4LHLA

Structure of the n-terminal domain of the flo1 adhesin (n-flo1p) from the yeast saccharomyces cerevisiae
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
251
structure length
248
Chain Sequence
ATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFKFATVDDSAILSVGGATAFNCCAQQQPPITSTNFTIDGIKPSLPPNIEGTVYMYAGYYYPMKVVYSNAVSWGTLPISVTLPDGTTVSDDFEGYVYSFDDDLSQSNCTVPDPSNYLEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flocculation protein FLO1
publication title Molecular mechanism of flocculation self-recognition in yeast and its role in mating and survival.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 56
structure length 248
sequence length 251
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4lhlA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lhlA01
2XJVA 4CP2A 4COZA 5A3MA 4ASLA 4AI0A 4GQ7A 2XJUA 4AI3A 4AFCA 2XJQA 4AI1A 4CP0A 4COVA 4COYA 4AFAA 4COUA 4AHYA 4AI2A 4AHWA 4A3XA 5A3LA 2XJTA 4CP1A 4LHNA 4D3WA 2XJRA 4AHZA 4LHKA 4LHLA 2XJSA 2XJPA 4AF9A 4AHXA 4AFBA 4COWA
chains in the Genus database with same CATH superfamily
3VBSC 4BIFA 5FZCA 5T50A 4QX7A 4HVRA 2PLV1 1UPIA 1B35B 5IP7L 5JOWA 1NE6A 2JDKA 1AYN2 1QH7A 3TBDA 4N9HA 1WW5A 1O3SA 2RS31 3PO2L 1B35C 3OB8A 4LO7A 4AAPA 1D4M1 3H0GL 4UFKA 4CCEA 3WQBA 3CU7A 3LA7A 4A44A 2FDKA 1R1ZA 2F6BA 3IB3A 4RQPB 4CCDA 3BTYA 3RVHA 2P5BA 4CPBA 1GFF2 1H0BA 1BK0A 3ENRA 2BWAA 4HT1T 4DXRA 2YMZA 4NJ4A 2ZGNA 4FAHA 3B7MA 1MVEA 3T4HB 4WFN1 1G6NA 3IMNA 3KYYA 4COWA 4YZ5A 3ASIA 3PTRB 1W2UA 4JAFA 5LWBA 1RUD3 2JXAA 4AFMA 3ZMOA 4MV2A 1EV11 4RXNA 1YWKA 3NVCA 4N43A 4OYUA 5FZ0A 3MI8A 5C4WB 2W46A 2O5JD 3A0KA 2VL6A 4R9AA 3KCCA 2D43A 3BOWA 4LKDA 4JRAA 5T5JA 4IERA 4LBJA 3FLTA 2LW8A 2P3IA 2O0OA 4XIOA 3MF6A 4Y1UA 3RGBA 4CCCA 4FQ4A 2H0BA 2ZGMA 5C9AB 1CAUB 3H7YA 3ZX7A 4DS0A 1RUH1 4D6RA 1NNQA 3AC0A 4J1WA 2RJKA 4YG3A 4MHRA 1F9KA 5GAGc 1OMIA 1XYOA 1O7FA 2HWB2 5DXDA 5C9AC 1KJLA 3BU7A 1H2KA 3VN4A 2TEPA 3ST7A 4NR1A 4NVPA 1JODA 2VR4A 5JAXA 1VBC3 1RGSA 2HJIA 3I97A 4DFSA 2PVEA 2JA5L 1ZVFA 4K20A 4OHXA 3H50A 2PLV2 4DY3A 1Q8PA 3VKOA 1GICA 2FDHA 3DYMA 1RUE3 1JZ6A 1E5IA 1B2JA 1JHNA 2IVJA 4I02A 4V1PA 3N9PA 1ENQA 4Y1YA 2RS32 4XJZA 2ERSA 4AHWA 2ARCA 1D4M2 1Z78A 3GM8A 2M6PA 2QBXA 2JG9B 4AI9A 4QX3A 1RYYA 2H0VA 4AQ6A 1S2ZA 2XMLA 4K3UA 3NFPI 2JG8C 1NLSA 4PBOA 3MV01 2CAVA 2DCZA 3S1NL 1QDOA 1TZOA 2JG9C 2PN5A 1V00A 2XOMA 4RS5B 5ACA3 4G4FA 4DIQA 4G3YC 4GMP3 5GZCA 5CG8A 2PAKA 1QQP1 5FXXA 4NE9A 3RZZA 3S0MA 5CKNA 1ENRA 4DXSA 2W47A 1EV12 4MO3M 1I5PA 4DEVA 1PMHX 2PSMC 1QGLA 2ZX3A 5GLZA 5IK8A 1QOSA 2VZVA 4QIWP 4LA2A 5JR7B 1UOBA 3LEKA 4TZDA 5CVRA 3GTML 4N7IA 2D97A 4GWNA 1JYBA 3SS2A 4A2UA 1HRV1 1C1FA 4YARA 5LW9A 1GLHA 3DYOA 3PWFA 4NHLA 3C7OA 4QX8A 3JU9A 4YW2A 5FUNA 5FZAA 3VGIA 4K9SA 1RUH2 4XF1A 2AYHA 4CTEA 3O1SA 3M3YL 2RDSA 1F2NA 4MGTA 1PIV1 3WCSA 4CU6A 4FPYA 3H1YA 4AFBA 1T6BX 2VL4A 3AKPA 2JI3A 3WOGA 4ATFA 4CZSA 1WD3A 3A23A 2PPTA 4XMIA 5A6YA 1LB2A 1NXGA 1OVSA 1S2KA 2C26A 2ZTNA 3VD7A 1E57A 2OPWA 2VQUA 1TG7A 2XG3A 5DUXA 4AK3A 2R061 4LO4B 1ZBA3 5AFBA 4YZ2A 3MLLA 1W8TA 4CEWB 1YCIA 4P9LA 1OFSA 5LCWL 1R091 2ZGRA 2XJRA 1E5RA 3N7KA 3O1TA 1LODA 2QZ2A 2RG4A 4LLOA 1LHVA 5FZFA 4CEWC 4BQWA 3J8F3 2GDFA 3C7FA 1NQDA 4BY1L 4E2GA 1ULFA 2W95A 1JZ2A 1ENSA 1UQXA 3KZ4C 1V9U3 3PKIA 2BVBA 2OS2A 1ZBE3 2HBTA 2VCCA 1TQ5A 5FJ8L 3C7HA 3M3CA 4IEUA 1EAH3 1QQP2 4AAXA 2FDJA 3AP4A 4JGYB 2HYXA 2EXJA 1DGWX 1GP5A 2Y0IA 2CR8A 1LOGA 1YUZA 2ZX0A 3DL3A 3RZLA 1ND2B 2W0XA 2ZZQA 1NG0A 3KQ4B 4CCOA 1DIWA 1CAXA 2YC4A 4JGYC 3O7OA 4ZS2A 2CYFA 3HD8B 2WUHA 1I6XA 1ND2C 1HRV2 1UIJA 4NWWA 5J3UA 2NMNA 1PM4A 4NIDA 1MZFA 1S24A 4A3IL 1FYUA 3DCQA 5GZFA 4YW4A 4R9CA 3ITQA 4M0HA 1PVC3 5FPUA 5GJ6A 1OA4A 1PIV2 3ACFA 3GF6A 1BKZA 4XHBA 2R30A 4XMAA 3WNXA 3LB9A 4EWAA 1H8VA 4QU1A 2W68A 5FLHA 2V3BB 2ZGTA 2KD7A 4BOWA 1JZ4A 4F3JA 