4LH6A

Crystal structure of a liga inhibitor
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
322
structure length
322
Chain Sequence
EQQPLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFPPEEAET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification through structure-based methods of a bacterial NAD(+)-dependent DNA ligase inhibitor that avoids known resistance mutations.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Ligase/ligase inhibitor
molecule keywords DNA ligase
total genus 113
structure length 322
sequence length 322
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4lh6A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4lh6A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4lh6A02
2CFMA 4DR1B 1XMQB 1CKMA 4UCOA 4UCRA 4JV5B 5FPRA 4DR2B 5BR8B 4JI8B 4JI1B 2HVQA 4LFBB 1HNXB 3GJXB 3PN1A 4LF7B 4JI7B 1IBKB 4EFEA 1N36B 1XNRB 5D1OB 4YY3B 1FVIA 4PZ8A 3VNNA 3L2PA 5IWAB 2VQEB 2UUCB 1P8LA 2Q2UA 5FPOA 2Q2TA 4UCVA 5D1PA 1XNQB 1XK5A 1IBLB 4NXNB 3BA9A 4AQYB 2UXCB 2VUGA 3W1GA 4UFZA 4JI2B 3OTOB 2UXBB 4JI0B 3NBYB 1CKNA 2UUBB 4KHPB 4B3SB 3UQ8A 2OWOA 4UCUA 4UCSA 4LF4B 3TY5A 3W1BA 4CC5A 3TY8A 2ZM6B 4DV0B 3BAAA 1I94B 3S24A 4B3TB 4YHHB 1X9NA 4LH6A 3W5OA 4LF6B 4OX9B 4LFCB 4DV2B 4EQ5A 3JSLA 1HR0B 1ZAUA 4X66B 1CKNB 4DV7B 4DV3B 1N33B 2E5LB 4LFAB 4TOIA 1A0IA 4DR4B 4DV1B 4DUZB 1N34B 3GDEA 5LMUB 1HNZB 4PZ6A 1DGSA 3RTXA 1J5EB 2HIVA 2HVRA 3TY9A 4E6NA 4JI3B 5D1OA 2F4VB 2HHHB 1VS0A 4K0KB 4LF8B 3BA8A 3BABA 3SGIA 4GLXA 3KYHC 4DUYB 2HIXA 4X64B 5LMNB 4UCTA 2UU9B 4EEQA 3JSNA 3T1HB 4DRFA 4JI5B 1FJGB 4GKJB 3NC0B 2UXDB 4PZ7A 3T1YB 4LF9B 1B04A 3RR5A 3NBZB 4LH7A 4DR7B 4X62B 4DR3B 4JI4B 1TA8A 2HVSA 4B3MB 4JI6B 1N32B 1TAEA 4X65B 4B3RB 4DR5B 1XDNA 5DISC 1XMOB 4DV4B 4CC6A 3QWUA 4GKKB 4NXMB 1HNWB 2UUAB 2VQFB 1P16A 1S68A 4EFBA 4DV6B 4JYAB 4DR6B 3GB8B 1CKOA 4LF5B 4DV5B 1V9PA 1IBMB
chains in the Genus database with same CATH superfamily
1AP6A 2WB1E 1Y1WG 4DR1B 4RQFA 5DMXA 1W0JG 4J9OA 4DR1H 1TWFA 2DQ0A 4I50B 1R1BA 4CS4A 1M0WA 5FNVB 3G4SV 2ATLA 5A2QN 1TWCA 1QQCA 4YY3H 1VQPV 2QKAA 2DYRC 1RYRA 4IHJF 2J6UA 3GJXB 3GB7C 2WWWA 4ED1A 1KT8A 1WRVA 3ZS8C 1RSOB 4IAJA 1RFYA 1CP9A 2HJDA 2PN1A 2IMWP 3ABUA 3FD9A 1ZL8A 1M90W 2XTAA 2ILMA 4B3RO 3OSNA 5CA0F 1WSCA 1AB3A 1NKDA 1C3OA 1Y76B 2R72A 2A7WA 5D1PA 2B1IA 1I0HA 2V1DA 3T2MA 3R9RA 3FKIA 2CH7A 4R7CA 4H44B 2AZ0A 2WLKA 2P7TC 3JAKB 4CKEA 3W1GA 4BXXG 2OIEA 4UFZA 1IURA 3SYAA 4JI2B 3K3VA 4F50A 2NUAB 4O2AA 4NLGA 2R7MA 1Q81W 4B3RH 3TQ1A 2QJ1A 2MCTA 5CA1F 1W2BU 4OXSA 1PM9A 3AX6A 4ZHQF 3W5OA 1SQPH 1OV9A 1PNMA 3JZ6A 3JD2A 1KUQA 1M6VA 3TGUH 1PD3A 3T9CA 2NVXA 4YP3A 4EYIB 1NVPD 5FD6A 5K3WA 4A2AA 3GIJA 3N6XA 3CSWA 1VP7A 5BYAA 2PMZA 3BVOA 2A79B 4BBSG 3MHHC 4ICGA 2HIVA 3DXRA 1JDBB 3GV8B 1GO3F 2Q73A 3RYIA 1NT2B 3JD4A 2HEPA 3ZMUA 4J10A 1HNWO 4BIOA 3E22B 4I5SA 2IH1C 1YTFB 2GDSA 4DV6O 4EG0A 1RM1C 1QLEC 1R3IC 4O7LA 1XI1A 5KX5B 4DR7B 4RQEA 1WPBA 5C4XG 4DR3B 2WLHA 2UXBH 4A3LG 1O75A 4R50A 1HNWH 3MR3A 2HR3A 4A2BA 3VQXA 4OPAA 4Y8VB 5I5TA 3ASOB 4NXMH 1Z5VA 1BSMA 1OCOC 3RBDA 3LNMB 2UXBO 4UUGA 4JYCA 4PWQA 4A3KG 1NBMG 4QIWE 5I5XA 1SQQH 3T5KA 2GUZA 2YWVA 4UCOA 4O7TA 2PI5A 1XOUA 1AJPA 4RB0A 2ZE8A 1VF6C 1EKFA 4M0JA 3CQZA 3T1HH 3RBZA 1Y6XA 4LFBB 2B9ZA 4WFGA 2WLJA 1VQLV 4K35A 2IW5A 2WYOA 5C5JA 3CCEV 4A3IG 2X0LA 4XZ3B 5I47A 4IZOA 2RF4A 5JJJB 1IVSA 5IYZA 4QGPA 2LW1A 1KKDA 4JV1A 4BY7G 1W0KG 1VQMV 1EFRG 4J9PA 2W7PA 1E4FT 3B8MA 4MTEA 2XGPA 2AGAA 4I9WA 3HOVG 3RVZA 1P84F 4JV5O 3AG2B 4O3OA 3VPBA 2C2EA 4AQYB 3M8AA 4N21A 2UUCH 4WFAV 3VOUA 4WFBV 1N32H 2B63G 4B08A 5KHKA 4DV7O 5JQGB 3ABMB 1XNQH 2WLIB 1EM1A 2KKWA 5KMGB 1WH2A 4G3IA 2IJJA 2ZIOA 3VA7A 1K34A 2W71A 3BAAA 4DR7H 4YHHB 1JX9A 4QWAA 1IX9A 4DR5O 2YI8A 2COJA 5DAAA 4LFCB 4XX0B 1HDJA 3SE7A 2UUCO 1GO3E 5FJ8G 2ITCC 5D8DA 4CKBA 1ZAUA 1N0NA 4X66B 4DV7H 3RAQA 5CB4A 2LP7A 1XNQO 4DL5A 1EZ1A 5JCOA 4JYBA 1I1MA 3L9DA 1NH2D 4FPPA 1GLVA 3RTXA 1AN7A 4EEYA 4EBCA 1Q8IA 3KKYA 2P06A 3B2EE 5D1OA 2F4VB 2HHHB 2W57A 4HN2A 4TQFA 3W7SA 4DUYB 2HJWA 2FE3A 3JCUZ 1VQNV 2WLMA 3T1HB 1TVKB 1MZEA 2Q0AA 3I55V 4LF9B 2PVPA 2DPIA 1QVFU 5KFBA 1NU1H 2YZNA 5I5UA 4R8CA 2JIZG 5LP6C 3BACA 1M1KW 2Q6AA 4O4HF 4X65B 3Q8QB 4MW3A 4RUAA 4DR5B 1R6KA 1A48A 4MA5A 3L4KA 3RB3A 1QHTA 1UC8A 5L3EA 4UV8A 5DGAA 1KC7A 5DG7A 4FLXA 1B33N 4P30A 5DLFA 3G67A 1F4MA 1SQFA 1JKJB 1SERA 1TUBB 3ABKC 5EWEA 5LP6A 3N42B 4KFMA 1ROPA 1V9PA 4DV3B 5J2UF 2QSAA 3K3WA 1Q43A 3OUSA 1WN7A 2R7NA 1HNXH 2VA3A 3K5IA 4CH3A 2WLNA 3W7WA 4JI8B 5LMNO 3WG7C 5C1OA 2J6TA 4NZOA 1K92A 1R3JC 3QF7A 4O2BB 1F7YA 1M57B 2W0XA 3H1IH 5KFRA 3RYFA 2QWNB 3ETEA 2QB5A 4HYKA 4ZOLB 5C8YF 1JFFB 2EJ3A 3T5HA 2B63A 5FPOA 3MR6A 4W4KA 3RYCB 2NU7B 1COWG 2ODTX 3FFQA 3UM7A 1JX4A 2DIKA 3JAMN 2HHHH 4AILC 1T36A 2WSSG 1FXKC 5EZYB 2VPSA 4DR6H 2V4RA 3L75H 1AJNA 4I7HA 1OCCC 3WB2A 4BIZA 1KBLA 1YI2V 2ZM6B 2R8HA 3CB2A 2KB1A 4ZI7F 1FAFA 4DW0A 2NNUA 1E1QG 2Q9LA 4Q4DA 3TIGA 2R7KA 2W8KA 2X6CA 1CKNB 1SESA 3QZ8A 4MVRA 1S76D 1N33B 3RWRD 5IYCO 4MV8A 5KFAA 1JR9A 2XAFA 4JF3A 1Q6UA 4X1IB 1YVWA 3AG4B 4ECYA 1K83A 4DLKA 4ZOLA 1NZ6A 4DAAA 2KSWA 4FZ1A 4UB6Z 1H2SB 2W9CA 2WLLB 4FK5C 1VS0A 1I7FA 1L0NH 5LYJB 5KFMA 4JZGA 4MV7A 4TVIA 5CE8A 2JGDA 4FS1A 1WNSA 4I50F 1A9XA 5LA6B 1Y74B 2YI9A 2FL4A 4LFAO 4G27B 4RB1A 4LH7A 3DGEA 1Z2GA 4PI2A 3OUUA 5EYPA 1JMKC 4YJ3A 5LHHA 5DQHA 1HP8A 2HVJC 1WAZA 2W6JG 1M56C 1V55B 3OEEG 3E86A 1WJZA 3O65A 3UT5B 4JI5O 1RK5A 5B66Z 2OIGA 4ZBMA 4GKKB 1VBHA 2NU8B 2W8LA 4EFBA 4DR6B 4JUZA 1YTFD 4TT3G 2CFMA 3N2GA 1KQSU 2R7LA 1IYDA 2CTQA 1VQ7V 3GV5B 3J80W 4UCRA 1DAAA 4HNAA 3TINA 3P3NA 3PW2A 4HBNA 2Y69B 1FKAH 5KKNB 2GPSA 5T14A 4PJ0Z 3HKEA 1EBOA 4H37A 4AQYO 1M9NA 2UU9O 1VF7A 4IHJA 1BL8A 4GX0A 1BGWA 2E3CA 4LF7B 1SZTA 4ZOLF 1R3KC 2DN9A 1IBKH 1GN4A 5D1OB 4YY3B 1TUBA 2CDYA 1FKAO 2EINB 3VNNA 2LW7A 2VWKA 4AQYH 3KHGA 1XBLA 2QM4A 4O4IA 3RYIB 5AG2A 4Q6GA 2CGNA 2BSKB 1XNQB 1VIBA 1UJWB 2CTWA 1IBKO 1OWTA 5JJNB 1H2NA 4TM5A 3NR7A 1K97A 2YIAA 1YCIA 5EK0A 3NBYB 3PO3G 3T4DA 3UQ8A 2JGUA 1F4NA 1XNRO 4UCSA 5BZBA 4CC5A 1R6TA 3AW8A 2YDEA 1U96A 1MNGA 5IJ9B 5JVDB 5GONF 4TQDA 3CCQV 5FNVF 3L71H 3E83A 4QE7A 2YEVA 2PYLA 2Q7EA 2C2AA 4FLTA 4Q8EA 5KX5F 1KD1W 1BZKA 2OLSA 4O4JF 4XDJA 4QPKA 4JAAA 3GTPA 1M93A 1XHZA 4LF9O 2VUMA 1XNRH 2RCVA 4O84A 3LSSA 1BHAA 2RDIA 4C5CA 5LGUA 2UXXA 1G8MA 4TV8A 4P9PA 2PI4A 4JI7H 1J5EB 4YIPA 4DIMA 5DQGA 2F93B 4DV1H 3ZRXA 3OAAG 4PA9A 3LQSA 3APOA 3N27A 4A5UB 4DUZO 3NC0B 4JYAO 5C3EG 5L1IA 5IP9G 4O7SA 4NYEA 3MWMA 3JASA 1NTZH 1XILA 4O81A 4X1IA 4J42A 1ZHQA 4U7NA 5KG0A 1N8RW 1TAEA 4O3RA 5FLXN 1YEWA 3D36C 1RJPA 2Y0SE 4I55F 3VBBA 1YJNV 4YHHH 4F6RB 1BS3A 5LL6b 4F4WA 2HP8A 3AG1B 4J7JA 4LR3A 5KS8A 5IYZB 4PDBA 3GTKA 3Q8PB 5A2QW 1OCRB 3J7AU 4JI0H 4DV5B 4I55B 1G1XB 2E2HA 2YZMA 3O9OA 1CKMA 4J80A 4MVZA 2GSMB 4YHHO 2C22A 1IDSA 4B7KA 4OPHA 1MSDA 3SYPA 4JI1B 5DN6G 2FLPA 1MZFA 1FXHA 5JQGA 3G8CA 4JI0O 4UVAA 4IIJB 4JI7B 3OHBA 4ECQA 1KJ9A 2HJFC 3ZBHA 5L3CA 1TGOA 3RFRA 5LHIA 5KFZA 2JA8G 3HPLC 4AYBE 1SQBH 3AG2C 1TWGA 3E8GA 4WFHA 2R87A 1XK5A 3JYCA 2Q7DA 3ETQA 1TWAA 4RNNA 1NJIW 2F95B 4RO2A 2Z02A 4QJFB 1QR8A 1RK6A 4UCUA 4WBNB 1N36O 4I9QA 3T54A 3QVNA 2GUZB 1GM8A 1I94B 1AI4A 3TEKA 2YIDA 1RPOA 4ZIBA 5L1KA 4DQNA 1Q6HA 5BWUA 5GONA 4QWEA 5ITZB 1JJOA 3GWKC 2W6NA 1AI7A 3Q8RB 1Y4MA 5JWPA 3U0ZA 1FD9A 2WPDG 4TSFG 3CCMV 4RWUA 2CH7B 3HKZA 1N36H 3UYYA 4LFCH 3G6VA 1S0MA 2JA5A 2CE4A 3AG3C 1UFIA 4RUFA 4TV9B 2P4VA 3VQWA 4X66H 2ZXWC 1VQ9V 3U9TA 3FX7A 2HVRA 4YAKB 1KB9F 2DYSC 5DG9A 4XYMB 3C3TA 2GQSA 1JCHA 5DG8A 4GLXA 1X4TA 1L1FA 4MV4A 4CKCA 2P0AA 4FM2A 2W9AA 4O7VA 1M4UA 4Q4CA 4X66O 3CJHB 1P4RA 2N05A 3STLC 1XDCA 2Q68A 1B04A 4R8UA 5LBQA 1IXMA 4DR1O 3M9MB 3GIKA 2WDTA 3FB6C 3K0DA 2QWRB 2XGQA 1K73W 2XNDG 4PDMA 1XMOH 5LL6Y 5L3DA 2LJ2A 3QWUA 4ASUG 1BCCH 2UUAB 2E2IA 4O7NA 3ZN0A 1S0OA 3K03A 4X8AA 5BPHA 1FXVA 2R9IA 2A06H 3WNZA 3D36A 4CMFA 4CS2A 3HKCA 2XHBA 2Y4RA 3H20A 3ZRWA 3OD4A 1EKPA 5HNEA 1Q7YW 3CRAA 5IYDG 3ABMC 