 3NBPA 2VG6A 4Z0UA 4CJTA 3OYGA 3NH0A 2OZMA 4PA1A 5HRPA 1L5UA 2X74A 3ZT3A 1S9GA 2X6SA 5CY4A 2YHBA 1RBUA 3AA5X 5HRRA 4CFAA 3OYIA 4DTSA 1JLQA 4M3YA 1J54A 3WNHA 4CEBA 4IG0A 4DU4A 5CYQA 2DFFA 1TK5A 1IH7A 3QIPA 3ZSWA 4BDZA 4FLTA 3EZ5A 4OKKA 1EXQA 4KO0A 3SQ0A 1X9SA 4FJMA 3OYKA 1TKTA 4HUGA 1JLCA 4FJ8A 5C25A 3DRPA 3V1QA 3VQ7A 3HXMA 3THVA 3G10A 1HYSA 3DYAA 1GOCA 2IGIA 3NF8A 1RT3A 3SPZA 3AO5A 2RPIA 4E19A 4FJ7A 3QIOA 4BE2A 1EETA 1S6PA 4DTJA 2HW3A 3O4QA 4CHOA 2HHSA 2E6MA 3C95A 1O1WA 3CYMA 1VSMA 3DMJA 2XO7A 3QNNA 1TKXA 4IG3A 4LH4A 1NK5A 1RDAA 4C8KA 3HL8A 3HP9A 4DLEA 2QK9A 1NJZA 1WLJA 2XY6A 2P1JA 3ULDA 3V4IA 1Z26A 4RG8A 1HMVA 1A5VA 3P83D 3TARA 4IKFA 4KHYA 4CGIA 1LW2A 1RT7A 4DFJA 2D0AA 4KPYA 4FZZA 1QSLA 2YHAA 3AV9A 3KLHA 2NUBA 4DSLA 1U45A 1NKBA 2ZD1A 3AVFA 4ELTA 1IG9A 1HYZA 4FVMA 3IS9A 1C1CA 2Z1HA 4CEQA 1RILA 3HP6A 1RT2A 3RTVA 3VA3A 2P5GA 3M8QA 4CIGA 2G8FA 3H08A 1RDDA 1VSLA 2FC0A 4NCBA 2F96A 4OGEA 4OPKA 3AO4A 3NF9A 3OVNA 1SV5A 5CYMA 3O3FA 2XHBA 3CFPA 1TK8A 2KFZA 4CFCA 2DTUA 5KRTA 3CFRA 4JRQA 5J2QA 4I9QA 1UWBA 3CM6A 3FFIA 4I2PA 1QSYA 1U49A 4E89A 3ISNC 3ZSRA 1X9WA 1N6QA 1UA0A 2E4LA 4KHSA 1I3AA 1K6YA 2BANA 2FBYA 1S1WA 4AHTA 3DOKA 4FLUA 3T3FA 4CK2A 1U47A 2DY4A 3QESA 4NCAA 3NFAA 4CF9A 3KKSA 4B3OA 1D8YA 2Q3SA 1HJRA 3AVJA 3LP2A 4KB0A 4OPJA 5HP1A 4NYNA 2GUIA 5CZ2A 3SUQA 4IFVA 4KKOA 1C0MA 4PQUA 1GOAA 3SJJA 5JS2A 5FRMA 3F9KA 2VG5A 2B5JA 2KQ2A 2EX3A 2GBZA 3EY1A 3AVIA 5T7BA 3HPOA 3RRHA 2Y1JA 3QETA 3K59A 4FK2A 2HVIA 3KLGA 2IAJA 3ZT1A 3ZSXA 4M45A 4BDYA 3SZ2A 4FJIA 1SKRA 1TL1A 2QXFA 4MQ3A 2OYQA 4F2SA 3L2WA 2O4GA 2Z1GA 1LAWA 1RBVA 1NK6A 2PY5A 3PY8A 4C8OA 4QAGA 3PO4A 4EP4A 1NJYA 1DTQA 3K5OA 3L2QA 5D3GA 5E41A 4DTRA 2IS3A 4IFYA 1VRTA 3KD5E 3OY9A 1QHTA 1LWCA 4CHQA 4I9LA 1RT6A 3K57A 1TKZA 4CGDA 4DS4A 1FKOA 1Z25A 4DF4A 1LWEA 2Z1IA 3L3UA 4CGFA 4AHVA 1BIZA 2XY8A 4FJJA 3QEXA 4B08A 2ZE2A 3S3MA 4DFPA 1RTDA 4W5NA 3LALA 3SQ1A 4Z4FA 4FW1A 1VSHA 4GMJB 2P51A 1WSJA 3TAGA 3HVRA 3K5NA 3OYMA 3DLKA 3S3NA 1MU2A 1HQEA 1XWLA 1IO2A 1HNVA 4KB1A 4QCLA 3NGIA 5HROA 5HLFA 3HPHA 3HK2A 1KVAA 3L3VA 2HNZA 4KI6A 4B9NA 4HCBA 3KIOA 4E1NA 1RNHA 4IBNA 3V81A 2HHWA 3TAEA 3OJUA 3CFOA 4FJHA 5DMRA 1JLEA 3U3GA 3OS1A 1NK9A 2XY5A 4ZTJA 4H4MA 1QS4A 3ZSQA 2JGUA 2DFHA 4CEEA 1D5AA 5J2MA 2EHGA 4KTWA 4F4KA 4DSFA 4B8CA 4IDKA 5FRNA 4DTUA 4PUOA 3MXJA 4M3TA 5C24A 5HRNA 5I3UA 1BIUA 4E7HA 4C8LA 4DQPA 4M42A 3OYAA 3HM9A 1S1VA 4CJ3A 4BE1A 4FJXA 3K5LA 3OS2A 1TL3A 1XI1A 4YNQA 4CK3A 4FK4A 3AVLA 3PX4A 2G8HA 1TAQA 1WSGA 4Y1DA 5FROA 3V9UA 4B9SA 2O4IA 4CFBA 1SKSA 1ASWA 1EKEA 1TVRA 5KRSA 3MEGA 1TAUA 4KFBA 4CGJA 2FBXA 4ICLA 3AVHA 1UA1A 1W0HA 4QOZB 1VSKA 2HHTA 4JS4A 4HHTA 2Y1IA 1U04A 1VSEA 3VQ9A 1BI4B 3LZJA 4FM0A 2B4JA 1T05A 3UIQA 3QEWA 4CESA 4FXDA 3C6UA 5DK5A 1RTIA 1WN7A 4RW7A 1NK4A 4E3SA 1BQNA 1ITGA 3AVNA 4AHUA 3AVKA 1ASUA 1EX4A 4E7JA 4G1QA 4M41A 3AO3A 1FXXA 2ATQA 1X1PA 4WE1A 1JLBA 4OGCA 3NDKA 3NCIA 3HJFA 1JL2A 1LWFA 4B9LA 4CGGA 3IRXA 4W5RA 4B9UA 4AHRA 4HCCA 4KHUA 3QEVA 4M3RA 3D45A 3ZCMA 1I39A 3LWMA 1RCHA 3I0SA 1WSEA 1NK0A 4PY5A 5EU7A 3M8RA 1B92A 4FJKA 3BGRA 4RW9A 4FM2A 1KFSA 3IAYA 3HO1A 3TAMA 2F8SA 3CM5A 3ZSYA 4FLWA 4DS5A 2HVHA 3TANA 1WSFA 2RKIA 4FCYA 3KD1E 1YVUA 2IDOA 1REVA 4LSLA 2DFEA 1U4BA 1QSSA 4NYFA 1SUQA 3PO5A 3VQQA 4CHYA 4Z4HA 3AVMA 2XRIA 3OYFA 4F3TA 4XIUA 3HT3A 4DF8A 1B9FA 3DM2A 1NOZA 3NGYA 5CZ1A 3KLEA 3KK3A 4CF1A 5J1EA 4CCHA 3NF7A 1JXEA 1ZBUA 3AO2A 3MEDA 3T19A 4N47A 4DQRA 1KVBA 1KTQA 3MEEA 3MXIA 2G8WA 4I7FA 4F2RA 4M3ZA 1S6QA 1ZBIA 1RDBA 3DLRA 3ZSOA 4J2EA 2E6LA 4CJ4A 5KGXA 3JSMA 4BDPA 4AH9A 1WAFA 3DI6A 3HYFA 4KREA 3LAKA 2D0BA 4O4GA 4FLXA 4KHWA 1RT1A 3IG1A 2YNHA 4FJLA 3VQ6A 3VQ5A 3M8PA 3KK1A 4DLGA 1N5YA 5K14A 1A5WA 1C0UA 3NH2A 1ZBLA 1S1UA 1SL0A 3QO9A 1T03A 1XHZA 4GW6A 3P5JA 1RBRA 4FLYA 1X9MA 2KZZA 4MFBA 3ZT0A 3ZSZA 1S5JA 5SWMA 2ZQBA 4OKEA 1R0AA 4E1MA 2KZMA 5FDLA 3ITHA 3LWLA 2G8VA 4JLHA 4AILC 4FJNA 4FM1A 1NK7A 4CHNA 3U6FA 3OYDA 4K8XA 3HSTB 1C1AA 3QEPA 1L3VA 4FJGA 4LSNA 1S9EA 1QE1A 4I2QA 2YNFA 2ITGA 4CJ5A 3MAQA 1XC9A 3NH1A 1CLQA 2BE2A 4DG1A 2OZSA 3V6DA 3SPYA 1KVCA 3V9WA 3DLGA 2ETJA 3HPGA 1JL1A 4DWIA 4DFKA 4YFUA 4HUEA 1C0TA 3WNGA 4CHZA 1J5OA 3SUNA 2VWKA 4CE9A 5J2PA 5I42A 2G8KA 4FK0A 4KI4A 1ZYQA 1YT3A 3M8SA 3AA4A 3TAFA 3ALYA 5HRSA 1L3TA 1F21A 2PZSA 4L8RB 4DQIA 4KHQA 3E01A 3O4NA 4CJKA 1RBTA 2G8UA 3I0RA 5SZTA 1RT4A 4NCGA 4KHNA 3OJSA 4CECA 3LANA 4DU1A 1Q8IA 3TABA 4EZ9A 3T1AA 3CG7A 1KLNA 3RMCA 2BGGA 2G8IA 4N41A 3KLIA 3B6PA 4Z4EA 4CJLA 3LP3A 1WNSA 3VQ8A 4OJRA 3OS0A 1L3SA 2KFNA 1EP4A 1SL1A 1BHLA 1JKHA 4DTPA 3WNEA 1HQUA 2QKBA 2A1SA 3BDPA 3RRGA 4J2AA 4FJ9A 1BCOA 1IKXA 1HNIA 1SL2A 4DTOA 3VQBA 3DRRA 3L2RA 1S1TA 4JS5A 2HHVA 4CIEA 1U48A 3DRSA 1BCMA 5KI6A 4ZHRA 4BACA 3D0PA 1BISA 3QERA 2LSNA 1GOBA 1VSJA 3VQDA 4EP5A 3SQ4A 3O3HA 2QKKA 3KKRA 3ZT2A 1D9DA 4CK1A 1JXBA 1RBSA 1NK8A 3SNNA 1VRUA 4H8KA 1NKCA 4CJRA 5KTQA 2KW4A 1T8EA 4CJPA 2D5RA 1ZBHA 3A2FA 3KLFA 1J53A 3SCXA 4DQSA 4B9TA 4KTQA 1DLOA 3L2VA 4OLAA 1CZ9A 4UQGA 3PV8A 4DMNA 3AO1A 2WONA 4J2DA 2RF2A 4N5SA 3LP0A 1JLFA 4ZTFA 3NGZA 3ZT4A 2OPSA 1Q9YA 3RR8A 2YNGA 3ASMA 1T7PA 2PYJA 2F8TA 2FBVA 1NJXA 3V1RA 3RMBA 4KAZA 2OPQA 3VA0A 1XHXA 3DLEA 2D0CA 2HNDA 1UAXA 2BDPA 4Z4IA 4LH5A 1NJWA 5C42A 3TAPA 3VQEA 4DU3A 4M3WA 1B9DA 1IKVA 4CJUA 2Z1JA 3OYLA 4CF8A 2YKMA 1A5XA 3EYZA 4O0JA 4CJFA 4K8ZA 4W5TA 3NF6A 4CFDA 1BL3A 4Y1CA 3G0ZA 3MECA 1Q9XA 4Z4GA 1WSIA 3VQPA 2IOCA 4O55A 3QLHA 4FLZA 3V9SA 1BQMA 3OYBA 3S9HA 3TAQA 1NOYA 2HHXA 3PUFA 1VSDA 3V1OA 3K58A 2VG7A 4JRPA 2OA8A 4J2BA 1RDCA 2B6AA 4O44A 4C8MA 3AVGA 1BI4A 3AVCA 4CJWA 3AVBA 3OYJA 3OYEA 2W42A 2R7YA 3I8DA 3F73A 3KJVA 4KV8A 4DFMA 4DSIA 4FLVA 3LPUA 4OVLA 1RTHA 4CEFA 3U3YA 2P5OA 2VWJA 1L3UA 4ID1A 2OPPA
chains in the Genus database with same CATH superfamily
4FYDA 4DTXA 4CGHA 4DSKA 5BPLA 4A2AA 2QWLA 4CJQA 1RTJA 1JLGA 2IVOA 3O8MA 4A59A 2YV0X 5AQLA 2WOMA 1TK0A 4EFHA 4W5OA 2A1RA 2O8EA 5MLCQ 4GVMA 2F4VK 4DR4K 3T1YK 4E7KA 4DSEA 3WT0A 3V9XA 3LDSA 3SQ2A 4B9VA 4JKCA 4XEIA 5HBMA 3QEIA 2HF3A 3MN5A 1EO1A 4YY3K 3JS6A 4PKHA 2P9LA 2CH5A 1VSIA 2ASMA 3DLBA 2QI2A 2GV9A 3WNFA 3DOLA 1CXUA 1QZ5A 5TKWA 3RR7A 3J80O 4E7IA 2AA4A 3AA2A 4N56A 1JLAA 3CCSN 4FZXC 4KRFA 3VN5A 3O3GA 3VGKA 4BG9A 1W9HA 1KSPA 1DGKN 1VSFA 3FE1A 3ZX0A 4GKKK 5DM7L 4E1JA 4WQ5A 1QQOA 4HTLA 3CQ8A 2AJQA 2OTJN 1C1BA 4DQQA 2NZTA 2X78A 3KTQA 4IJNA 3M3ZA 5BPNA 4KH5A 1SKWA 4AHCA 5BN9A 5JS1A 2KHOA 1DT9A 2UU9K 4Z0UA 5HRPA 1L5UA 1Q18A 3JAMO 5CY4A 4GV6A 3VOVA 4R79A 4WFAL 1TK5A 3QIPA 2QXLA 3ZSWA 2W41A 4FLTA 1JJ2M 3L6QA 1VQNN 4KO0A 3R6MA 4HUGA 1NNEA 1Z6RA 3V1QA 3HXMA 3MN6A 3NF8A 5AQPA 5AQZA 1N34K 1YJNN 3QIOA 4BE2A 3NMUA 5BN8A 2HHSA 2XO7A 3DMJA 3IUCA 4DKWA 4LF9K 3HP9A 4DLEA 1SS6A 1NJZA 1WLJA 5EX5A 1YF5L 4RG8A 3TARA 3A5LC 2D0AA 3AV9A 3VPZA 4NXNK 3RSEA 3RTVA 3M8QA 4CIGA 2G8FA 3H08A 4NCBA 4OGEA 2W40A 2XHBA 3AO4A 3OVNA 5CYMA 3FZMA 1BA0A 2KFZA 4CFCA 5KRTA 3CFRA 3VF6A 3CM6A 1GLJO 4H0PA 4K43A 3SMSA 4DHYA 2FBYA 1ATNA 3T3FA 3QESA 4CF9A 4H5TA 2PFUA 4O5FA 3AVJA 3LP2A 2ASPA 4OPJA 4DR2K 4NYNA 1HPMA 3SK3A 5HP1A 3SUQA 1GOAA 2JWLA 3MWTA 5BR9A 3S41A 4CD1A 2VG5A 3QBXA 2B5JA 2GBZA 5M1OA 3CERA 4JKBA 3C7NB 2IAJA 3ZT1A 4BDYA 3SZ2A 4ILHA 4CZEA 3PSIA 3SMPA 4RTFD 2YI1A 3SBTA 1VQON 4QAGA 2IIRA 4BRCA 4IFEA 2BTFA 5AQIA 4DTRA 1HKCA 3KD5E 5EOYA 2P9UA 1QHTA 3OY9A 4K25A 4JYAK 3K57A 3N4PA 1Q81O 4DF4A 1LWEA 2Z1IA 3L3UA 4CGFA 3AGKA 2HF4A 3KHYA 1LOTB 3FLCO 4CZHA 1MWMA 5AQRA 3S3MA 3LALA 2VGMA 1FJGK 3PLAA 2VWBA 1VHXA 4JHDA 4JAXA 3HPHA 3O9UA 3UE5A 3WQTA 2E2NA 4E1NA 1X3NA 1RNHA 2HHWA 1QVFM 1E4FT 1JLEA 1IBLK 4B3RK 4F4KA 1NGCA 4B8CA 4CZJA 4JV5K 5LMNK 1NGFA 5I3UA 3DXMA 3BEXA 5CR4A 4M42A 3OYAA 1S1VA 5AQUA 4BRIA 3OS2A 1XI1A 1NWKA 1U6ZA 1TAQA 3V9UA 4Y1DA 3TSPA 1TUYA 4CFBA 4PL7A 4DV5K 1ASWA 1EKEA 3DLLL 4LFCK 1TAUA 4KFBA 2P9KB 3AVHA 1YI2N 4DR1K 5LJWA 1VSEA 3VQ9A 3H1QA 3THXB 3GG4A 3LDQA 2IVNA 4HWIA 3C6UA 3ZEUB 3R3LA 1RTIA 1NK4A 4DR6K 3AAQA 3AVNA 2F9TA 2VGNA 1YUWA 3H6EA 4E7JA 4M41A 5BRHA 2ATQA 4OGCA 3NDKA 3VESA 3IRXA 4IOCL 4W5RA 4HCCA 3ZCMA 1RCHA 5AQVA 5EU7A 3M8RA 2EWSA 3BGRA 4RW9A 5GINA 2NRHA 3IAYA 3HO1A 2F8SA 3ZSYA 3M5RA 4BRDA 3TANA 3KD1E 2DFEA 2NRZA 1U4BA 4NYFA 1QHAA 3CCMN 3MN7A 4CHYA 4F3TA 2XRIA 4BRGA 3DM2A 3ENHA 2QWOA 3CCRN 1U2VB 4A57A 5IWAK 1KTQA 3DLRA 1HNXK 2A40A 2NNWA 2I7PA 1RT1A 3IG1A 2A6AA 4MDBA 1FW6A 4DLGA 1A5WA 1NGJA 3VMFB 3NH2A 2ZJQL 1SL0A 3QO9A 3TTFA 4FLYA 1X9MA 2O8DA 4MFBA 3ZSZA 2OCEA 1S5JA 1VQLN 4AF1A 2O8BA 5AZIA 3O9RA 1OVQA 5FDLA 3ITHA 4JLHA 4AILC 4FJNA 5CE3A 3Q7CA 4NO7A 4K8XA 1VQ5N 5JLFA 4LFBK 1BO5O 4Z94A 5LL6Z 3NH1A 3CCJN 3DLGA 5AFUH 3HPGA 1QQMA 4HUEA 3WNGA 3G25A 4DV2K 2QEXN 4PKGA 3AA4A 5HRSA 4K42A 4KHQA 5JMVA 1RT4A 4X66K 4BR5A 4KHNA 3VTIA 4CJ7A 3OJSA 2E2OA 3T69A 1HKBA 3HRGA 