3ALQA 1TWAL 4Y22B 4D6QA 2B5ID 5MFPA 2IXCA 2R062 1N3PA 4IEVA 5GADc 4PIZA 2V5DA 5T3NA 4AEDA 1RUC1 1TVGA 4QPGA 4JKMA 1ND3B 3FLPA 3S15L 1R092 3FBYA 2ERJA 1OUSA 4TVMA 3H8UA 3JQXA 4YM0A 3THDA 3OPZA 5CYYA 4E27A 2PHWA 3VBRA 2WINB 5C4XL 1L7LA 3AB0A 4AZZA 4QGMA 1ND3C 2WN2A 2VJXA 2A7AA 2GMEA 5FUPA 3USUB 4F83A 2ZAAA 1VP6A 1RTVA 5F5CA 2JDPA 3ZIXA 2GP3A 1QY4A 5F5IA 5FY8A 4Q5OA 5A3NA 3T0AA 5JOXA 4TTGA 1G9FA 5A3OA 1AX1A 2WO2A 1OD5A 4G9SB 2WA4A 1NUKA 1R081 3OG2A 4OMDA 2YROA 4GB33 2WLQA 5A7WA 3RYKA 4MADA 4JZRA 1QNYA 2ADEA 1W6MA 3O1MA 4OI1A 2CU5A 5M3ML 1WMFA 1S0FA 2LCQA 5LA0A 4A3XA 4PDWA 5FZKA 4CP9B 4CA9A 5A3LA 5FXWA 2DBIA 4YYOA 4A3FL 3K51A 2ET1A 2VOXA 2WO7A 3OUIA 1CIWA 2BPA2 2EIDA 1LEMA 3ZO0B 1UKRA 1XYNA 1XJAA 3KYXA 1U5YA 1XE8A 3OD4A 1OQEA 3SISA 4BQ3A 3USSA 1QOTA 1VAVA 2Y6LA 3V0BB 5DUWA 5DUUA 4Q0QA 4IEYA 5CFDB 4HK8A 3ACIA 3GZEA 3I3EA 4G6BA 4IE4A 4LK7A 3LWRB 2WA3A 3KYVA 4Q29A 2XWJB 4QM9A 2IVIB 4R9DA 3WW2A 3B02A 4D69A 1ASJ1 2OVUA 5FYVA 3NNLA 1XNAA 4IV1A 3VBHA 1FXZA 5A33B 4GD4A 1RUC2 4FTBA 3X29B 1O91A 3ZPYA 5CZKA 3U4XA 1AJOA 1EUTA 3BI3A 3D8CA 3S7EA 1TNRA 5I0SA 3SC7X 2MS3A 2FDGA 1X8EA 4CUCA 2G4IA 1WUVA 1YRZA 3PL5A 2W94A 3MHZA 1CVNA 1W9TA 2ZHKA 3EMRA 3NV3A 2JWPA 2ZPXA 4ZONA 5F9TA 1PM7A 3K4ZA 2Y0SP 1Q8QA 5FJHA 1U5IA 2IXLA 4XJWA 3FMGA 2GP5A 1R082 3ZM8A 4OVEA 1LESA 3ZKUA 2L9LA 3L2YA 4QPIB 1T2XA 4AR4A 2OX0A 4LEJA 3LIGA 3NO8A 4IGPA 1UMIA 5BNPB 4AVAA 4LORA 3I4IA 5C3EL 1SFOL 1X8MA 2JDMA 4QPIC 5FPAA 1CONA 2PMWB 3S5QA 3WV6A 1AYN3 1UD1A 2J9UB 1JUIA 4QX2A 3THPA 5J1XA 1BRFA 2VXJA 2D98A 1L7RA 4O7XA 4UW6A 5BNPC 4M00A 2NPIA 2G19A 1ZA7A 4WVMA 3JB4C 5L9BA 3RI8A 4A7KA 5LRSA 2RS11 3IDEA 5L7OB 4MGQA 1O3RA 4DUXA 1S0BA 2AH2A 1DQ5A 1DQ1A 2VQAA 3I59A 4ARYA 1H8TC 2E26A 4O65A 4Q8LA 4CCMA 2Q5TA 5L7OC 1C57A 1G9BA 5JSPA 2WABA 2QQJA 1B2OA 3HQUA 2CWMA 4ZZ5A 4CDXB 1W6OA 1R9TL 4BCUA 1ASJ2 4DMIA 2WWSA 2ZMNA 1W2NA 2A3YA 3M7AA 4LOSA 1JYIA 1DVBA 3WP5A 1BMV1 1VMFA 1PK6B 2ZA9A 2BOIA 4I09A 3BYWA 2BGPA 1S1AA 2ZACA 4XUPA 4CDXC 3A44A 3UGHA 5LZ6A 4IE6A 4Z2AA 3H3UA 3WDVA 4W65A 2GC3A 1PK6C 4Q1PA 4CDQA 5FYSA 1GKBA 3ES4A 2YY1A 4MH0E 4ZN3B 1JOPA 3S57A 4BJ0A 3ES1A 3H1MA 4L0PA 4YGEA 3W59A 4MUVA 1UU5A 1W2TA 2DVAA 2HWB3 2DBNA 3D5OA 3LWOB 3DKWA 2ORZA 4M0NA 4ZZ8A 2PELA 3HQRA 4UW5A 5FV3A 2VOTA 4Y7NL 2KKDA 2GMMA 2XKOA 2J7MA 3BIWE 4LE4A 4UT5A 5CBLA 1S0GA 3TN91 3AVRA 2GSYA 1V70A 2D44A 2WT1A 3OGGA 2GNDA 2VBPA 1XNKA 2NM1A 3BPZA 3Q9OA 4QMAA 3H0OA 4L11A 5JPNB 1O3TA 1W6NA 2OXBA 3OCPA 4ZU7A 4QKFA 2Q1FA 2RS33 4KI5M 1S2EA 2GU9A 3NQHA 4I30A 1D4M3 4PLMA 3ZYFA 5FY4A 2RS12 1WMXA 1RINA 1ZX5A 2YXSA 3DF0A 4UXAA 1I50L 1NXD1 1EPZA 3GTLL 3I54A 5FZBA 5KC6A 1RUNA 4BU2A 2YB7A 1ULEA 5JZGB 1MS3A 2WIIB 2BTVC 4JVAA 2VG9A 3IIIA 1W8ZA 3EB7A 4HK9A 4JQTA 4CRQA 2YFUA 3FHAA 3LDBA 4RA0A 2R071 3MICA 5JR2A 4AR6A 1W2OA 4MHUA 2XVKA 4URTA 1EV13 3OPTA 3HAGA 4XJ9A 2E9QA 3FJSA 4Y33A 4WM8B 4OUSA 4WM7B 4A93L 4BISA 3UNPA 1AL0G 4P5HA 4BQ1A 2J1EA 3EQEA 3KV4A 5K8SA 1UIKA 2K2DA 3F95A 4WM8C 1S0JA 2A69D 1YK4A 4WM7C 4CCKA 2BGOA 2CHHA 1FX5A 2BBAA 2RMU1 2WNOA 1OC1A 2ZKLA 1RJ7A 4KH9A 1RUH3 3I2IA 3THTA 1CAWA 4RGGA 1G9AA 2BWCA 2Q4SA 3KB5A 3ZN6B 4IETA 4BK4A 1VZHA 1C8NA 2RV9A 2PHUA 4HN1A 4PBPA 5SV5A 3ZSEA 3AYDA 4CEYA 5JIUA 5H9SA 1VRBA 4H7MA 3DKQA 3CMGA 3E1F1 3TN92 3WNMA 1QJU1 3N7JA 1SACA 1O3QA 3GNEA 1OQDA 1ZZ8A 2DU0A 5A7NA 2VZQA 3OEAA 2D6OX 2J42A 3RI9A 1PX4A 3HT2A 4GKYA 3OGRA 1POV0 3ZYGA 1RUI1 3VZOA 2Y0OA 5CU1A 2Y64A 1DHKB 5FP4A 2ORXA 1IS6A 1VPHA 1UNBA 5IVCA 3ZYBA 4LJHA 2CGPA 3FL7A 1RL3A 1XSRA 2VE1A 5LEKA 1DF0A 1OVPA 2BOJA 2C9KA 2HEVF 3NNGA 3OY8B 4KQ7A 5ANNA 1HB2A 2B4KA 5GAEc 2PQSA 5IP9L 1CAVA 3A4UA 4XUOA 4FFIA 1JMUB 3A21A 1W03A 3QH7A 4Q4Y1 1REEA 3EO6A 4FXGB 4LA3A 5JIAA 1LR5A 4H14A 4QX0A 1ONAA 5FRAA 2E53A 4OI0A 2R072 5C71A 1JYCA 1QQP3 4HPKB 2JIGA 4FOYA 3NJZA 1NOVA 4C1WA 1K5JA 2EALA 4I3GA 5DDJ1 1VB4A 