4H13B 5LA6A 2W0FC 4LF5O 3MR5A 1A0GA 3HR0A 2HFEC 1VKZA 4O3QA 4D7SA 5IYBO 1OBGA 1AR5A 2XOKG 4B3TO 3T9AA 1ZETA 1Y1VG 2UXNA 5HFMA 3RAXA 3BQ2A 1EUDB 3SYCA 2ZDIA 3H1KH 2V59A 1S5LZ 3CCVV 2VQEH 4DW1A 1LR1A 1ZTEA 3RV4A 1WLEA 5D5PA 2WAQA 3VOTA 1VF5B 1I7NA 4PA4A 5FD5A 1PL0A 2KSDA 3G71V 4FM1A 2B5UA 5IYBG 1JA8A 4RU9A 2JA6A 2CUGA 5CBGA 4O3NA 5H9CA 2IJIA 5EIBC 1NVPB 2XC9A 4M7EA 4KHPB 3M9OB 1HWYA 1L0LH 3TY5A 2WAQE 2ZR3A 2GTAA 1KU9A 3DC6A 3OUFA 5KT4A 4CH4A 4O3PA 3JRXA 5IT9N 5BWVA 5EC2C 5KFYA 2GLTA 4DK0A 5L3BA 1YITV 4B3SH 4PA3A 3G6EV 2RMKB 5C93A 5C8YA 2FLNA 3ABLB 1KJJA 5E1AC 4UUJC 4O7YA 5H5NA 1BMFG 2JEUA 3ABLC 2CQYA 4F4ZA 5JVLA 3D8CA 2E5LH 4B3SO 2WLIA 5KMGA 1GYFA 2C00A 4ED3A 4X9QA 3UT5A 4I0XA 2PUSA 3RB6A 2MW2B 3BA8A 3BABA 4CHIA 2R8KA 2UU9B 2ASLA 3GTMA 3QFFA 2JEFA 3DTUB 4MVOA 2E5LO 4WFFA 3VQYA 4KHPO 4X64H 4MTDA 4RNOA 4Z1MG 3BPZA 3UCSC 4ZKIA 4LF6O 3HOXG 4DV2O 5DISC 3LDEA 4FFKA 4ABMA 4CC6A 4DV4H 2AHZA 4ZQIA 4ECXA 4KHPH 4O83A 3CPWU 5GONB 2SCUB 1SETA 1L8DA 3CEIA 3N43B 4RB3C 2W9BA 2BCCH 3GB8B 2KG7B 3FYIB 1CKOA 2VUMG 2LGWA 4LF6H 3J7AK 2OT5A 4DV2H 5BMVB 2EIYA 4JV5H 4TUYA 2OH2A 4DR2B 5GW7A 3T5JA 1AI6A 4IR1A 3ORRA 3EVKA 3RB0A 1YJWV 3H9VA 3UZOA 4FS2A 1Y74A 1C30A 3MFHA 3HKZE 4FFRA 1T5EA 4PA6A 2YIBD 3QQMA 4DR7O 4HZ3A 3PW7A 3OUZA 3K08A 4DR5H 5IWAB 1F51A 3M4IA 1ZWIC 2E75B 4K8XA 3SJBC 3ZHSA 5KHIA 2JA7A 2R9AA 1E4EA 4YBZB 1VQ5V 3CXCU 4JI8O 1KJQA 2UXCB 1QLEB 2YXLA 2DMXA 4PDLA 2UXBB 2BQ3A 1FFTB 3P32A 3S3WA 5J9PC 1XHXA 3CCJV 3OTFA 3U11A 5K1PA 5IE9A 1AJQA 1SF9A 1S0NA 2FB9A 2EIKC 3FB5C 4MA0A 5B1AB 1B6RA 1T3NA 4TUYB 4AYBA 2GBOA 3H3VH 4G28B 4RZQA 4JI8H 1J5EO 4O4LA 5LOVB 3OTOO 3K57A 1HR0B 2ZCEA 2NU6B 4DV7B 2FPIB 4LFAB 1NTMH 2PYJA 1NI8A 5HV6A 3ZMVA 4LMYA 2ODMA 4HAMA 3OMIB 2H3OA 1ZQ7A 1M57C 3RYHA 1J5EH 2R93A 4J9MA 1PL4A 5C44G 1K8AW 2CW7A 5CBHA 3EPGA 4R6ZA 1CPYA 2HIXA 4WBNF 2NLJC 3I4MG 4KXRA 2FB5A 1FJGB 1KC8W 1FJGH 3RR5A 5CAEB 3CCRV 2ZQMA 1FPOA 5B1NA 2HVSA 2Y0SA 5KFIA 3OSPA 5LP6B 3K3PA 3UFXB 3GTJA 2YRXA 1GH6A 1Q90D 5EZYA 2ASDA 3TCUA 4ECTA 4NKGB 2P67A 1EUCB 3G80A 2M7WA 1WP8A 4I0XB 4JTAB 4CS3A 5BWRA 3PFFA 5LXTB 1HNWB 2YIBA 1P16A 2UXCH 2LGQA 2QR4A 3I4NG 4QJFA 4Q0YA 5LMUO 3PO2G 1SKVA 4IHJB 5H2FZ 1DF4A 2UUBH 2ZDHA 2Q7HA 4C5AA 2HHHO 4NZMA 2PF4E 4L1KA 5KFSA 1P7GA 4QW8A 3PZPA 2IJKA 2Q69A 3Q4HA 2HVQA 4C7UA 2ZDGA 4RCNA 3V4ZA 4DL2A 4ECWA 5LMUH 4K0KH 3HOUG 1G4YB 3SPGA 2UUBO 3CRMA 3KCYA 4FBTA 1XNRB 3AK3A 3C0FB 4X1KA 5KT6A 1MG1A 5KT5A 3RB4A 4ME6A 2M6YA 1H2MA 1VQKV 1DV2A 1I7LA 4I50A 2JK5C 3N8DA 3SDLA 1CE8A 5K2MA 4DR4O 1YF2A 1K1QA 2L35A 3BCCH 3SPHA 3VMMA 3JAWA 1HW7A 1S0VA 5LOVF 3MAQA 4DV0B 1KTAA 3S24A 2EZPA 1H8EG 1PP9H 4YQWA 3F5TA 1EN6A 4LBEC 3JSLA 1FXKA 4JI3O 1R73A 1M0TA 3N6RA 3ETHA 1N33H 2G38A 4ECUA 2J9GA 5FR9A 1PX2A 5EBMC 2A0LA 3QZ7A 1GM7A 1K7DA 3FAVA 2BQRA 1IBMH 4XDLA 4JI3H 3PVXA 1I94O 4NTYA 4E6NA 2ASJA 4JI5H 4J9QA 4K0KB 3GTLA 2XD4A 2FKLA 1VBGA 4X20B 5KLVH 2R70A 4X64B 5KHJA 2Z04A 1SRYA 5L1JA 3CRQA 3CYOA 3RN4A 3SPIA 4PZ7A 1S5JA 5BYBA 3ZMZA 4YIOA 1JXLA 1IBMO 3K58A 2X0SA 3D3IA 3GVMA 4X89A 4JGSA 3OFNG 4K3AA 4WHXA 4IR9A 1TUEB 4NZNA 2CTPA 3OHAA 4BBRG 4O2AB 3TXSA 4PDVA 2XCAA 5HFLA 4GKJO 3E8FA 4RUCA 3AK2A 3CCSV 4ZHQA 2VPQA 5KFKA 2PTMA 1I6UA 5B3SB 3HKDA 4LF5B 5KFXA 3KHRA 2W7OA 5KX5A 1XMQB 1Y66A 5FLMG 2QDOA 5B3SC 2BTQA 2QTSA 4MTOA 5FPRA 1D5NA 3W7XA 1K1SA 2CW8A 3ZEDA 4YXWG 4J9YB 2EIJC 5EOYA 3OT7A 2F1MA 3H40A 2XAJA 2QKCA 2FMLA 2JDIG 4DL6A 3M99B 3PN1A 3AG3B 2DLNA 3KREA 1I08A 4LF7H 1KECA 2ALZA 2YZLA 1N36B 4IRDA 5JCOC 4FFOA 5CM0A 4A3BG 5B1BB 1PKXA 3IFXA 1I2KA 3L2PA 3J81W 1QLNA 2VQEB 4WCEV 2ZR2A 3FAVB 4GUNA 1O9GA 4X62H 1BHBA 2P4KA 5KA6A 3ZHTA 3U9SA 2JA5G 1SYXB 2EULA 4F4YA 4M9UA 1L2ZA 1IBLB 4NXNB 4NXNH 4E4TA 3LSQA 4JV0A 1QR9A 2FTKA 1I2LA 1DF5A 4MV1A 3HXLA 4JI7O 4R8UB 4CBCA 3GIPA 1MOFA 2DAAA 4ECVA 4J41A 4XDKA 5LYJF 1I3QA 1FYJA 2QWOB 5JUMA 1V55C 3RYCA 4DV1O 5JQWA 4LSXA 1KP3A 4NVPA 3ZHUA 4A3DG 2LFSA 4IGGA 5GTIZ 4NXNO 3CEBA 3HBLA 3VPCA 4XYLB 1VQ6V 1GKFA 3JCZA 4DUZH 5CB4F 2O03A 4APMA 2BOBC 4J9ZB 1N48A 3P30A 2MK3A 2YL2A 3G6BA 2R86A 1A32A 4DV1B 1JVMA 3FKSG 3BEHA 4NYKA 3IG0A 3FDSA 5KT2A 2ADQB 3SGIA 4X1KB 1IYEA 5ITZA 4YJ3F 1OCZC 2YS7A 3T9FA 3B40A 5IDJA 3KHLA 4A3MG 3JSNA 4O4IF 3ZIAG 4DRFA 3RVYA 5KFVA 4Q44A 4FZ0A 2K1EA 3T1YB 4OGQB 2W6QA 1K5QA 4PD4F 5EZYF 5EIBD 2P90A 3RF2A 3RJ0A 4Z1VA 4BY1G 1S97A 4JI6B 2HVKC 5IYZF 3L74H 4TV9A 1RM1B 4TQSA 4XBFA 3PW4A 3KAKA 4C2MA 4DV4B 2PGGA 5L9XA 4GYCB 4JV2A 1M56B 1AILA 4FGRA 1Y1VA 2QEXV 2QTOA 5J2TA 1S68A 1HR0H 3CVZA 4MVMA 4DXWA 2W6PA 2Q0OC 3GV7B 4J9KA 2R92A 1SQVH 2H8PC 5H6QA 2PBZA 1W59A 2EJRA 4MW8A 3T7AA 2NR5A 4FU0A 2RGRA 2QK4A 3OGCC 3GTGA 3IC7A 3E5NA 2CNUA 4I55A 1ZSPA 3GIMA 4DUYH 3ZRSA 1AI5A 3M9NB 1Q86W 5L1LA 3ASNC 2F23A 3CP1A 5KFCA 3L70H 1NR7A 2FYUH 2AGOA 2VR1A 5KFOA 3ZCCA 2V4DA 5BR8O 4A93G 1S77D 3HO8A 3CRRA 1OBDA 1NR1A 3R5FA 4UCVA 4PDRA 1QU7A 4DUYO 3BFRA 4LFCO 3K79A 2JEJA 3JATA 5IT9W 4IT5A 2XT9A 3HOZG 3K9SA 2DWDC 5K1XA 4J9RA 3DXRB 3EHBB 3GWOA 2EBOA 3RYFB 2DQ3A 1KYOF 2EIJB 5CBFA 3KZIZ 2YXYA 3JAKA 4BW9A 1H2KA 3I56V 3CC7V 3KXYT 5KFUA 4DL7A 1YZBA 2ZE6A 5KFDA 1H38A 1H2LA 5LGTA 1GGOA 3ZRVA 2JEXA 3HKCB 4F4LA 5LMUB 3JD1A 3ZX6A 4U7OA 2BOCC 4DO2A 4JI6O 2UXDO 4YAJB 3LULA 5IYCG 3RUPA 3WB0A 4FFLA 2VRZA 2DABA 2ZXWB 1B6SA 2YS6A 2JA6G 3QTCA 1XMOO 1S3JA 5J2TF 4LF8B 2X7RB 4J11A 3KYHC 4LF8H 1JLLB 1GM9A 3HT5A 2YEVB 4FJCC 4QIWA 2UUAO 2ZNIA 2V5AA 2EIMB 2UXDH 4LFBH 2UXDB 2IBKA 3JALA 2VOBA 3V4SA 3K5NA 2WA3A 4JI4B 1UC9A 4QWCA 2H94A 4LF8O 2R8IA 1VMGA 4RAZA 1WCMA 5LA6F 2UUAH 3ZHVA 5DGHA 5BY1A 4Q43A 3ML0A 1BE3H 2BE3A 3ORQA 4LFBO 1QCEA 4LF5H 2WE6A 4MAMA 2FK2A 2XAGA 4DK1A 2JRIA 5KG7A 2CZGA 4FLYA 4EBEA 4B3TH 3OR7C 2EIKB 3N44B 1K3EA 5B1OA 5DGBA 3RGZA 2EILB 3CCUV 3SYOA 1ZX3A 2VQEO 3RBEA 1PNKA 2F43G 5IYDO 4B3MO 2N04A 2QE7G 4FFNA 2DYRB 2UVVA 4LC1A 4JXUA 1OHHG 1Z5WA 3SPCA 4HR7A 2CGOA 2Y4TA 2ADPA 3LDDA 1V4YA 2PMZE 5IP7G 4MVQA 5B1BC 2BSKA 2JJ1G 4FM0A 2AQ4A 4MTGA 1SA0A 4YJ2B 4PA7A 4ECSA 4B3MH 5KUKA 4QWBA 4LCUC 4LWSA 2J6SA 1K5SA 1K9MW 2X6AA 3GTQA 3T9EA 1CS0A 2FKXA 1WPXA 3JRWA 1WA8A 1JQ0A 2Q2TA 4NTXA 1FXKB 5BWWA 1MZBA 4JASA 1LNQA 3MHSC 3ETJA 3HOYG 4MVSA 3B4SA 5KG3A 5KG5A 5KG1A 3MJFA 1US6A 5EC1C 1Q82W 5C8YB 1GSOA 4FFMA 4GKKH 3B77A 4K6NA 2OWOA 3T99A 1S10A 4YJ2A 4LF4B 3NUAA 4JZ2A 3TY8A 1N0JA 1OCCB 4GX5A 3B8NA 3FB7C 2Z5UA 2C2RA 1VQOV 1ZLZA 1N56A 1ZL8B 2CKZB 4A3EG 3OM3B 1B06A 3RGXA 2QGNA 4DV0H 2WLLA 1Y1WA 1E4EB 4YR0A 3KG2A 4TOIA 3SJAC 1GN6A 3W7TA 4X64O 3DSQA 3UO3A 2YZGA 2BTOA 3WWHA 1N34B 3GDEA 4LP8A 1MMMA 2COIA 3ABKB 4FIPC 4FVMA 2LQTA 4W4LA 1XMQO 4PBCA 2RQ6A 4DV0O 5BWTA 4DV4O 2OTJV 5CN0A 5KFQA 4PHZA 2WB1A 3T9BA 1S03G 1GRJA 4AHCA 4MV9A 2QYZA 5I5YA 1UPGA 4IRCA 1XQ8A 4GT1A 3RT3C 1N34O 4JI5B 1RPRA 1V54C 3CHXA 4EB6A 1WCMG 4F6RA 1JOYA 4O4HB 3OMAB 3RW0A 3NBZB 4DRXB 4B3MB 2Q4PA 2XASA 2V7QG 3MWEA 4CE5A 1G2WA 2R8GA 4MV3A 4EGJA 3WWJA 4FM9A 3CD6V 2ZDIC 3WWIA 4G2KA 2M05A 3G8DA 1EN4A 4GC6A 3K5LA 4U3JA 4I4TB 3OE7G 3N2KA 2JEIA 5I5VA 2Q67A 2XCLA 1EKVA 3A0HZ 3IJ4A 1BNCA 4MSWC 2ZT9B 4GLWA 2ZIMA 4BR6A 1PK8A 3FYEB 2Z0AA 1ZUQA 1KUTA 1SC5B 5DQIA 1EZJA 1JDEA 3EYYA 2ZKOA 2UVUA 4TUYF 2C35B 4J9SA 4GC7A 1GN2A 2YUAA 5JH7B 2EX3A 2NN4A 3TIIA 3EXAA 5KFHA 3CJHA 4UVBA 2EINC 5KFGA 3LWBA 4UVCA 4R7RA 2V4QA 2CK3G 4D7TA 4PZ8A 1EHIA 4IIJF 3N41B 2UUCB 3CRCA 1PV0A 1MABG 3OMNB 5CA0A 3OTOH 3V6KA 4I7ZB 4FFBA 3T5LA 2WA4A 4IWXA 3UKMA 4GZRB 1YSCA 4QW9A 4ED0A 1V51A 2UVRA 3U54A 1U97A 2RJZA 2ABJA 4MTXA 1KBHA 2HDKA 4JI0B 5DECA 2UVWA 2UUBB 1V54B 1D5AA 3N40P 3X2QB 3F7VC 3QO8A 4H0LB 2A1HA 3CC2V 4KUMA 2R82A 2XUMA 2YS8A 1EYZA 1QVGU 1AUVA 2W9BB 4EQ5A 1FJGO 3CXHF 3MDSA 3UO2A 4ETSA 4TV8F 3TQTA 1WB7A 3D3QA 4JPRA 4JTCB 3PR4A 5FNVA 3SJCC 2IU3A 3OGIB 2VA2A 1CXZB 4WD3A 5IJ9A 4DUZB 4Z2WA 2WAMA 2BQUA 3ZJZA 4O2AF 3Q8SB 3BY6A 3TJTA 5LXTF 3ZHRA 2JEGA 1OCZB 4K8ZA 4DL4A 2DWEC 3WFVA 2K9PA 4O3SA 1PNLA 4EEQA 2UXCO 1P7BA 1EN5A 2YW2A 2R9RB 1BQZA 4RUEA 2IU0A 2OCCC 2EJ0A 3BQ1A 5KFJA 3N2KB 1OZ0A 1N32B 2V58A 4HNTA 