4FWNA 3KLIA 1L3SA 2QWRA 4OJRA 4CD3A 4OPAA 3LDNA 2A1SA 4B1ZA 3RRGA 1BCOA 1HNIA 5FPMA 2RE2A 5LY3A 3D0PA 2LSNA 2W6LA 3O3HA 4CK1A 1NK8A 5KPTA 5KTQA 1GLDG 2KW4A 1OH5A 3A2FA 1ATSA 1J53A 4JI3K 4DQSA 4B9TA 1DLOA 4OLAA 4DMNA 4J2DA 1MWKA 2D4WA 2WBNA 4ZTFA 3NGZA 3RR8A 1CZAN 2YNGA 1MA9B 2PYJA 3KWGA 1GLAG 3D6RA 3RVCA 3GBTA 3DLEA 1UAXA 2BDPA 4YDUC 4Z4IA 3TAPA 1B9DA 2Z1JA 4K41A 1EWRA 1BL3A 1WSIA 2IOCA 5GADP 2BH1A 2CGKA 4ISGA 2QA4N 4WFNL 3B8AX 4JRPA 2QM1A 4BC4A 1BI4A 3AVCA 3IDHA 2E2PA 4WQ4A 3OYEA 3F73A 3KJVA 4KV8A 1RTHA 2ZGYA 2VWJA 4ID1A 1DEJA 2YNIA 3ENOA 2ITMA 1BGXT 4H4OA 4CJSA 3VEYA 4DTNA 3SV4A 4JK8A 3JYTA 3QINA 4DB3A 2PYLA 1D9FA 3UKRB 1TKDA 3AA3A 4ID5A 3OTOK 1ZBFA 4OO1J 3MMVA 4M3UA 4O0IA 3M6GA 3LP1A 3KWIA 5AQJA 4HTUA 3V9ZA 2O8EB 4CJEA 3OYHA 2PBDA 4B9MA 4RW8A 4E7LA 5M1QA 4RW6A 4DUYK 1R59O 1NGIA 4ELUA 4JHDB 3SUOA 1J9AA 2FXUA 3RWUA 3LPTA 3K5MA 2X6NA 1HRHA 3EE8A 3E1YA 3CJ9A 2HHHK 1QQCA 1NJIO 2NRRA 3RMDA 4FZYA 1CZBA 3C6TA 1X3MA 1QTMA 4B3TK 4LD0A 1G15A 3VQAA 2KLAA 3L8BA 4DSJA 2P9SA 4DQ8A 4EZ6A 3S3OA 4JI5K 1RT5A 4F8RA 2Q0RA 2HHQA 3SYZA 4PWDA 3TSUA 3NE6A 1KFDA 1XQSC 1IJJA 1VK0A 3AVAA 3NHGA 2Q0UA 4M7YA 4Q5VA 4AHSA 4CEAA 1N36K 1IKWA 4JKEA 3IMXA 2D0OA 3HVTA 4L3QA 3WXIA 2NRXA 3U8XA 4BWMA 3NBPA 3UKUA 3NH0A 2OZMA 2X74A 1WBDA 1S9GA 5HRRA 2YHBA 4DTSA 3CCQN 1J54A 4CEBA 4FVUA 4KHPK 3H3NO 1SZ2A 1X9SA 3OYKA 1TKTA 3DRPA 1VQPN 5AZJB 3DYAA 5B8HA 2IGIA 3GDQA 2RPIA 4E19A 1EETA 1S6PA 2HW3A 4FPBA 2O8CB 3RSEB 1O1WA 1NGEA 1VSMA 4BR0A 3I56N 1BWFO 3HL8A 2QK9A 1VAZA 1K8AO 1Z26A 1HMVA 3LM2A 3J81O 4BROA 1LW2A 1RT7A 3Q7BA 1QSLA 2NUBA 4DSLA 4JKFA 5H1SQ 2ZD1A 1U45A 1NKBA 4MDAA 1IG9A 4ELTA 2YHWA 4MO5A 4CEQA 2P5GA 1RILA 3VA3A 3P39A 4BREA 2FC0A 1VSLA 4GY2B 2QWPA 1SV5A 5AZJA 4JRQA 5KPRA 4I9QA 1S3XA 1QSYA 1U49A 4E89A 3ZSRA 1P8ZA 1N6QA 5EVZA 1KD1O 1K6YA 4B1XB 3U9ZA 4CK2A 2DY4A 4JI6K 4BR2A 4O8KA 2FF3B 5CZ2A 2A5XA 1C0MA 5AZIB 3SJJA 3EY1A 1HNWK 3HPOA 3RRHA 2Y1JA 3QETA 4FK2A 1VQ6N 3KLGA 5F0XA 4PHTX 4DCHA 1BUPA 3ZSXA 1SKRA 1TL1A 4F2SA 4MQ3A 4YDUA 4CW7B 3CF5L 1VQ9N 4WQ5C 1RBVA 3PO4A 4EP4A 1NJYA 5D3GA 5E41A 4BRMA 4IFYA 1VRTA 2WTUA 1U2VA 1TKZA 4CGDA 1FKOA 4FWLA 4AHVA 1BIZA 1ATRA 1K9MO 3O5BA 2NRVA 2ZE2A 3MCAB 4W5NA 3SQ1A 4Z4FA 2A3ZA 5AQKA 4GMJB 2P51A 1WSJA 3BP8A 2Q2RA 5FLXO 1MDUB 3OYMA 3K5NA 3TAGA 3S3NA 1HQEA 1HNVA 4KB1A 5HROA 3HK2A 1KVAA 4KI6A 3CQYA 1QVGM 1OKJA 3P38A 3VGLA 3V81A 2UUBK 3CFOA 2HSTA 5DMRA 3OS1A 3CPEA 4H4MA 2DFHA 1HX1A 4CEEA 1EWQA 5J2MA 2EHGA 1W7AA 4LF6K 5FRNA 4DTUA 5C24A 4C8LA 4KH6A 3HM9A 4FJXA 1TL3A 4FK4A 4B9SA 2O4IA 4IZ9A 4BR9A 4H0YB 4C23A 4ICLA 3G71N 3CI5A 1VSKA 4GV3A 3ZLJA 3VF4A 1U04A 3LZJA 4FM0A 2B4JA 2NRTA 4CESA 4FXDA 5DK5A 1WN7A 1NG9A 4E3SA 2YCHA 4AHUA 3DXMB 4BRLA 3VERA 3CC4N 4OPHA 3AO3A 4H5RA 3NCIA 1JLBA 1JL2A 3CD6N 4BRHA 3CMEN 3ZETB 3D45A 5KQ8A 3TTDA 2F9WA 1NK0A 4PY5A 4ILGB 1KFSA 3VTHA 2OTLN 2RKIA 3BUZB 5GAHP 2DPNA 2IDOA 1REVA 1SUQA 3PO5A 3HOTA 4ISFA 4Z4HA 3HSCA 5AR0A 4WFBL 4XIUA 3HT3A 4DF8A 1OH8A 4M63C 2GEMA 3KLEA 4BC3A 4J8FA 3THWA 3CJAA 4NLBA 2UUCK 5I9EB 1JXEA 1ZBUA 3AO2A 4N47A 2G8WA 1ZBIA 1YAGA 5KQDA 3LAKA 3QBWA 4MO4A 2P9IB 1HR0K 2OA8A 4DV4K 1T03A 1XHZA 4BRQA 3P5JA 1KC8O 3O1WA 3O08A 4LF7K 3WEEA 3ZT0A 3FZLA 5M1NA 3K0SA 3TSQA 1R0AA 3DXKA 3CQXA 2YHYA 4YOXA 3P31A 1NK7A 3OYDA 3HSTB 4JKGA 3QEPA 1L3VA 3THYB 4I2QA 2YNFA 2ITGA 4CJ5A 2OZSA 3V6DA 1W2BM 3SPYA 3V9WA 1JL1A 4FPAA 5J2PA 4CE9A 5I42A 3WXJA 4KI4A 1ZYQA 4JKAA 3M8SA 1F21A 3U4LA 3FZFA 4YOWA 3O4NA 4I6MB 2G8UA 1IBMK 3C65A 5ELZA 4DU1A 3TABA 4EZ9A 1DKGD 4XH1A 4CJLA 4CZIA 3LP3A 1OH7A 1EP4A 1T6CA 1BHLA 1JKHA 3DAWA 3WNEA 2QKBA 5AQFA 4J2AA 4CZGA 2HMPA 1SL2A 2O8FA 2HHVA 3O9SA 3C0BA 1S1TA 1BCMA 4ZHRA 5C0YA 5HL7L 3VEVA 1GOBA 3SQ4A 4FSVA 3ZT2A 1D9DA 1JXBA 3SNNA 1VRUA 3VETA 1NKCA 4C1NI 1IG8A 4PKIA 1ZBHA 1GLEG 4BRPA 4UQGA 2VQEK 4N5SA 5GAGP 1JLFA 1KQSM 5EXWA 4YOVA 3ASMA 4BGAA 4NXMK 4CI6A 3RMBA 3VA0A 5ADXA 2D0CA 2GWKA 2ZJRL 2BUPA 1NGGA 3BF3A 3CIPA 2YKMA 5M1KA 1A5XA 2ZWHA 4EHUA 4FL9A 5E26A 3EYZA 4O0JA 3D2EB 4CJFA 1N8RO 1M90O 3G0ZA 3MECA 4H5VA 2Q36A 3VQPA 3SLCA 3OYBA 1NOYA 1S72N 3HOSA 2HHXA 2UXDK 1BG3A 3K58A 1RDCA 4O44A 3J7YP 4C8MA 3AVGA 3OYJA 3AVBA 2O8CA 3LPUA 1HUXA 3U3YA 4YOTA 1L3UA 4OKJA 4NCGA 4CZFA 2D0PA 4JI4K 3VF2A 3RMAA 1Q82O 4Z4CA 4OX9K 3HBTA 2IC3A 3OYCA 2GWJA 4Q0BA 3VEXA 4IOXA 3EN9A 3TR8A 2D1KA 5AQMA 4JKGB 4JKHA 4KTZA 3PX6A 2FBTA 3SV3A 4M3XA 3HM8A 3QB0A 3LM9A 2O8BB 2J4RA 4CF2A 4OLBA 4B1UB 1Y97A 5M1FA 4CERA 2JWKA 3QFUA 3PSFA 4CEZA 3A5OC 4CEDA 1DTTA 3OBWA 1Z05A 1LW0A 4ELVA 2HNYA 5AJ3K 4CZKA 2CGJA 1NKEA 3QICA 3P1GA 3L2UA 3J7AP 4CBXA 2E2QA 2I5JA 5GAEP 4HUFA 2JLEA 2YKNA 3F2KA 1CXQA 2P9SB 4H0TB 2P9PB 3T7ZA 3K2PA 1YXQA 1HPZA 4DTMA 3SI6A 1S1XA 5JLHA 4EIAA 1LV5A 4JD2B 4R5PA 3LAMA 4AQYK 3PX0A 1OH6A 3MN9A 1KCFA 3C94A 4CJTA 4CZMA 3OYGA 3ATUA 1XMOK 4FWSA 2X6SA 2CH6A 4CFAA 1RBUA 2RHKA 3AA5X 4M3YA 3OYIA 1JLQA 3TPQA 2Q1NA 4DU4A 3VGMA 2DFFA 4IWVA 1IH7A 4JNEA 2GUPA 5BRFA 3CETA 4BDZA 3CJ1A 1BA1A 4ILJA 4OKKA 1EXQA 3SQ0A 4FJMA 1JLCA 4FJ8A 3VQ7A 3G10A 4DR5K 1RT3A 3SPZA 3WXMB 4JKDA 4FJ7A 3MX2A 3KK7A 4A5BA 2E6MA 3CYMA 3I8BA 4LH4A 1NK5A 1RDAA 4C8KA 3O9TA 2ZF5O 1NGAA 3ULDA 3V4IA 2ZJPL 4IJAA 4G9ZA 4B3SK 2QW9A 1WOQA 4DFJA 4H0OA 3CCUN 1HYZA 3R9PA 3IS9A 3O1BA 5C15A 2Z1HA 3HP6A 4BGBA 1KXPA 3J7ZO 3FGUA 2F96A 3N4QA 4OPKA 1D4XA 1TK8A 4CZLA 3CFPA 1UWBA 3FFIA 4I2PA 3ISNC 1X9WA 3EO3A 3BZKA 1V4SA 2QWQA 4B3OA 1D8YA 1HJRA 3MK6A 3NVMA 2GUIA 3UKUB 4IFVA 3CC2N 3DXKB 5JS2A 5FRMA 3F9KA 1O13A 4WQ4C 2EX3A 3AVIA 5T7BA 3U9DA 1GLCG 3K59A 2HVIA 4M45A 3LDPA 4FJIA 2WFBA 2OYQA 3L2WA 2YJEA 1M1KO 2Z1GA 1LAWA 2PY5A 4RCHA 4C8OA 4GNIA 4JI1K 2IS3A 1YITN 1LWCA 1Z25A 4FJJA 2QTDA 1RTDA 2UXBK 3FR0A 4NLCA 1XMQK 5HOOA 5GIPA 1VSHA 4BC2A 4V19S 3HVRA 3DLKA 1NMDA 4O8UA 5F1XA 3NGIA 1XNRK 5HLFA 2HNZA 3O4WA 4HCBA 4EHTA 4IBNA 4H0XB 3SBGA 5EY4A 3THYA 3U3GA 1NK9A 2XY5A 4ZTJA 1QS4A 1JCGA 2P9NA 1D5AA 3HZ6A 4IOAL 1EQYA 1ZXOA 3O80A 3A8YA 4YOYA 4PUOA 3MXJA 5HRNA 3D7EO 3CCVN 3WUHA 1S22A 1HKGA 3HI0A 3WEEB 4YNQA 4CK3A 3AVLA 3PX4A 2G8HA 1WSGA 3THXA 1SKSA 1TVRA 5KRSA 3VEZA 3MEGA 1IBKK 2FBXA 3IFRA 4LF4K 1W0HA 3E66A 2Y1IA 1BI4B 3R8EA 1T05A 3UIQA 3L0QA 1J5EK 1P90A 1ITGA 4C1NK 3CMAN 1ASUA 1FXXA 4WE1A 1X1PA 4BR7A 1NM1A 4B9LA 4AM7A 4B9UA 4AHRA 1WUAA 3ZX2A 3QEVA 4KHUA 1I39A 3LWMA 1YHQN 1BU6O 1WSEA 3A5NC 3I0SA 3R1XA 3SJHA 1B92A 4B1VA 2ZM6K 3KVGA 1T6DA 3CJCA 3CM5A 4DS5A 3CXCM 3G6EN 4FOIA 4LF8K 3F9MA 1YVUA 2Q97A 1RFQA 3AARA 1QSSA 2FSKA 3VQQA 4DV6K 2NRWA 4FWOA 3QMLA 2WC9A 2FSNA 1WB9A 3KK3A 2YX6A 4JK7A 4CF1A 5J1EA 4CCHA 3ZEUA 3MXIA 3T19A 5FPEA 2P9UB 4QCLA 3MEEA 4I7FA 4B1WB 1RDBA 3ZSOA 4A62A 1X9JA 4CJ4A 5KGXA 1VQKN 4J2EA 1J6ZA 4BDPA 3DI6A 3HYFA 4Y0WA 4KREA 2D0BA 3H45C 4FLXA 4FJLA 3P4IA 5AQYA 3ULEB 3KK1A 3M8PA 3C7NA 1ZBLA 4GW6A 1RBRA 1JCFA 3BZCA 4X64K 5AQWA 4DR3K 2KZMA 4E1MA 3AGRA 3EKUA 4FM1A 4BRNA 5BRDA 2P9NB 3U6FA 5A2QO 1E3MA 4FJGA 4LSNA 1QE1A 4I6MA 3MAQA 1NGBA 1KAYA 2BE2A 4CBWA 1H1VA 3L4IA 3TTCA 4DWIA 4IEEA 3FFKB 2VWKA 4ISEA 1YT3A 3TAFA 3ALYA 3VEWA 1IV0A 4DV1K 2PZSA 1RBTA 3A0IX 4XH4A 3I0RA 4CECA 3CJ7A 3LANA 3CG7A 1VQ8N 1JCEA 4N41A 1E4GT 1WNSA 3VQ8A 3OS0A 1SL1A 1HQUA 4FWPA 5ADXH 4DUZK 5AQTA 2P9IA 2AP1A 4DTOA 3VQBA 3DRRA 4JS5A 4B1YB 1U48A 3DRSA 4H03B 5KI6A 3VQDA 4EP5A 2QKKA 4H8KA 4CJRA 3ENBA 4BVOA 1T8EA 4CJPA 2D5RA 3SCXA 1K8KB 4U7BA 3L2VA 1CZ9A 3AO1A 2E20A 5E84A 3ZT4A 4XH5A 1T7PA 3V1RA 2IVPA 2VYPA 3CJBA 5C42A 3H1VX 2NLXA 4JD2A 1IKVA 3OYLA 4CF8A 4B3MK 4W5TA 3NF6A 4CFDA 1ILYA 4Y1CA 4DR7K 4BRKA 4IXCA 4FLZA 2GELA 3TAQA 4GV9A 3PUFA 3T1HK 2V52B 3V1OA 2UUAK 2VG7A 1HNZK 4J2BA 2B6AA 3D2FB 4CJWA 4FWQA 2W42A 4DFMA 4OVLA 2P5OA 4Z4GA 1C6VA 1LAVA 3CCLN 4CJVA 4BRFA 4FJ5A 1N32K 1TUUA 4BR4A 3H3OB 1C0GA 4KH4A 4C8NA 1TGOA 1YTAA 1FK9A 4CF0A 1W97L 3OHRA 4BE0A 3DLHA 4CEOA 4X62K 3TI0A 2RN2A 5J2NA 2QWMA 3EEQA 3ZSVA 2WUSA 1WSHA 1FKPA 1QZ6A 3W0LA 1KAXA 3LL3A 3VQ4A 1BOTO 4CIFA 4RW4A 3TWHA 3VQCA 2O8DB 3ZYYX 4B8AB 3OYNA 3LZIA 4E0DA 4O5BA 2HHUA 3MXMA 3M1FA 1IKYA 1ASVA 4H5NA 3GL1A 4HVJA 3K9KA 1HLUA 4UY8O 4N76A 2KKZA 4W5QA 2XY7A 1G99A 4QS8A 4F3OA 1WBBA 4FW2A 1NBWA 1UOCA 4YOUA 1C0FA 1TV6A 4CHPA 3THWB 1ZC6A 2HMIA 4H5WA 3KK2A 2KTQA 4BRAA 3B6OA 3MCPA 3NAEA 1VQMN 3SUPA 2OPRA 3D2EA 4TSXA 4BWJA 1KLMA 1WAJA 1KRPA 2HB5A 4FWMA 5JICA 4B9QA 3QNOA 2P9LB 1HYVA 1I94K 4LY7A 5KGWA 3TU5A 2FSJA 3K9JA 4A5AA 2VG6A 2OANA 1YIJN 4PA1A 2ZGZA 4M7XA 3SAHA 3ZT3A 3NVKA 1V4TA 2QWNA 3WNHA 4IG0A 5CYQA 5M1PA 5LMUK 3UKRA 5BR8K 3CHWA 5AQHA 3EZ5A 1RGIA 4MLEA 5C25A 3THVA 1HYSA 1GOCA 5DM6L 3L4QA 3AO5A 2I7NA 1Q7YO 3I55N 4DTJA 3O4QA 4CHOA 3QNNA 3C95A 3GOIA 1TKXA 4IG3A 4RWTA 2XY6A 2P1JA 1A5VA 3P83D 4FOEA 4IKFA 3LDLA 3O6WA 4CGIA 2E5LK 4KPYA 4FZZA 2YHAA 5FPNA 3KLHA 3AVFA 4FVMA 1C1CA 1N33K 1RT2A 2YJFA 1T44A 