4M3CF 1YJKA 1LGNA 1YI9A 5DUVA 4AHXA 1GQGA 2MEV1 1BEV1 2WWUA 4MGZE 3U0ZA 2WYSA 1S4CA 1V0AA 1HRV3 5LK5A 5A1FA 1AJKA 2Z3RB 2HVYC 7RXNA 4QHZA 4IXLA 1PZXA 4J1XA 4PIYA 4QQLA 2XLGA 2RMU2 5GZGA 5FTTC 1NA1B 2CAUA 5EQUA 4O9EA 4XAAA 3FZ3A 2JEMA 1W06A 3AP9A 4YVWA 2EXIA 1WCQA 2YU1A 4LBNA 1WCML 2IXIA 3MW3A 2EAAA 4XCAA 1PIV3 3H8XA 3HKZP 1NA1C 1G7YA 1WJVA 3AZZA 1F4LA 3WWLA 2VQ0A 5FZOA 4AHYA 5FQ0B 2E63A 2YZ4A 4XQ4A 1P7PA 5JPMB 1RITA 3WP3A 4P9WA 1QCVA 2PHDA 1QJU2 5F32A 5FMCA 2F4LA 2VZSA 1VLNA 3LIHA 1ZNPA 5EYYA 2RS51 4CDUC 4M3CB 2XVGA 3PUSA 3IT8A 2R063 1RUI2 4FT8A 5FO7B 4QDQA 1K3IA 1CJDA 1R093 3HN1A 2JA7L 2JDHA 1J1TA 1OPMA 2A70A 1LGBA 2XBO1 4FFGA 5D8AB 2QDRA 1GMMA 3QLQA 2AREA 2GNMA 1CPNA 4Q4Y2 4TXWA 1APNA 5D8AC 1NCQB 4R4ZA 4R9BA 1BE7A 1CR7A 1VCXA 1Y1WL 2VW0A 2W87A 2BVVA 2ZGSA 3U07A 4RD7A 3ILNA 4PHZA 5JXHA 5A32A 5IYCL 3FC0A 3K3OA 5JXJA 3RZHA 5DDJ2 2VZPA 4D7YA 3GTJL 3OBAA 3MQKB 3KT7A 4YW6A 1NLRA 1QJFA 1W3VA 1JW6A 1YQ2A 2GC0A 2MEV2 3H9CA 1BEV2 3MV11 1V6LA 3HJYB 1H1IA 1I5ZA 1UY4A 1VBD1 2D3SA 5I0DA 2R92L 5A3WA 5GALA 5HCAA 1AR71 4DRRA 3H1WA 3P2AA 4U671 3UETA 3VD5A 2WNUA 1VJ2A 2WZR1 3VDBA 4JV4A 1LU2A 4FO9A 1NT0A 4AEMA 1YI7A 3VDAA 1O4YA 4XCBA 4EYUA 5C70A 3KVBA 2W52A 4FVVA 2ZABA 2VPVA 1ODHA 4IE5A 4XBQA 3O0VA 1GSLA 4A3ML 1W6QA 2ZBJA 4BZ4A 1PGL1 2IUWA 3WSOA 3OGJA 1IS5A 2RS52 1O4TA 4H2AA 2M6OA 5EINC 1QOOA 1IU5A 1KS4A 3OGVA 4LHSA 2DV9A 3N36A 2MPFA 4XVHA 1O4ZA 1RUC3 5FY1A 5FKBA 1LOFA 3I2KA 4XBNA 2O8OA 2JENA 2WFF3 3HNBM 3OJBA 3S6PA 3V56A 5EJ3A 1W8HA 2XBO2 3HN3A 1VZGA 5H1Sc 5FZ9A 5DN2A 1VALA 1XE7A 2W39A 4ORFA 3I2HA 1QWRA 3B08B 1AR61 3DPRA 4CUAA 1O6UA 3LDKA 2Q30A 2A6ED 3P5BA 2ES3A 4Q4V1 1IG0A 1T9OA 1OI6A 1SLTA 3SKJE 3ZDSA 5B4NA 5FLJA 5BNNA 3POGA 1J83A 1R083 4OI4A 4UF0B 2OZ6A 4AR3A 3GTKL 2A6YA 2FBEA 2VZOA 3VBFB 4JCKA 1F5JA 4IEQA 2GZWA 1RB8G 4C0BA 2WR9A 1FNZA 1L3JA 4Q4X1 1QXJA 2WAAA 3ILRA 2W91A 4WZCA 5AC91 3S17L 3VBFC 1MQTB 1WW4A 3JD71 1VBD2 1PFUA 5FZGA 2H6BA 4LOTA 5L36A 3ZXAC 2C6AA 4RR3A 4QX1A 1AR72 2WN3A 3CKHA 1MQTC 3KCXA 4IQPA 3RJ2X 1YC61 3B3QE 4Y3OA 3VZJA 3T3YA 2WC2A 2WZR2 3FBMA 4MGKE 1WA4A 4Q27A 4V2VA 2V4VA 2WSUA 1HV1A 2JJ6A 2WJSA 4XF4A 3S14L 4Q8KA 2CKCA 3R4DB 1LHWA 1UXZA 2IFRA 2AC1A 2C24A 3GHMA 1QJY1 3ZR6A 1DGWA 4U36A 2GH8A 1PGL2 3ZYRA 2BDRA 3NJVA 5APAA 1NLQA 1S0EA 3AKSA 4L9BA 4BBRL 1ASJ3 1VBA1 4NHKA 4Q2FA 5LA2A 2DFCA 4ZPIA 2RM21 1QMJA 4XHXA 5FPZA 4S2DA 3ZFGB 3MFAA 4AGVA 4D7SA 1CZSA 1FAYA 3MZHA 5KR7A 3LWVB 3QVDA 1OFNA 2Y6KA 4CDWA 2V09A 2RDVA 1OF3A 5AI2A 5AN9H 4IEWA 4COVA 3J7Z1 4JKLA 3J4UH 2Y38A 4UFJA 3VL8A 3J7Y1 3I2DA 1AR62 2C4XA 1YXWA 2VOVA 3PUAA 5JXGA 4Q4V2 3LAGA 4P08A 2NLRA 5CADA 4D3WA 3MW4A 4I3PA 1N1SA 4FFFA 1IQAA 3TB0A 3ZKYA 1GWKA 4CU7A 3VPBE 5DAQA 4HMZA 2VUDA 1ZRIA 2B5HA 2E7AA 3GHNA 1RYQA 2V0EA 1UY2A 2XGXA 4ZU5A 3UJOA 3VBSB 3BUCA 4AEKA 3WHTA 4Q4X2 5EV7A 3ZFFA 5AC92 1M06G 3VDDB 4COZA 2K0GA 1WA6X 2Y26A 2P2KA 3HEIA 4HL0A 3JD72 5GLWA 4OFGA 4B8EA 1GBGA 3HT1A 5K0UB 3M3OA 2QQNA 1EUUA 2ATFA 3VDDC 1KXGA 2BE5D 1N3OA 5EPAA 2C9AA 4FOWA 1D2SA 2R49A 5K0UC 2RS13 5EZWA 5FY9A 5A70A 4S2GA 3J7LA 2RR11 1XYPA 3H3LA 4DY5A 4LR4A 1QJY2 4N53A 4C90A 4ET7A 1GWMA 5C44L 2AUYA 4P9IA 3MPSA 2XQRA 4JADA 1IKQA 4DRVA 3WXPA 2VNVA 2GNTA 2P3KA 4RQPA 1VBA2 2Z42A 1VAKA 2RM22 1QIQA 2DVFA 3MW2A 4GQ7A 2DCKA 2B39A 4PT6A 2NP0A 1YFXA 1KITA 4BMBA 3FHQA 1FATA 4AI1A 3QACA 3OYWA 4PCRA 4B1MA 2VM9A 3AKTA 4QD2A 4YNIA 3KV6A 4DB5A 5C4WA 4IV3A 2WKKA 1AL21 3CL1A 1YQ8A 4AVVA 5F39A 1BZWA 2ZGKA 1KRIA 2BU9A 4N43B 1OPOA 2BQPA 3Q8AA 3BU0A 5ABJA 3POEA 1REDA 5C5TA 1TWCL 3NV2A 4GWJA 4HKOA 4NWVA 2VTFA 3CIHA 4BBSL 1GQHA 2QQOA 3GCWA 4N43C 1Z0HA 2R0HA 1LKOA 2QTWB 4QQ2A 3S1ML 1OH3A 1KFXL 5A3UA 5M5YL 1DBNA 3I3DA 5I93A 1PHMA 1SFNA 5KWRA 3LPFA 5F2WA 2VNOA 5CFCA 5LBCA 3UESA 1CN1A 4CP0A 2VMDA 1H2NA 4QB2A 2P6CA 4F7ZA 5KXEA 3EHKA 3AJYA 2WZEA 1WWYA 4JTNA 1ZREA 