3HKBB 1GN3A 1W93A 4YJ2F 2D2CB 5KG2A 2RN9A 3E22A 2XAHA 4YR3A 5IJ0B 2JA7G 4NB5A 3BQ0A 2R84A 2LO1A 2IA6A 1KP2A 4K0KO 2AGQA 4H33A 3MR2A 1NH2B 4GX1A 4Q8FA 3TETA 1OCRC 4J7ZA 4O2BA 5KT7A 5KHHA 4RZRA 1SQGA 1VEWA 2DJVA 2RNBA 1KKCA 2AHYA 4QNHB 3DTFA 5JVDF 3V6HA 2QF7A 2IH3C 3JD3A 2PZSA 4DV6B 4O7WA 4DV6H 2ZE5A 1YXBA 2FP4B 2YCHA 1URFA 2GV9A 2YC0A 1PPJH 3G6YA 2FK3A 5BR8B 4DR4H 3H4DA 2KG7A 2DZDA 3GIDA 1RJQA 4B7EA 1E4GT 1J95A 5EWFA 1SEIA 4NXMO 4EFEA 4LF4O 2DPJA 2ZM6O 1JJ2U 1SCUB 5EYPB 4U6PA 3HKEB 3WU2Z 4ECRA 5EBWC 2HG8A 1N33O 2VS0A 3U0GA 3F7YC 2YSUB 4LF4H 1RSOA 3BA9A 4HYOA 3T1CA 2CNVA 2ZM6H 4Q45A 5KUMA 3T1HO 1O9HA 3A2FA 4O7RA 3RYHB 3V6JA 1R6NA 4DV5O 3T1YH 1WA8B 1GTOA 3OR6C 3W1BA 5JH7F 1I94H 3DTGA 1YHQV 4B3TB 1X9NA 4D6TH 4O2BF 5DM6V 3NGDA 2Q7GA 3BJYA 3PW0A 1BXRA 3STZC 3LNNA 1XREA 1VARA 3HKDB 5JQGF 3PR5B 1R3LC 3THOA 4IRKA 1H8HG 4X88A 1IBLO 3T1YO 5KFWA 5LP6F 4DV5H 3BG5A 5KAIZ 4ZI7A 1S72V 5FL7G 4LNUB 3T4ZA 5BMVF 3CMEV 4GX2A 1Q5OA 1N32O 3MWDA 4UB8Z 3AG7A 5DGIA 1XUQA 3KAJA 4ED8A 2XIGA 3WO1A 1NQTA 4GKJH 1CQIB 4IIJA 2FK1A 2C28A 1YJ9V 2W6MA 1IBLH 2EJ2A 2GTSA 2A9HA 1NTKH 4QIWF 5LXTA 4U7CA 2RDJA 5LMNB 4JI1H 3BRCA 2JVDA 2HHFB 4O82A 2Q8VA 3E8HA 3K04A 3W7UA 4FE2A 3JARA 2VWJA 3K9AA 3DAAA 4LWSB 3TW7A 4J0MA 2Q5ZA 3B09A 2QM8A 4IYHA 2CTRA 3F5WC 4DV3O 3IAYA 4HQ6A 3HOWG 2N74A 3K06A 4DL3A 4O4LB 5LOVA 2V9WA 5B5EZ 4JI1O 2R7ZG 1Y76A 1XMOB 5I60A 2ZNJA 1MSWD 3LUTB 4LF7O 3ZMSA 2O57A 3SYQA 4BIUA 2XAQA 4BW5A 4E2LA 1BGYH 2D3OW 1HNZO 3LP8A 2ZJTA 5J2UA 4DV3H 1DK1A 2DWCA 2OCCB 3TK1A 5L3GA 4X62O 4DR3O 4QWDA 5KT3A 2QA4V 4O7ZA 3L73H 2BR0A 1T94A 5L3FA 4MVUA 1Q3EA 4WF9V 5KFPA 2I87A 1I1KA 1B6QA 1HNXB 2AZ2A 1HNZH 5KFLA 3WG7B 1I5YA 2OYQA 1BJTA 4YB8B 3KHHA 4ECZA 2AXTZ 5E79Z 3I12A 4DR3H 2R8JA 3GIIA 1FVIA 2E76B 2IM9A 4QSHA 1QBZA 4PI0A 5CA1A 1F23A 1E79G 4BWSC 2FMAA 2HKOA 1XL4A 1HNXO 4KL1A 2L6LA 4PELA 3OW2U 1WP7A 2AGPA 3I5DA 4U3JB 2HG5C 3K5MA 5LMNH 1ULZA 2P22C 2W6OA 3X2QC 1LUWA 3ASOC 4EYHB 1CKNA 4BAYA 2ATKC 1K33A 3JASB 3CC4V 2ARHA 3F8NA 4CH6A 2NU9B 1ET0A 5JJEB 5J2TB 4JAUA 3EPIA 2RDCA 4X20A 1GAXA 4LF6B 4F4XA 5CA1B 4DV2B 4GCZA 1AR1B 4X1YB 2R6FA 1W96A 5BPFA 3CE2A 1OJHA 2OCHA 2A3QA 4DR2H 2W70A 1A0IA 3E8BA 3MFIA 5IY5B 4PZ6A 3ZHQA 4DR6O 4HNUA 3GILA 3FMAA 1WB8A 3L4JA 5EDWA 4O4JA 1KJ8A 3H1HH 3TY9A 2FPGB 2DOSA 2W6IG 3E2EA 5LGNA 1SZXA 1VF6A 4EBDA 4AI8A 3APQA 5GTHZ 3QO5A 4DR2O 5KG4A 4IYIA 1EZVH 3DC5A 1A3GA 4ED2A 2CAZC 5IY5C 2AU0A 1N4CA 4UCTA 3A0BZ 1JFFA 1RJRA 1HR0O 3R65A 4JI2O 3ETGA 2W6ZA 3R23A 1RYSA 4X62B 2ITDC 3GLKA 3KTMA 5LYJA 4TV8B 4FMTA 1ZHSA 4I4TF 3C3SA 1JPXA 4JI2H 2QWPB 4FFBB 4A3FG 5H6RA 5E25A 2PY5A 3CX5F 4OX9H 4NXMB 2I8CA 5KFTA 2VQFB 2VQFH 2B1GA 2HHFA 3HB9A 2R93G 4LFAH 5BR8H 5H80A 4O4JB 3QG5A 4JI4O 4Q20A 5F2VO 3H1LH 4JV5B 2QKSA 4CZZA 4MT8A 1WR2A 4NTWA 4X65O 4OX9O 1AR4A 1IOWA 1NS1A 5BWXA 4LNUA 5EWGA 2EJ7A 3RIZA 2VQFO 4X1YA 3H01A 1TVKA 2HLDG 4EB6B 2JS5A 3AG4C 5KAFZ 4ZHQB 1Y67A 3N2GB 1IBKB 5HBRB 3WO0A 4JI4H 1DLBA 1IXBA 3G6XA 2LFRA 1IOVA 3K5HA 5KFNA 4X65H 3ZMTA 5KFEA 2R92G 2YXHA 4FLUA 3ICXA 4J7KA 2IJHA 4U3FH 2ZDQA 1I50A 3DF7A 3E89A 1M7JA 3U10A 2UU9H 3OTOB 2X6BA 4JI6H 4O86A 3GTOA 3JZIA 1VAJA 3VPDA 4JYYA 2DYSB 5C1PA 1K4DC 3IC9A 5A9GA 5CR5A 4IWYA 4RNMA 3R66A 1DTOA 2P5OA 2DW4A 4OX9B 2CNQA 1YDXA 3QO7A 4JAVA 2DE0X 2HGXA 4C5BA 1G6UA 3CSXA 4L8JA 2FJZA 3KCXA 5B1AC 5I5SA 3J80N 4DR4B 1SS3A 3LSUA 4P9OA 4FLZA 4RAYA 1DIKA 5IWAO 5F9LA 3RGBA 3LMLA 1VQ4V 5F9NA 3H0GG 1K4CC 3GQCA 3EFFK 2BTQB 4MS2A 3CMAV 4J9LA 3A8TA 2R85A 5FLXW 2EZOA 4L87A 4E4EA 2X5RA 3E35A 1E1RG 4UXNA 3FB8C 5IWAH 1S5HC 2QWQB 4LF9H 1AUXA 3K59A 4O4IB 2EILC 3P3PA 5DEDA 1ORQC 1TA8A 3CWBH 1KJIA 4F6EA 1LUVA 3SNOA 1FFXA 3ZRWB 3SI8A 5KA5A 3JD0A 4RB2C 1VQ8V 3S3XA 1KEEA 1RP3B 4UV9A 1Y14B 3AG1C 4TV9F 4RAIA 2GHYA 5LHGA 1Z2OX 4P2ZA 5D5QA 5JVDA 2Y0PA 3H0GA 3Q4HB 4BWAA 4CMDA 4A3JG 4JYAB 4LSAA 4N23A 4JYAH 1IBMB 1FS0G 3TXQA 1SFOA 1GK9A 4EKWA 2YICA 1THZA 4DYLA 1B3QA 3MD0A 1SQXH 4ZI7B 2I80A 2NVYA 1GSHA 1UNNC 5DLGA 3AYHB 1M5IA 2FLLA 3FKIG 1MA1A 2AW9A 3TW6A 5CA0B 2Y0IA 4GKKO 4MTFA 5CA3A 1KMIZ 3U55A 2XCPA 4HNVA 1Z2PX 1QNMA 3PW5A 1JIHA 3GIQA 4IL6Z 5KHGA 1FFXB 2WTFA 4JTDB 1Z2NX 5I5WA 4FLWA 1P8LA 2Q2UA 3M7MX 3BHPA 4NR1A 2C2DA 4O4HA 2ZE7A 4TQRA 1IZ3A 1SA0B 3WB1A 3K0GA 2ZINA 3A0RA 2JJ2G 4FBUA 2VUGA 1GSAA 3T9DA 1TWHA 2E74B 3AK1A 1Q6IA 3K5OA 2R7ZA 5CB4B 2Z3YA 3HB3B 4QE9A 4B3SB 3Q2OA 1XMQH 2W9CB 3JARB 3H4BA 2KQXA 5BMVA 2FPPB 3ASNB 3IGAC 1AP5A 2GQRA 3HKBA 3IN5A 1XL6A 4LH6A 3KALA 2P6JA 5IJ0A 3RFCA 3L72H 2VQDA 1N34H 5J2UB 2HGWA 3PJSK 2E5LB 4ED6A 4WBNA 2IP4A 4FFPA 4WFEA 1AROP 4TWKA 3R5XA 3LDCA 3RV3A 3JATB 3NXSA 3OEHG 4FLVA 4YJ3B 5JH7A 3JZFA 3AEIA 1HNZB 3Q1KA 5EBLC 3J81N 3SJQC 1DGSA 3SPJA 1AVMA 4HNAB 2Y4UA 4JI3B 1DV1A 3H1JH 5TISZ 5CMUA 1D2DA 1X59A 1CQJB 2JS3A 2OTLV 3C90A 3CS5A 3CCLV 2F66C 3ABTA 4GKJB 1S9FA 5KG6A 4A3CG 1BQ0A 2YRWA 2F4VH 4QPJA 3QNEA 4I4TA 1OCOB 5KFFA 1I5XA 2ZD9A 2ZGIA 2YYAA 2RGVA 3SR2C 1XEQA 2ETNA 1I1LA 2Y69C 3VQVA 4J9NA 4B3RB 2Y48A 2EIMC 1P49A 4EGQA 2IBZH 1XDNA 4CH5A 4PV1B 5BXZA 4A3GG 1H2GA 2F4VO 1BT8A 1CEZA 3JAWB 4O4LF 1ENVA 4DRXA 3R5HA 2HGSA 1GMGA 4YR2A 4MV6A 4YY3O 3UZBA 1R9TA 2QM7A 4KP4A 2JGDB 1YIJV 2GPWA 3JAMW 3ETDA 3ZN1A 4ED7A 2COGA 3JALB 2YU9A
chains in the Genus database with same CATH topology
4DR1B 5KX5A 1XMQB 1CKMA 4DR1H 4I50B 2YCHA 2GV9A 4CS4A 1M0WA 2BTQA 5FPRA 5FNVB 2CW8A 3ZEDA 5BR8B 1QQCA 4YY3H 4JI1B 5EOYA 4DR4H 2F1MA 3GJXB 5JQGA 1E4GT 3PN1A 4IIJB 4LF7H 4JI7B 1SEIA 4EFEA 3ZS8C 1N36B 5JCOC 4IAJA 5EYPB 1TGOA 3RFRA 3L2PA 3J81W 3HKEB 2VQEB 1O9GA 4X62H 2R72A 5D1PA 1SYXB 1XK5A 1L2ZA 1IBLB 3JAKB 4LF4H 1RSOA 3BA9A 3ETQA 4NXNB 3W1GA 2ZM6H 4UFZA 4NXNH 4JI2B 3K3VA 1O9HA 2F95B 4O2AA 3HXLA 3A2FA 3RYHB 3T1YH 4B3RH 4WBNB 4UCUA 4I9QA 2QJ1A 3W1BA 2MCTA 1I94H 1I94B 3RYCA 4LSXA 4B3TB 1X9NA 4NVPA 4ZIBA 5GONA 3W5OA 5ITZB 1JJOA 2Q7GA 3LNNA 4DUZH 2O03A 3HKDB 3U0ZA 3THOA 4APMA 5FD6A 4DV5H 4A2AA 1N36H 3N6XA 4ZI7A 4LFCH 4DV1B 4LNUB 3VQWA 1Q5OA 4TV9B 4X66H 3KAJA 2HIVA 3IG0A 2HVRA 2XIGA 4GKJH 3RYIA 4IIJA 1NT2B 3SGIA 4GLXA 2HEPA 4X1KB 1IBLH 5LXTA 5ITZA 1X4TA 5LMNB 3E22B 4FM2A 3JSNA 4JI1H 1M4UA 2JVDA 3BRCA 4DRFA 3T1YB 1B04A 5EIBD 3RF2A 1XI1A 5KX5B 4DR7B 3RJ0A 1WPBA 3JARA 2VWJA 4DR3B 4JI6B 4J0MA 2UXBH 4TV9A 1O75A 3IAYA 1HNWH 4A2BA 2WDTA 3VQXA 4O4LB 5LOVA 3KAKA 1XMOB 1XMOH 4DV4B 2PGGA 2ZNJA 4GYCB 3QWUA 4NXMH 1Z5VA 2UUAB 5J2TA 1S68A 1HR0H 3CVZA 2ZJTA 5J2UA 4DV3H 4UCOA 4CS2A 4RB0A 3HKCA 2XHBA 1Q3EA 3H20A 3T1HH 2RGRA 4LFBB 1HNXB 1HNZH 5LA6A 2OYQA 4I55A 1BJTA 4DUYH 2WYOA 4DR3H 5JJJB 4D7SA 5IYZA 1FVIA 2IM9A 1E4FT 4PI0A 2V4DA 5CA1A 4MTEA 4BWSC 2VQEH 4UCVA 4KL1A 5D5PA 5FD5A 4U3JB 4FM1A 4AQYB 3JATA 2UUCH 5IT9W 3K5MA 5LMNH 2P22C 1N32H 4B08A 5EIBC 5KHKA 5JQGB 1CKNA 4M7EA 1XNQH 4KHPB 5K1XA 2KKWA 5KMGB 1WH2A 3JASB 3TY5A 2ZIOA 3F8NA 1KU9A 4CH6A 3BAAA 3RYFB 4DR7H 4CH4A 5JJEB 5J2TB 4YHHB 3JAKA 4X20A 4BW9A 4LF6B 2YI8A 4DK0A 5CA1B 4LFCB 4B3SH 4DV2B 3KXYT 4X1YB 1ZAUA 4X66B 5C8YA 4DV7H 5CB4A 4DR2H 1A0IA 5JCOA 3HKCB 4PZ6A 5LMUB 3FMAA 3L4JA 4O4JA 3WB0A 2E5LH 5KMGA 3RTXA 1AN7A 1GYFA 3TY9A 1Q8IA 3QTCA 3B2EE 3UT5A 5D1OA 2F4VB 2HHHB 2PUSA 4LF8B 3BA8A 3BABA 3KYHC 2W57A 4LF8H 4TQFA 4DUYB 2CAZC 2UU9B 4UCTA 2FE3A 2ZNIA 1JFFA 3T1HB 2UXDH 4LFBH 1TVKB 2UXDB 2Q0AA 4LF9B 3JALA 3VQYA 2VOBA 3K5NA 4X64H 4X62B 4JI4B 4MTDA 5LP6C 3BPZA 5LYJA 4X65B 4TV8B 4RAZA 4DR5B 1ZHSA 3L4KA 2UUAH 1QHTA 4JI2H 5DISC 4FFBB 4FLXA 4LF5H 4CC6A 2WE6A 4DV4H 2PY5A 4KHPH 1SQFA 4OX9H 4NXMB 5GONB 4DK1A 1L8DA 2VQFB 4FLYA 1TUBB 3N43B 4RB3C 2VQFH 4B3TH 5LP6A 3GB8B 3N44B 1CKOA 3N42B 4LFAH 3RGZA 1V9PA 4DV3B 4O4JB 5BR8H 4LF6H 3J7AK 3QG5A 1Q43A 5BMVB 1WN7A 4DV2H 1HNXH 4JV5H 4JV5B 4TUYA 1Z5WA 4CH3A 4DR2B 4JI8B 4LNUA 3RIZA 4X1YA 1TVKA 4EB6B 4FM0A 2JS5A 3QF7A 4O2BB 4ZHQB 1SA0A 3N2GB 1IBKB 4YJ2B 4JI4H 1T5EA 4B3MH 2YIBD 3RYFA 4X65H 4DR5H 4ZOLB 5IWAB 3M4IA 1JFFB 4K8XA 4FLUA 3ICXA 5FPOA 2Q2TA 3SJBC 1MZBA 5KHIA 3RYCB 2R9AA 3FFQA 2HHHH 4AILC 2UXCB 3DF7A 2YXLA 5EZYB 3U10A 2VPSA 