1HJOA 1VQ7N 1RDDA 4KHYA 3NF9A 3O3FA 3BY5A 2DTUA 5J2QA 5C2DA 4CBUA 3EZWA 4JK9A 2FF6A 1UA0A 2E4LA 4EAHD 4KHSA 1I3AA 2BANA 4FLUA 4AHTA 1S1WA 1YTUA 3DOKA 1U47A 4QS9A 4NCAA 3NFAA 3KKSA 3WXLA 2HBKA 2Q3SA 3QFPA 4KB0A 3OW2M 5TKYA 1NGDA 4KKOA 4PQUA 2Q31A 1ESVA 3DWLA 2KQ2A 5CHIA 4BQZA 4YORA 4JN4A 5AQXA 3OA9A 2QXFA 4FO0A 2O4GA 1NK6A 3C6HA 3PY8A 5C12A 3I33A 1DTQA 3K5OA 3L2QA 2H3GX 3AY9A 1YJWN 2E8AA 3QDKA 4BC5A 2P9PA 3G4SN 4CHQA 5LJVA 4I9LA 1RDUA 1KAZA 1RT6A 4DS4A 3HTVA 4BVPA 3EKSA 2YHXA 2XY8A 3E9PA 3QEXA 4B08A 5KPZA 2VQFK 1NU0A 4DFPA 4FW1A 4MLHA 4JI0K 1T3VA 2HBLA 1MU2A 1XWLA 1IO2A 3OBYA 2ASOA 3VEOA 3H46O 3L3VA 5C2FA 4B9NA 3KIOA 1XNQK 3TAEA 3OJUA 4FJHA 3BF1A 1GLBG 3O9QA 5AQSA 5FPDA 2UXCK 1GLLO 3ZSQA 2JGUA 1TYQA 4KTWA 4DSFA 3JXUA 3F5TA 4IDKA 5JVHL 4M3TA 3ID8A 1BIUA 4E7HA 4DQPA 4BE1A 4CJ3A 4JEPA 3K5LA 5JVGL 5BREA 5FROA 4NB4A 3SAGA 4QS7A 3ULEA 1NMNA 2F7TA 4CGJA 2HHTA 4PL8A 1UA1A 4QOZB 4WCEL 4JS4A 4HHTA 4BY9C 3D2FA 3QEWA 4RW7A 4BQLA 4H0VB 1BQNA 3AVKA 1EX4A 4G1QA 3KZBA 2E1ZA 5C10A 3HJFA 5IT9O 2GX9A 1LWFA 3ZX3A 4CGGA 4GKJK 3GE1A 4M3RA 3E9OA 1NGHA 4A61A 3WQUA 4FJKA 3SAFA 4FM2A 3TAMA 4FLWA 2HVHA 1WSFA 1SQKA 4FCYA 3ZETA 4LF5K 3EE9A 3PIOL 4LSLA 3LDOA 2HOEA 3DJCA 1Y64A 1K8KA 3AVMA 4A2BA 3OYFA 1B9FA 4IEIA 1NOZA 5CZ1A 2W6KA 3NGYA 3CPWM 4GVEA 3NF7A 3MEDA 1SAZA 3MWPA 4DQRA 4JI8K 1KVBA 4F2RA 1Q86O 4M3ZA 1S6QA 2E6LA 3JSMA 3AAPA 4AH9A 1WAFA 2P9KA 3A5MC 4LFAK 4O4GA 3W3DA 4KHWA 3FZKA 2VCPA 2YNHA 3VQ6A 4WF9L 4WYBA 4LC9B 3VQ5A 1N5YA 2UYTA 5K14A 1C0UA 1S1UA 2KZZA 1NLVA 4CVNE 3J8AA 4AM6A 4K0KK 1QQNA 1BDGA 2V7ZA 2ZQBA 4OKEA 5AQOA 5SWMA 1GLFO 3LWLA 3IKMA 2G8VA 1TYQB 4CHNA 2PAVA 4FWKA 1C1AA 1S9EA 5GIOA 2CGLA 1XC9A 1CLQA 4DG1A 1KVCA 2ETJA 2FLOA 4DFKA 5AQGA 4YFUA 1C0TA 1XC3A 3FZHA 4CHZA 4F9OA 1J5OA 3SUNA 3MX5A 2E88A 2G8KA 3ATVA 4FK0A 1L3TA 4L8RB 4DQIA 3E01A 4CJKA 2HBJA 5SZTA 3EL2A 3VENA 2V7YA 5AFUA 1Q8IA 2A42A 3T1AA 1KLNA 3RMCA 2BGGA 2G8IA 3CC7N 1K73O 3B6PA 4Z4EA 4FWRA 3UB5A 2KFNA 4DTPA 4DV7K 4FJ9A 3BDPA 2HBMA 1IKXA 4KBOA 3L2RA 4CIEA 5BPMA 4X65K 4BACA 1BISA 3QERA 4YHHK 1YJ9N 1VSJA 1VQ4N 4IO8A 2GTDA 3KKRA 1RBSA 4U67L 1RDWX 5F2RA 4JI7K 3KLFA 3C6AA 1YVNA 4KTQA 2E1YA 3PV8A 2WONA 4DV0K 1ZBSA 2RF2A 3LP0A 2OPSA 1Q9YA 2F8TA 2FBVA 1NJXA 4KAZA 2OPQA 4DV3K 1XHXA 2HNDA 1XUPO 4LH5A 1NJWA 3MDQA 3VQEA 3E9LA 4DU3A 4M3WA 4CJUA 2O8FB 4JI2K 3PIPL 3ID6A 1LCUA 4K8ZA 4IDHA 1Q9XA 2A41A 4O55A 3QLHA 3V9SA 1BQMA 3S9HA 2V51B 1OVYA 3CCEN 1VSDA 5AQNA 3WXKA 2R7YA 4DSIA 3I8DA 5AQQA 4BG8A 4FLVA 4CEFA 4IO9L 2OPPA
chains in the Genus database with same CATH topology
1C6VA 1LAVA 2YNIA 4DTXA 4CJVA 4CGHA 3RMAA 4DSKA 4FJ5A 4Z4CA 4FYDA 1BGXT 4H4OA 4CJQA 1RTJA 2IC3A 3OYCA 4CJSA 4C8NA 4DTNA 3SV4A 1TGOA 3JYTA 4Q0BA 1YTAA 1FK9A 4CF0A 3QINA 2PYLA 1JLGA 1D9FA 3TR8A 4BE0A 1TKDA 3DLHA 3AA3A 2YV0X 4ID5A 4CEOA 1ZBFA 2WOMA 3TI0A 1TK0A 2RN2A 5J2NA 4W5OA 2A1RA 4M3UA 4O0IA 4KTZA 3ZSVA 3PX6A 4GVMA 2FBTA 3SV3A 4M3XA 1WSHA 3LP1A 1FKPA 4E7KA 4HTUA 3V9ZA 4DSEA 4OKJA 3V9XA 4CJEA 3OYHA 3LDSA 3VQ4A 3SQ2A 4B9VA 4CIFA 4B9MA 5HBMA 4RW8A 3QEIA 4CF2A 4OLBA 4RW4A 3TWHA 4E7LA 1Y97A 3VQCA 4RW6A 4CERA 4B8AB 3OYNA 4ELUA 4CEZA 3SUOA 1VSIA 4CEDA 3DLBA 1J9AA 3LZIA 2GV9A 1DTTA 4E0DA 3RWUA 3LPTA 4O5BA 2HHUA 3K5MA 3MXMA 1IKYA 1ASVA 2X6NA 3DOLA 3WNFA 1CXUA 1HRHA 4HVJA 1LW0A 4ELVA 4N76A 1QQCA 3RR7A 2HNYA 4FZYA 3RMDA 4W5QA 4E7IA 2XY7A 1CZBA 3AA2A 3C6TA 1NKEA 1QTMA 4N56A 4F3OA 1JLAA 4FW2A 4LD0A 1G15A 1UOCA 3P1GA 3VQAA 3L2UA 4FZXC 4KRFA 3L8BA 2I5JA 4DSJA 3VN5A 4HUFA 1TV6A 4EZ6A 4CHPA 3S3OA 2JLEA 2YKNA 3O3GA 1RT5A 2HMIA 4F8RA 3KK2A 2KTQA 1W9HA 1KSPA 1CXQA 1VSFA 3B6OA 3SYZA 2HHQA 3K2PA 4PWDA 3NAEA 3NE6A 1KFDA 1VK0A 3SUPA 2OPRA 1HPZA 3AVAA 4TSXA 4BWJA 3NHGA 4DTMA 3SI6A 1YTUA 1S1XA 1KLMA 4Q5VA 1WAJA 3CQ8A 1KRPA 2AJQA 1LV5A 1C1BA 2HB5A 4DQQA 4AHSA 4CEAA 4R5PA 2X78A 3LAMA 3QNOA 3KTQA 1IKWA 1HYVA 3PX0A 4LY7A 5KGWA 3HVTA 1SKWA 1KCFA 4AHCA 5JS1A 3C94A 4BWMA 3NBPA 2VG6A 4Z0UA 4CJTA 3OYGA 3NH0A 2OZMA 4PA1A 5HRPA 1L5UA 2X74A 3ZT3A 1S9GA 2X6SA 5CY4A 2YHBA 1RBUA 3AA5X 5HRRA 4CFAA 3OYIA 4DTSA 1JLQA 4M3YA 1J54A 3WNHA 4CEBA 4IG0A 4DU4A 5CYQA 2DFFA 1TK5A 1IH7A 3QIPA 3ZSWA 4BDZA 4FLTA 3EZ5A 4OKKA 1EXQA 4KO0A 3SQ0A 1X9SA 4FJMA 3OYKA 1TKTA 4HUGA 1JLCA 4FJ8A 5C25A 3DRPA 3V1QA 3VQ7A 3HXMA 3THVA 3G10A 1HYSA 3DYAA 1GOCA 2IGIA 3NF8A 1RT3A 3SPZA 3AO5A 2RPIA 4E19A 4FJ7A 3QIOA 4BE2A 1EETA 1S6PA 4DTJA 2HW3A 3O4QA 4CHOA 2HHSA 2E6MA 3C95A 1O1WA 3CYMA 1VSMA 3DMJA 2XO7A 3QNNA 1TKXA 4IG3A 4LH4A 1NK5A 1RDAA 4C8KA 3HL8A 3HP9A 4DLEA 2QK9A 1NJZA 1WLJA 2XY6A 2P1JA 3ULDA 3V4IA 1Z26A 4RG8A 1HMVA 1A5VA 3P83D 3TARA 4IKFA 4KHYA 4CGIA 1LW2A 1RT7A 4DFJA 2D0AA 4KPYA 4FZZA 1QSLA 2YHAA 3AV9A 3KLHA 2NUBA 4DSLA 1U45A 1NKBA 2ZD1A 3AVFA 4ELTA 1IG9A 1HYZA 4FVMA 3IS9A 1C1CA 2Z1HA 4CEQA 1RILA 3HP6A 1RT2A 3RTVA 3VA3A 2P5GA 3M8QA 4CIGA 2G8FA 3H08A 1RDDA 1VSLA 2FC0A 4NCBA 2F96A 4OGEA 4OPKA 3AO4A 3NF9A 3OVNA 1SV5A 5CYMA 3O3FA 2XHBA 3CFPA 1TK8A 2KFZA 4CFCA 2DTUA 5KRTA 3CFRA 4JRQA 5J2QA 4I9QA 1UWBA 3CM6A 3FFIA 4I2PA 1QSYA 1U49A 4E89A 3ISNC 3ZSRA 1X9WA 1N6QA 1UA0A 2E4LA 4KHSA 1I3AA 1K6YA 2BANA 2FBYA 1S1WA 4AHTA 3DOKA 4FLUA 3T3FA 4CK2A 1U47A 2DY4A 3QESA 4NCAA 3NFAA 4CF9A 3KKSA 4B3OA 1D8YA 2Q3SA 1HJRA 3AVJA 3LP2A 4KB0A 4OPJA 5HP1A 4NYNA 2GUIA 5CZ2A 3SUQA 4IFVA 4KKOA 1C0MA 4PQUA 1GOAA 3SJJA 5JS2A 5FRMA 3F9KA 2VG5A 2B5JA 2KQ2A 2EX3A 2GBZA 3EY1A 3AVIA 5T7BA 3HPOA 3RRHA 2Y1JA 3QETA 3K59A 4FK2A 2HVIA 3KLGA 2IAJA 3ZT1A 3ZSXA 4M45A 4BDYA 3SZ2A 4FJIA 1SKRA 1TL1A 2QXFA 4MQ3A 2OYQA 4F2SA 3L2WA 2O4GA 2Z1GA 1LAWA 1RBVA 1NK6A 2PY5A 3PY8A 4C8OA 4QAGA 3PO4A 4EP4A 1NJYA 1DTQA 3K5OA 3L2QA 5D3GA 5E41A 4DTRA 2IS3A 4IFYA 1VRTA 3KD5E 3OY9A 1QHTA 1LWCA 4CHQA 4I9LA 1RT6A 3K57A 1TKZA 4CGDA 4DS4A 1FKOA 1Z25A 4DF4A 1LWEA 2Z1IA 3L3UA 4CGFA 4AHVA 1BIZA 2XY8A 4FJJA 3QEXA 4B08A 2ZE2A 3S3MA 4DFPA 1RTDA 4W5NA 3LALA 3SQ1A 4Z4FA 4FW1A 1VSHA 4GMJB 2P51A 1WSJA 3TAGA 3HVRA 3K5NA 3OYMA 3DLKA 3S3NA 1MU2A 1HQEA 1XWLA 1IO2A 1HNVA 4KB1A 4QCLA 3NGIA 5HROA 5HLFA 3HPHA 3HK2A 1KVAA 3L3VA 2HNZA 4KI6A 4B9NA 4HCBA 3KIOA 4E1NA 1RNHA 4IBNA 3V81A 2HHWA 3TAEA 3OJUA 3CFOA 4FJHA 5DMRA 1JLEA 3U3GA 3OS1A 1NK9A 2XY5A 4ZTJA 4H4MA 1QS4A 3ZSQA 2JGUA 2DFHA 4CEEA 1D5AA 5J2MA 2EHGA 4KTWA 4F4KA 4DSFA 4B8CA 4IDKA 5FRNA 4DTUA 4PUOA 3MXJA 4M3TA 5C24A 5HRNA 5I3UA 1BIUA 4E7HA 4C8LA 4DQPA 4M42A 3OYAA 3HM9A 1S1VA 4CJ3A 4BE1A 4FJXA 3K5LA 3OS2A 1TL3A 1XI1A 4YNQA 4CK3A 4FK4A 3AVLA 3PX4A 2G8HA 1TAQA 1WSGA 4Y1DA 5FROA 3V9UA 4B9SA 2O4IA 4CFBA 1SKSA 1ASWA 1EKEA 1TVRA 5KRSA 3MEGA 1TAUA 4KFBA 4CGJA 2FBXA 4ICLA 3AVHA 1UA1A 1W0HA 4QOZB 1VSKA 2HHTA 4JS4A 4HHTA 2Y1IA 1U04A 1VSEA 3VQ9A 1BI4B 3LZJA 4FM0A 2B4JA 1T05A 3UIQA 3QEWA 4CESA 4FXDA 3C6UA 5DK5A 1RTIA 1WN7A 4RW7A 1NK4A 4E3SA 1BQNA 1ITGA 3AVNA 4AHUA 3AVKA 1ASUA 1EX4A 4E7JA 4G1QA 4M41A 3AO3A 1FXXA 2ATQA 1X1PA 4WE1A 1JLBA 4OGCA 3NDKA 3NCIA 3HJFA 1JL2A 1LWFA 4B9LA 4CGGA 3IRXA 4W5RA 4B9UA 4AHRA 4HCCA 4KHUA 3QEVA 4M3RA 3D45A 3ZCMA 1I39A 3LWMA 1RCHA 3I0SA 1WSEA 1NK0A 4PY5A 5EU7A 3M8RA 1B92A 4FJKA 3BGRA 4RW9A 4FM2A 1KFSA 3IAYA 3HO1A 3TAMA 2F8SA 3CM5A 3ZSYA 4FLWA 4DS5A 2HVHA 3TANA 1WSFA 2RKIA 4FCYA 3KD1E 1YVUA 2IDOA 1REVA 4LSLA 2DFEA 1U4BA 1QSSA 4NYFA 1SUQA 3PO5A 3VQQA 4CHYA 4Z4HA 3AVMA 2XRIA 3OYFA 4F3TA 4XIUA 3HT3A 4DF8A 1B9FA 3DM2A 1NOZA 3NGYA 5CZ1A 3KLEA 3KK3A 4CF1A 5J1EA 4CCHA 3NF7A 1JXEA 1ZBUA 3AO2A 3MEDA 3T19A 4N47A 4DQRA 1KVBA 1KTQA 3MEEA 3MXIA 2G8WA 4I7FA 4F2RA 4M3ZA 1S6QA 1ZBIA 1RDBA 3DLRA 3ZSOA 4J2EA 2E6LA 4CJ4A 5KGXA 3JSMA 4BDPA 4AH9A 1WAFA 3DI6A 3HYFA 4KREA 3LAKA 2D0BA 4O4GA 4FLXA 4KHWA 1RT1A 3IG1A 2YNHA 4FJLA 3VQ6A 3VQ5A 3M8PA 3KK1A 4DLGA 1N5YA 5K14A 1A5WA 1C0UA 3NH2A 1ZBLA 1S1UA 1SL0A 3QO9A 1T03A 1XHZA 4GW6A 3P5JA 1RBRA 4FLYA 1X9MA 2KZZA 4MFBA 3ZT0A 3ZSZA 1S5JA 5SWMA 2ZQBA 4OKEA 1R0AA 4E1MA 2KZMA 5FDLA 3ITHA 3LWLA 2G8VA 4JLHA 4AILC 4FJNA 4FM1A 1NK7A 4CHNA 3U6FA 3OYDA 4K8XA 3HSTB 1C1AA 3QEPA 1L3VA 4FJGA 4LSNA 1S9EA 1QE1A 4I2QA 2YNFA 2ITGA 4CJ5A 3MAQA 1XC9A 3NH1A 1CLQA 2BE2A 4DG1A 2OZSA 3V6DA 3SPYA 1KVCA 3V9WA 3DLGA 2ETJA 3HPGA 1JL1A 4DWIA 4DFKA 4YFUA 4HUEA 1C0TA 3WNGA 4CHZA 1J5OA 3SUNA 2VWKA 4CE9A 5J2PA 5I42A 2G8KA 4FK0A 4KI4A 1ZYQA 1YT3A 3M8SA 3AA4A 3TAFA 3ALYA 5HRSA 1L3TA 1F21A 2PZSA 4L8RB 4DQIA 4KHQA 3E01A 3O4NA 4CJKA 1RBTA 2G8UA 3I0RA 5SZTA 1RT4A 4NCGA 4KHNA 3OJSA 4CECA 3LANA 4DU1A 1Q8IA 3TABA 4EZ9A 3T1AA 3CG7A 1KLNA 3RMCA 2BGGA 2G8IA 4N41A 3KLIA 3B6PA 4Z4EA 4CJLA 3LP3A 1WNSA 3VQ8A 4OJRA 3OS0A 1L3SA 2KFNA 1EP4A 1SL1A 1BHLA 1JKHA 4DTPA 3WNEA 1HQUA 2QKBA 2A1SA 3BDPA 3RRGA 4J2AA 4FJ9A 1BCOA 1IKXA 1HNIA 1SL2A 4DTOA 3VQBA 3DRRA 3L2RA 1S1TA 4JS5A 2HHVA 4CIEA 1U48A 3DRSA 1BCMA 5KI6A 4ZHRA 4BACA 3D0PA 1BISA 3QERA 2LSNA 1GOBA 1VSJA 3VQDA 4EP5A 3SQ4A 3O3HA 