3RZ6A 5LA9A 1W9FA 3T2OA 2XJTA 3I3MA 1F4AA 2JG8B 4Z82A 2IC1A 3WQ7A 4BQ2A 5CG9A 4LHLA 3K4DA 4Y4RA 4N90A 2RR12 3S2HL 2WRAA 3SITA 1VB2A 1B09A 2P34A 5BNOA 5LATA 3V0AA 4C2M1 1XXNA 3RG0A 3POJA 4QU2A 2R073 3AP7A 1RHI1 2ZEXA 1QJX3 4K1YA 4QXCA 4XF9A 4O9GA 5A6XA 1C5IA 1U0AA 3DGTA 4XC9A 4BQ4A 5HV0A 4P5YA 5ERLA 2VZTA 4RS5A 4ZY9A 2PMZP 1IOAA 1QF3A 5A7PA 2Y6GA 3E5XA 2C6SA 5IVJA 3MGUA 1RVF1 2VMGA 5A6ZA 3K35A 2RMU3 4XFAA 2D6LX 2PHFA 4FCAA 5DZGA 2E6VA 2O14A 3KMHA 2CY6A 4GMP0 4EE2A 1GNZA 1AL22 1BBT1 3AZWA 3LKJA 2P6HA 3A22A 2XL7A 2OQ7A 2PFWA 1OOPA 2Z5WA 2KXLA 1WLWA 3H42B 3WD5A 4LT5A 1OUXA 3J7MA 3LEMA 3T2TA 3VDCA 1UOFA 4BWOA 1DQ4A 1QKQA 3SMHA 5F8PA 4HZFA 1UCXA 1MS5A 1H7VA 1CIYA 1WZXA 1QJU3 2JX9A 3PU3A 4PLOA 2FCTA 1QU0A 5T54A 2XPJA 1LOAA 4B7EA 2YUEA 3IDCB 1IRNA 3PNAA 4XAEA 1SFYA 4X6AL 4A42A 4ES9A 2PXJA 1RUI3 1UF2C 4GJYA 4E9KA 4BY7L 3ACHA 1FPN1 3HOYL 5DAVA 2PHTA 1WCUA 1N1VA 4IE0A 5DAPA 4BQYA 2DTWA 1YEWA 5JSOA 3AJZA 3CEWA 2E32A 5CKMA 1HKDA 1SPPA 3S16L 3H97A 4A6SA 3UL2A 1AUYA 1QQTA 2ZOEB 1OBNA 1I3HA 5AVPA 3WDXA 1IZ3A 4CEWA 4Z8BA 3SH4A 2X8KA 3B5LB 3WT3A 1MZ6A 4IW3A 4XUTA 1UU6A 1RHI2 1SLIA 2A1XA 4Y5SA 3ZYHA 5HPOA 1NQJA 1RUG1 1O5UA 4Y24A 3WWNB 1J3RA 5DDJ3 4YZ3A 4UW3A 4GS7D 3LWCA 3OOXA 5EHDA 2Y6FA 1MS4A 2F17A 3F2ZA 5J96B 5FPXA 1UYXA 2MEV3 1AYM1 1BEV3 5E88A 1WCSA 3NV4A 4I0WB 4P9JA 1RVF2 1DGRA 4OUMA 4Y26A 1IPKA 3WF0A 3RZOL 1HN0A 3AMQA 2D6NA 5LA1A 1KDKA 5FYHA 3PJQA 5A80A 4LKEA 1BBT2 2DVGA 4A3BL 4WVVA 1C09A 4X8PA 2VZ3A 5FYIA 4MSVA 1GQPA 2Z4FA 4QHBA 3AXEA 4QDRA 5A1LA 5FY5A 1SDWA 3E97A 1CAXB 2ZGQA 1PGW1 4GWIA 3ZXKA 4YFZA 5C8CA 3LA3A 2Y6HA 1UL9A 2R0FA 4FPFA 1YJLA 2VECA 1GOFA 2BNMA 2XVLA 2ZEWA 3H9AA 3OBTA 1KEXA 3ETPA 3ROUA 3NJXA 2RS53 1XRUA 1E5HA 5FFOC 4YW3A 1LHUA 4BXSV 5C8WA 3APBA 5K9YA 1CADA 1HDKA 5FZIA 2VUML 3D6EA 1NKGA 3B94A 4X6RB 1FPN2 5JOZA 3PIJA 1W8NA 2W1SA 3GTOL 1DZQA 3ILFA 3ECQA 1ZZBA 3ZXDA 4QQHA 4C0HA 2XBO3 1OLQA 1CWPA 4B4RA 5A1AA 4HVQA 5J98B 4Z07A 3BOPA 1OQ1A 2XR4A 4HBNA 2JB4A 2VNGA 3H7JA 5FZ6A 3ZXJA 3PTYA 4DQAA 3I2OA 3NAPA 3WZ1A 4Y1XA 1Y1VL 3NMBA 4XFIA 4XFHA 3WEZA 1RUG2 4FPEA 3T09A 4AEDB 2ZX1A 5C3PA 1V6IA 2QJVA 4IEZA 3RZDL 4QPGB 4UFLA 4LXLA 3K3NA 1IS3A 1W9SA 3KHCA 3RRDA 4AEDC 2HWC1 1SLBA 1IS4A 3VBRB 5IW0A 4Y52L 4QPGC 3R6SA 1AYM2 2VMIA 3WR0A 1VBD3 3SCFA 4LO5B 1N1TA 5MF6A 1PMJX 3H99A 2D3RA 1QXPA 2QFEA 3MBWA 5FXVA 4U2AA 1CGPA 1ZRDA 2APOB 3VBRC 1W2AX 1AR73 1VIWB 1KD7A 1WKYA 3PL0A 2WNVA 5T5OA 1FHHA 4ONUA 2Y60A 2WZR3 3AFGA 4KWJA 4XETA 5HCFA 3RYGA 2VY0A 2C6BA 1JXNA 3KS7A 2BEOA 4CP9A 4E8CA 1JYTA 4PQQA 4PI0A 1W6MB 5IWFA 2JD4A 1GR3A 4EN9B 3CJXA 1PGW2 3L9JT 3QBQA 4HLTA 3CQOA 1X33A 4PDWB 2ID4A 1YQCA 4YWMA 3CJIA 3E5UA 3RDIA 1LJ7A 2Q1ZB 1OH4A 5FZ7A 4PDWC 4AFAA 3WP4A 2JIJA 2Q8EA 5JWPA 5HI0A 3I2GA 1I1EA 1GP4A 3ZN6A 4ZHNA 1LHOA 4IEPA 3AZXA 3I2JA 5CFDA 2B7YA 3E6BA 5E16A 2LRPA 4LO8A 3WQ1A 1UY1A 1Y43B 4MVTA 1AXZA 1JI6A 5KHGA 5IK5A 5CEHA 2NYDA 1W8UA 4MX3A 1SDDB 1F35A 1QNWA 1A78A 2CWSA 3HQXA 1Y9MA 1AR63 4YRDA 4NHXA 2E7QA 4Z92B 5A33A 4Q4V3 4M01A 1WLCA 3TNQA 1XNDA 3ZFEA 5F2SA 4A6OA 4DZGA 2XXZA 1UMHA 3MIFA 5F6LB 4N7UA 1XU1A 4IV1B 1ZRPA 2X5IA 4QGNA 3RJRA 1OLMA 3VBHB 4IUGA 4YG0A 3ZG6A 4AXOA 3PZAA 3R4SA 3WDWA 4BM8A 1I3QL 2BYVE 5C3SA 4IV1C 3B69A 3VBHC 4Q4X3 1SZBA 5AC93 4E2SA 2HWC2 2NN8A 1YIPA 3AYAA 4XEZA 4AI8A 3KM5A 1GZ9A 4B1LA 4KGGA 1O8SA 3JCIA 4NPMA 3FLRA 4S2HA 4XW3A 1RYTA 1DYKA 3SHRA 1VBE1 5F1RA 2NVXL 2JE7A 3U37A 2UURA 3ATGA 4ZKTB 3G6JB 3O0WA 1W0PA 3L2HA 1H8TB 2VZRA 1AX0A 2HR5A 4GAZA 4XFBA 5C3OA 3HBZA 3N3HA 5IVBA 1QJY3 5FP8A 2EICA 3PURA 1HRI1 3ZSJA 4KL1A 4OMCA 4FP3A 1JHJA 5RXNA 2A5ZA 3DUIA 1UZVA 1D2QA 4QWNA 1P8JA 4AGRA 4BDVB 2IFWA 5KXCA 3TYJA 1NCRA 5FIXA 1BYHA 1ZRCA 1VBA3 4GA9A 4B4PA 4HXCA 4IEOA 3ZXLA 3PVBB 2RM23 1UY3A 4WVMB 3BVCA 4K1ZA 1ZRFA 4P9YA 2GN3A 4WVWA 2GH2A 1I6HL 2CV6A 4H55A 3POBA 4JGZA 1PZ9A 4X8NA 