3OTOB 2UU9H 4DR6H 2UXBB 4I7HA 4JI6H 3WB2A 1XHXA 5C8YB 3OTFA 3U11A 5K1PA 4GKKH 2OWOA 4YJ2A 4LF4B 3TY8A 2ZM6B 3CB2A 4TUYB 2P5OA 4RZQA 4JI8H 4OX9B 4O4LA 5LOVB 3RGXA 3K57A 1HR0B 2ZCEA 4DV0H 1CKNB 1G6UA 4DV7B 1N33B 3CSXA 4L8JA 3RWRD 4LFAB 4TOIA 3SJAC 2PYJA 3DSQA 4DR4B 4LMYA 4X1IB 2BTOA 1N34B 3GDEA 4FLZA 4RAYA 3RYHA 4ZOLA 2KSWA 1J5EH 4FVMA 3RGBA 1H2SB 3LMLA 2RQ6A 1VS0A 2BTQB 2CW7A 4PHZA 1S03G 4AHCA 1I7FA 4MV9A 2HIXA 5LYJB 5FLXW 4MV7A 1XQ8A 1WNSA 4JI5B 1FJGB 5LA6B 3CHXA 2YI9A 4EB6A 1FJGH 4F6RA 4O4HB 5IWAH 4RB1A 4LF9H 3K59A 3RR5A 4O4IB 4DRXB 3NBZB 4LH7A 4PI2A 2HVSA 1TA8A 5EYPA 1JMKC 4YJ3A 4B3MB 5LP6B 1FFXA 5EZYA 4RB2C 4FM9A 3UT5B 4CS3A 3K5LA 4U3JA 4I4TB 4GKKB 5LXTB 1HNWB 3N2KA 2YIBA 1Z2OX 5D5QA 5JVDA 1P16A 2UXCH 4BWAA 4EFBA 4JYAB 4DR6B 4Q0YA 1SKVA 4IHJB 4LSAA 4JYAH 2ZIMA 1IBMB 2CFMA 2UUBH 3N2GA 2Q7HA 3J80W 4UCRA 4HNAA 4HBNA 3EYYA 1FKAH 4ZI7B 3HKEA 1M5IA 5JH7B 2HVQA 2EX3A 1VF7A 5CA0B 4IHJA 5LMUH 4K0KH 1BGWA 2E3CA 1KMIZ 4LF7B 4R7RA 1Z2PX 1IBKH 1XNRB 4D7TA 5D1OB 4YY3B 3C0FB 1TUBA 4X1KA 4PZ8A 3VNNA 2VWKA 5KHGA 1FFXB 3N41B 4AQYH 1Z2NX 2UUCB 4FLWA 1P8LA 2Q2UA 2QM4A 3OTOH 3M7MX 4O4IA 5CA0A 3BHPA 3RYIB 4Q6GA 4I50A 4O4HA 4FFBA 1XNQB 1SA0B 3WB1A 2ZINA 5JJNB 2VUGA 2RJZA 3K5OA 2YIAA 4JI0B 3NBYB 5CB4B 2UUBB 4B3SB 3UQ8A 2JGUA 1XMQH 4UCSA 3JAWA 1HW7A 3JARB 1D5AA 4CC5A 5BMVA 3N40P 3MAQA 4DV0B 3S24A 5IJ9B 5JVDB 3HKBA 4TQDA 4LH6A 3KALA 2PYLA 5IJ0A 2Q7EA 4FLTA 4EQ5A 1N34H 3JSLA 5J2UB 1M0TA 4ETSA 1M93A 1XHZA 2E5LB 1N33H 4WBNA 1XNRH 5FNVA 3SJCC 3JATB 5IJ9A 4FLVA 4YJ3B 5JH7A 4DUZB 1HNZB 4TV8A 1DGSA 4JI7H 1J5EB 1IBMH 4JI3H 4E6NA 2F93B 4HNAB 4JI3B 4JI5H 4DV1H 4K0KB 4K8ZA 4X20B 2R70A 4X64B 5KHJA 4EEQA 2F66C 4GKJB 3NC0B 2F4VH 4PZ7A 1S5JA 4I4TA 3MWMA 3JASA 3K58A 3N2KB 4X1IA 1N32B 1ZHQA 2RGVA 3HKBB 3SR2C 1TAEA 3VQVA 4B3RB 3E22A 1YEWA 1P49A 5IJ0B 4O2AB 1XDNA 4CH5A 4YHHH 4F6RB 3JAWB 4O2BA 4ZHQA 4DRXA 5LL6b 5KHHA 2HGSA 1SQGA 2PTMA 1I6UA 4LR3A 5IYZB 4PDBA 5A2QW 2PZSA 4DV6B 3JAMW 4DV6H 3HKDA 4LF5B 4JI0H 4DV5B 3JALB 4I55B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFM A;  4DR1 B;  1XMQ B;  1CKM A;  4UCO A;  4UCR A;  4JV5 B;  5FPR A;  4DR2 B;  5BR8 B;  4JI8 B;  4JI1 B;  2HVQ A;  4LFB B;  1HNX B;  3GJX B;  3PN1 A;  4LF7 B;  4JI7 B;  1IBK B;  4EFE A;  1N36 B;  1XNR B;  5D1O B;  4YY3 B;  1FVI A;  4PZ8 A;  3VNN A;  3L2P A;  5IWA B;  2VQE B;  2UUC B;  1P8L A;  2Q2U A;  5FPO A;  2Q2T A;  4UCV A;  5D1P A;  1XNQ B;  1XK5 A;  1IBL B;  4NXN B;  3BA9 A;  4AQY B;  2UXC B;  2VUG A;  3W1G A;  4UFZ A;  4JI2 B;  3OTO B;  2UXB B;  4JI0 B;  3NBY B;  1CKN A;  2UUB B;  4KHP B;  4B3S B;  3UQ8 A;  2OWO A;  4UCU A;  4UCS A;  4LF4 B;  3TY5 A;  3W1B A;  4CC5 A;  3TY8 A;  2ZM6 B;  4DV0 B;  3BAA A;  1I94 B;  3S24 A;  4B3T B;  4YHH B;  1X9N A;  4LH6 A;  3W5O A;  4LF6 B;  4OX9 B;  4LFC B;  4DV2 B;  4EQ5 A;  3JSL A;  1HR0 B;  1ZAU A;  4X66 B;  1CKN B;  4DV7 B;  4DV3 B;  1N33 B;  2E5L B;  4LFA B;  4TOI A;  1A0I A;  4DR4 B;  4DV1 B;  4DUZ B;  1N34 B;  3GDE A;  5LMU B;  1HNZ B;  4PZ6 A;  1DGS A;  3RTX A;  1J5E B;  2HIV A;  2HVR A;  3TY9 A;  4E6N A;  4JI3 B;  5D1O A;  2F4V B;  2HHH B;  1VS0 A;  4K0K B;  4LF8 B;  3BA8 A;  3BAB A;  3SGI A;  4GLX A;  3KYH C;  4DUY B;  2HIX A;  4X64 B;  5LMN B;  4UCT A;  2UU9 B;  4EEQ A;  3JSN A;  3T1H B;  4DRF A;  4JI5 B;  1FJG B;  4GKJ B;  3NC0 B;  2UXD B;  4PZ7 A;  3T1Y B;  4LF9 B;  1B04 A;  3RR5 A;  3NBZ B;  4LH7 A;  4DR7 B;  4X62 B;  4DR3 B;  4JI4 B;  1TA8 A;  2HVS A;  4B3M B;  4JI6 B;  1N32 B;  1TAE A;  4X65 B;  4B3R B;  4DR5 B;  1XDN A;  5DIS C;  1XMO B;  4DV4 B;  4CC6 A;  3QWU A;  4GKK B;  4NXM B;  1HNW B;  2UUA B;  2VQF B;  1P16 A;  1S68 A;  4EFB A;  4DV6 B;  4JYA B;  4DR6 B;  3GB8 B;  1CKO A;  4LF5 B;  4DV5 B;  1V9P A;  1IBM B; 
#chains in the Genus database with same CATH topology
 1AP6 A;  2WB1 E;  1Y1W G;  4DR1 B;  4RQF A;  5DMX A;  1W0J G;  4J9O A;  4DR1 H;  1TWF A;  2DQ0 A;  4I50 B;  1R1B A;  4CS4 A;  1M0W A;  5FNV B;  3G4S V;  2ATL A;  5A2Q N;  1TWC A;  1QQC A;  4YY3 H;  1VQP V;  2QKA A;  2DYR C;  1RYR A;  4IHJ F;  2J6U A;  3GJX B;  3GB7 C;  2WWW A;  4ED1 A;  1KT8 A;  1WRV A;  3ZS8 C;  1RSO B;  4IAJ A;  1RFY A;  1CP9 A;  2HJD A;  2PN1 A;  2IMW P;  3ABU A;  3FD9 A;  1ZL8 A;  1M90 W;  2XTA A;  2ILM A;  4B3R O;  3OSN A;  5CA0 F;  1WSC A;  1AB3 A;  1NKD A;  1C3O A;  1Y76 B;  2R72 A;  2A7W A;  5D1P A;  2B1I A;  1I0H A;  2V1D A;  3T2M A;  3R9R A;  3FKI A;  2CH7 A;  4R7C A;  4H44 B;  2AZ0 A;  2WLK A;  2P7T C;  3JAK B;  4CKE A;  3W1G A;  4BXX G;  2OIE A;  4UFZ A;  1IUR A;  3SYA A;  4JI2 B;  3K3V A;  4F50 A;  2NUA B;  4O2A A;  4NLG A;  2R7M A;  1Q81 W;  4B3R H;  3TQ1 A;  2QJ1 A;  2MCT A;  5CA1 F;  1W2B U;  4OXS A;  1PM9 A;  3AX6 A;  4ZHQ F;  3W5O A;  1SQP H;  1OV9 A;  1PNM A;  3JZ6 A;  3JD2 A;  1KUQ A;  1M6V A;  3TGU H;  1PD3 A;  3T9C A;  2NVX A;  4YP3 A;  4EYI B;  1NVP D;  5FD6 A;  5K3W A;  4A2A A;  3GIJ A;  3N6X A;  3CSW A;  1VP7 A;  5BYA A;  2PMZ A;  3BVO A;  2A79 B;  4BBS G;  3MHH C;  4ICG A;  2HIV A;  3DXR A;  1JDB B;  3GV8 B;  1GO3 F;  2Q73 A;  3RYI A;  1NT2 B;  3JD4 A;  2HEP A;  3ZMU A;  4J10 A;  1HNW O;  4BIO A;  3E22 B;  4I5S A;  2IH1 C;  1YTF B;  2GDS A;  4DV6 O;  4EG0 A;  1RM1 C;  1QLE C;  1R3I C;  4O7L A;  1XI1 A;  5KX5 B;  4DR7 B;  4RQE A;  1WPB A;  5C4X G;  4DR3 B;  2WLH A;  2UXB H;  4A3L G;  1O75 A;  4R50 A;  1HNW H;  3MR3 A;  2HR3 A;  4A2B A;  3VQX A;  4OPA A;  4Y8V B;  5I5T A;  3ASO B;  4NXM H;  1Z5V A;  1BSM A;  1OCO C;  3RBD A;  3LNM B;  2UXB O;  4UUG A;  4JYC A;  4PWQ A;  4A3K G;  1NBM G;  4QIW E;  5I5X A;  1SQQ H;  3T5K A;  2GUZ A;  2YWV A;  4UCO A;  4O7T A;  2PI5 A;  1XOU A;  1AJP A;  4RB0 A;  2ZE8 A;  1VF6 C;  1EKF A;  4M0J A;  3CQZ A;  3T1H H;  3RBZ A;  1Y6X A;  4LFB B;  2B9Z A;  4WFG A;  2WLJ A;  1VQL V;  4K35 A;  2IW5 A;  2WYO A;  5C5J A;  3CCE V;  4A3I G;  2X0L A;  4XZ3 B;  5I47 A;  4IZO A;  2RF4 A;  5JJJ B;  1IVS A;  5IYZ A;  4QGP A;  2LW1 A;  1KKD A;  4JV1 A;  4BY7 G;  1W0K G;  1VQM V;  1EFR G;  4J9P A;  2W7P A;  1E4F T;  3B8M A;  4MTE A;  2XGP A;  2AGA A;  4I9W A;  3HOV G;  3RVZ A;  1P84 F;  4JV5 O;  3AG2 B;  4O3O A;  3VPB A;  2C2E A;  4AQY B;  3M8A A;  4N21 A;  2UUC H;  4WFA V;  3VOU A;  4WFB V;  1N32 H;  2B63 G;  4B08 A;  5KHK A;  4DV7 O;  5JQG B;  3ABM B;  1XNQ H;  2WLI B;  1EM1 A;  2KKW A;  5KMG B;  1WH2 A;  4G3I A;  2IJJ A;  2ZIO A;  3VA7 A;  1K34 A;  2W71 A;  3BAA A;  4DR7 H;  4YHH B;  1JX9 A;  4QWA A;  1IX9 A;  4DR5 O;  2YI8 A;  2COJ A;  5DAA A;  4LFC B;  4XX0 B;  1HDJ A;  3SE7 A;  2UUC O;  1GO3 E;  5FJ8 G;  2ITC C;  5D8D A;  4CKB A;  1ZAU A;  1N0N A;  4X66 B;  4DV7 H;  3RAQ A;  5CB4 A;  2LP7 A;  1XNQ O;  4DL5 A;  1EZ1 A;  5JCO A;  4JYB A;  1I1M A;  3L9D A;  1NH2 D;  4FPP A;  1GLV A;  3RTX A;  1AN7 A;  4EEY A;  4EBC A;  1Q8I A;  3KKY A;  2P06 A;  3B2E E;  5D1O A;  2F4V B;  2HHH B;  2W57 A;  4HN2 A;  4TQF A;  3W7S A;  4DUY B;  2HJW A;  2FE3 A;  3JCU Z;  1VQN V;  2WLM A;  3T1H B;  1TVK B;  1MZE A;  2Q0A A;  3I55 V;  4LF9 B;  2PVP A;  2DPI A;  1QVF U;  5KFB A;  1NU1 H;  2YZN A;  5I5U A;  4R8C A;  2JIZ G;  5LP6 C;  3BAC A;  1M1K W;  2Q6A A;  4O4H F;  4X65 B;  3Q8Q B;  4MW3 A;  4RUA A;  4DR5 B;  1R6K A;  1A48 A;  4MA5 A;  3L4K A;  3RB3 A;  1QHT A;  1UC8 A;  5L3E A;  4UV8 A;  5DGA A;  1KC7 A;  5DG7 A;  4FLX A;  1B33 N;  4P30 A;  5DLF A;  3G67 A;  1F4M A;  1SQF A;  1JKJ B;  1SER A;  1TUB B;  3ABK C;  5EWE A;  5LP6 A;  3N42 B;  4KFM A;  1ROP A;  1V9P A;  4DV3 B;  5J2U F;  2QSA A;  3K3W A;  1Q43 A;  3OUS A;  1WN7 A;  2R7N A;  1HNX H;  2VA3 A;  3K5I A;  4CH3 A;  2WLN A;  3W7W A;  4JI8 B;  5LMN O;  3WG7 C;  5C1O A;  2J6T A;  4NZO A;  1K92 A;  1R3J C;  3QF7 A;  4O2B B;  1F7Y A;  1M57 B;  2W0X A;  3H1I H;  5KFR A;  3RYF A;  2QWN B;  3ETE A;  2QB5 A;  4HYK A;  4ZOL B;  5C8Y F;  1JFF B;  2EJ3 A;  3T5H A;  2B63 A;  5FPO A;  3MR6 A;  4W4K A;  3RYC