2QKKA 3KKRA 3ZT2A 1D9DA 4CK1A 1JXBA 1RBSA 1NK8A 3SNNA 1VRUA 4H8KA 1NKCA 4CJRA 5KTQA 2KW4A 1T8EA 4CJPA 2D5RA 1ZBHA 3A2FA 3KLFA 1J53A 3SCXA 4DQSA 4B9TA 4KTQA 1DLOA 3L2VA 4OLAA 1CZ9A 4UQGA 3PV8A 4DMNA 3AO1A 2WONA 4J2DA 2RF2A 4N5SA 3LP0A 1JLFA 4ZTFA 3NGZA 3ZT4A 2OPSA 1Q9YA 3RR8A 2YNGA 3ASMA 1T7PA 2PYJA 2F8TA 2FBVA 1NJXA 3V1RA 3RMBA 4KAZA 2OPQA 3VA0A 1XHXA 3DLEA 2D0CA 2HNDA 1UAXA 2BDPA 4Z4IA 4LH5A 1NJWA 5C42A 3TAPA 3VQEA 4DU3A 4M3WA 1B9DA 1IKVA 4CJUA 2Z1JA 3OYLA 4CF8A 2YKMA 1A5XA 3EYZA 4O0JA 4CJFA 4K8ZA 4W5TA 3NF6A 4CFDA 1BL3A 4Y1CA 3G0ZA 3MECA 1Q9XA 4Z4GA 1WSIA 3VQPA 2IOCA 4O55A 3QLHA 4FLZA 3V9SA 1BQMA 3OYBA 3S9HA 3TAQA 1NOYA 2HHXA 3PUFA 1VSDA 3V1OA 3K58A 2VG7A 4JRPA 2OA8A 4J2BA 1RDCA 2B6AA 4O44A 4C8MA 3AVGA 1BI4A 3AVCA 4CJWA 3AVBA 3OYJA 3OYEA 2W42A 2R7YA 3I8DA 3F73A 3KJVA 4KV8A 4DFMA 4DSIA 4FLVA 3LPUA 4OVLA 1RTHA 4CEFA 3U3YA 2P5OA 2VWJA 1L3UA 4ID1A 2OPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C6V A;  1LAV A;  2YNI A;  4DTX A;  4CJV A;  4CGH A;  3RMA A;  4DSK A;  4FJ5 A;  4Z4C A;  4FYD A;  1BGX T;  4H4O A;  4CJQ A;  1RTJ A;  2IC3 A;  3OYC A;  4CJS A;  4C8N A;  4DTN A;  3SV4 A;  1TGO A;  3JYT A;  4Q0B A;  1YTA A;  1FK9 A;  4CF0 A;  3QIN A;  2PYL A;  1JLG A;  1D9F A;  3TR8 A;  4BE0 A;  1TKD A;  3DLH A;  3AA3 A;  2YV0 X;  4ID5 A;  4CEO A;  1ZBF A;  2WOM A;  3TI0 A;  1TK0 A;  2RN2 A;  5J2N A;  4W5O A;  2A1R A;  4M3U A;  4O0I A;  4KTZ A;  3ZSV A;  3PX6 A;  4GVM A;  2FBT A;  3SV3 A;  4M3X A;  1WSH A;  3LP1 A;  1FKP A;  4E7K A;  4HTU A;  3V9Z A;  4DSE A;  4OKJ A;  3V9X A;  4CJE A;  3OYH A;  3LDS A;  3VQ4 A;  3SQ2 A;  4B9V A;  4CIF A;  4B9M A;  5HBM A;  4RW8 A;  3QEI A;  4CF2 A;  4OLB A;  4RW4 A;  3TWH A;  4E7L A;  1Y97 A;  3VQC A;  4RW6 A;  4CER A;  4B8A B;  3OYN A;  4ELU A;  4CEZ A;  3SUO A;  1VSI A;  4CED A;  3DLB A;  1J9A A;  3LZI A;  2GV9 A;  1DTT A;  4E0D A;  3RWU A;  3LPT A;  4O5B A;  2HHU A;  3K5M A;  3MXM A;  1IKY A;  1ASV A;  2X6N A;  3DOL A;  3WNF A;  1CXU A;  1HRH A;  4HVJ A;  1LW0 A;  4ELV A;  4N76 A;  1QQC A;  3RR7 A;  2HNY A;  4FZY A;  3RMD A;  4W5Q A;  4E7I A;  2XY7 A;  1CZB A;  3AA2 A;  3C6T A;  1NKE A;  1QTM A;  4N56 A;  4F3O A;  1JLA A;  4FW2 A;  4LD0 A;  1G15 A;  1UOC A;  3P1G A;  3VQA A;  3L2U A;  4FZX C;  4KRF A;  3L8B A;  2I5J A;  4DSJ A;  3VN5 A;  4HUF A;  1TV6 A;  4EZ6 A;  4CHP A;  3S3O A;  2JLE A;  2YKN A;  3O3G A;  1RT5 A;  2HMI A;  4F8R A;  3KK2 A;  2KTQ A;  1W9H A;  1KSP A;  1CXQ A;  1VSF A;  3B6O A;  3SYZ A;  2HHQ A;  3K2P A;  4PWD A;  3NAE A;  3NE6 A;  1KFD A;  1VK0 A;  3SUP A;  2OPR A;  1HPZ A;  3AVA A;  4TSX A;  4BWJ A;  3NHG A;  4DTM A;  3SI6 A;  1YTU A;  1S1X A;  1KLM A;  4Q5V A;  1WAJ A;  3CQ8 A;  1KRP A;  2AJQ A;  1LV5 A;  1C1B A;  2HB5 A;  4DQQ A;  4AHS A;  4CEA A;  4R5P A;  2X78 A;  3LAM A;  3QNO A;  3KTQ A;  1IKW A;  1HYV A;  3PX0 A;  4LY7 A;  5KGW A;  3HVT A;  1SKW A;  1KCF A;  4AHC A;  5JS1 A;  3C94 A;  4BWM A;  3NBP A;  2VG6 A;  4Z0U A;  4CJT A;  3OYG A;  3NH0 A;  2OZM A;  4PA1 A;  5HRP A;  1L5U A;  2X74 A;  3ZT3 A;  1S9G A;  2X6S A;  5CY4 A;  2YHB A;  1RBU A;  3AA5 X;  5HRR A;  4CFA A;  3OYI A;  4DTS A;  1JLQ A;  4M3Y A;  1J54 A;  3WNH A;  4CEB A;  4IG0 A;  4DU4 A;  5CYQ A;  2DFF A;  1TK5 A;  1IH7 A;  3QIP A;  3ZSW A;  4BDZ A;  4FLT A;  3EZ5 A;  4OKK A;  1EXQ A;  4KO0 A;  3SQ0 A;  1X9S A;  4FJM A;  3OYK A;  1TKT A;  4HUG A;  1JLC A;  4FJ8 A;  5C25 A;  3DRP A;  3V1Q A;  3VQ7 A;  3HXM A;  3THV A;  3G10 A;  1HYS A;  3DYA A;  1GOC A;  2IGI A;  3NF8 A;  1RT3 A;  3SPZ A;  3AO5 A;  2RPI A;  4E19 A;  4FJ7 A;  3QIO A;  4BE2 A;  1EET A;  1S6P A;  4DTJ A;  2HW3 A;  3O4Q A;  4CHO A;  2HHS A;  2E6M A;  3C95 A;  1O1W A;  3CYM A;  1VSM A;  3DMJ A;  2XO7 A;  3QNN A;  1TKX A;  4IG3 A;  4LH4 A;  1NK5 A;  1RDA A;  4C8K A;  3HL8 A;  3HP9 A;  4DLE A;  2QK9 A;  1NJZ A;  1WLJ A;  2XY6 A;  2P1J A;  3ULD A;  3V4I A;  1Z26 A;  4RG8 A;  1HMV A;  1A5V A;  3P83 D;  3TAR A;  4IKF A;  4KHY A;  4CGI A;  1LW2 A;  1RT7 A;  4DFJ A;  2D0A A;  4KPY A;  4FZZ A;  1QSL A;  2YHA A;  3AV9 A;  3KLH A;  2NUB A;  4DSL A;  1U45 A;  1NKB A;  2ZD1 A;  3AVF A;  4ELT A;  1IG9 A;  1HYZ A;  4FVM A;  3IS9 A;  1C1C A;  2Z1H A;  4CEQ A;  1RIL A;  3HP6 A;  1RT2 A;  3RTV A;  3VA3 A;  2P5G A;  3M8Q A;  4CIG A;  2G8F A;  3H08 A;  1RDD A;  1VSL A;  2FC0 A;  4NCB A;  2F96 A;  4OGE A;  4OPK A;  3AO4 A;  3NF9 A;  3OVN A;  1SV5 A;  5CYM A;  3O3F A;  2XHB A;  3CFP A;  1TK8 A;  2KFZ A;  4CFC A;  2DTU A;  5KRT A;  3CFR A;  4JRQ A;  5J2Q A;  4I9Q A;  1UWB A;  3CM6 A;  3FFI A;  4I2P A;  1QSY A;  1U49 A;  4E89 A;  3ISN C;  3ZSR A;  1X9W A;  1N6Q A;  1UA0 A;  2E4L A;  4KHS A;  1I3A A;  1K6Y A;  2BAN A;  2FBY A;  1S1W A;  4AHT A;  3DOK A;  4FLU A;  3T3F A;  4CK2 A;  1U47 A;  2DY4 A;  3QES A;  4NCA A;  3NFA A;  4CF9 A;  3KKS A;  4B3O A;  1D8Y A;  2Q3S A;  1HJR A;  3AVJ A;  3LP2 A;  4KB0 A;  4OPJ A;  5HP1 A;  4NYN A;  2GUI A;  5CZ2 A;  3SUQ A;  4IFV A;  4KKO A;  1C0M A;  4PQU A;  1GOA A;  3SJJ A;  5JS2 A;  5FRM A;  3F9K A;  2VG5 A;  2B5J A;  2KQ2 A;  2EX3 A;  2GBZ A;  3EY1 A;  3AVI A;  5T7B A;  3HPO A;  3RRH A;  2Y1J A;  3QET A;  3K59 A;  4FK2 A;  2HVI A;  3KLG A;  2IAJ A;  3ZT1 A;  3ZSX A;  4M45 A;  4BDY A;  3SZ2 A;  4FJI A;  1SKR A;  1TL1 A;  2QXF A;  4MQ3 A;  2OYQ A;  4F2S A;  3L2W A;  2O4G A;  2Z1G A;  1LAW A;  1RBV A;  1NK6 A;  2PY5 A;  3PY8 A;  4C8O A;  4QAG A;  3PO4 A;  4EP4 A;  1NJY A;  1DTQ A;  3K5O A;  3L2Q A;  5D3G A;  5E41 A;  4DTR A;  2IS3 A;  4IFY A;  1VRT A;  3KD5 E;  3OY9 A;  1QHT A;  1LWC A;  4CHQ A;  4I9L A;  1RT6 A;  3K57 A;  1TKZ A;  4CGD A;  4DS4 A;  1FKO A;  1Z25 A;  4DF4 A;  1LWE A;  2Z1I A;  3L3U A;  4CGF A;  4AHV A;  1BIZ A;  2XY8 A;  4FJJ A;  3QEX A;  4B08 A;  2ZE2 A;  3S3M A;  4DFP A;  1RTD A;  4W5N A;  3LAL A;  3SQ1 A;  4Z4F A;  4FW1 A;  1VSH A;  4GMJ B;  2P51 A;  1WSJ A;  3TAG A;  3HVR A;  3K5N A;  3OYM A;  3DLK A;  3S3N A;  1MU2 A;  1HQE A;  1XWL A;  1IO2 A;  1HNV A;  4KB1 A;  4QCL A;  3NGI A;  5HRO A;  5HLF A;  3HPH A;  3HK2 A;  1KVA A;  3L3V A;  2HNZ A;  4KI6 A;  4B9N A;  4HCB A;  3KIO A;  4E1N A;  1RNH A;  4IBN A;  3V81 A;  2HHW A;  3TAE A;  3OJU A;  3CFO A;  4FJH A;  5DMR A;  1JLE A;  3U3G A;  3OS1 A;  1NK9 A;  2XY5 A;  4ZTJ A;  4H4M A;  1QS4 A;  3ZSQ A;  2JGU A;  2DFH A;  4CEE A;  1D5A A;  5J2M A;  2EHG A;  4KTW A;  4F4K A;  4DSF A;  4B8C A;  4IDK A;  5FRN A;  4DTU A;  4PUO A;  3MXJ A;  4M3T A;  5C24 A;  5HRN A;  5I3U A;  1BIU A;  4E7H A;  4C8L A;  4DQP A;  4M42 A;  3OYA A;  3HM9 A;  1S1V A;  4CJ3 A;  4BE1 A;  4FJX A;  3K5L A;  3OS2 A;  1TL3 A;  1XI1 A;  4YNQ A;  4CK3 A;  4FK4 A;  3AVL A;  3PX4 A;  2G8H A;  1TAQ A;  1WSG A;  4Y1D A;  5FRO A;  3V9U A;  4B9S A;  2O4I A;  4CFB A;  1SKS A;  1ASW A;  1EKE A;  1TVR A;  5KRS A;  3MEG A;  1TAU A;  4KFB A;  4CGJ A;  2FBX A;  4ICL A;  3AVH A;  1UA1 A;  1W0H A;  4QOZ B;  1VSK A;  2HHT A;  4JS4 A;  4HHT A;  2Y1I A;  1U04 A;  1VSE A;  3VQ9 A;  1BI4 B;  3LZJ A;  4FM0 A;  2B4J A;  1T05 A;  3UIQ A;  3QEW A;  4CES A;  4FXD A;  3C6U A;  5DK5 A;  1RTI A;  1WN7 A;  4RW7 A;  1NK4 A;  4E3S A;  1BQN A;  1ITG A;  3AVN A;  4AHU A;  3AVK A;  1ASU A;  1EX4 A;  4E7J A;  4G1Q A;  4M41 A;  3AO3 A;  1FXX A;  2ATQ A;  1X1P A;  4WE1 A;  1JLB A;  4OGC A;  3NDK A;  3NCI A;  3HJF A;  1JL2 A;  1LWF A;  4B9L A;  4CGG A;  3IRX A;  4W5R A;  4B9U A;  4AHR A;  4HCC A;  4KHU A;  3QEV A;  4M3R A;  3D45 A;  3ZCM A;  1I39 A;  3LWM A;  1RCH A;  3I0S A;  1WSE A;  1NK0 A;  4PY5 A;  5EU7 A;  3M8R A;  1B92 A;  4FJK A;  3BGR A;  4RW9 A;  4FM2 A;  1KFS A;  3IAY A;  3HO1 A;  3TAM A;  2F8S A;  3CM5 A;  3ZSY A;  4FLW A;  4DS5 A;  2HVH A;  3TAN A;  1WSF A;  2RKI A;  4FCY A;  3KD1 E;  1YVU A;  2IDO A;  1REV A;  4LSL A;  2DFE A;  1U4B A;  1QSS A;  4NYF A;  1SUQ A;  3PO5 A;  3VQQ A;  4CHY A;  4Z4H A;  3AVM A;  2XRI A;  3OYF A;  4F3T A;  4XIU A;  3HT3 A;  4DF8 A;  1B9F A;  3DM2 A;  1NOZ A;  3NGY A;  5CZ1 A;  3KLE A;  3KK3 A;  4CF1 A;  5J1E A;  4CCH A;  3NF7 A;  1JXE A;  1ZBU A;  3AO2 A;  3MED A;  3T19 A;  4N47 A;  4DQR A;  1KVB A;  1KTQ A;  3MEE A;  3MXI A;  2G8W A;  4I7F A;  4F2R A;  4M3Z A;  1S6Q A;  1ZBI A;  1RDB A;  3DLR A;  3ZSO A;  4J2E A;  2E6L A;  4CJ4 A;  5KGX A;  3JSM A;  4BDP A;  4AH9 A;  1WAF A;  3DI6 A;  3HYF A;  4KRE A;  3LAK A;  2D0B A;  4O4G A;  4FLX A;  4KHW A;  1RT1 A;  3IG1 A;  2YNH A;  4FJL A;  3VQ6 A;  3VQ5 A;  3M8P A;  3KK1 A;  4DLG A;  1N5Y A;  5K14 A;  1A5W A;  1C0U A;  3NH2 A;  1ZBL A;  1S1U A;  1SL0 A;  3QO9 A;  1T03 A;  1XHZ A;  4GW6 A;  3P5J A;  1RBR A;  4FLY A;  1X9M A;  2KZZ A;  4MFB A;  3ZT0 A;  3ZSZ A;  1S5J