4NRPA 2M4VA 4JQRA 5F37A 1QH6A 2ILMA 2P3JA 2V72A 2D6KA 1Z7S1 3MUY1 5D2AA 4BLJA 4GALA 3RWKX 1X82A 5LASA 1W6OB 1R0JA 2DUPA 1ULGA 4Y5Z0 4YGCA 3MFCA 2R7ZL 1NYWA 3ACGA 4E4ZA 1FOD1 2GMPA 2R32A 5M0TA 1NE4A 2OZJA 3DXUA 3HAXC 4YZ4A 3V65A 1YFUA 3PMEA 3AZVA 4JHZA 4K7JA 1H4HA 2HH9A 5K7PA 3HOBA 1LGCA 1CAAA 1DYOA 2E2JL 3BODA 4GH4A 4AFDA 3SH5A 1V6MA 2XUEA 1J59A 4EV0A 2Y6JA 1F15A 2J1TA 2PLV3 1COV1 2B46X 4BIOA 1IKPA 4V2WA 4JDNA 1UO9A 1LENA 1TEIA 2ZKNA 4QKNA 3PKJA 2GC2A 2ET7A 1G9CA 3D3AA 1LKNA 1VBE2 4KNCA 2YC2A 5EIYB 1DQ6A 3LSEA 4BHPA 5FWJA 2LM3A 5EYXA 5IVYA 4A45A 2GAUA 1TWHL 4XILA 3O1RA 1YUXA 3KCYA 1GOHA 4QGLA 2RR13 5FZ1A 1J3PA 3LE0A 2G9GA 1BJQA 2D93A 1FMD1 1HRI2 1KGYA 3JZVA 5KC5A 4R52A 1W6NB 1GNYA 5LBEA 4LBLA 3TN93 4QAWA 4JTOA 4UY81 1KQRA 3IMMA 3MLJA 3MLKA 5JZGA 1ZZCA 3U75A 3CDZB 3PHMA 2ETEA 4ZN1B 5B2GB 4UI9L 4MOAA 1C3HA 1RUOA 1PX3A 4MG2A 3PLQA 3SH3A 1Z7S2 2DWRA 1DZTA 5A7SA 4FPGA 2PA7A 5L73A 1AL23 3A7QA 3O12A 4AOCA 2WS91 4EQVA 1AXKA 2J22A 3WF1A 1FOD2 4Z2WA 1BFYA 1UOJA 1VMJA 2EA7A 1HQNA 4P9XA 4CE8A 3IM0A 5B4XA 2V0FA 1A3KA 2VTXJ 1DG6A 4LK6A 2C1FA 3BTZA 1G8WA 1XBFA 1RMU1 5M5XL 4Q26A 1CAWB 1COV2 1ALYA 2B63L 1KS5A 2W08A 3WDYA 1DLLA 3TAYA 4XJ8A 1S0DA 4HN0A 2NVTL 2W1WA 1PO21 4LKFA 5JVH1 4CEYB 2HEYF 2VCAA 1GANA 1VZIA 3WW4A 5IK4A 3ZPOA 3VHPA 4JHTA 4FXKB 4CEYC 4CCJA 5GM0A 3WF3A 3HJRA 4A7YA 4XDPA 2WDBA 1LTLA 5EXOA 2XJQA 2VU9A 2XQXA 4R8HA 1FMD2 1W9WA 2ERFA 1BCXA 5M5WL 1PO11 2ZHMA 3HOWL 2F4PA 1CESA 2BZDA 5CA6A 5E6HA 2B45X 1UXXX 2SBAA 4UFIA 5C4JL 4LHNA 4RGKA 4LBQB 3TRSB 4Q0SA 3UT0A 1JZ8A 2AACA 2WNEA 4PLNA 4RYDA 3AYCA 5MGNA 3I49A 2WB1P 2AR6A 3HPNA 1W90A 1UYPA 1RVF3 3O1OA 3WUDA 4POGA 2P3YA 3RZGA 3UGFA 3LPGA 2AYJA 4UBGA 4C8DA 3POWA 2ZX2A 4XUNA 5FDBA 2CL2A 1W3XA 4ASLA 5LK7B 4L97A 3MIEA 1BBT3 2WS92 3HOXL 3WF4A 1K5MA 2VBBA 4XBLA 4L2NA 2DVBA 4EZHA 2QQWA 2JA6L 1ACCA 1HV0A 5F5QA 4PQ9A 2IZWA 4CUGA 3UGGA 4XIKA 1XB9A 1B13A 4XURA 4CDUB 2MNGA 5JDBA 3ZIWA 2A6VA 5F7UA 1RMU2 5C33A 5L9VA 4JKKA 1Q3EA 1RDGA 2YBPA 3C2UA 1GP6A 2DDUA 3JB8A 4YVWB 3LDRA 2VXRA 4BPZA 3FWEA 4NIHA 1FPN3 1PO22 1C1LA 4L99A 4XPVA 1HB4A 4YVWC 5FZOB 4E8DA 3FFQA 3TEWA 4MGIE 5KHIA 4XACA 4LNVA 5E1RA 3RZJA 2GALA 2JDNA 3RZTA 1JOBA 2VMHA 2JE8A 3PMSA 4SLIA 1R0GA 1BK1A 4YSFA 3C8XA 3ZYPA 3B0AB 2Z3QB 4IEXA 3KT4A 1Y9GA 2YC0A 1PO12 5M3FL 3I2FA 2ARBA 1YK5A 1IPJA 2PTMA 4JC1A 1RUG3 1UX7A 2DCJA 2P1BA 4EN6B 5HBAA 1H6XA 4QQPA 5F6KA 1CZTA 2EF6A 2QZ3A 4UAPA 4XXAA 2B9VA 1LAJA 2VO5A 4Q4W1 4FOQA 1MS9A 1H1MA 3DN7A 4TWTA 1DU3D 1NCQA 2VBDA 4AVCA 1AYM3 4FPLA 1YIFA 3J9SA 4ISQA 1LULA 2WSVA 3KV9A 5MLC3 2XB6C 3BTAA 3K7AL 3IPVA 2QQMA 4CXXA 5J7MA 1O8PA 4AVTA 5A3PA 1QDCA 5IHRA 3S2DL 5A32B 1JBCA 3R05A 2GNBA 4W6XA 3PIP1 3I3QA 2R7EB 1B71A 1JYNA 2HBUA 3POSA 4XQDA 2PYAA 1Q43A 3U11A 3T2QA 2YGLA 3D4KA 5FZHA 3RZKA 3OBRA 4MXWA 5A3TA 3VBOA 1U5ZA 5ISLA 2I2SA 3UKNA 3NKTA 3OGSA 1W39A 3O14A 4FFHA 4YW5A 4NIAA 1W6PA 1I9RA 5KBFA 1JN2P 2A6XA 3S1QL 3JR7A 4KBZA 3WW1A 2WNUB 3CNAA 3D0JA 3GBWA 5LY2A 1W04A 2QQLA 4URAA 2EAKA 3THCA 1WD4A 1R0IA 1FI2A 5L9RA 4ATEA 3PDQA 5JOYA 4Y1VA 4FTSA 3LGRA 2WNUC 4WV8A 3VZLA 2XKPA 3EXUA 1JYWA 4LULA 2FMDA 1SCRA 4XDQA 3VKLA 1MS8A 1SEFA 1VBB1 2ENRA 4AE2A 1S0IA 1DYPA 1R0HA 5AI3A 1EYBA 2BW8A 2DTYA 1STMA 2PYTA 2WZ8A 2FD8A 2FZ1A 1S55A 3NNMA 2UU8A 3MIGA 1URXA 3GDBA 3PU8A 4NN0A 5FPBA 3RPQA 4LHKA 4YFWA 3C7GA 4D6SA 5HCHA 3M70A 2CSGA 1X36A 2ZGLA 4AR5A 2TBVA 4P02B 1YQ5A 4Q4W2 4YM1A 2HWC3 2ZAHA 5IYYA 1HXS1 1SLCA 1LOFC 2W1QA 4DXTA 2BERA 2QKDA 3O1UA 3DPRB 4XJUA 4EN0A 4JDOA 1HQWA 3KGLA 3UKTA 1YV1A 5BY5A 3ZSKA 3ZYJB 3ME2A 2E2IL 2PVXA 4AFCA 5BNNB 3DPRC 4XABA 1JTZX 4QKDA 4PIXA 1IW7D 1PFVA 4Q0VA 1BQ8A 3Q8EA 1UZ0A 1ZA4A 3QQCE 5BNNC 3CO2A 1DGLA 2A3WA 2HWF1 2QE3A 2W92A 2QQIA 1GWLA 5KHKA 1OA2A 1LOCA 2JDAA 5FYYA 1XU2A 3UKVA 1US2A 1X7NA 2E51A 1GZWA 3AMMA 4YVSA 3ACLA 3SCGA 2YYOA 5BNQA 3A0NA 