B;  2NU7 B;  1COW G;  2ODT X;  3FFQ A;  3UM7 A;  1JX4 A;  2DIK A;  3JAM N;  2HHH H;  4AIL C;  1T36 A;  2WSS G;  1FXK C;  5EZY B;  2VPS A;  4DR6 H;  2V4R A;  3L75 H;  1AJN A;  4I7H A;  1OCC C;  3WB2 A;  4BIZ A;  1KBL A;  1YI2 V;  2ZM6 B;  2R8H A;  3CB2 A;  2KB1 A;  4ZI7 F;  1FAF A;  4DW0 A;  2NNU A;  1E1Q G;  2Q9L A;  4Q4D A;  3TIG A;  2R7K A;  2W8K A;  2X6C A;  1CKN B;  1SES A;  3QZ8 A;  4MVR A;  1S76 D;  1N33 B;  3RWR D;  5IYC O;  4MV8 A;  5KFA A;  1JR9 A;  2XAF A;  4JF3 A;  1Q6U A;  4X1I B;  1YVW A;  3AG4 B;  4ECY A;  1K83 A;  4DLK A;  4ZOL A;  1NZ6 A;  4DAA A;  2KSW A;  4FZ1 A;  4UB6 Z;  1H2S B;  2W9C A;  2WLL B;  4FK5 C;  1VS0 A;  1I7F A;  1L0N H;  5LYJ B;  5KFM A;  4JZG A;  4MV7 A;  4TVI A;  5CE8 A;  2JGD A;  4FS1 A;  1WNS A;  4I50 F;  1A9X A;  5LA6 B;  1Y74 B;  2YI9 A;  2FL4 A;  4LFA O;  4G27 B;  4RB1 A;  4LH7 A;  3DGE A;  1Z2G A;  4PI2 A;  3OUU A;  5EYP A;  1JMK C;  4YJ3 A;  5LHH A;  5DQH A;  1HP8 A;  2HVJ C;  1WAZ A;  2W6J G;  1M56 C;  1V55 B;  3OEE G;  3E86 A;  1WJZ A;  3O65 A;  3UT5 B;  4JI5 O;  1RK5 A;  5B66 Z;  2OIG A;  4ZBM A;  4GKK B;  1VBH A;  2NU8 B;  2W8L A;  4EFB A;  4DR6 B;  4JUZ A;  1YTF D;  4TT3 G;  2CFM A;  3N2G A;  1KQS U;  2R7L A;  1IYD A;  2CTQ A;  1VQ7 V;  3GV5 B;  3J80 W;  4UCR A;  1DAA A;  4HNA A;  3TIN A;  3P3N A;  3PW2 A;  4HBN A;  2Y69 B;  1FKA H;  5KKN B;  2GPS A;  5T14 A;  4PJ0 Z;  3HKE A;  1EBO A;  4H37 A;  4AQY O;  1M9N A;  2UU9 O;  1VF7 A;  4IHJ A;  1BL8 A;  4GX0 A;  1BGW A;  2E3C A;  4LF7 B;  1SZT A;  4ZOL F;  1R3K C;  2DN9 A;  1IBK H;  1GN4 A;  5D1O B;  4YY3 B;  1TUB A;  2CDY A;  1FKA O;  2EIN B;  3VNN A;  2LW7 A;  2VWK A;  4AQY H;  3KHG A;  1XBL A;  2QM4 A;  4O4I A;  3RYI B;  5AG2 A;  4Q6G A;  2CGN A;  2BSK B;  1XNQ B;  1VIB A;  1UJW B;  2CTW A;  1IBK O;  1OWT A;  5JJN B;  1H2N A;  4TM5 A;  3NR7 A;  1K97 A;  2YIA A;  1YCI A;  5EK0 A;  3NBY B;  3PO3 G;  3T4D A;  3UQ8 A;  2JGU A;  1F4N A;  1XNR O;  4UCS A;  5BZB A;  4CC5 A;  1R6T A;  3AW8 A;  2YDE A;  1U96 A;  1MNG A;  5IJ9 B;  5JVD B;  5GON F;  4TQD A;  3CCQ V;  5FNV F;  3L71 H;  3E83 A;  4QE7 A;  2YEV A;  2PYL A;  2Q7E A;  2C2A A;  4FLT A;  4Q8E A;  5KX5 F;  1KD1 W;  1BZK A;  2OLS A;  4O4J F;  4XDJ A;  4QPK A;  4JAA A;  3GTP A;  1M93 A;  1XHZ A;  4LF9 O;  2VUM A;  1XNR H;  2RCV A;  4O84 A;  3LSS A;  1BHA A;  2RDI A;  4C5C A;  5LGU A;  2UXX A;  1G8M A;  4TV8 A;  4P9P A;  2PI4 A;  4JI7 H;  1J5E B;  4YIP A;  4DIM A;  5DQG A;  2F93 B;  4DV1 H;  3ZRX A;  3OAA G;  4PA9 A;  3LQS A;  3APO A;  3N27 A;  4A5U B;  4DUZ O;  3NC0 B;  4JYA O;  5C3E G;  5L1I A;  5IP9 G;  4O7S A;  4NYE A;  3MWM A;  3JAS A;  1NTZ H;  1XIL A;  4O81 A;  4X1I A;  4J42 A;  1ZHQ A;  4U7N A;  5KG0 A;  1N8R W;  1TAE A;  4O3R A;  5FLX N;  1YEW A;  3D36 C;  1RJP A;  2Y0S E;  4I55 F;  3VBB A;  1YJN V;  4YHH H;  4F6R B;  1BS3 A;  5LL6 b;  4F4W A;  2HP8 A;  3AG1 B;  4J7J A;  4LR3 A;  5KS8 A;  5IYZ B;  4PDB A;  3GTK A;  3Q8P B;  5A2Q W;  1OCR B;  3J7A U;  4JI0 H;  4DV5 B;  4I55 B;  1G1X B;  2E2H A;  2YZM A;  3O9O A;  1CKM A;  4J80 A;  4MVZ A;  2GSM B;  4YHH O;  2C22 A;  1IDS A;  4B7K A;  4OPH A;  1MSD A;  3SYP A;  4JI1 B;  5DN6 G;  2FLP A;  1MZF A;  1FXH A;  5JQG A;  3G8C A;  4JI0 O;  4UVA A;  4IIJ B;  4JI7 B;  3OHB A;  4ECQ A;  1KJ9 A;  2HJF C;  3ZBH A;  5L3C A;  1TGO A;  3RFR A;  5LHI A;  5KFZ A;  2JA8 G;  3HPL C;  4AYB E;  1SQB H;  3AG2 C;  1TWG A;  3E8G A;  4WFH A;  2R87 A;  1XK5 A;  3JYC A;  2Q7D A;  3ETQ A;  1TWA A;  4RNN A;  1NJI W;  2F95 B;  4RO2 A;  2Z02 A;  4QJF B;  1QR8 A;  1RK6 A;  4UCU A;  4WBN B;  1N36 O;  4I9Q A;  3T54 A;  3QVN A;  2GUZ B;  1GM8 A;  1I94 B;  1AI4 A;  3TEK A;  2YID A;  1RPO A;  4ZIB A;  5L1K A;  4DQN A;  1Q6H A;  5BWU A;  5GON A;  4QWE A;  5ITZ B;  1JJO A;  3GWK C;  2W6N A;  1AI7 A;  3Q8R B;  1Y4M A;  5JWP A;  3U0Z A;  1FD9 A;  2WPD G;  4TSF G;  3CCM V;  4RWU A;  2CH7 B;  3HKZ A;  1N36 H;  3UYY A;  4LFC H;  3G6V A;  1S0M A;  2JA5 A;  2CE4 A;  3AG3 C;  1UFI A;  4RUF A;  4TV9 B;  2P4V A;  3VQW A;  4X66 H;  2ZXW C;  1VQ9 V;  3U9T A;  3FX7 A;  2HVR A;  4YAK B;  1KB9 F;  2DYS C;  5DG9 A;  4XYM B;  3C3T A;  2GQS A;  1JCH A;  5DG8 A;  4GLX A;  1X4T A;  1L1F A;  4MV4 A;  4CKC A;  2P0A A;  4FM2 A;  2W9A A;  4O7V A;  1M4U A;  4Q4C A;  4X66 O;  3CJH B;  1P4R A;  2N05 A;  3STL C;  1XDC A;  2Q68 A;  1B04 A;  4R8U A;  5LBQ A;  1IXM A;  4DR1 O;  3M9M B;  3GIK A;  2WDT A;  3FB6 C;  3K0D A;  2QWR B;  2XGQ A;  1K73 W;  2XND G;  4PDM A;  1XMO H;  5LL6 Y;  5L3D A;  2LJ2 A;  3QWU A;  4ASU G;  1BCC H;  2UUA B;  2E2I A;  4O7N A;  3ZN0 A;  1S0O A;  3K03 A;  4X8A A;  5BPH A;  1FXV A;  2R9I A;  2A06 H;  3WNZ A;  3D36 A;  4CMF A;  4CS2 A;  3HKC A;  2XHB A;  2Y4R A;  3H20 A;  3ZRW A;  3OD4 A;  1EKP A;  5HNE A;  1Q7Y W;  3CRA A;  5IYD G;  3ABM C;  4H13 B;  5LA6 A;  2W0F C;  4LF5 O;  3MR5 A;  1A0G A;  3HR0 A;  2HFE C;  1VKZ A;  4O3Q A;  4D7S A;  5IYB O;  1OBG A;  1AR5 A;  2XOK G;  4B3T O;  3T9A A;  1ZET A;  1Y1V G;  2UXN A;  5HFM A;  3RAX A;  3BQ2 A;  1EUD B;  3SYC A;  2ZDI A;  3H1K H;  2V59 A;  1S5L Z;  3CCV V;  2VQE H;  4DW1 A;  1LR1 A;  1ZTE A;  3RV4 A;  1WLE A;  5D5P A;  2WAQ A;  3VOT A;  1VF5 B;  1I7N A;  4PA4 A;  5FD5 A;  1PL0 A;  2KSD A;  3G71 V;  4FM1 A;  2B5U A;  5IYB G;  1JA8 A;  4RU9 A;  2JA6 A;  2CUG A;  5CBG A;  4O3N A;  5H9C A;  2IJI A;  5EIB C;  1NVP B;  2XC9 A;  4M7E A;  4KHP B;  3M9O B;  1HWY A;  1L0L H;  3TY5 A;  2WAQ E;  2ZR3 A;  2GTA A;  1KU9 A;  3DC6 A;  3OUF A;  5KT4 A;  4CH4 A;  4O3P A;  3JRX A;  5IT9 N;  5BWV A;  5EC2 C;  5KFY A;  2GLT A;  4DK0 A;  5L3B A;  1YIT V;  4B3S H;  4PA3 A;  3G6E V;  2RMK B;  5C93 A;  5C8Y A;  2FLN A;  3ABL B;  1KJJ A;  5E1A C;  4UUJ C;  4O7Y A;  5H5N A;  1BMF G;  2JEU A;  3ABL C;  2CQY A;  4F4Z A;  5JVL A;  3D8C A;  2E5L H;  4B3S O;  2WLI A;  5KMG A;  1GYF A;  2C00 A;  4ED3 A;  4X9Q A;  3UT5 A;  4I0X A;  2PUS A;  3RB6 A;  2MW2 B;  3BA8 A;  3BAB A;  4CHI A;  2R8K A;  2UU9 B;  2ASL A;  3GTM A;  3QFF A;  2JEF A;  3DTU B;  4MVO A;  2E5L O;  4WFF A;  3VQY A;  4KHP O;  4X64 H;  4MTD A;  4RNO A;  4Z1M G;  3BPZ A;  3UCS C;  4ZKI A;  4LF6 O;  3HOX G;  4DV2 O;  5DIS C;  3LDE A;  4FFK A;  4ABM A;  4CC6 A;  4DV4 H;  2AHZ A;  4ZQI A;  4ECX A;  4KHP H;  4O83 A;  3CPW U;  5GON B;  2SCU B;  1SET A;  1L8D A;  3CEI A;  3N43 B;  4RB3 C;  2W9B A;  2BCC H;  3GB8 B;  2KG7 B;  3FYI B;  1CKO A;  2VUM G;  2LGW A;  4LF6 H;  3J7A K;  2OT5 A;  4DV2 H;  5BMV B;  2EIY A;  4JV5 H;  4TUY A;  2OH2 A;  4DR2 B;  5GW7 A;  3T5J A;  1AI6 A;  4IR1 A;  3ORR A;  3EVK A;  3RB0 A;  1YJW V;  3H9V A;  3UZO A;  4FS2 A;  1Y74 A;  1C30 A;  3MFH A;  3HKZ E;  4FFR A;  1T5E A;  4PA6 A;  2YIB D;  3QQM A;  4DR7 O;  4HZ3 A;  3PW7 A;  3OUZ A;  3K08 A;  4DR5 H;  5IWA B;  1F51 A;  3M4I A;  1ZWI C;  2E75 B;  4K8X A;  3SJB C;  3ZHS A;  5KHI A;  2JA7 A;  2R9A A;  1E4E A;  4YBZ B;  1VQ5 V;  3CXC U;  4JI8 O;  1KJQ A;  2UXC B;  1QLE B;  2YXL A;  2DMX A;  4PDL A;  2UXB B;  2BQ3 A;  1FFT B;  3P32 A;  3S3W A;  5J9P C;  1XHX A;  3CCJ V;  3OTF A;  3U11 A;  5K1P A;  5IE9 A;  1AJQ A;  1SF9 A;  1S0N A;  2FB9 A;  2EIK C;  3FB5 C;  4MA0 A;  5B1A B;  1B6R A;  1T3N A;  4TUY B;  4AYB A;  2GBO A;  3H3V H;  4G28 B;  4RZQ A;  4JI8 H;  1J5E O;  4O4L A;  5LOV B;  3OTO O;  3K57 A;  1HR0 B;  2ZCE A;  2NU6 B;  4DV7 B;  2FPI B;  4LFA B;  1NTM H;  2PYJ A;  1NI8 A;  5HV6 A;  3ZMV A;  4LMY A;  2ODM A;  4HAM A;  3OMI B;  2H3O A;  1ZQ7 A;  1M57 C;  3RYH A;  1J5E H;  2R93 A;  4J9M A;  1PL4 A;  5C44 G;  1K8A W;  2CW7 A;  5CBH A;  3EPG A;  4R6Z A;  1CPY A;  2HIX A;  4WBN F;  2NLJ C;  3I4M G;  4KXR A;  2FB5 A;  1FJG B;  1KC8 W;  1FJG H;  3RR5 A;  5CAE B;  3CCR V;  2ZQM A;  1FPO A;  5B1N A;  2HVS A;  2Y0S A;  5KFI A;  3OSP A;  5LP6 B;  3K3P A;  3UFX B;  3GTJ A;  2YRX A;  1GH6 A;  1Q90 D;  5EZY A;  2ASD A;  3TCU A;  4ECT A;  4NKG B;  2P67 