A;  5SWM A;  2ZQB A;  4OKE A;  1R0A A;  4E1M A;  2KZM A;  5FDL A;  3ITH A;  3LWL A;  2G8V A;  4JLH A;  4AIL C;  4FJN A;  4FM1 A;  1NK7 A;  4CHN A;  3U6F A;  3OYD A;  4K8X A;  3HST B;  1C1A A;  3QEP A;  1L3V A;  4FJG A;  4LSN A;  1S9E A;  1QE1 A;  4I2Q A;  2YNF A;  2ITG A;  4CJ5 A;  3MAQ A;  1XC9 A;  3NH1 A;  1CLQ A;  2BE2 A;  4DG1 A;  2OZS A;  3V6D A;  3SPY A;  1KVC A;  3V9W A;  3DLG A;  2ETJ A;  3HPG A;  1JL1 A;  4DWI A;  4DFK A;  4YFU A;  4HUE A;  1C0T A;  3WNG A;  4CHZ A;  1J5O A;  3SUN A;  2VWK A;  4CE9 A;  5J2P A;  5I42 A;  2G8K A;  4FK0 A;  4KI4 A;  1ZYQ A;  1YT3 A;  3M8S A;  3AA4 A;  3TAF A;  3ALY A;  5HRS A;  1L3T A;  1F21 A;  2PZS A;  4L8R B;  4DQI A;  4KHQ A;  3E01 A;  3O4N A;  4CJK A;  1RBT A;  2G8U A;  3I0R A;  5SZT A;  1RT4 A;  4NCG A;  4KHN A;  3OJS A;  4CEC A;  3LAN A;  4DU1 A;  1Q8I A;  3TAB A;  4EZ9 A;  3T1A A;  3CG7 A;  1KLN A;  3RMC A;  2BGG A;  2G8I A;  4N41 A;  3KLI A;  3B6P A;  4Z4E A;  4CJL A;  3LP3 A;  1WNS A;  3VQ8 A;  4OJR A;  3OS0 A;  1L3S A;  2KFN A;  1EP4 A;  1SL1 A;  1BHL A;  1JKH A;  4DTP A;  3WNE A;  1HQU A;  2QKB A;  2A1S A;  3BDP A;  3RRG A;  4J2A A;  4FJ9 A;  1BCO A;  1IKX A;  1HNI A;  1SL2 A;  4DTO A;  3VQB A;  3DRR A;  3L2R A;  1S1T A;  4JS5 A;  2HHV A;  4CIE A;  1U48 A;  3DRS A;  1BCM A;  5KI6 A;  4ZHR A;  4BAC A;  3D0P A;  1BIS A;  3QER A;  2LSN A;  1GOB A;  1VSJ A;  3VQD A;  4EP5 A;  3SQ4 A;  3O3H A;  2QKK A;  3KKR A;  3ZT2 A;  1D9D A;  4CK1 A;  1JXB A;  1RBS A;  1NK8 A;  3SNN A;  1VRU A;  4H8K A;  1NKC A;  4CJR A;  5KTQ A;  2KW4 A;  1T8E A;  4CJP A;  2D5R A;  1ZBH A;  3A2F A;  3KLF A;  1J53 A;  3SCX A;  4DQS A;  4B9T A;  4KTQ A;  1DLO A;  3L2V A;  4OLA A;  1CZ9 A;  4UQG A;  3PV8 A;  4DMN A;  3AO1 A;  2WON A;  4J2D A;  2RF2 A;  4N5S A;  3LP0 A;  1JLF A;  4ZTF A;  3NGZ A;  3ZT4 A;  2OPS A;  1Q9Y A;  3RR8 A;  2YNG A;  3ASM A;  1T7P A;  2PYJ A;  2F8T A;  2FBV A;  1NJX A;  3V1R A;  3RMB A;  4KAZ A;  2OPQ A;  3VA0 A;  1XHX A;  3DLE A;  2D0C A;  2HND A;  1UAX A;  2BDP A;  4Z4I A;  4LH5 A;  1NJW A;  5C42 A;  3TAP A;  3VQE A;  4DU3 A;  4M3W A;  1B9D A;  1IKV A;  4CJU A;  2Z1J A;  3OYL A;  4CF8 A;  2YKM A;  1A5X A;  3EYZ A;  4O0J A;  4CJF A;  4K8Z A;  4W5T A;  3NF6 A;  4CFD A;  1BL3 A;  4Y1C A;  3G0Z A;  3MEC A;  1Q9X A;  4Z4G A;  1WSI A;  3VQP A;  2IOC A;  4O55 A;  3QLH A;  4FLZ A;  3V9S A;  1BQM A;  3OYB A;  3S9H A;  3TAQ A;  1NOY A;  2HHX A;  3PUF A;  1VSD A;  3V1O A;  3K58 A;  2VG7 A;  4JRP A;  2OA8 A;  4J2B A;  1RDC A;  2B6A A;  4O44 A;  4C8M A;  3AVG A;  1BI4 A;  3AVC A;  4CJW A;  3AVB A;  3OYJ A;  3OYE A;  2W42 A;  2R7Y A;  3I8D A;  3F73 A;  3KJV A;  4KV8 A;  4DFM A;  4DSI A;  4FLV A;  3LPU A;  4OVL A;  1RTH A;  4CEF A;  3U3Y A;  2P5O A;  2VWJ A;  1L3U A;  4ID1 A;  2OPP A; 
#chains in the Genus database with same CATH topology
 4FYD A;  4DTX A;  4CGH A;  4DSK A;  5BPL A;  4A2A A;  2QWL A;  4CJQ A;  1RTJ A;  1JLG A;  2IVO A;  3O8M A;  4A59 A;  2YV0 X;  5AQL A;  2WOM A;  1TK0 A;  4EFH A;  4W5O A;  2A1R A;  2O8E A;  5MLC Q;  4GVM A;  2F4V K;  4DR4 K;  3T1Y K;  4E7K A;  4DSE A;  3WT0 A;  3V9X A;  3LDS A;  3SQ2 A;  4B9V A;  4JKC A;  4XEI A;  5HBM A;  3QEI A;  2HF3 A;  3MN5 A;  1EO1 A;  4YY3 K;  3JS6 A;  4PKH A;  2P9L A;  2CH5 A;  1VSI A;  2ASM A;  3DLB A;  2QI2 A;  2GV9 A;  3WNF A;  3DOL A;  1CXU A;  1QZ5 A;  5TKW A;  3RR7 A;  3J80 O;  4E7I A;  2AA4 A;  3AA2 A;  4N56 A;  1JLA A;  3CCS N;  4FZX C;  4KRF A;  3VN5 A;  3O3G A;  3VGK A;  4BG9 A;  1W9H A;  1KSP A;  1DGK N;  1VSF A;  3FE1 A;  3ZX0 A;  4GKK K;  5DM7 L;  4E1J A;  4WQ5 A;  1QQO A;  4HTL A;  3CQ8 A;  2AJQ A;  2OTJ N;  1C1B A;  4DQQ A;  2NZT A;  2X78 A;  3KTQ A;  4IJN A;  3M3Z A;  5BPN A;  4KH5 A;  1SKW A;  4AHC A;  5BN9 A;  5JS1 A;  2KHO A;  1DT9 A;  2UU9 K;  4Z0U A;  5HRP A;  1L5U A;  1Q18 A;  3JAM O;  5CY4 A;  4GV6 A;  3VOV A;  4R79 A;  4WFA L;  1TK5 A;  3QIP A;  2QXL A;  3ZSW A;  2W41 A;  4FLT A;  1JJ2 M;  3L6Q A;  1VQN N;  4KO0 A;  3R6M A;  4HUG A;  1NNE A;  1Z6R A;  3V1Q A;  3HXM A;  3MN6 A;  3NF8 A;  5AQP A;  5AQZ A;  1N34 K;  1YJN N;  3QIO A;  4BE2 A;  3NMU A;  5BN8 A;  2HHS A;  2XO7 A;  3DMJ A;  3IUC A;  4DKW A;  4LF9 K;  3HP9 A;  4DLE A;  1SS6 A;  1NJZ A;  1WLJ A;  5EX5 A;  1YF5 L;  4RG8 A;  3TAR A;  3A5L C;  2D0A A;  3AV9 A;  3VPZ A;  4NXN K;  3RSE A;  3RTV A;  3M8Q A;  4CIG A;  2G8F A;  3H08 A;  4NCB A;  4OGE A;  2W40 A;  2XHB A;  3AO4 A;  3OVN A;  5CYM A;  3FZM A;  1BA0 A;  2KFZ A;  4CFC A;  5KRT A;  3CFR A;  3VF6 A;  3CM6 A;  1GLJ O;  4H0P A;  4K43 A;  3SMS A;  4DHY A;  2FBY A;  1ATN A;  3T3F A;  3QES A;  4CF9 A;  4H5T A;  2PFU A;  4O5F A;  3AVJ A;  3LP2 A;  2ASP A;  4OPJ A;  4DR2 K;  4NYN A;  1HPM A;  3SK3 A;  5HP1 A;  3SUQ A;  1GOA A;  2JWL A;  3MWT A;  5BR9 A;  3S41 A;  4CD1 A;  2VG5 A;  3QBX A;  2B5J A;  2GBZ A;  5M1O A;  3CER A;  4JKB A;  3C7N B;  2IAJ A;  3ZT1 A;  4BDY A;  3SZ2 A;  4ILH A;  4CZE A;  3PSI A;  3SMP A;  4RTF D;  2YI1 A;  3SBT A;  1VQO N;  4QAG A;  2IIR A;  4BRC A;  4IFE A;  2BTF A;  5AQI A;  4DTR A;  1HKC A;  3KD5 E;  5EOY A;  2P9U A;  1QHT A;  3OY9 A;  4K25 A;  4JYA K;  3K57 A;  3N4P A;  1Q81 O;  4DF4 A;  1LWE A;  2Z1I A;  3L3U A;  4CGF A;  3AGK A;  2HF4 A;  3KHY A;  1LOT B;  3FLC O;  4CZH A;  1MWM A;  5AQR A;  3S3M A;  3LAL A;  2VGM A;  1FJG K;  3PLA A;  2VWB A;  1VHX A;  4JHD A;  4JAX A;  3HPH A;  3O9U A;  3UE5 A;  3WQT A;  2E2N A;  4E1N A;  1X3N A;  1RNH A;  2HHW A;  1QVF M;  1E4F T;  1JLE A;  1IBL K;  4B3R K;  4F4K A;  1NGC A;  4B8C A;  4CZJ A;  4JV5 K;  5LMN K;  1NGF A;  5I3U A;  3DXM A;  3BEX A;  5CR4 A;  4M42 A;  3OYA A;  1S1V A;  5AQU A;  4BRI A;  3OS2 A;  1XI1 A;  1NWK A;  1U6Z A;  1TAQ A;  3V9U A;  4Y1D A;  3TSP A;  1TUY A;  4CFB A;  4PL7 A;  4DV5 K;  1ASW A;  1EKE A;  3DLL L;  4LFC K;  1TAU A;  4KFB A;  2P9K B;  3AVH A;  1YI2 N;  4DR1 K;  5LJW A;  1VSE A;  3VQ9 A;  3H1Q A;  3THX B;  3GG4 A;  3LDQ A;  2IVN A;  4HWI A;  3C6U A;  3ZEU B;  3R3L A;  1RTI A;  1NK4 A;  4DR6 K;  3AAQ A;  3AVN A;  2F9T A;  2VGN A;  1YUW A;  3H6E A;  4E7J A;  4M41 A;  5BRH A;  2ATQ A;  4OGC A;  3NDK A;  3VES A;  3IRX A;  4IOC L;  4W5R A;  4HCC A;  3ZCM A;  1RCH A;  5AQV A;  5EU7 A;  3M8R A;  2EWS A;  3BGR A;  4RW9 A;  5GIN A;  2NRH A;  3IAY A;  3HO1 A;  2F8S A;  3ZSY A;  3M5R A;  4BRD A;  3TAN A;  3KD1 E;  2DFE A;  2NRZ A;  1U4B A;  4NYF A;  1QHA A;  3CCM N;  3MN7 A;  4CHY A;  4F3T A;  2XRI A;  4BRG A;  3DM2 A;  3ENH A;  2QWO A;  3CCR N;  1U2V B;  4A57 A;  5IWA K;  1KTQ A;  3DLR A;  1HNX K;  2A40 A;  2NNW A;  2I7P A;  1RT1 A;  3IG1 A;  2A6A A;  4MDB A;  1FW6 A;  4DLG A;  1A5W A;  1NGJ A;  3VMF B;  3NH2 A;  2ZJQ L;  1SL0 A;  3QO9 A;  3TTF A;  4FLY A;  1X9M A;  2O8D A;  4MFB A;  3ZSZ A;  2OCE A;  1S5J A;  1VQL N;  4AF1 A;  2O8B A;  5AZI A;  3O9R A;  1OVQ A;  5FDL A;  3ITH A;  4JLH A;  4AIL C;  4FJN A;  5CE3 A;  3Q7C A;  4NO7 A;  4K8X A;  1VQ5 N;  5JLF A;  4LFB K;  1BO5 O;  4Z94 A;  5LL6 Z;  3NH1 A;  3CCJ N;  3DLG A;  5AFU H;  3HPG A;  1QQM A;  4HUE A;  3WNG A;  3G25 A;  4DV2 K;  2QEX N;  4PKG A;  3AA4 A;  5HRS A;  4K42 A;  4KHQ A;  5JMV A;  1RT4 A;  4X66 K;  4BR5 A;  4KHN A;  3VTI A;  4CJ7 A;  3OJS A;  2E2O A;  3T69 A;  1HKB A;  3HRG A;  4FWN A;  3KLI A;  1L3S A;  2QWR A;  4OJR A;  4CD3 A;  4OPA A;  3LDN A;  2A1S A;  4B1Z A;  3RRG A;  1BCO A;  1HNI A;  5FPM A;  2RE2 A;  5LY3 A;  3D0P A;  2LSN A;  2W6L A;  3O3H A;  4CK1 A;  1NK8 A;  5KPT A;  5KTQ A;  1GLD G;  2KW4 A;  1OH5 A;  3A2F A;  1ATS A;  1J53 A;  4JI3 K;  4DQS A;  4B9T A;  1DLO A;  4OLA A;  4DMN A;  4J2D A;  1MWK A;  2D4W A;  2WBN A;  4ZTF A;  3NGZ A;  3RR8 A;  1CZA N;  2YNG A;  1MA9 B;  2PYJ A;  3KWG A;  1GLA G;  3D6R A;  3RVC A;  3GBT A;  3DLE A;  1UAX A;  2BDP A;  4YDU C;  4Z4I A;  3TAP A;  1B9D A;  2Z1J A;  4K41 A;  1EWR A;  1BL3 A;  1WSI A;  2IOC A;  5GAD P;  2BH1 A;  2CGK A;  4ISG A;  2QA4 N;  4WFN L;  3B8A X;  4JRP A;  2QM1 A;  4BC4 A;  1BI4 A;  3AVC A;  3IDH A;  2E2P A;  4WQ4 A;  3OYE A;  3F73 A;  3KJV A;  4KV8 A;  1RTH A;  2ZGY A;  2VWJ A;  4ID1 A;  1DEJ A;  2YNI A;  3ENO A;  2ITM A;  1BGX T;  4H4O A;  4CJS A;  3VEY A;  4DTN A;  3SV4 A;  4JK8 A;  3JYT A;  3QIN A;  4DB3 A;  2PYL A;  1D9F A;  3UKR B;  1TKD A;  3AA3 A;  4ID5 A;  3OTO K;  1ZBF A;  4OO1 J;  3MMV A;  4M3U A;  4O0I A;  3M6G A;  3LP1 A;  3KWI A;  5AQJ A;  4HTU A;  3V9Z A;  2O8E B;  4CJE A;  3OYH A;  2PBD A;  4B9M A;  4RW8 A;  4E7L A;  5M1Q A;  4RW6 A;  4DUY K;  1R59 O;  1NGI A;  4ELU A;  4JHD B;  3SUO A;  1J9A A;  2FXU A;  3RWU A;  3LPT A;  3K5M A;  2X6N A;  1HRH A;  3EE8 A;  3E1Y A;  3CJ9 A;  2HHH K;  1QQC A;  