4LQRA 4QX5A 2R041 4WZFA 3S5AA 3Q8BA 1C28A 4RR3C 3FE5A 3ZN5A 5JMCA 5JLVA 5C6CA 1FV2A 1TWGL 3T4VA 3OSDA 2BP6A 2VNRA 1RXGA 1Y3TA 1DQ0A 1VBB2 4WVZA 4D8MA 3AP5A 2JKXA 3JBG1 5FZLA 3PJYA 3ZFGA 4YLZA 1PNGA 4I0BA 3QOPA 2VOKA 2LUWA 1S2BA 2XONA 1MVQA 4XYXA 4FPCA 1SMUA 4K8RB 2CDPA 4XJAA 4DEQA 4Y20A 4KWLA 4YM3A 4XDOA 5BV6A 3NNFA 4A3EL 1REFA 2YPJA 2UY8A 1VE0A 2BFUL 2MHFA 3VBUA 4AVBA 1AZDA 2Z79A 1E8JA 2TNFA 3IAQA 5DQ0A 4CDWB 5DZEA 2A75A 4XZPA 1ZZ6A 3RSJA 1W8FA 1HXS2 3ON7A 1GUIA 3VKMA 5FMOL 2JI1A 4CDWC 5FZ3A 3J7HA 3RWNA 3VBSA 4INDA 3TEYA 3GZUC 1UYZA 3KD4A 3UYJA 4F8AA 5FP3A 3K77A 3Q8CA 1VBE3 2B8MA 2ZXQA 3WINE 2RHPA 2BJSA 3T2PA 3IU3I 2RDNA 5D21A 1F5FA 3ZFFB 1UYYA 2HWF2 1B35A 4TYSA 3RQ0A 1NXEA 3AL5A 4KU7A 4XFCA 2FZ2A 1HRI3 1AR91 4QXBA 2QDNA 1JH5A 1SLAA 4EWEA 2YU9L 1WCKA 3ZFFC 2AZ5A 2OUHA 1SMWA 1VRH1 1X9TA 2XLFA 3B9CA 3GTQL 4NAOA 5J09A 3ZXEA 3LNLA 3PVEA 1H30A 3TWIA 4YM2A 1UW8A 2R042 5DAWA 5F3GA 5A3MA 5GZDA 5CAZA 2CDOA 1CD3G 4N9IA 4ZXKA 3SQOA 2TUNA 4MLOA 1PVXA 5IATA 4N53B 4CPBD 1LU1A 5HCBA 3BIEA 2PQQA 2D7FA 4OQ8A 1Z7S3 3OUJA 1X9PA 3JBG2 4ASKA 1Y4WA 2LS6A 3IN9A 4N53C 5C7GA 5C3RA 4OHYA 4AYBP 2I45A 5A7OA 3EYPA 4TPUA 1FOD3 4NIGA 3E6CC 2ZEZA 5FJKA 4E6YA 4KWKA 5H9RA 1KDMA 2DUOA 2LROA 2XJPA 2AUSB 1NXMA 3KQRA 4RQPC 5T5PA 4JDMA 4C91A 4YZ1A 4C3JL 2ZGPA 3ZMNA 2XH6A 3AK0A 3KLSA 1EP0A 2WAOA 3HMYA 3OYWB 2ZS6B 3T30A 1CAUA 3WQ0A 5C9AA 2K46A 2VMCA 3W9AA 2JE9A 4DUVA 4IV3B 4JAGA 4AI3A 1COV3 2E7TA 3I8TA 4CCLA 3RZMA 1TMF1 1TME1 2UWAA 3J26N 3N9NA 3LCPA 4HONA 3LOIA 5I8SA 1YFYA 5ABJB 3AMHA 4IV3C 5FZDA 5C4WC 4BXXL 4ZS3A 1D7PM 5FZ8A 1MPXA 4JRLA 3LPEB 3WW3A 3KF3A 2X10A 2VW2A 2YG0A 5ABJC 3KWVA 4B3NA 2KM2A 1VMHA 1POV1 3R4UA 1FMD3 1AR92 3GXUA 2X53S 2ZIXA 2KA3A 4AWDA 5J37A 5CFCB 2VCMA 3FHIB 3LD8A 1VRH2 1J3QA 3K75B 4IDZA 2OYZA 2JG8A 5FAXA 5IVFA 4LKSA 2VTXA 1UU4A 2DUQA 2JG9A 3M1HA 4Y5TA 4ARXA 4ES8A 5CFCC 4L8QA 1F31A 1LRHA 3D82A 3SEPA 2CGOA 1Q8SA 1E5SA 2D5FA 3DYPA 1ST8A 1N47A 3U10A 3VLBB 1JZ7A 1UN1A 1QJEA 5IY0A 4PF1A 2NQYA 3UJQA 4POFA 4LIUA 3T1MA 1WW7A 3V0AB 5BNOB 1VR3A 5GZEA 3CF6E 4CYDA 2OT7A 2ZJCA 4I0AA 3K48A 4RL7A 3KT1A 4XXPA 4DUWA 5FPLA 2YPDA 2WS93 3IZOA 3OD0A 3POYA 4NUBA 1Q56A 3GGLA 5BNOC 1JU4A 4GWMA 3WG2A 4A41A 3KF5A 1TNFA 4EZ4A 3PVNA 3POIA 4S2FA 1SG3A 4AEJA 3WG1A 2VMEA 2UWBA 4CUBA 3N35A 1HQLA 4FP2A 1VAMA 3CHXA 4RS5C 1H9PA 3PIGA 1NY71 1RMU3 2AGSA 2DCYA 3LFMA 1H6YA 4KMQA 2BRTA 2XLAA 1RUJ1 4L92A 1UWWA 5KHHA 4XFGA 1OT5A 4DO0A 1D4VB 1GU3A 1TMF2 1TME2 2P4EA 1V6JA 1H2LA 1RUF1 3MPBA 1PO23 3N9MA 4C3IL 1OOPB 2AEZA 2VD7A 4QQOA 1Y7BA 1X50A 2DCTA 2QQPA 1IG3A 2K2SA 2VVEA 1RWDA 4AHZA 3KYUA 1JYVA 1JUHA 1OOPC 4ASMB 1W0NA 1AX2A 2WO3A 4LUKA 4E4DX 4AW7A 1US3A 2A71A 1CQ9A 1PO13 3O5SA 4Q4Y3 4RN5A 1MS0A 4UW4A 1EPWA 2WQZC 1V6KA 1UZWA 3CBNA 4UBHA 3RFRA 3OTFA 4YW1A 2PHXA 1DLCA 4GXLA 5BPXA 3VKFC 2R1BA 1YO8A 4AQ2A 1SPPB 2HKXA 2JECA 1YUDA 5L19A 2FDFA 3WNOA 3P1IA 2X09A 2YV8A 4AYUA 5FUIA 3FKIL 1ZZ9A 5G05L 1A8MA 1WGPA 5I0UA 1YLLA 4OLLA 1J58A 4BK5A 2QNKA 4JGYA 4B8CD 5JI7A 1IHMA 1O59A 2UYBA 4ITCA 3CZUA 3RMXA 3N4MA 4IE7A 8RXNA 4IGQA 3LWPB 4CU9A 1ND2A 1DDLA 4AVSA 3BCWA 1EY2A 2WT0A 2VQTA 2GC1A 3IAPA 2B9UA 2SLIA 3HWJA 4YWLA 1AR81 2VOWA 2ADDA 1R0FA 3WVJA 1WBFA 1R1A1 1YNAA 3U14A 4AL9A 5IYBL 1UY0A 1UKGA 5GAHc 1NY72 4Y4YA 5BXXA 3ZLIA 4NO4A 1RUJ2 3NL1A 1MACA 1LKMA 1ZZ7A 5DM61 3N9QA 1YHFA 5C5UA 2JDZA 3S1RL 1O5LA 1RUF2 2LALA 2BNNA 3FUQA 4GIQA 3BTXA 4K8FA 3PO3L 3AKRA 5C8CB 3WG4A 1MS1A 3LFIA 4KBBA 2R1DA 5FZEA 4GULA 1SCSA 5A7QA 4Y1ZA 1WMDA 2BGCA 1UZZA 5C8CC 1HJGA 2OPKA 4RHV1 2VGDA 4Y22A 5FZ4A 1IGOA 3RYRA 3T08A 2HEWF 2W3JA 5G04L 3PUIA 2CGNA 3LEIA 4Q0PA 3B93A 5F5AA 3RYPA 4CDQC 1ND3A 3RMYA 3MIDA 4LO6B 3WG3A 1K83L 2XDVA 4Q4W3 2B42B 5DAXA 3LEGA 3U1XA 1NAEA 3WHUA 2BBVA 2VW1A 1AF9A 3USUA 1WMEA 1OSGA 1C8M1 5FYTA 2X05A 2W1UA 2DF7A 1G86A 2DURA 2HWE1 1DQ2A 2WAQP 