A;  1EUC B;  3G80 A;  2M7W A;  1WP8 A;  4I0X B;  4JTA B;  4CS3 A;  5BWR A;  3PFF A;  5LXT B;  1HNW B;  2YIB A;  1P16 A;  2UXC H;  2LGQ A;  2QR4 A;  3I4N G;  4QJF A;  4Q0Y A;  5LMU O;  3PO2 G;  1SKV A;  4IHJ B;  5H2F Z;  1DF4 A;  2UUB H;  2ZDH A;  2Q7H A;  4C5A A;  2HHH O;  4NZM A;  2PF4 E;  4L1K A;  5KFS A;  1P7G A;  4QW8 A;  3PZP A;  2IJK A;  2Q69 A;  3Q4H A;  2HVQ A;  4C7U A;  2ZDG A;  4RCN A;  3V4Z A;  4DL2 A;  4ECW A;  5LMU H;  4K0K H;  3HOU G;  1G4Y B;  3SPG A;  2UUB O;  3CRM A;  3KCY A;  4FBT A;  1XNR B;  3AK3 A;  3C0F B;  4X1K A;  5KT6 A;  1MG1 A;  5KT5 A;  3RB4 A;  4ME6 A;  2M6Y A;  1H2M A;  1VQK V;  1DV2 A;  1I7L A;  4I50 A;  2JK5 C;  3N8D A;  3SDL A;  1CE8 A;  5K2M A;  4DR4 O;  1YF2 A;  1K1Q A;  2L35 A;  3BCC H;  3SPH A;  3VMM A;  3JAW A;  1HW7 A;  1S0V A;  5LOV F;  3MAQ A;  4DV0 B;  1KTA A;  3S24 A;  2EZP A;  1H8E G;  1PP9 H;  4YQW A;  3F5T A;  1EN6 A;  4LBE C;  3JSL A;  1FXK A;  4JI3 O;  1R73 A;  1M0T A;  3N6R A;  3ETH A;  1N33 H;  2G38 A;  4ECU A;  2J9G A;  5FR9 A;  1PX2 A;  5EBM C;  2A0L A;  3QZ7 A;  1GM7 A;  1K7D A;  3FAV A;  2BQR A;  1IBM H;  4XDL A;  4JI3 H;  3PVX A;  1I94 O;  4NTY A;  4E6N A;  2ASJ A;  4JI5 H;  4J9Q A;  4K0K B;  3GTL A;  2XD4 A;  2FKL A;  1VBG A;  4X20 B;  5KLV H;  2R70 A;  4X64 B;  5KHJ A;  2Z04 A;  1SRY A;  5L1J A;  3CRQ A;  3CYO A;  3RN4 A;  3SPI A;  4PZ7 A;  1S5J A;  5BYB A;  3ZMZ A;  4YIO A;  1JXL A;  1IBM O;  3K58 A;  2X0S A;  3D3I A;  3GVM A;  4X89 A;  4JGS A;  3OFN G;  4K3A A;  4WHX A;  4IR9 A;  1TUE B;  4NZN A;  2CTP A;  3OHA A;  4BBR G;  4O2A B;  3TXS A;  4PDV A;  2XCA A;  5HFL A;  4GKJ O;  3E8F A;  4RUC A;  3AK2 A;  3CCS V;  4ZHQ A;  2VPQ A;  5KFK A;  2PTM A;  1I6U A;  5B3S B;  3HKD A;  4LF5 B;  5KFX A;  3KHR A;  2W7O A;  5KX5 A;  1XMQ B;  1Y66 A;  5FLM G;  2QDO A;  5B3S C;  2BTQ A;  2QTS A;  4MTO A;  5FPR A;  1D5N A;  3W7X A;  1K1S A;  2CW8 A;  3ZED A;  4YXW G;  4J9Y B;  2EIJ C;  5EOY A;  3OT7 A;  2F1M A;  3H40 A;  2XAJ A;  2QKC A;  2FML A;  2JDI G;  4DL6 A;  3M99 B;  3PN1 A;  3AG3 B;  2DLN A;  3KRE A;  1I08 A;  4LF7 H;  1KEC A;  2ALZ A;  2YZL A;  1N36 B;  4IRD A;  5JCO C;  4FFO A;  5CM0 A;  4A3B G;  5B1B B;  1PKX A;  3IFX A;  1I2K A;  3L2P A;  3J81 W;  1QLN A;  2VQE B;  4WCE V;  2ZR2 A;  3FAV B;  4GUN A;  1O9G A;  4X62 H;  1BHB A;  2P4K A;  5KA6 A;  3ZHT A;  3U9S A;  2JA5 G;  1SYX B;  2EUL A;  4F4Y A;  4M9U A;  1L2Z A;  1IBL B;  4NXN B;  4NXN H;  4E4T A;  3LSQ A;  4JV0 A;  1QR9 A;  2FTK A;  1I2L A;  1DF5 A;  4MV1 A;  3HXL A;  4JI7 O;  4R8U B;  4CBC A;  3GIP A;  1MOF A;  2DAA A;  4ECV A;  4J41 A;  4XDK A;  5LYJ F;  1I3Q A;  1FYJ A;  2QWO B;  5JUM A;  1V55 C;  3RYC A;  4DV1 O;  5JQW A;  4LSX A;  1KP3 A;  4NVP A;  3ZHU A;  4A3D G;  2LFS A;  4IGG A;  5GTI Z;  4NXN O;  3CEB A;  3HBL A;  3VPC A;  4XYL B;  1VQ6 V;  1GKF A;  3JCZ A;  4DUZ H;  5CB4 F;  2O03 A;  4APM A;  2BOB C;  4J9Z B;  1N48 A;  3P30 A;  2MK3 A;  2YL2 A;  3G6B A;  2R86 A;  1A32 A;  4DV1 B;  1JVM A;  3FKS G;  3BEH A;  4NYK A;  3IG0 A;  3FDS A;  5KT2 A;  2ADQ B;  3SGI A;  4X1K B;  1IYE A;  5ITZ A;  4YJ3 F;  1OCZ C;  2YS7 A;  3T9F A;  3B40 A;  5IDJ A;  3KHL A;  4A3M G;  3JSN A;  4O4I F;  3ZIA G;  4DRF A;  3RVY A;  5KFV A;  4Q44 A;  4FZ0 A;  2K1E A;  3T1Y B;  4OGQ B;  2W6Q A;  1K5Q A;  4PD4 F;  5EZY F;  5EIB D;  2P90 A;  3RF2 A;  3RJ0 A;  4Z1V A;  4BY1 G;  1S97 A;  4JI6 B;  2HVK C;  5IYZ F;  3L74 H;  4TV9 A;  1RM1 B;  4TQS A;  4XBF A;  3PW4 A;  3KAK A;  4C2M A;  4DV4 B;  2PGG A;  5L9X A;  4GYC B;  4JV2 A;  1M56 B;  1AIL A;  4FGR A;  1Y1V A;  2QEX V;  2QTO A;  5J2T A;  1S68 A;  1HR0 H;  3CVZ A;  4MVM A;  4DXW A;  2W6P A;  2Q0O C;  3GV7 B;  4J9K A;  2R92 A;  1SQV H;  2H8P C;  5H6Q A;  2PBZ A;  1W59 A;  2EJR A;  4MW8 A;  3T7A A;  2NR5 A;  4FU0 A;  2RGR A;  2QK4 A;  3OGC C;  3GTG A;  3IC7 A;  3E5N A;  2CNU A;  4I55 A;  1ZSP A;  3GIM A;  4DUY H;  3ZRS A;  1AI5 A;  3M9N B;  1Q86 W;  5L1L A;  3ASN C;  2F23 A;  3CP1 A;  5KFC A;  3L70 H;  1NR7 A;  2FYU H;  2AGO A;  2VR1 A;  5KFO A;  3ZCC A;  2V4D A;  5BR8 O;  4A93 G;  1S77 D;  3HO8 A;  3CRR A;  1OBD A;  1NR1 A;  3R5F A;  4UCV A;  4PDR A;  1QU7 A;  4DUY O;  3BFR A;  4LFC O;  3K79 A;  2JEJ A;  3JAT A;  5IT9 W;  4IT5 A;  2XT9 A;  3HOZ G;  3K9S A;  2DWD C;  5K1X A;  4J9R A;  3DXR B;  3EHB B;  3GWO A;  2EBO A;  3RYF B;  2DQ3 A;  1KYO F;  2EIJ B;  5CBF A;  3KZI Z;  2YXY A;  3JAK A;  4BW9 A;  1H2K A;  3I56 V;  3CC7 V;  3KXY T;  5KFU A;  4DL7 A;  1YZB A;  2ZE6 A;  5KFD A;  1H38 A;  1H2L A;  5LGT A;  1GGO A;  3ZRV A;  2JEX A;  3HKC B;  4F4L A;  5LMU B;  3JD1 A;  3ZX6 A;  4U7O A;  2BOC C;  4DO2 A;  4JI6 O;  2UXD O;  4YAJ B;  3LUL A;  5IYC G;  3RUP A;  3WB0 A;  4FFL A;  2VRZ A;  2DAB A;  2ZXW B;  1B6S A;  2YS6 A;  2JA6 G;  3QTC A;  1XMO O;  1S3J A;  5J2T F;  4LF8 B;  2X7R B;  4J11 A;  3KYH C;  4LF8 H;  1JLL B;  1GM9 A;  3HT5 A;  2YEV B;  4FJC C;  4QIW A;  2UUA O;  2ZNI A;  2V5A A;  2EIM B;  2UXD H;  4LFB H;  2UXD B;  2IBK A;  3JAL A;  2VOB A;  3V4S A;  3K5N A;  2WA3 A;  4JI4 B;  1UC9 A;  4QWC A;  2H94 A;  4LF8 O;  2R8I A;  1VMG A;  4RAZ A;  1WCM A;  5LA6 F;  2UUA H;  3ZHV A;  5DGH A;  5BY1 A;  4Q43 A;  3ML0 A;  1BE3 H;  2BE3 A;  3ORQ A;  4LFB O;  1QCE A;  4LF5 H;  2WE6 A;  4MAM A;  2FK2 A;  2XAG A;  4DK1 A;  2JRI A;  5KG7 A;  2CZG A;  4FLY A;  4EBE A;  4B3T H;  3OR7 C;  2EIK B;  3N44 B;  1K3E A;  5B1O A;  5DGB A;  3RGZ A;  2EIL B;  3CCU V;  3SYO A;  1ZX3 A;  2VQE O;  3RBE A;  1PNK A;  2F43 G;  5IYD O;  4B3M O;  2N04 A;  2QE7 G;  4FFN A;  2DYR B;  2UVV A;  4LC1 A;  4JXU A;  1OHH G;  1Z5W A;  3SPC A;  4HR7 A;  2CGO A;  2Y4T A;  2ADP A;  3LDD A;  1V4Y A;  2PMZ E;  5IP7 G;  4MVQ A;  5B1B C;  2BSK A;  2JJ1 G;  4FM0 A;  2AQ4 A;  4MTG A;  1SA0 A;  4YJ2 B;  4PA7 A;  4ECS A;  4B3M H;  5KUK A;  4QWB A;  4LCU C;  4LWS A;  2J6S A;  1K5S A;  1K9M W;  2X6A A;  3GTQ A;  3T9E A;  1CS0 A;  2FKX A;  1WPX A;  3JRW A;  1WA8 A;  1JQ0 A;  2Q2T A;  4NTX A;  1FXK B;  5BWW A;  1MZB A;  4JAS A;  1LNQ A;  3MHS C;  3ETJ A;  3HOY G;  4MVS A;  3B4S A;  5KG3 A;  5KG5 A;  5KG1 A;  3MJF A;  1US6 A;  5EC1 C;  1Q82 W;  5C8Y B;  1GSO A;  4FFM A;  4GKK H;  3B77 A;  4K6N A;  2OWO A;  3T99 A;  1S10 A;  4YJ2 A;  4LF4 B;  3NUA A;  4JZ2 A;  3TY8 A;  1N0J A;  1OCC B;  4GX5 A;  3B8N A;  3FB7 C;  2Z5U A;  2C2R A;  1VQO V;  1ZLZ A;  1N56 A;  1ZL8 B;  2CKZ B;  4A3E G;  3OM3 B;  1B06 A;  3RGX A;  2QGN A;  4DV0 H;  2WLL A;  1Y1W A;  1E4E B;  4YR0 A;  3KG2 A;  4TOI A;  3SJA C;  1GN6 A;  3W7T A;  4X64 O;  3DSQ A;  3UO3 A;  2YZG A;  2BTO A;  3WWH A;  1N34 B;  3GDE A;  4LP8 A;  1MMM A;  2COI A;  3ABK B;  4FIP C;  4FVM A;  2LQT A;  4W4L A;  1XMQ O;  4PBC A;  2RQ6 A;  4DV0 O;  5BWT A;  4DV4 O;  2OTJ V;  5CN0 A;  5KFQ A;  4PHZ A;  2WB1 A;  3T9B A;  1S03 G;  1GRJ A;  4AHC A;  4MV9 A;  2QYZ A;  5I5Y A;  1UPG A;  4IRC A;  1XQ8 A;  4GT1 A;  3RT3 C;  1N34 O;  4JI5 B;  1RPR A;  1V54 C;  3CHX A;  4EB6 A;  1WCM G;  4F6R A;  1JOY A;  4O4H B;  3OMA B;  3RW0 A;  3NBZ B;  4DRX B;  4B3M B;  2Q4P A;  2XAS A;  2V7Q G;  3MWE A;  4CE5 A;  1G2W A;  2R8G A;  4MV3 A;  4EGJ A;  3WWJ A;  4FM9 A;  3CD6 V;  2ZDI C;  3WWI A;  4G2K A;  2M05 A;  3G8D A;  1EN4 A;  4GC6 A;  3K5L A;  4U3J A;  4I4T B;  3OE7 G;  3N2K A;  2JEI A;  5I5V A;  2Q67 A;  2XCL A;  1EKV A;  3A0H Z;  3IJ4 A;  1BNC A;  4MSW C;  2ZT9 B;  4GLW A;  2ZIM A;  4BR6 A;  1PK8 A;  3FYE B;  2Z0A A;  1ZUQ A;  1KUT A;  1SC5 B;  5DQI A;  1EZJ A;  1JDE A;  3EYY A;  2ZKO A;  2UVU A;  4TUY F;  2C35 B;  4J9S A;  4GC7 A;  1GN2 A;  2YUA A;  5JH7 B;  2EX3 A;  2NN4 A;  3TII A;  3EXA A;  5KFH A;  3CJH A;  4UVB A;  2EIN C;  5KFG A;  3LWB A;  4UVC A;  4R7R A;  2V4Q A;  2CK3 G;  4D7T A;  4PZ8 A;  1EHI A;  4IIJ F;  3N41 B;  2UUC B;  3CRC A;  1PV0 A;  1MAB G;  3OMN B;  5CA0 A;  3OTO H;  3V6K A;  4I7Z B;  4FFB A;  3T5L A;  2WA4 A;  4IWX A;  3UKM