1NJI O;  2NRR A;  3RMD A;  4FZY A;  1CZB A;  3C6T A;  1X3M A;  1QTM A;  4B3T K;  4LD0 A;  1G15 A;  3VQA A;  2KLA A;  3L8B A;  4DSJ A;  2P9S A;  4DQ8 A;  4EZ6 A;  3S3O A;  4JI5 K;  1RT5 A;  4F8R A;  2Q0R A;  2HHQ A;  3SYZ A;  4PWD A;  3TSU A;  3NE6 A;  1KFD A;  1XQS C;  1IJJ A;  1VK0 A;  3AVA A;  3NHG A;  2Q0U A;  4M7Y A;  4Q5V A;  4AHS A;  4CEA A;  1N36 K;  1IKW A;  4JKE A;  3IMX A;  2D0O A;  3HVT A;  4L3Q A;  3WXI A;  2NRX A;  3U8X A;  4BWM A;  3NBP A;  3UKU A;  3NH0 A;  2OZM A;  2X74 A;  1WBD A;  1S9G A;  5HRR A;  2YHB A;  4DTS A;  3CCQ N;  1J54 A;  4CEB A;  4FVU A;  4KHP K;  3H3N O;  1SZ2 A;  1X9S A;  3OYK A;  1TKT A;  3DRP A;  1VQP N;  5AZJ B;  3DYA A;  5B8H A;  2IGI A;  3GDQ A;  2RPI A;  4E19 A;  1EET A;  1S6P A;  2HW3 A;  4FPB A;  2O8C B;  3RSE B;  1O1W A;  1NGE A;  1VSM A;  4BR0 A;  3I56 N;  1BWF O;  3HL8 A;  2QK9 A;  1VAZ A;  1K8A O;  1Z26 A;  1HMV A;  3LM2 A;  3J81 O;  4BRO A;  1LW2 A;  1RT7 A;  3Q7B A;  1QSL A;  2NUB A;  4DSL A;  4JKF A;  5H1S Q;  2ZD1 A;  1U45 A;  1NKB A;  4MDA A;  1IG9 A;  4ELT A;  2YHW A;  4MO5 A;  4CEQ A;  2P5G A;  1RIL A;  3VA3 A;  3P39 A;  4BRE A;  2FC0 A;  1VSL A;  4GY2 B;  2QWP A;  1SV5 A;  5AZJ A;  4JRQ A;  5KPR A;  4I9Q A;  1S3X A;  1QSY A;  1U49 A;  4E89 A;  3ZSR A;  1P8Z A;  1N6Q A;  5EVZ A;  1KD1 O;  1K6Y A;  4B1X B;  3U9Z A;  4CK2 A;  2DY4 A;  4JI6 K;  4BR2 A;  4O8K A;  2FF3 B;  5CZ2 A;  2A5X A;  1C0M A;  5AZI B;  3SJJ A;  3EY1 A;  1HNW K;  3HPO A;  3RRH A;  2Y1J A;  3QET A;  4FK2 A;  1VQ6 N;  3KLG A;  5F0X A;  4PHT X;  4DCH A;  1BUP A;  3ZSX A;  1SKR A;  1TL1 A;  4F2S A;  4MQ3 A;  4YDU A;  4CW7 B;  3CF5 L;  1VQ9 N;  4WQ5 C;  1RBV A;  3PO4 A;  4EP4 A;  1NJY A;  5D3G A;  5E41 A;  4BRM A;  4IFY A;  1VRT A;  2WTU A;  1U2V A;  1TKZ A;  4CGD A;  1FKO A;  4FWL A;  4AHV A;  1BIZ A;  1ATR A;  1K9M O;  3O5B A;  2NRV A;  2ZE2 A;  3MCA B;  4W5N A;  3SQ1 A;  4Z4F A;  2A3Z A;  5AQK A;  4GMJ B;  2P51 A;  1WSJ A;  3BP8 A;  2Q2R A;  5FLX O;  1MDU B;  3OYM A;  3K5N A;  3TAG A;  3S3N A;  1HQE A;  1HNV A;  4KB1 A;  5HRO A;  3HK2 A;  1KVA A;  4KI6 A;  3CQY A;  1QVG M;  1OKJ A;  3P38 A;  3VGL A;  3V81 A;  2UUB K;  3CFO A;  2HST A;  5DMR A;  3OS1 A;  3CPE A;  4H4M A;  2DFH A;  1HX1 A;  4CEE A;  1EWQ A;  5J2M A;  2EHG A;  1W7A A;  4LF6 K;  5FRN A;  4DTU A;  5C24 A;  4C8L A;  4KH6 A;  3HM9 A;  4FJX A;  1TL3 A;  4FK4 A;  4B9S A;  2O4I A;  4IZ9 A;  4BR9 A;  4H0Y B;  4C23 A;  4ICL A;  3G71 N;  3CI5 A;  1VSK A;  4GV3 A;  3ZLJ A;  3VF4 A;  1U04 A;  3LZJ A;  4FM0 A;  2B4J A;  2NRT A;  4CES A;  4FXD A;  5DK5 A;  1WN7 A;  1NG9 A;  4E3S A;  2YCH A;  4AHU A;  3DXM B;  4BRL A;  3VER A;  3CC4 N;  4OPH A;  3AO3 A;  4H5R A;  3NCI A;  1JLB A;  1JL2 A;  3CD6 N;  4BRH A;  3CME N;  3ZET B;  3D45 A;  5KQ8 A;  3TTD A;  2F9W A;  1NK0 A;  4PY5 A;  4ILG B;  1KFS A;  3VTH A;  2OTL N;  2RKI A;  3BUZ B;  5GAH P;  2DPN A;  2IDO A;  1REV A;  1SUQ A;  3PO5 A;  3HOT A;  4ISF A;  4Z4H A;  3HSC A;  5AR0 A;  4WFB L;  4XIU A;  3HT3 A;  4DF8 A;  1OH8 A;  4M63 C;  2GEM A;  3KLE A;  4BC3 A;  4J8F A;  3THW A;  3CJA A;  4NLB A;  2UUC K;  5I9E B;  1JXE A;  1ZBU A;  3AO2 A;  4N47 A;  2G8W A;  1ZBI A;  1YAG A;  5KQD A;  3LAK A;  3QBW A;  4MO4 A;  2P9I B;  1HR0 K;  2OA8 A;  4DV4 K;  1T03 A;  1XHZ A;  4BRQ A;  3P5J A;  1KC8 O;  3O1W A;  3O08 A;  4LF7 K;  3WEE A;  3ZT0 A;  3FZL A;  5M1N A;  3K0S A;  3TSQ A;  1R0A A;  3DXK A;  3CQX A;  2YHY A;  4YOX A;  3P31 A;  1NK7 A;  3OYD A;  3HST B;  4JKG A;  3QEP A;  1L3V A;  3THY B;  4I2Q A;  2YNF A;  2ITG A;  4CJ5 A;  2OZS A;  3V6D A;  1W2B M;  3SPY A;  3V9W A;  1JL1 A;  4FPA A;  5J2P A;  4CE9 A;  5I42 A;  3WXJ A;  4KI4 A;  1ZYQ A;  4JKA A;  3M8S A;  1F21 A;  3U4L A;  3FZF A;  4YOW A;  3O4N A;  4I6M B;  2G8U A;  1IBM K;  3C65 A;  5ELZ A;  4DU1 A;  3TAB A;  4EZ9 A;  1DKG D;  4XH1 A;  4CJL A;  4CZI A;  3LP3 A;  1OH7 A;  1EP4 A;  1T6C A;  1BHL A;  1JKH A;  3DAW A;  3WNE A;  2QKB A;  5AQF A;  4J2A A;  4CZG A;  2HMP A;  1SL2 A;  2O8F A;  2HHV A;  3O9S A;  3C0B A;  1S1T A;  1BCM A;  4ZHR A;  5C0Y A;  5HL7 L;  3VEV A;  1GOB A;  3SQ4 A;  4FSV A;  3ZT2 A;  1D9D A;  1JXB A;  3SNN A;  1VRU A;  3VET A;  1NKC A;  4C1N I;  1IG8 A;  4PKI A;  1ZBH A;  1GLE G;  4BRP A;  4UQG A;  2VQE K;  4N5S A;  5GAG P;  1JLF A;  1KQS M;  5EXW A;  4YOV A;  3ASM A;  4BGA A;  4NXM K;  4CI6 A;  3RMB A;  3VA0 A;  5ADX A;  2D0C A;  2GWK A;  2ZJR L;  2BUP A;  1NGG A;  3BF3 A;  3CIP A;  2YKM A;  5M1K A;  1A5X A;  2ZWH A;  4EHU A;  4FL9 A;  5E26 A;  3EYZ A;  4O0J A;  3D2E B;  4CJF A;  1N8R O;  1M90 O;  3G0Z A;  3MEC A;  4H5V A;  2Q36 A;  3VQP A;  3SLC A;  3OYB A;  1NOY A;  1S72 N;  3HOS A;  2HHX A;  2UXD K;  1BG3 A;  3K58 A;  1RDC A;  4O44 A;  3J7Y P;  4C8M A;  3AVG A;  3OYJ A;  3AVB A;  2O8C A;  3LPU A;  1HUX A;  3U3Y A;  4YOT A;  1L3U A;  4OKJ A;  4NCG A;  4CZF A;  2D0P A;  4JI4 K;  3VF2 A;  3RMA A;  1Q82 O;  4Z4C A;  4OX9 K;  3HBT A;  2IC3 A;  3OYC A;  2GWJ A;  4Q0B A;  3VEX A;  4IOX A;  3EN9 A;  3TR8 A;  2D1K A;  5AQM A;  4JKG B;  4JKH A;  4KTZ A;  3PX6 A;  2FBT A;  3SV3 A;  4M3X A;  3HM8 A;  3QB0 A;  3LM9 A;  2O8B B;  2J4R A;  4CF2 A;  4OLB A;  4B1U B;  1Y97 A;  5M1F A;  4CER A;  2JWK A;  3QFU A;  3PSF A;  4CEZ A;  3A5O C;  4CED A;  1DTT A;  3OBW A;  1Z05 A;  1LW0 A;  4ELV A;  2HNY A;  5AJ3 K;  4CZK A;  2CGJ A;  1NKE A;  3QIC A;  3P1G A;  3L2U A;  3J7A P;  4CBX A;  2E2Q A;  2I5J A;  5GAE P;  4HUF A;  2JLE A;  2YKN A;  3F2K A;  1CXQ A;  2P9S B;  4H0T B;  2P9P B;  3T7Z A;  3K2P A;  1YXQ A;  1HPZ A;  4DTM A;  3SI6 A;  1S1X A;  5JLH A;  4EIA A;  1LV5 A;  4JD2 B;  4R5P A;  3LAM A;  4AQY K;  3PX0 A;  1OH6 A;  3MN9 A;  1KCF A;  3C94 A;  4CJT A;  4CZM A;  3OYG A;  3ATU A;  1XMO K;  4FWS A;  2X6S A;  2CH6 A;  4CFA A;  1RBU A;  2RHK A;  3AA5 X;  4M3Y A;  3OYI A;  1JLQ A;  3TPQ A;  2Q1N A;  4DU4 A;  3VGM A;  2DFF A;  4IWV A;  1IH7 A;  4JNE A;  2GUP A;  5BRF A;  3CET A;  4BDZ A;  3CJ1 A;  1BA1 A;  4ILJ A;  4OKK A;  1EXQ A;  3SQ0 A;  4FJM A;  1JLC A;  4FJ8 A;  3VQ7 A;  3G10 A;  4DR5 K;  1RT3 A;  3SPZ A;  3WXM B;  4JKD A;  4FJ7 A;  3MX2 A;  3KK7 A;  4A5B A;  2E6M A;  3CYM A;  3I8B A;  4LH4 A;  1NK5 A;  1RDA A;  4C8K A;  3O9T A;  2ZF5 O;  1NGA A;  3ULD A;  3V4I A;  2ZJP L;  4IJA A;  4G9Z A;  4B3S K;  2QW9 A;  1WOQ A;  4DFJ A;  4H0O A;  3CCU N;  1HYZ A;  3R9P A;  3IS9 A;  3O1B A;  5C15 A;  2Z1H A;  3HP6 A;  4BGB A;  1KXP A;  3J7Z O;  3FGU A;  2F96 A;  3N4Q A;  4OPK A;  1D4X A;  1TK8 A;  4CZL A;  3CFP A;  1UWB A;  3FFI A;  4I2P A;  3ISN C;  1X9W A;  3EO3 A;  3BZK A;  1V4S A;  2QWQ A;  4B3O A;  1D8Y A;  1HJR A;  3MK6 A;  3NVM A;  2GUI A;  3UKU B;  4IFV A;  3CC2 N;  3DXK B;  5JS2 A;  5FRM A;  3F9K A;  1O13 A;  4WQ4 C;  2EX3 A;  3AVI A;  5T7B A;  3U9D A;  1GLC G;  3K59 A;  2HVI A;  4M45 A;  3LDP A;  4FJI A;  2WFB A;  2OYQ A;  3L2W A;  2YJE A;  1M1K O;  2Z1G A;  1LAW A;  2PY5 A;  4RCH A;  4C8O A;  4GNI A;  4JI1 K;  2IS3 A;  1YIT N;  1LWC A;  1Z25 A;  4FJJ A;  2QTD A;  1RTD A;  2UXB K;  3FR0 A;  4NLC A;  1XMQ K;  5HOO A;  5GIP A;  1VSH A;  4BC2 A;  4V19 S;  3HVR A;  3DLK A;  1NMD A;  4O8U A;  5F1X A;  3NGI A;  1XNR K;  5HLF A;  2HNZ A;  3O4W A;  4HCB A;  4EHT A;  4IBN A;  4H0X B;  3SBG A;  5EY4 A;  3THY A;  3U3G A;  1NK9 A;  2XY5 A;  4ZTJ A;  1QS4 A;  1JCG A;  2P9N A;  1D5A A;  3HZ6 A;  4IOA L;  1EQY A;  1ZXO A;  3O80 A;  3A8Y A;  4YOY A;  4PUO A;  3MXJ A;  5HRN A;  3D7E O;  3CCV N;  3WUH A;  1S22 A;  1HKG A;  3HI0 A;  3WEE B;  4YNQ A;  4CK3 A;  3AVL A;  3PX4 A;  2G8H A;  1WSG A;  3THX A;  1SKS A;  1TVR A;  5KRS A;  3VEZ A;  3MEG A;  1IBK K;  2FBX A;  3IFR A;  4LF4 K;  1W0H A;  3E66 A;  2Y1I A;  1BI4 B;  3R8E A;  1T05 A;  3UIQ A;  3L0Q A;  1J5E K;  1P90 A;  1ITG A;  4C1N K;  3CMA N;  1ASU A;  1FXX A;  4WE1 A;  1X1P A;  4BR7 A;  1NM1 A;  4B9L A;  4AM7 A;  4B9U A;  4AHR A;  1WUA A;  3ZX2 A;  3QEV A;  4KHU A;  1I39 A;  3LWM A;  1YHQ N;  1BU6 O;  1WSE A;  3A5N C;  3I0S A;  3R1X A;  3SJH A;  1B92 A;  4B1V A;  2ZM6 K;  3KVG A;  1T6D A;  3CJC A;  3CM5 A;  4DS5 A;  3CXC M;  3G6E N;  4FOI A;  4LF8 K;  3F9M A;  1YVU A;  2Q97 A;  1RFQ A;  3AAR A;  1QSS A;  2FSK A;  3VQQ A;  4DV6 K;  2NRW A;  4FWO A;  3QML A;  2WC9 A;  2FSN A;  1WB9 A;  3KK3 A;  2YX6 A;  4JK7 A;  4CF1 A;  5J1E A;  4CCH A;  3ZEU A;  3MXI A;  3T19 A;  5FPE A;  2P9U B;  4QCL A;  3MEE A;  4I7F A;  4B1W B;  1RDB A;  3ZSO A;  4A62 A;  1X9J A;  4CJ4 A;  5KGX A;  1VQK N;  4J2E A;  1J6Z A;  4BDP A;  3DI6 A;  3HYF A;  4Y0W A;  4KRE A;  2D0B A;  3H45 C;  4FLX A;  4FJL A;  3P4I A;  5AQY A;  3ULE B;  3KK1 A;  3M8P A;  3C7N A;  1ZBL A;  