3H3VM 3NAPB 1AXYA 2A6WA 4P14A 3QD6A 2WFF1 3ZR5A 3H9BA 3HJWB 3WDUA 1WLTA 5FO8B 1QEXA 1V6NA 3NAPC 2RDQA 1KFUL 2I74A 2ZEYA 3AL6A 5A7WB 5JCTA 3M2MA 1UAIA 4IL7A 4QPYA 4FAGA 1AR82 1A8DA 3W58A 3GCXA 2D3PA 3WNNA 1AHSA 4D94A 1R1A2 4JAAA 4XQWA 2FMYA 4Q0UA 5FK7A 5IFPA 1BMV2 2D5HA 2WNVB 1Q8OA 5CB7A 1SMVA 2O1QA 1UX6A 2OKXA 4AR2A 3ZVXA 3C7EA 1S30A 4H3WA 5I8YA 4XF0A 5TSWA 3E5QA 3VZNA 1MEC1 3RNSA 5LEJA 2ZGOA 3T1LA 2WNVC 3V0BA 1CX1A 2FCVA 1BHGA 1XE0A 4OHVA 1JYXA 3AMPA 1VBB3 3GALA 2E33A 3POFA 4J6GA 4YPJA 1ZRRA 3WUCA 1UMZA 3AKQA 3BN6A 2OIIA 3CJIB 4BLIA 4NPRA 4LLFA 4RHV2 1Q8VA 3S7IA 1HLCA 2VCBA 4LBOA 4E4HA 2HWD1 5SV8A 3M3IA 1TE1B 3CJIC 3WLUA 3VUOA 4UYBA 4IESA 2WQ8A 3LF7A 1YYNA 4OUEA 1S0CA 2IXJA 3N9LA 2IWGB 3P3NA 5E89A 4ZXEA 1FV3A 1GOGA 2CKAA 5LRRA 2JDYA 2XHNA 3MIHA 4TLGA 5IAVA 2CTVA 1HXS3 3HNYM 3K46A 3TEXA 4CU8A 1OLME 5EJZB 3URFA 5CFDC 4GZ9A 1WLDA 4BQXA 1H9WA 1C8M2 3ABZA 3I3BA 4B4QA 2JICA 2HWE2 3W5NA 1A6CA 3ZFEB 4DPNA 2P37A 3JD73 4FBFA 4D0QA 3MUZ1 1PGSA 2WFF2 4XXBB 3FN9A 3D0SA 1D0HA 2X5IB 3P3PA 3PIO1 4FQZA 5FOJB 1GV9A 4QPIA 3WDTA 3ZFEC 2H12A 3GYDA 3HOZL 1W8WA 2D40A 4QB1A 5GLVA 2WFPA 3BALA 5E8AA 5HXVA 4TLFA 2X5IC 5BNPA 2YGMA 2HWF3 4CCNA 1L7QA 4P00B 2Q8CA 5IFTA 4CSWA 4BMEA 1ENXA 4O61A 5CIRA 4W4ZA 5FK8A 2OQ6A 2RVAA 2C0ZA 2VZUA 1F4HA 3NSTA 3OEBA 1ULCA 3NV1A 4KGQA 3HOUL 1H8TA 3NNJA 1CZVA 2R043 1DZRA 5L7OA 4Z1VA 5IAXA 1RXFA 1MEC2 4AQSA 3GTGL 2A68D 1HB1A 4JX0A 1N3QA 5FR3A 2VUAA 3TEZA 3OUHA 2E31A 2ZGUA 3UK9A 2YHJA 3VHOA 3VV1A 1G9DA 1T9PA 1OKQA 1T9QA 1YQ6A 3I59B 4HVOA 4AF9A 2KN9A 3FDJA 2O8QA 3JBG3 1JU3A 4CDXA 1ZM1A 1HJFA 3K4AA 1NCRB 2UYAA 4GKXA 2Z69A 2XJVA 4H7LA 5J48A 2UY9A 2NVQL 2HWD2 2J1VA 2R16A 4RFT0 2EY4E 3I4ML 1RJ8A 1PK6A 5T52A 5LB6A 3SCHA 3M3QA 4I2OA 3U78A 1A34A 4CVUA 1NCRC 2VH9A 4JGZB 4NHMA 3BGAA 4QPWA 3DEMA 1PNFA 5JMOA 2J1RA 5EIOC 1PZ7A 4COYA 5KXDA 5ANQA 4M4PA 2Q8DA 1W8OA 2CNAA 3G7DA 3PUHA 5IUQA 4EN7B 1RUD1 3K2OA 2PHLA 4JGZC 4HETA 5F3EA 5FLIA 4E2QA 2V5YA 2ARAA 3NRUA 2DFBA 2DVDA 2KR2A 2H6CA 2VZ1A 2WLPA 1SQ4A 4XZUG 4EROA 3C3VA 4EWDA 4MZUA 1LECA 1LOEA 2QQKA 1R64A 1GYKA 4N8MA 4XTMA 1DGRN 3PUQA 5IVVA 1PFWA 2OUJA 4META 2GN7A 1BXHA 2RE9A 4BA6A 4GH4B 5FMBA 2G9FA 2BV4A 4ME3A 1AR93 3LQCA 3P8BA 1W0OA 2PAMA 5FYMA 3S30A 3W5MA 3UV9A 1LOBA 1VRH3 2D6MA 4GH4C 4BH9A 3ZSLA 5EWSA 1IU6A 4OZOA 5GLUA 3JQWA 2IXHA 3CZJA 1UZYA 2Q0AA 5I0TA 1VBC1 3NWKA 4OHWA 3ZDVA 5FBZA 2NYYA 2DU1A 3DXTA 4RGAA 3TOJA 5FO9B 3VD4A 2RDRA 5FREA 1FT9A 1XC6A 1BQPA 3SLIA 2WYFA 1RUE1 1FNYA 3KSCA 5D1IA 4K21A 5FY0A 5BYNA 1LCLA 2P17A 3ETQA 3HNMA 4LUMA 4D7TA 4OI2A 2R6QA 1C5HA 3FFZA 3AXDA 1J1LA 4W50A 1MZ5A 4AI0A 2VMFA 4WM8A 1OD3A 4BYYA 1SHWB 4WM7A 1RB9A 2J1UA 2WL1A 4A3JL 2V4AA 2VC9A 2ZHLA 5FOBB 4LIVA 4FPOB 4NMIA 1SFPA 2QCSB 1H1AA 4E4SA 1BVVA 1QJX1 5ACA1 5LY1A 2VAUA 5JZGC 2RJLA 3AM2A 3PVOA 5FPVA 4LMFA 4GMP1 3VZMA 3NW4A 2G1MA 5JI9A 3H3ZA 1RUD2 3HVDA 4HKWA 4XF3A 5GLTA 5LBFA 5J36A 3QH6A 3J7NA 1RIRA 4RSUA 4WBBA 2QUOA 5DPNA 3WNKA 4CXWA 3GBGA 1TMF3 4OULA 1TME3 2DSXA 3HIFA 4I01A 1BQ9A 3H8OA 4LBKA 4JAEA 5FBJA 2Y8KA 3AVSA 4NRMA 2VVDA 1XQNA 4W6YA 4OQ9A 2WO1A 2W5FA 1JZ3A 2VVFA 3NKGA 4UFHA 5DABA 2ZX4A 1DX8A 3V64A 4A4AA 3JXSA 3WY6A 3BPSA 1F8VA 4NOTA 5EFUA 1POV3 1W05A 3MDPA 4YWAA 2A3XA 1PFYA 3O0XA 3KV5A 3QCWA 1TWFL 3GTPL 3GZTB 4LPLA 1RC6A 4B29A 4FTEA 2Q1MA 1BLZA 2HLEA 2GMGA 2Z2SB 4XTPA 4XUQA 1RHI3 1C4RA 3VKNA 4DOUA 4NRQA 3VD3A 1K42A 3OY8A 1VBC2 3CQZL 4LBQD 3I7DA 3OPWA 3R0RA 3AZYA 3GJAA 4HOOA 3ELNA 3M4FA 5HV4A 2L0ZA 2WQ4A 1RUE2 4BE3A 4C1XA 1CAVB 1ZBA1 5FXZA 1OKOA 1Z92B 4HPKA 4K40A 4LBQA 3Q8FA 4QKBA 5DG2A 4BB3A 2EXKA 4QXKA 4NIIA 4Q1RA 4HSLA 4J25A 4LE3A 1JS9A 4FI9A 5FY7A 1GZCA 1BVP1 3J8F1 4LBMA 4UWDA 1JZ5A 1LNSA 5FKCA 3O1VA 3CLPA 4P9GA 4NPLA 4A3CL 1NZIA 4A3DL 1V9U1 2NMOA 4MXVA 4QDSA 3LOBA 1QJX2 4OHZA 2A6ZA 5ACA2 5JXIA 2NZ9A 1W28A 1ZBE1 1IPSA 1NA1A 3O1PA 