A;  4GZR B;  1YSC A;  4QW9 A;  4ED0 A;  1V51 A;  2UVR A;  3U54 A;  1U97 A;  2RJZ A;  2ABJ A;  4MTX A;  1KBH A;  2HDK A;  4JI0 B;  5DEC A;  2UVW A;  2UUB B;  1V54 B;  1D5A A;  3N40 P;  3X2Q B;  3F7V C;  3QO8 A;  4H0L B;  2A1H A;  3CC2 V;  4KUM A;  2R82 A;  2XUM A;  2YS8 A;  1EYZ A;  1QVG U;  1AUV A;  2W9B B;  4EQ5 A;  1FJG O;  3CXH F;  3MDS A;  3UO2 A;  4ETS A;  4TV8 F;  3TQT A;  1WB7 A;  3D3Q A;  4JPR A;  4JTC B;  3PR4 A;  5FNV A;  3SJC C;  2IU3 A;  3OGI B;  2VA2 A;  1CXZ B;  4WD3 A;  5IJ9 A;  4DUZ B;  4Z2W A;  2WAM A;  2BQU A;  3ZJZ A;  4O2A F;  3Q8S B;  3BY6 A;  3TJT A;  5LXT F;  3ZHR A;  2JEG A;  1OCZ B;  4K8Z A;  4DL4 A;  2DWE C;  3WFV A;  2K9P A;  4O3S A;  1PNL A;  4EEQ A;  2UXC O;  1P7B A;  1EN5 A;  2YW2 A;  2R9R B;  1BQZ A;  4RUE A;  2IU0 A;  2OCC C;  2EJ0 A;  3BQ1 A;  5KFJ A;  3N2K B;  1OZ0 A;  1N32 B;  2V58 A;  4HNT A;  3HKB B;  1GN3 A;  1W93 A;  4YJ2 F;  2D2C B;  5KG2 A;  2RN9 A;  3E22 A;  2XAH A;  4YR3 A;  5IJ0 B;  2JA7 G;  4NB5 A;  3BQ0 A;  2R84 A;  2LO1 A;  2IA6 A;  1KP2 A;  4K0K O;  2AGQ A;  4H33 A;  3MR2 A;  1NH2 B;  4GX1 A;  4Q8F A;  3TET A;  1OCR C;  4J7Z A;  4O2B A;  5KT7 A;  5KHH A;  4RZR A;  1SQG A;  1VEW A;  2DJV A;  2RNB A;  1KKC A;  2AHY A;  4QNH B;  3DTF A;  5JVD F;  3V6H A;  2QF7 A;  2IH3 C;  3JD3 A;  2PZS A;  4DV6 B;  4O7W A;  4DV6 H;  2ZE5 A;  1YXB A;  2FP4 B;  2YCH A;  1URF A;  2GV9 A;  2YC0 A;  1PPJ H;  3G6Y A;  2FK3 A;  5BR8 B;  4DR4 H;  3H4D A;  2KG7 A;  2DZD A;  3GID A;  1RJQ A;  4B7E A;  1E4G T;  1J95 A;  5EWF A;  1SEI A;  4NXM O;  4EFE A;  4LF4 O;  2DPJ A;  2ZM6 O;  1JJ2 U;  1SCU B;  5EYP B;  4U6P A;  3HKE B;  3WU2 Z;  4ECR A;  5EBW C;  2HG8 A;  1N33 O;  2VS0 A;  3U0G A;  3F7Y C;  2YSU B;  4LF4 H;  1RSO A;  3BA9 A;  4HYO A;  3T1C A;  2CNV A;  2ZM6 H;  4Q45 A;  5KUM A;  3T1H O;  1O9H A;  3A2F A;  4O7R A;  3RYH B;  3V6J A;  1R6N A;  4DV5 O;  3T1Y H;  1WA8 B;  1GTO A;  3OR6 C;  3W1B A;  5JH7 F;  1I94 H;  3DTG A;  1YHQ V;  4B3T B;  1X9N A;  4D6T H;  4O2B F;  5DM6 V;  3NGD A;  2Q7G A;  3BJY A;  3PW0 A;  1BXR A;  3STZ C;  3LNN A;  1XRE A;  1VAR A;  3HKD B;  5JQG F;  3PR5 B;  1R3L C;  3THO A;  4IRK A;  1H8H G;  4X88 A;  1IBL O;  3T1Y O;  5KFW A;  5LP6 F;  4DV5 H;  3BG5 A;  5KAI Z;  4ZI7 A;  1S72 V;  5FL7 G;  4LNU B;  3T4Z A;  5BMV F;  3CME V;  4GX2 A;  1Q5O A;  1N32 O;  3MWD A;  4UB8 Z;  3AG7 A;  5DGI A;  1XUQ A;  3KAJ A;  4ED8 A;  2XIG A;  3WO1 A;  1NQT A;  4GKJ H;  1CQI B;  4IIJ A;  2FK1 A;  2C28 A;  1YJ9 V;  2W6M A;  1IBL H;  2EJ2 A;  2GTS A;  2A9H A;  1NTK H;  4QIW F;  5LXT A;  4U7C A;  2RDJ A;  5LMN B;  4JI1 H;  3BRC A;  2JVD A;  2HHF B;  4O82 A;  2Q8V A;  3E8H A;  3K04 A;  3W7U A;  4FE2 A;  3JAR A;  2VWJ A;  3K9A A;  3DAA A;  4LWS B;  3TW7 A;  4J0M A;  2Q5Z A;  3B09 A;  2QM8 A;  4IYH A;  2CTR A;  3F5W C;  4DV3 O;  3IAY A;  4HQ6 A;  3HOW G;  2N74 A;  3K06 A;  4DL3 A;  4O4L B;  5LOV A;  2V9W A;  5B5E Z;  4JI1 O;  2R7Z G;  1Y76 A;  1XMO B;  5I60 A;  2ZNJ A;  1MSW D;  3LUT B;  4LF7 O;  3ZMS A;  2O57 A;  3SYQ A;  4BIU A;  2XAQ A;  4BW5 A;  4E2L A;  1BGY H;  2D3O W;  1HNZ O;  3LP8 A;  2ZJT A;  5J2U A;  4DV3 H;  1DK1 A;  2DWC A;  2OCC B;  3TK1 A;  5L3G A;  4X62 O;  4DR3 O;  4QWD A;  5KT3 A;  2QA4 V;  4O7Z A;  3L73 H;  2BR0 A;  1T94 A;  5L3F A;  4MVU A;  1Q3E A;  4WF9 V;  5KFP A;  2I87 A;  1I1K A;  1B6Q A;  1HNX B;  2AZ2 A;  1HNZ H;  5KFL A;  3WG7 B;  1I5Y A;  2OYQ A;  1BJT A;  4YB8 B;  3KHH A;  4ECZ A;  2AXT Z;  5E79 Z;  3I12 A;  4DR3 H;  2R8J A;  3GII A;  1FVI A;  2E76 B;  2IM9 A;  4QSH A;  1QBZ A;  4PI0 A;  5CA1 A;  1F23 A;  1E79 G;  4BWS C;  2FMA A;  2HKO A;  1XL4 A;  1HNX O;  4KL1 A;  2L6L A;  4PEL A;  3OW2 U;  1WP7 A;  2AGP A;  3I5D A;  4U3J B;  2HG5 C;  3K5M A;  5LMN H;  1ULZ A;  2P22 C;  2W6O A;  3X2Q C;  1LUW A;  3ASO C;  4EYH B;  1CKN A;  4BAY A;  2ATK C;  1K33 A;  3JAS B;  3CC4 V;  2ARH A;  3F8N A;  4CH6 A;  2NU9 B;  1ET0 A;  5JJE B;  5J2T B;  4JAU A;  3EPI A;  2RDC A;  4X20 A;  1GAX A;  4LF6 B;  4F4X A;  5CA1 B;  4DV2 B;  4GCZ A;  1AR1 B;  4X1Y B;  2R6F A;  1W96 A;  5BPF A;  3CE2 A;  1OJH A;  2OCH A;  2A3Q A;  4DR2 H;  2W70 A;  1A0I A;  3E8B A;  3MFI A;  5IY5 B;  4PZ6 A;  3ZHQ A;  4DR6 O;  4HNU A;  3GIL A;  3FMA A;  1WB8 A;  3L4J A;  5EDW A;  4O4J A;  1KJ8 A;  3H1H H;  3TY9 A;  2FPG B;  2DOS A;  2W6I G;  3E2E A;  5LGN A;  1SZX A;  1VF6 A;  4EBD A;  4AI8 A;  3APQ A;  5GTH Z;  3QO5 A;  4DR2 O;  5KG4 A;  4IYI A;  1EZV H;  3DC5 A;  1A3G A;  4ED2 A;  2CAZ C;  5IY5 C;  2AU0 A;  1N4C A;  4UCT A;  3A0B Z;  1JFF A;  1RJR A;  1HR0 O;  3R65 A;  4JI2 O;  3ETG A;  2W6Z A;  3R23 A;  1RYS A;  4X62 B;  2ITD C;  3GLK A;  3KTM A;  5LYJ A;  4TV8 B;  4FMT A;  1ZHS A;  4I4T F;  3C3S A;  1JPX A;  4JI2 H;  2QWP B;  4FFB B;  4A3F G;  5H6R A;  5E25 A;  2PY5 A;  3CX5 F;  4OX9 H;  4NXM B;  2I8C A;  5KFT A;  2VQF B;  2VQF H;  2B1G A;  2HHF A;  3HB9 A;  2R93 G;  4LFA H;  5BR8 H;  5H80 A;  4O4J B;  3QG5 A;  4JI4 O;  4Q20 A;  5F2V O;  3H1L H;  4JV5 B;  2QKS A;  4CZZ A;  4MT8 A;  1WR2 A;  4NTW A;  4X65 O;  4OX9 O;  1AR4 A;  1IOW A;  1NS1 A;  5BWX A;  4LNU A;  5EWG A;  2EJ7 A;  3RIZ A;  2VQF O;  4X1Y A;  3H01 A;  1TVK A;  2HLD G;  4EB6 B;  2JS5 A;  3AG4 C;  5KAF Z;  4ZHQ B;  1Y67 A;  3N2G B;  1IBK B;  5HBR B;  3WO0 A;  4JI4 H;  1DLB A;  1IXB A;  3G6X A;  2LFR A;  1IOV A;  3K5H A;  5KFN A;  4X65 H;  3ZMT A;  5KFE A;  2R92 G;  2YXH A;  4FLU A;  3ICX A;  4J7K A;  2IJH A;  4U3F H;  2ZDQ A;  1I50 A;  3DF7 A;  3E89 A;  1M7J A;  3U10 A;  2UU9 H;  3OTO B;  2X6B A;  4JI6 H;  4O86 A;  3GTO A;  3JZI A;  1VAJ A;  3VPD A;  4JYY A;  2DYS B;  5C1P A;  1K4D C;  3IC9 A;  5A9G A;  5CR5 A;  4IWY A;  4RNM A;  3R66 A;  1DTO A;  2P5O A;  2DW4 A;  4OX9 B;  2CNQ A;  1YDX A;  3QO7 A;  4JAV A;  2DE0 X;  2HGX A;  4C5B A;  1G6U A;  3CSX A;  4L8J A;  2FJZ A;  3KCX A;  5B1A C;  5I5S A;  3J80 N;  4DR4 B;  1SS3 A;  3LSU A;  4P9O A;  4FLZ A;  4RAY A;  1DIK A;  5IWA O;  5F9L A;  3RGB A;  3LML A;  1VQ4 V;  5F9N A;  3H0G G;  1K4C C;  3GQC A;  3EFF K;  2BTQ B;  4MS2 A;  3CMA V;  4J9L A;  3A8T A;  2R85 A;  5FLX W;  2EZO A;  4L87 A;  4E4E A;  2X5R A;  3E35 A;  1E1R G;  4UXN A;  3FB8 C;  5IWA H;  1S5H C;  2QWQ B;  4LF9 H;  1AUX A;  3K59 A;  4O4I B;  2EIL C;  3P3P A;  5DED A;  1ORQ C;  1TA8 A;  3CWB H;  1KJI A;  4F6E A;  1LUV A;  3SNO A;  1FFX A;  3ZRW B;  3SI8 A;  5KA5 A;  3JD0 A;  4RB2 C;  1VQ8 V;  3S3X A;  1KEE A;  1RP3 B;  4UV9 A;  1Y14 B;  3AG1 C;  4TV9 F;  4RAI A;  2GHY A;  5LHG A;  1Z2O X;  4P2Z A;  5D5Q A;  5JVD A;  2Y0P A;  3H0G A;  3Q4H B;  4BWA A;  4CMD A;  4A3J G;  4JYA B;  4LSA A;  4N23 A;  4JYA H;  1IBM B;  1FS0 G;  3TXQ A;  1SFO A;  1GK9 A;  4EKW A;  2YIC A;  1THZ A;  4DYL A;  1B3Q A;  3MD0 A;  1SQX H;  4ZI7 B;  2I80 A;  2NVY A;  1GSH A;  1UNN C;  5DLG A;  3AYH B;  1M5I A;  2FLL A;  3FKI G;  1MA1 A;  2AW9 A;  3TW6 A;  5CA0 B;  2Y0I A;  4GKK O;  4MTF A;  5CA3 A;  1KMI Z;  3U55 A;  2XCP A;  4HNV A;  1Z2P X;  1QNM A;  3PW5 A;  1JIH A;  3GIQ A;  4IL6 Z;  5KHG A;  1FFX B;  2WTF A;  4JTD B;  1Z2N X;  5I5W A;  4FLW A;  1P8L A;  2Q2U A;  3M7M X;  3BHP A;  4NR1 A;  2C2D A;  4O4H A;  2ZE7 A;  4TQR A;  1IZ3 A;  1SA0 B;  3WB1 A;  3K0G A;  2ZIN A;  3A0R A;  2JJ2 G;  4FBU A;  2VUG A;  1GSA A;  3T9D A;  1TWH A;  2E74 B;  3AK1 A;  1Q6I A;  3K5O A;  2R7Z A;  5CB4 B;  2Z3Y A;  3HB3 B;  4QE9 A;  4B3S B;  3Q2O A;  1XMQ H;  2W9C B;  3JAR B;  3H4B A;  2KQX A;  5BMV A;  2FPP B;  3ASN B;  3IGA C;  1AP5 A;  2GQR A;  3HKB A;  3IN5 A;  1XL6 A;  4LH6 A;  3KAL A;  2P6J A;  5IJ0 A;  3RFC A;  3L72 H;  2VQD A;  1N34 H;  5J2U B;  2HGW A;  3PJS K;  2E5L B;  4ED6 A;  4WBN A;  2IP4 A;  4FFP A;  4WFE A;  1ARO P;  4TWK A;  3R5X A;  3LDC A;  3RV3 A;  3JAT B;  3NXS A;  3OEH G;  4FLV A;  4YJ3 B;  5JH7 A;  3JZF A;  3AEI A;  1HNZ B;  3Q1K A;  5EBL C;  3J81 N;  3SJQ C;  1DGS A;  3SPJ A;  1AVM A;  4HNA B;  2Y4U A;  4JI3 B;  1DV1 A;  3H1J H;  5TIS Z;  5CMU A;  1D2D A;  1X59 A;  1CQJ B;  2JS3 A;  2OTL V;  3C90 A;  3CS5 A;  3CCL V;  2F66 C;  3ABT A;  4GKJ B;  1S9F A;  5KG6 A;  4A3C G;  1BQ0 A;  2YRW A;  2F4V H;  4QPJ A;  3QNE A;  4I4T A;  1OCO B;  5KFF A;  1I5X A;  2ZD9 A;  2ZGI A;  2YYA A;  2RGV A;  3SR2 C;  1XEQ A;  2ETN A;  1I1L A;  2Y69 C;  3VQV A;  4J9N A;  4B3R B;  2Y48 A;  2EIM C;  1P49 A;  4EGQ A;  2IBZ H;  1XDN A;  4CH5 A;  4PV1 B;  5BXZ A;  4A3G G;  1H2G A;  2F4V O;  1BT8 A;  1CEZ A;  3JAW B;  4O4L F;  1ENV A;  4DRX A;  3R5H A;  2HGS A;  1GMG A;  4YR2 A;  4MV6 A;  4YY3 O;  3UZB A;  1R9T A;  2QM7 A;  4KP4 A;  2JGD B;  1YIJ V;  2GPW A;  3JAM W;  3ETD A;  3ZN1 A;  4ED7 A;  2COG A;  3JAL B;  2YU9 A; 