4GW6 A;  1RBR A;  1JCF A;  3BZC A;  4X64 K;  5AQW A;  4DR3 K;  2KZM A;  4E1M A;  3AGR A;  3EKU A;  4FM1 A;  4BRN A;  5BRD A;  2P9N B;  3U6F A;  5A2Q O;  1E3M A;  4FJG A;  4LSN A;  1QE1 A;  4I6M A;  3MAQ A;  1NGB A;  1KAY A;  2BE2 A;  4CBW A;  1H1V A;  3L4I A;  3TTC A;  4DWI A;  4IEE A;  3FFK B;  2VWK A;  4ISE A;  1YT3 A;  3TAF A;  3ALY A;  3VEW A;  1IV0 A;  4DV1 K;  2PZS A;  1RBT A;  3A0I X;  4XH4 A;  3I0R A;  4CEC A;  3CJ7 A;  3LAN A;  3CG7 A;  1VQ8 N;  1JCE A;  4N41 A;  1E4G T;  1WNS A;  3VQ8 A;  3OS0 A;  1SL1 A;  1HQU A;  4FWP A;  5ADX H;  4DUZ K;  5AQT A;  2P9I A;  2AP1 A;  4DTO A;  3VQB A;  3DRR A;  4JS5 A;  4B1Y B;  1U48 A;  3DRS A;  4H03 B;  5KI6 A;  3VQD A;  4EP5 A;  2QKK A;  4H8K A;  4CJR A;  3ENB A;  4BVO A;  1T8E A;  4CJP A;  2D5R A;  3SCX A;  1K8K B;  4U7B A;  3L2V A;  1CZ9 A;  3AO1 A;  2E20 A;  5E84 A;  3ZT4 A;  4XH5 A;  1T7P A;  3V1R A;  2IVP A;  2VYP A;  3CJB A;  5C42 A;  3H1V X;  2NLX A;  4JD2 A;  1IKV A;  3OYL A;  4CF8 A;  4B3M K;  4W5T A;  3NF6 A;  4CFD A;  1ILY A;  4Y1C A;  4DR7 K;  4BRK A;  4IXC A;  4FLZ A;  2GEL A;  3TAQ A;  4GV9 A;  3PUF A;  3T1H K;  2V52 B;  3V1O A;  2UUA K;  2VG7 A;  1HNZ K;  4J2B A;  2B6A A;  3D2F B;  4CJW A;  4FWQ A;  2W42 A;  4DFM A;  4OVL A;  2P5O A;  4Z4G A;  1C6V A;  1LAV A;  3CCL N;  4CJV A;  4BRF A;  4FJ5 A;  1N32 K;  1TUU A;  4BR4 A;  3H3O B;  1C0G A;  4KH4 A;  4C8N A;  1TGO A;  1YTA A;  1FK9 A;  4CF0 A;  1W97 L;  3OHR A;  4BE0 A;  3DLH A;  4CEO A;  4X62 K;  3TI0 A;  2RN2 A;  5J2N A;  2QWM A;  3EEQ A;  3ZSV A;  2WUS A;  1WSH A;  1FKP A;  1QZ6 A;  3W0L A;  1KAX A;  3LL3 A;  3VQ4 A;  1BOT O;  4CIF A;  4RW4 A;  3TWH A;  3VQC A;  2O8D B;  3ZYY X;  4B8A B;  3OYN A;  3LZI A;  4E0D A;  4O5B A;  2HHU A;  3MXM A;  3M1F A;  1IKY A;  1ASV A;  4H5N A;  3GL1 A;  4HVJ A;  3K9K A;  1HLU A;  4UY8 O;  4N76 A;  2KKZ A;  4W5Q A;  2XY7 A;  1G99 A;  4QS8 A;  4F3O A;  1WBB A;  4FW2 A;  1NBW A;  1UOC A;  4YOU A;  1C0F A;  1TV6 A;  4CHP A;  3THW B;  1ZC6 A;  2HMI A;  4H5W A;  3KK2 A;  2KTQ A;  4BRA A;  3B6O A;  3MCP A;  3NAE A;  1VQM N;  3SUP A;  2OPR A;  3D2E A;  4TSX A;  4BWJ A;  1KLM A;  1WAJ A;  1KRP A;  2HB5 A;  4FWM A;  5JIC A;  4B9Q A;  3QNO A;  2P9L B;  1HYV A;  1I94 K;  4LY7 A;  5KGW A;  3TU5 A;  2FSJ A;  3K9J A;  4A5A A;  2VG6 A;  2OAN A;  1YIJ N;  4PA1 A;  2ZGZ A;  4M7X A;  3SAH A;  3ZT3 A;  3NVK A;  1V4T A;  2QWN A;  3WNH A;  4IG0 A;  5CYQ A;  5M1P A;  5LMU K;  3UKR A;  5BR8 K;  3CHW A;  5AQH A;  3EZ5 A;  1RGI A;  4MLE A;  5C25 A;  3THV A;  1HYS A;  1GOC A;  5DM6 L;  3L4Q A;  3AO5 A;  2I7N A;  1Q7Y O;  3I55 N;  4DTJ A;  3O4Q A;  4CHO A;  3QNN A;  3C95 A;  3GOI A;  1TKX A;  4IG3 A;  4RWT A;  2XY6 A;  2P1J A;  1A5V A;  3P83 D;  4FOE A;  4IKF A;  3LDL A;  3O6W A;  4CGI A;  2E5L K;  4KPY A;  4FZZ A;  2YHA A;  5FPN A;  3KLH A;  3AVF A;  4FVM A;  1C1C A;  1N33 K;  1RT2 A;  2YJF A;  1T44 A;  1HJO A;  1VQ7 N;  1RDD A;  4KHY A;  3NF9 A;  3O3F A;  3BY5 A;  2DTU A;  5J2Q A;  5C2D A;  4CBU A;  3EZW A;  4JK9 A;  2FF6 A;  1UA0 A;  2E4L A;  4EAH D;  4KHS A;  1I3A A;  2BAN A;  4FLU A;  4AHT A;  1S1W A;  1YTU A;  3DOK A;  1U47 A;  4QS9 A;  4NCA A;  3NFA A;  3KKS A;  3WXL A;  2HBK A;  2Q3S A;  3QFP A;  4KB0 A;  3OW2 M;  5TKY A;  1NGD A;  4KKO A;  4PQU A;  2Q31 A;  1ESV A;  3DWL A;  2KQ2 A;  5CHI A;  4BQZ A;  4YOR A;  4JN4 A;  5AQX A;  3OA9 A;  2QXF A;  4FO0 A;  2O4G A;  1NK6 A;  3C6H A;  3PY8 A;  5C12 A;  3I33 A;  1DTQ A;  3K5O A;  3L2Q A;  2H3G X;  3AY9 A;  1YJW N;  2E8A A;  3QDK A;  4BC5 A;  2P9P A;  3G4S N;  4CHQ A;  5LJV A;  4I9L A;  1RDU A;  1KAZ A;  1RT6 A;  4DS4 A;  3HTV A;  4BVP A;  3EKS A;  2YHX A;  2XY8 A;  3E9P A;  3QEX A;  4B08 A;  5KPZ A;  2VQF K;  1NU0 A;  4DFP A;  4FW1 A;  4MLH A;  4JI0 K;  1T3V A;  2HBL A;  1MU2 A;  1XWL A;  1IO2 A;  3OBY A;  2ASO A;  3VEO A;  3H46 O;  3L3V A;  5C2F A;  4B9N A;  3KIO A;  1XNQ K;  3TAE A;  3OJU A;  4FJH A;  3BF1 A;  1GLB G;  3O9Q A;  5AQS A;  5FPD A;  2UXC K;  1GLL O;  3ZSQ A;  2JGU A;  1TYQ A;  4KTW A;  4DSF A;  3JXU A;  3F5T A;  4IDK A;  5JVH L;  4M3T A;  3ID8 A;  1BIU A;  4E7H A;  4DQP A;  4BE1 A;  4CJ3 A;  4JEP A;  3K5L A;  5JVG L;  5BRE A;  5FRO A;  4NB4 A;  3SAG A;  4QS7 A;  3ULE A;  1NMN A;  2F7T A;  4CGJ A;  2HHT A;  4PL8 A;  1UA1 A;  4QOZ B;  4WCE L;  4JS4 A;  4HHT A;  4BY9 C;  3D2F A;  3QEW A;  4RW7 A;  4BQL A;  4H0V B;  1BQN A;  3AVK A;  1EX4 A;  4G1Q A;  3KZB A;  2E1Z A;  5C10 A;  3HJF A;  5IT9 O;  2GX9 A;  1LWF A;  3ZX3 A;  4CGG A;  4GKJ K;  3GE1 A;  4M3R A;  3E9O A;  1NGH A;  4A61 A;  3WQU A;  4FJK A;  3SAF A;  4FM2 A;  3TAM A;  4FLW A;  2HVH A;  1WSF A;  1SQK A;  4FCY A;  3ZET A;  4LF5 K;  3EE9 A;  3PIO L;  4LSL A;  3LDO A;  2HOE A;  3DJC A;  1Y64 A;  1K8K A;  3AVM A;  4A2B A;  3OYF A;  1B9F A;  4IEI A;  1NOZ A;  5CZ1 A;  2W6K A;  3NGY A;  3CPW M;  4GVE A;  3NF7 A;  3MED A;  1SAZ A;  3MWP A;  4DQR A;  4JI8 K;  1KVB A;  4F2R A;  1Q86 O;  4M3Z A;  1S6Q A;  2E6L A;  3JSM A;  3AAP A;  4AH9 A;  1WAF A;  2P9K A;  3A5M C;  4LFA K;  4O4G A;  3W3D A;  4KHW A;  3FZK A;  2VCP A;  2YNH A;  3VQ6 A;  4WF9 L;  4WYB A;  4LC9 B;  3VQ5 A;  1N5Y A;  2UYT A;  5K14 A;  1C0U A;  1S1U A;  2KZZ A;  1NLV A;  4CVN E;  3J8A A;  4AM6 A;  4K0K K;  1QQN A;  1BDG A;  2V7Z A;  2ZQB A;  4OKE A;  5AQO A;  5SWM A;  1GLF O;  3LWL A;  3IKM A;  2G8V A;  1TYQ B;  4CHN A;  2PAV A;  4FWK A;  1C1A A;  1S9E A;  5GIO A;  2CGL A;  1XC9 A;  1CLQ A;  4DG1 A;  1KVC A;  2ETJ A;  2FLO A;  4DFK A;  5AQG A;  4YFU A;  1C0T A;  1XC3 A;  3FZH A;  4CHZ A;  4F9O A;  1J5O A;  3SUN A;  3MX5 A;  2E88 A;  2G8K A;  3ATV A;  4FK0 A;  1L3T A;  4L8R B;  4DQI A;  3E01 A;  4CJK A;  2HBJ A;  5SZT A;  3EL2 A;  3VEN A;  2V7Y A;  5AFU A;  1Q8I A;  2A42 A;  3T1A A;  1KLN A;  3RMC A;  2BGG A;  2G8I A;  3CC7 N;  1K73 O;  3B6P A;  4Z4E A;  4FWR A;  3UB5 A;  2KFN A;  4DTP A;  4DV7 K;  4FJ9 A;  3BDP A;  2HBM A;  1IKX A;  4KBO A;  3L2R A;  4CIE A;  5BPM A;  4X65 K;  4BAC A;  1BIS A;  3QER A;  4YHH K;  1YJ9 N;  1VSJ A;  1VQ4 N;  4IO8 A;  2GTD A;  3KKR A;  1RBS A;  4U67 L;  1RDW X;  5F2R A;  4JI7 K;  3KLF A;  3C6A A;  1YVN A;  4KTQ A;  2E1Y A;  3PV8 A;  2WON A;  4DV0 K;  1ZBS A;  2RF2 A;  3LP0 A;  2OPS A;  1Q9Y A;  2F8T A;  2FBV A;  1NJX A;  4KAZ A;  2OPQ A;  4DV3 K;  1XHX A;  2HND A;  1XUP O;  4LH5 A;  1NJW A;  3MDQ A;  3VQE A;  3E9L A;  4DU3 A;  4M3W A;  4CJU A;  2O8F B;  4JI2 K;  3PIP L;  3ID6 A;  1LCU A;  4K8Z A;  4IDH A;  1Q9X A;  2A41 A;  4O55 A;  3QLH A;  3V9S A;  1BQM A;  3S9H A;  2V51 B;  1OVY A;  3CCE N;  1VSD A;  5AQN A;  3WXK A;  2R7Y A;  4DSI A;  3I8D A;  5AQQ A;  4BG8 A;  4FLV A;  4CEF A;  4IO9 L;  2OPP A; 
#chains in the Genus database with same CATH homology
 1C6V A;  1LAV A;  2YNI A;  4DTX A;  4CJV A;  4CGH A;  3RMA A;  4DSK A;  4FJ5 A;  4Z4C A;  4FYD A;  1BGX T;  4H4O A;  4CJQ A;  1RTJ A;  2IC3 A;  3OYC A;  4CJS A;  4C8N A;  4DTN A;  3SV4 A;  1TGO A;  3JYT A;  4Q0B A;  1YTA A;  1FK9 A;  4CF0 A;  3QIN A;  2PYL A;  1JLG A;  1D9F A;  3TR8 A;  4BE0 A;  1TKD A;  3DLH A;  3AA3 A;  2YV0 X;  4ID5 A;  4CEO A;  1ZBF A;  2WOM A;  3TI0 A;  1TK0 A;  2RN2 A;  5J2N A;  4W5O A;  2A1R A;  4M3U A;  4O0I A;  4KTZ A;  3ZSV A;  3PX6 A;  4GVM A;  2FBT A;  3SV3 A;  4M3X A;  1WSH A;  3LP1 A;  1FKP A;  4E7K A;  4HTU A;  3V9Z A;  4DSE A;  4OKJ A;  3V9X A;  4CJE A;  3OYH A;  3LDS A;  3VQ4 A;  3SQ2 A;  4B9V A;  4CIF A;  4B9M A;  5HBM A;  4RW8 A;  3QEI A;  4CF2 A;  4OLB A;  4RW4 A;  3TWH A;  4E7L A;  1Y97 A;  3VQC A;  4RW6 A;  4CER A;  4B8A B;  3OYN A;  4ELU A;  4CEZ A;  3SUO A;  1VSI A;  4CED A;  3DLB A;  1J9A A;  3LZI A;  2GV9 A;  1DTT A;  4E0D A;  3RWU A;  3LPT A;  4O5B A;  2HHU A;  3K5M A;  3MXM A;  1IKY A;  1ASV A;  2X6N A;  3DOL A;  3WNF A;  1CXU A;  1HRH A;  4HVJ A;  1LW0 A;  4ELV A;  4N76 A;  1QQC A;  3RR7 A;  2HNY A;  4FZY A;  3RMD A;  4W5Q A;  4E7I A;  2XY7 A;  1CZB A;  3AA2 A;  3C6T A;  1NKE A;  1QTM A;  4N56 A;  4F3O A;  1JLA A;  4FW2 A;  4LD0 A;  1G15 A;  1UOC A;  3P1G A;  3VQA A;  3L2U A;  4FZX C;  4KRF A;  3L8B A;  2I5J A;  4DSJ A;  3VN5 A;  4HUF A;  1TV6 A;  4EZ6 A;  4CHP A;  3S3O A;  2JLE A;  2YKN A;  3O3G A;  1RT5 A;  2HMI A;  4F8R A;  3KK2 A;  2KTQ A;  1W9H A;  1KSP A;  1CXQ A;  1VSF A;  3B6O A;  3SYZ A;  2HHQ A;  3K2P A;  4PWD A;  3NAE A;  3NE6 A;  1KFD A;  1VK0 A;  3SUP A;  2OPR A;  1HPZ A;  3AVA A;  4TSX A;  4BWJ A;  3NHG A;  4DTM A;  3SI6 A;  1YTU A;  1S1X A;  1KLM A;  4Q5V A;  1WAJ A;  3CQ8 A;  1KRP A;  2AJQ A;  1LV5 A;  1C1B A;  2HB5 A;  4DQQ A;  4AHS A;  4CEA A;  4R5P A;  2X78 A;  3LAM A;  3QNO A;  3KTQ A;  1IKW A;  1HYV