#chains in the Genus database with same CATH homology
 4DR1 B;  5KX5 A;  1XMQ B;  1CKM A;  4DR1 H;  4I50 B;  2YCH A;  2GV9 A;  4CS4 A;  1M0W A;  2BTQ A;  5FPR A;  5FNV B;  2CW8 A;  3ZED A;  5BR8 B;  1QQC A;  4YY3 H;  4JI1 B;  5EOY A;  4DR4 H;  2F1M A;  3GJX B;  5JQG A;  1E4G T;  3PN1 A;  4IIJ B;  4LF7 H;  4JI7 B;  1SEI A;  4EFE A;  3ZS8 C;  1N36 B;  5JCO C;  4IAJ A;  5EYP B;  1TGO A;  3RFR A;  3L2P A;  3J81 W;  3HKE B;  2VQE B;  1O9G A;  4X62 H;  2R72 A;  5D1P A;  1SYX B;  1XK5 A;  1L2Z A;  1IBL B;  3JAK B;  4LF4 H;  1RSO A;  3BA9 A;  3ETQ A;  4NXN B;  3W1G A;  2ZM6 H;  4UFZ A;  4NXN H;  4JI2 B;  3K3V A;  1O9H A;  2F95 B;  4O2A A;  3HXL A;  3A2F A;  3RYH B;  3T1Y H;  4B3R H;  4WBN B;  4UCU A;  4I9Q A;  2QJ1 A;  3W1B A;  2MCT A;  1I94 H;  1I94 B;  3RYC A;  4LSX A;  4B3T B;  1X9N A;  4NVP A;  4ZIB A;  5GON A;  3W5O A;  5ITZ B;  1JJO A;  2Q7G A;  3LNN A;  4DUZ H;  2O03 A;  3HKD B;  3U0Z A;  3THO A;  4APM A;  5FD6 A;  4DV5 H;  4A2A A;  1N36 H;  3N6X A;  4ZI7 A;  4LFC H;  4DV1 B;  4LNU B;  3VQW A;  1Q5O A;  4TV9 B;  4X66 H;  3KAJ A;  2HIV A;  3IG0 A;  2HVR A;  2XIG A;  4GKJ H;  3RYI A;  4IIJ A;  1NT2 B;  3SGI A;  4GLX A;  2HEP A;  4X1K B;  1IBL H;  5LXT A;  5ITZ A;  1X4T A;  5LMN B;  3E22 B;  4FM2 A;  3JSN A;  4JI1 H;  1M4U A;  2JVD A;  3BRC A;  4DRF A;  3T1Y B;  1B04 A;  5EIB D;  3RF2 A;  1XI1 A;  5KX5 B;  4DR7 B;  3RJ0 A;  1WPB A;  3JAR A;  2VWJ A;  4DR3 B;  4JI6 B;  4J0M A;  2UXB H;  4TV9 A;  1O75 A;  3IAY A;  1HNW H;  4A2B A;  2WDT A;  3VQX A;  4O4L B;  5LOV A;  3KAK A;  1XMO B;  1XMO H;  4DV4 B;  2PGG A;  2ZNJ A;  4GYC B;  3QWU A;  4NXM H;  1Z5V A;  2UUA B;  5J2T A;  1S68 A;  1HR0 H;  3CVZ A;  2ZJT A;  5J2U A;  4DV3 H;  4UCO A;  4CS2 A;  4RB0 A;  3HKC A;  2XHB A;  1Q3E A;  3H20 A;  3T1H H;  2RGR A;  4LFB B;  1HNX B;  1HNZ H;  5LA6 A;  2OYQ A;  4I55 A;  1BJT A;  4DUY H;  2WYO A;  4DR3 H;  5JJJ B;  4D7S A;  5IYZ A;  1FVI A;  2IM9 A;  1E4F T;  4PI0 A;  2V4D A;  5CA1 A;  4MTE A;  4BWS C;  2VQE H;  4UCV A;  4KL1 A;  5D5P A;  5FD5 A;  4U3J B;  4FM1 A;  4AQY B;  3JAT A;  2UUC H;  5IT9 W;  3K5M A;  5LMN H;  2P22 C;  1N32 H;  4B08 A;  5EIB C;  5KHK A;  5JQG B;  1CKN A;  4M7E A;  1XNQ H;  4KHP B;  5K1X A;  2KKW A;  5KMG B;  1WH2 A;  3JAS B;  3TY5 A;  2ZIO A;  3F8N A;  1KU9 A;  4CH6 A;  3BAA A;  3RYF B;  4DR7 H;  4CH4 A;  5JJE B;  5J2T B;  4YHH B;  3JAK A;  4X20 A;  4BW9 A;  4LF6 B;  2YI8 A;  4DK0 A;  5CA1 B;  4LFC B;  4B3S H;  4DV2 B;  3KXY T;  4X1Y B;  1ZAU A;  4X66 B;  5C8Y A;  4DV7 H;  5CB4 A;  4DR2 H;  1A0I A;  5JCO A;  3HKC B;  4PZ6 A;  5LMU B;  3FMA A;  3L4J A;  4O4J A;  3WB0 A;  2E5L H;  5KMG A;  3RTX A;  1AN7 A;  1GYF A;  3TY9 A;  1Q8I A;  3QTC A;  3B2E E;  3UT5 A;  5D1O A;  2F4V B;  2HHH B;  2PUS A;  4LF8 B;  3BA8 A;  3BAB A;  3KYH C;  2W57 A;  4LF8 H;  4TQF A;  4DUY B;  2CAZ C;  2UU9 B;  4UCT A;  2FE3 A;  2ZNI A;  1JFF A;  3T1H B;  2UXD H;  4LFB H;  1TVK B;  2UXD B;  2Q0A A;  4LF9 B;  3JAL A;  3VQY A;  2VOB A;  3K5N A;  4X64 H;  4X62 B;  4JI4 B;  4MTD A;  5LP6 C;  3BPZ A;  5LYJ A;  4X65 B;  4TV8 B;  4RAZ A;  4DR5 B;  1ZHS A;  3L4K A;  2UUA H;  1QHT A;  4JI2 H;  5DIS C;  4FFB B;  4FLX A;  4LF5 H;  4CC6 A;  2WE6 A;  4DV4 H;  2PY5 A;  4KHP H;  1SQF A;  4OX9 H;  4NXM B;  5GON B;  4DK1 A;  1L8D A;  2VQF B;  4FLY A;  1TUB B;  3N43 B;  4RB3 C;  2VQF H;  4B3T H;  5LP6 A;  3GB8 B;  3N44 B;  1CKO A;  3N42 B;  4LFA H;  3RGZ A;  1V9P A;  4DV3 B;  4O4J B;  5BR8 H;  4LF6 H;  3J7A K;  3QG5 A;  1Q43 A;  5BMV B;  1WN7 A;  4DV2 H;  1HNX H;  4JV5 H;  4JV5 B;  4TUY A;  1Z5W A;  4CH3 A;  4DR2 B;  4JI8 B;  4LNU A;  3RIZ A;  4X1Y A;  1TVK A;  4EB6 B;  4FM0 A;  2JS5 A;  3QF7 A;  4O2B B;  4ZHQ B;  1SA0 A;  3N2G B;  1IBK B;  4YJ2 B;  4JI4 H;  1T5E A;  4B3M H;  2YIB D;  3RYF A;  4X65 H;  4DR5 H;  4ZOL B;  5IWA B;  3M4I A;  1JFF B;  4K8X A;  4FLU A;  3ICX A;  5FPO A;  2Q2T A;  3SJB C;  1MZB A;  5KHI A;  3RYC B;  2R9A A;  3FFQ A;  2HHH H;  4AIL C;  2UXC B;  3DF7 A;  2YXL A;  5EZY B;  3U10 A;  2VPS A;  3OTO B;  2UU9 H;  4DR6 H;  2UXB B;  4I7H A;  4JI6 H;  3WB2 A;  1XHX A;  5C8Y B;  3OTF A;  3U11 A;  5K1P A;  4GKK H;  2OWO A;  4YJ2 A;  4LF4 B;  3TY8 A;  2ZM6 B;  3CB2 A;  4TUY B;  2P5O A;  4RZQ A;  4JI8 H;  4OX9 B;  4O4L A;  5LOV B;  3RGX A;  3K57 A;  1HR0 B;  2ZCE A;  4DV0 H;  1CKN B;  1G6U A;  4DV7 B;  1N33 B;  3CSX A;  4L8J A;  3RWR D;  4LFA B;  4TOI A;  3SJA C;  2PYJ A;  3DSQ A;  4DR4 B;  4LMY A;  4X1I B;  2BTO A;  1N34 B;  3GDE A;  4FLZ A;  4RAY A;  3RYH A;  4ZOL A;  2KSW A;  1J5E H;  4FVM A;  3RGB A;  1H2S B;  3LML A;  2RQ6 A;  1VS0 A;  2BTQ B;  2CW7 A;  4PHZ A;  1S03 G;  4AHC A;  1I7F A;  4MV9 A;  2HIX A;  5LYJ B;  5FLX W;  4MV7 A;  1XQ8 A;  1WNS A;  4JI5 B;  1FJG B;  5LA6 B;  3CHX A;  2YI9 A;  4EB6 A;  1FJG H;  4F6R A;  4O4H B;  5IWA H;  4RB1 A;  4LF9 H;  3K59 A;  3RR5 A;  4O4I B;  4DRX B;  3NBZ B;  4LH7 A;  4PI2 A;  2HVS A;  1TA8 A;  5EYP A;  1JMK C;  4YJ3 A;  4B3M B;  5LP6 B;  1FFX A;  5EZY A;  4RB2 C;  4FM9 A;  3UT5 B;  4CS3 A;  3K5L A;  4U3J A;  4I4T B;  4GKK B;  5LXT B;  1HNW B;  3N2K A;  2YIB A;  1Z2O X;  5D5Q A;  5JVD A;  1P16 A;  2UXC H;  4BWA A;  4EFB A;  4JYA B;  4DR6 B;  4Q0Y A;  1SKV A;  4IHJ B;  4LSA A;  4JYA H;  2ZIM A;  1IBM B;  2CFM A;  2UUB H;  3N2G A;  2Q7H A;  3J80 W;  4UCR A;  4HNA A;  4HBN A;  3EYY A;  1FKA H;  4ZI7 B;  3HKE A;  1M5I A;  5JH7 B;  2HVQ A;  2EX3 A;  1VF7 A;  5CA0 B;  4IHJ A;  5LMU H;  4K0K H;  1BGW A;  2E3C A;  1KMI Z;  4LF7 B;  4R7R A;  1Z2P X;  1IBK H;  1XNR B;  4D7T A;  5D1O B;  4YY3 B;  3C0F B;  1TUB A;  4X1K A;  4PZ8 A;  3VNN A;  2VWK A;  5KHG A;  1FFX B;  3N41 B;  4AQY H;  1Z2N X;  2UUC B;  4FLW A;  1P8L A;  2Q2U A;  2QM4 A;  3OTO H;  3M7M X;  4O4I A;  5CA0 A;  3BHP A;  3RYI B;  4Q6G A;  4I50 A;  4O4H A;  4FFB A;  1XNQ B;  1SA0 B;  3WB1 A;  2ZIN A;  5JJN B;  2VUG A;  2RJZ A;  3K5O A;  2YIA A;  4JI0 B;  3NBY B;  5CB4 B;  2UUB B;  4B3S B;  3UQ8 A;  2JGU A;  1XMQ H;  4UCS A;  3JAW A;  1HW7 A;  3JAR B;  1D5A A;  4CC5 A;  5BMV A;  3N40 P;  3MAQ A;  4DV0 B;  3S24 A;  5IJ9 B;  5JVD B;  3HKB A;  4TQD A;  4LH6 A;  3KAL A;  2PYL A;  5IJ0 A;  2Q7E A;  4FLT A;  4EQ5 A;  1N34 H;  3JSL A;  5J2U B;  1M0T A;  4ETS A;  1M93 A;  1XHZ A;  2E5L B;  1N33 H;  4WBN A;  1XNR H;  5FNV A;  3SJC C;  3JAT B;  5IJ9 A;  4FLV A;  4YJ3 B;  5JH7 A;  4DUZ B;  1HNZ B;  4TV8 A;  1DGS A;  4JI7 H;  1J5E B;  1IBM H;  4JI3 H;  4E6N A;  2F93 B;  4HNA B;  4JI3 B;  4JI5 H;  4DV1 H;  4K0K B;  4K8Z A;  4X20 B;  2R70 A;  4X64 B;  5KHJ A;  4EEQ A;  2F66 C;  4GKJ B;  3NC0 B;  2F4V H;  4PZ7 A;  1S5J A;  4I4T A;  3MWM A;  3JAS A;  3K58 A;  3N2K B;  4X1I A;  1N32 B;  1ZHQ A;  2RGV A;  3HKB B;  3SR2 C;  1TAE A;  3VQV A;  4B3R B;  3E22 A;  1YEW A;  1P49 A;  5IJ0 B;  4O2A B;  1XDN A;  4CH5 A;  4YHH H;  4F6R B;  3JAW B;  4O2B A;  4ZHQ A;  4DRX A;  5LL6 b;  5KHH A;  2HGS A;  1SQG A;  2PTM A;  1I6U A;  4LR3 A;  5IYZ B;  4PDB A;  5A2Q W;  2PZS A;  4DV6 B;  3JAM W;  4DV6 H;  3HKD A;  4LF5 B;  4JI0 H;  4DV5 B;  3JAL B;  4I55 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...