A;  3PX0 A;  4LY7 A;  5KGW A;  3HVT A;  1SKW A;  1KCF A;  4AHC A;  5JS1 A;  3C94 A;  4BWM A;  3NBP A;  2VG6 A;  4Z0U A;  4CJT A;  3OYG A;  3NH0 A;  2OZM A;  4PA1 A;  5HRP A;  1L5U A;  2X74 A;  3ZT3 A;  1S9G A;  2X6S A;  5CY4 A;  2YHB A;  1RBU A;  3AA5 X;  5HRR A;  4CFA A;  3OYI A;  4DTS A;  1JLQ A;  4M3Y A;  1J54 A;  3WNH A;  4CEB A;  4IG0 A;  4DU4 A;  5CYQ A;  2DFF A;  1TK5 A;  1IH7 A;  3QIP A;  3ZSW A;  4BDZ A;  4FLT A;  3EZ5 A;  4OKK A;  1EXQ A;  4KO0 A;  3SQ0 A;  1X9S A;  4FJM A;  3OYK A;  1TKT A;  4HUG A;  1JLC A;  4FJ8 A;  5C25 A;  3DRP A;  3V1Q A;  3VQ7 A;  3HXM A;  3THV A;  3G10 A;  1HYS A;  3DYA A;  1GOC A;  2IGI A;  3NF8 A;  1RT3 A;  3SPZ A;  3AO5 A;  2RPI A;  4E19 A;  4FJ7 A;  3QIO A;  4BE2 A;  1EET A;  1S6P A;  4DTJ A;  2HW3 A;  3O4Q A;  4CHO A;  2HHS A;  2E6M A;  3C95 A;  1O1W A;  3CYM A;  1VSM A;  3DMJ A;  2XO7 A;  3QNN A;  1TKX A;  4IG3 A;  4LH4 A;  1NK5 A;  1RDA A;  4C8K A;  3HL8 A;  3HP9 A;  4DLE A;  2QK9 A;  1NJZ A;  1WLJ A;  2XY6 A;  2P1J A;  3ULD A;  3V4I A;  1Z26 A;  4RG8 A;  1HMV A;  1A5V A;  3P83 D;  3TAR A;  4IKF A;  4KHY A;  4CGI A;  1LW2 A;  1RT7 A;  4DFJ A;  2D0A A;  4KPY A;  4FZZ A;  1QSL A;  2YHA A;  3AV9 A;  3KLH A;  2NUB A;  4DSL A;  1U45 A;  1NKB A;  2ZD1 A;  3AVF A;  4ELT A;  1IG9 A;  1HYZ A;  4FVM A;  3IS9 A;  1C1C A;  2Z1H A;  4CEQ A;  1RIL A;  3HP6 A;  1RT2 A;  3RTV A;  3VA3 A;  2P5G A;  3M8Q A;  4CIG A;  2G8F A;  3H08 A;  1RDD A;  1VSL A;  2FC0 A;  4NCB A;  2F96 A;  4OGE A;  4OPK A;  3AO4 A;  3NF9 A;  3OVN A;  1SV5 A;  5CYM A;  3O3F A;  2XHB A;  3CFP A;  1TK8 A;  2KFZ A;  4CFC A;  2DTU A;  5KRT A;  3CFR A;  4JRQ A;  5J2Q A;  4I9Q A;  1UWB A;  3CM6 A;  3FFI A;  4I2P A;  1QSY A;  1U49 A;  4E89 A;  3ISN C;  3ZSR A;  1X9W A;  1N6Q A;  1UA0 A;  2E4L A;  4KHS A;  1I3A A;  1K6Y A;  2BAN A;  2FBY A;  1S1W A;  4AHT A;  3DOK A;  4FLU A;  3T3F A;  4CK2 A;  1U47 A;  2DY4 A;  3QES A;  4NCA A;  3NFA A;  4CF9 A;  3KKS A;  4B3O A;  1D8Y A;  2Q3S A;  1HJR A;  3AVJ A;  3LP2 A;  4KB0 A;  4OPJ A;  5HP1 A;  4NYN A;  2GUI A;  5CZ2 A;  3SUQ A;  4IFV A;  4KKO A;  1C0M A;  4PQU A;  1GOA A;  3SJJ A;  5JS2 A;  5FRM A;  3F9K A;  2VG5 A;  2B5J A;  2KQ2 A;  2EX3 A;  2GBZ A;  3EY1 A;  3AVI A;  5T7B A;  3HPO A;  3RRH A;  2Y1J A;  3QET A;  3K59 A;  4FK2 A;  2HVI A;  3KLG A;  2IAJ A;  3ZT1 A;  3ZSX A;  4M45 A;  4BDY A;  3SZ2 A;  4FJI A;  1SKR A;  1TL1 A;  2QXF A;  4MQ3 A;  2OYQ A;  4F2S A;  3L2W A;  2O4G A;  2Z1G A;  1LAW A;  1RBV A;  1NK6 A;  2PY5 A;  3PY8 A;  4C8O A;  4QAG A;  3PO4 A;  4EP4 A;  1NJY A;  1DTQ A;  3K5O A;  3L2Q A;  5D3G A;  5E41 A;  4DTR A;  2IS3 A;  4IFY A;  1VRT A;  3KD5 E;  3OY9 A;  1QHT A;  1LWC A;  4CHQ A;  4I9L A;  1RT6 A;  3K57 A;  1TKZ A;  4CGD A;  4DS4 A;  1FKO A;  1Z25 A;  4DF4 A;  1LWE A;  2Z1I A;  3L3U A;  4CGF A;  4AHV A;  1BIZ A;  2XY8 A;  4FJJ A;  3QEX A;  4B08 A;  2ZE2 A;  3S3M A;  4DFP A;  1RTD A;  4W5N A;  3LAL A;  3SQ1 A;  4Z4F A;  4FW1 A;  1VSH A;  4GMJ B;  2P51 A;  1WSJ A;  3TAG A;  3HVR A;  3K5N A;  3OYM A;  3DLK A;  3S3N A;  1MU2 A;  1HQE A;  1XWL A;  1IO2 A;  1HNV A;  4KB1 A;  4QCL A;  3NGI A;  5HRO A;  5HLF A;  3HPH A;  3HK2 A;  1KVA A;  3L3V A;  2HNZ A;  4KI6 A;  4B9N A;  4HCB A;  3KIO A;  4E1N A;  1RNH A;  4IBN A;  3V81 A;  2HHW A;  3TAE A;  3OJU A;  3CFO A;  4FJH A;  5DMR A;  1JLE A;  3U3G A;  3OS1 A;  1NK9 A;  2XY5 A;  4ZTJ A;  4H4M A;  1QS4 A;  3ZSQ A;  2JGU A;  2DFH A;  4CEE A;  1D5A A;  5J2M A;  2EHG A;  4KTW A;  4F4K A;  4DSF A;  4B8C A;  4IDK A;  5FRN A;  4DTU A;  4PUO A;  3MXJ A;  4M3T A;  5C24 A;  5HRN A;  5I3U A;  1BIU A;  4E7H A;  4C8L A;  4DQP A;  4M42 A;  3OYA A;  3HM9 A;  1S1V A;  4CJ3 A;  4BE1 A;  4FJX A;  3K5L A;  3OS2 A;  1TL3 A;  1XI1 A;  4YNQ A;  4CK3 A;  4FK4 A;  3AVL A;  3PX4 A;  2G8H A;  1TAQ A;  1WSG A;  4Y1D A;  5FRO A;  3V9U A;  4B9S A;  2O4I A;  4CFB A;  1SKS A;  1ASW A;  1EKE A;  1TVR A;  5KRS A;  3MEG A;  1TAU A;  4KFB A;  4CGJ A;  2FBX A;  4ICL A;  3AVH A;  1UA1 A;  1W0H A;  4QOZ B;  1VSK A;  2HHT A;  4JS4 A;  4HHT A;  2Y1I A;  1U04 A;  1VSE A;  3VQ9 A;  1BI4 B;  3LZJ A;  4FM0 A;  2B4J A;  1T05 A;  3UIQ A;  3QEW A;  4CES A;  4FXD A;  3C6U A;  5DK5 A;  1RTI A;  1WN7 A;  4RW7 A;  1NK4 A;  4E3S A;  1BQN A;  1ITG A;  3AVN A;  4AHU A;  3AVK A;  1ASU A;  1EX4 A;  4E7J A;  4G1Q A;  4M41 A;  3AO3 A;  1FXX A;  2ATQ A;  1X1P A;  4WE1 A;  1JLB A;  4OGC A;  3NDK A;  3NCI A;  3HJF A;  1JL2 A;  1LWF A;  4B9L A;  4CGG A;  3IRX A;  4W5R A;  4B9U A;  4AHR A;  4HCC A;  4KHU A;  3QEV A;  4M3R A;  3D45 A;  3ZCM A;  1I39 A;  3LWM A;  1RCH A;  3I0S A;  1WSE A;  1NK0 A;  4PY5 A;  5EU7 A;  3M8R A;  1B92 A;  4FJK A;  3BGR A;  4RW9 A;  4FM2 A;  1KFS A;  3IAY A;  3HO1 A;  3TAM A;  2F8S A;  3CM5 A;  3ZSY A;  4FLW A;  4DS5 A;  2HVH A;  3TAN A;  1WSF A;  2RKI A;  4FCY A;  3KD1 E;  1YVU A;  2IDO A;  1REV A;  4LSL A;  2DFE A;  1U4B A;  1QSS A;  4NYF A;  1SUQ A;  3PO5 A;  3VQQ A;  4CHY A;  4Z4H A;  3AVM A;  2XRI A;  3OYF A;  4F3T A;  4XIU A;  3HT3 A;  4DF8 A;  1B9F A;  3DM2 A;  1NOZ A;  3NGY A;  5CZ1 A;  3KLE A;  3KK3 A;  4CF1 A;  5J1E A;  4CCH A;  3NF7 A;  1JXE A;  1ZBU A;  3AO2 A;  3MED A;  3T19 A;  4N47 A;  4DQR A;  1KVB A;  1KTQ A;  3MEE A;  3MXI A;  2G8W A;  4I7F A;  4F2R A;  4M3Z A;  1S6Q A;  1ZBI A;  1RDB A;  3DLR A;  3ZSO A;  4J2E A;  2E6L A;  4CJ4 A;  5KGX A;  3JSM A;  4BDP A;  4AH9 A;  1WAF A;  3DI6 A;  3HYF A;  4KRE A;  3LAK A;  2D0B A;  4O4G A;  4FLX A;  4KHW A;  1RT1 A;  3IG1 A;  2YNH A;  4FJL A;  3VQ6 A;  3VQ5 A;  3M8P A;  3KK1 A;  4DLG A;  1N5Y A;  5K14 A;  1A5W A;  1C0U A;  3NH2 A;  1ZBL A;  1S1U A;  1SL0 A;  3QO9 A;  1T03 A;  1XHZ A;  4GW6 A;  3P5J A;  1RBR A;  4FLY A;  1X9M A;  2KZZ A;  4MFB A;  3ZT0 A;  3ZSZ A;  1S5J A;  5SWM A;  2ZQB A;  4OKE A;  1R0A A;  4E1M A;  2KZM A;  5FDL A;  3ITH A;  3LWL A;  2G8V A;  4JLH A;  4AIL C;  4FJN A;  4FM1 A;  1NK7 A;  4CHN A;  3U6F A;  3OYD A;  4K8X A;  3HST B;  1C1A A;  3QEP A;  1L3V A;  4FJG A;  4LSN A;  1S9E A;  1QE1 A;  4I2Q A;  2YNF A;  2ITG A;  4CJ5 A;  3MAQ A;  1XC9 A;  3NH1 A;  1CLQ A;  2BE2 A;  4DG1 A;  2OZS A;  3V6D A;  3SPY A;  1KVC A;  3V9W A;  3DLG A;  2ETJ A;  3HPG A;  1JL1 A;  4DWI A;  4DFK A;  4YFU A;  4HUE A;  1C0T A;  3WNG A;  4CHZ A;  1J5O A;  3SUN A;  2VWK A;  4CE9 A;  5J2P A;  5I42 A;  2G8K A;  4FK0 A;  4KI4 A;  1ZYQ A;  1YT3 A;  3M8S A;  3AA4 A;  3TAF A;  3ALY A;  5HRS A;  1L3T A;  1F21 A;  2PZS A;  4L8R B;  4DQI A;  4KHQ A;  3E01 A;  3O4N A;  4CJK A;  1RBT A;  2G8U A;  3I0R A;  5SZT A;  1RT4 A;  4NCG A;  4KHN A;  3OJS A;  4CEC A;  3LAN A;  4DU1 A;  1Q8I A;  3TAB A;  4EZ9 A;  3T1A A;  3CG7 A;  1KLN A;  3RMC A;  2BGG A;  2G8I A;  4N41 A;  3KLI A;  3B6P A;  4Z4E A;  4CJL A;  3LP3 A;  1WNS A;  3VQ8 A;  4OJR A;  3OS0 A;  1L3S A;  2KFN A;  1EP4 A;  1SL1 A;  1BHL A;  1JKH A;  4DTP A;  3WNE A;  1HQU A;  2QKB A;  2A1S A;  3BDP A;  3RRG A;  4J2A A;  4FJ9 A;  1BCO A;  1IKX A;  1HNI A;  1SL2 A;  4DTO A;  3VQB A;  3DRR A;  3L2R A;  1S1T A;  4JS5 A;  2HHV A;  4CIE A;  1U48 A;  3DRS A;  1BCM A;  5KI6 A;  4ZHR A;  4BAC A;  3D0P A;  1BIS A;  3QER A;  2LSN A;  1GOB A;  1VSJ A;  3VQD A;  4EP5 A;  3SQ4 A;  3O3H A;  2QKK A;  3KKR A;  3ZT2 A;  1D9D A;  4CK1 A;  1JXB A;  1RBS A;  1NK8 A;  3SNN A;  1VRU A;  4H8K A;  1NKC A;  4CJR A;  5KTQ A;  2KW4 A;  1T8E A;  4CJP A;  2D5R A;  1ZBH A;  3A2F A;  3KLF A;  1J53 A;  3SCX A;  4DQS A;  4B9T A;  4KTQ A;  1DLO A;  3L2V A;  4OLA A;  1CZ9 A;  4UQG A;  3PV8 A;  4DMN A;  3AO1 A;  2WON A;  4J2D A;  2RF2 A;  4N5S A;  3LP0 A;  1JLF A;  4ZTF A;  3NGZ A;  3ZT4 A;  2OPS A;  1Q9Y A;  3RR8 A;  2YNG A;  3ASM A;  1T7P A;  2PYJ A;  2F8T A;  2FBV A;  1NJX A;  3V1R A;  3RMB A;  4KAZ A;  2OPQ A;  3VA0 A;  1XHX A;  3DLE A;  2D0C A;  2HND A;  1UAX A;  2BDP A;  4Z4I A;  4LH5 A;  1NJW A;  5C42 A;  3TAP A;  3VQE A;  4DU3 A;  4M3W A;  1B9D A;  1IKV A;  4CJU A;  2Z1J A;  3OYL A;  4CF8 A;  2YKM A;  1A5X A;  3EYZ A;  4O0J A;  4CJF A;  4K8Z A;  4W5T A;  3NF6 A;  4CFD A;  1BL3 A;  4Y1C A;  3G0Z A;  3MEC A;  1Q9X A;  4Z4G A;  1WSI A;  3VQP A;  2IOC A;  4O55 A;  3QLH A;  4FLZ A;  3V9S A;  1BQM A;  3OYB A;  3S9H A;  3TAQ A;  1NOY A;  2HHX A;  3PUF A;  1VSD A;  3V1O A;  3K58 A;  2VG7 A;  4JRP A;  2OA8 A;  4J2B A;  1RDC A;  2B6A A;  4O44 A;  4C8M A;  3AVG A;  1BI4 A;  3AVC A;  4CJW A;  3AVB A;  3OYJ A;  3OYE A;  2W42 A;  2R7Y A;  3I8D A;  3F73 A;  3KJV A;  4KV8 A;  4DFM A;  4DSI A;  4FLV A;  3LPU A;  4OVL A;  1RTH A;  4CEF A;  3U3Y A;  2P5O A;  2VWJ A;  1L3U A;  4ID1 A;  2OPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...