1HN1A 2ARXA 3HOVL 3OBZA 1LKPA 3ZN4A 1EAH1 1RUJ3 1HIXA 1M4WA 1K5MB 5FLML 4LITA 2C5DA 2XWBB 1RUF3 1H4GA 4UFMA 5FQ0A 4HG6B 4KU8A 5DZFA 4CDUA 3I4NL 2A73B 4QT6A 5BUVA 1K5MC 2I07B 2G9ZA 3B9IA 1OWCA 5IVEA 4GJZA 4AQTA 4QM8A 4K6BA 4EJRA 4M3CA 1WCDJ 2E2HL 4V196 1NX9A 1PVC1 2FQPA 2PAEA 3KYWA 2BFUS 3AX4A 4M3CE 5CNAA 1QYBA 5FMDA 2EIEA 3HBKA 5D8AA 5LBBA 5FMOS 4KG8A 1SMMA 2YBSA 5FP9A 3VZKA 4PF5A 1U12A 4HANA 4A3ZA 5A6QA 4KWUA 4XOGA 4A3GL 5EJ1B 2VULA 3U4SA 3GJBA 2Y33A 4EN8B 2YDEA 1PMIA 4YW7A 1PZ8A 1ZBA2 2WZPP 4CP2A 1ULOA 1V6OA 1IQDC 1YFWA 1NZCA 3B01A 3MF9A 3ORJA 3SXWA 3TNPB 1OHFA 3T0BA 3MSUA 2ZZJA 1LEDA 1WBLA 2XHKA 3J8F2 1ULDA 3WNLA 5H9QA 2FCUA 3AFKA 1XNBA 1D0GA 4MGYE 1OF4A 1AR83 1U5XA 2QVSB 1WW6A 4PJYA 1V9U2 1OLRA 2EVXA 2V73A 2NVYL 2W2IA 3FUOA 2BNOA 4A3LL 1R1A3 1ZBE2 2EXHA 2IXKA 1NCQC 3KVAA 3M3EA 5DG1A 3IPVB 3DECA 4LTAA 1EAH2 2XJSA 5FCCA 5H9PA 5K4LA 2AEYA 4BQ5A 4RFRB 3VL9A 4GB31 3WNPA 3H8RA 2HYKA 2JKBA 2JDUA 4QB6A 2WWJA 2RFKB 4BXFA 4W6WA 3M4OL 2XL9A 1W99A 1J84A 3IDBB 4MYEA 4MXWB 1QXRA 5F3CA 3VBOB 3WCRA 2QQVA 4C3HL 2LTNA 5AVAA 2FDIA 4KG0A 4RHV3 4ISRA 5JUVA 1W6PB 1W6QB 2JA8L 3WF2A 5FYBA 4COUA 2D6PA 2X29A 3VHNA 1PVC2 3E6DA 4FPKA 4YGBA 3P6BA 3VBOC 3M8LA 4AI2A 2EIGA 4CXYA 4FSJA 1SBDA 1XSQA 1POQA 3EBRA 3VD9A 2K9ZA 1DCSA 2QQUA 1OURA 2WBKA 2Y34A 5T55A 3IKWA 4FPHA 2AQCA 4NHYA 5IK7A 2ZMLA 2VUJA 1MR5A 3KGZA 3WP6A 1DP0A 2Q8OA 5JSRA 1C8M3 3GBFA 1Q5OA 1QHDA 2HWE3 2OA2A 3MPPG 3GZAA 1CPMA 3IBMA 3BB6A 1XNCA 2XUMA 1UOGA 3LWQB 3FX3A 4AGGA 1HW5A 5FZMA 4W8JA 2FHRA 1LHNA 5DM71 1XNTA 2UWCA 4UF0A 3IDAA 5FP7A 5EP9A 5T5LA 3VBFA 3JUUA 4M4RA 3ZSMA 1HB3A 5KXBA 1GNHA 4HFSA 5GKAC 3VB9A 3SNMA 5DMYA 3RS6A 5FYUA 3SKVA 3BKZA 1MQTA 3SEEA 1N1YA 3ZXFA 3INAA 3AYEA 2OW4A 4FOVA 5FWEA 1T6GC 3HR9A 1RDVA 2YBKA 3LA2A 3T0DA 4K9FA 1K12A 1GZTA 5I8TA 2JD9A 3IWZA 4NAMA 5JVG1 2M4YA 3MYXA 4RR3B 1IROA 2EIBA 2N7GA 3AMNA 4GB32 3MO4A 4PI2A 4TSVA 4YG6A 4AG4A 4QXHA 1MEC3 2ZHNA 1SBFA 3ZYIB 2DYCA 4R4XA 3WX5A 4IGOA 1ZYBA 1SBEA 5I91A 2JB8A 2ZMKA 5F3IA 2YFZA 4NROA 4QHOA 1AYN1 4A7ZA 3IIAA 1MZEA 5JVVA 4SBVA 5IYDL 3N9OA 2WT2A 1GZWB 1UPSA 4YVSB 4ZU4A 2BUKA 3AP6A 4YGDA 2HWD3 6RXNA 5HXMA 4XFFA 5FYCA 1KJRA 3MEPA 3LSDA 1FHMA 4XE9A 4YVSC 4MGSA 1DFQA 1ULPA 1HX6A 1K45A 3MIBA 1OWBA 3W20A 5KHJA 5C3QA 2W9XA 5K2ME 3DV8A 2R93L 4UOJA 4HKLA 5MFZA 5IJRA 5CKQA 2J1SA 1LTEA 3EJKA 4DNYA 2YU2A 4HSJA 4OZXA 3W21A 5IT6A 2QL0A 2XJUA 3N7LA 5AFEA 5CISA 5I0RA 1ODNA 4X6QB 4Y20B 1ODMA 4OCTA 4TN7A 5FYZA 3ZFGC 4FPJA 4DXZA 3VBUB 2VUCA 3LZZA 2JI2A 2J1AA 1OA3A 1AVBA 1XPWA 2ZCWA 3VDDA 3ZOIA 1CJPA 1SLLA 3ZXGA 1XOYA 4DINB 4CDQB 3VBUC 3VHRA 4CP1A 5K0UA 2AENA 2PHRA 1CX4A 1H2MA 2HWB1 3KHBA 3N7MA 1W9YA 3NJYA 2A6HD 2RJ2A 3OF1A 3B00A 1QJZA 1JOJA 4A3KL 1Y9QA 4B7KA 1OXCA 4XGHA
chains in the Genus database with same CATH topology
3VBSC 4BIFA 5T50A 4HVRA 2PLV1 1UPIA 1B35B 5JOWA 1NE6A 3TBDA 1AYN2 1QH7A 4N9HA 1WW5A 1O3SA 2RS31 4LO7A 1B35C 1D4M1 3CU7A 3LA7A 1R1ZA 2F6BA 4RQPB 1GFF2 1H0BA 3ENRA 2BWAA 4HT1T 2YMZA 4FAHA 2ZGNA 3B7MA 1MVEA 4WFN1 1G6NA 3IMNA 3KYYA 4COWA 4YZ5A 3ASIA 1W2UA 4JAFA 1RUD3 2JXAA 4AFMA 3ZMOA 4MV2A 1EV11 4RXNA 1YWKA 3NVCA 4N43A 3MI8A 5C4WB 2O5JD 3A0KA 2VL6A 4R9AA 3KCCA 2D43A 3BOWA 4JRAA 5T5JA 4IERA 4LBJA 3FLTA 2P3IA 4XIOA 2O0OA 3MF6A 4Y1UA 4FQ4A 2H0BA 2ZGMA 5C9AB 1CAUB 3H7YA 3ZX7A 4DS0A 1RUH1 1NNQA 4J1WA 2RJKA 4YG3A 1F9KA 5GAGc 1OMIA 1XYOA 1O7FA 2HWB2 5DXDA 5C9AC 1KJLA 3BU7A 1H2KA 3VN4A 2TEPA 3ST7A 4NR1A 4NVPA 5JAXA 1VBC3 1RGSA 2HJIA 4DFSA 2PVEA 4K20A 1ZVFA 4OHXA 3H50A 2PLV2 4DY3A 1Q8PA 1GICA 1RUE3 1JHNA 1B2JA 4I02A 4V1PA 1ENQA 4Y1YA 2RS32 4XJZA 2ERSA 4AHWA 1D4M2 1Z78A 2M6PA 2JG9B 2H0VA 4AQ6A 1S2ZA 4K3UA 3NFPI 2JG8C 1NLSA 4PBOA 2CAVA 2DCZA 1QDOA 2JG9C 2PN5A 4RS5B 5ACA3 1V00A 4G4FA 4G3YC 4GMP3 5GZCA 5CG8A 2PAKA 1QQP1 3RZZA 3S0MA 1ENRA 1EV12 5IK8A 1QGLA 2PSMC 2ZX3A 5GLZA 1QOSA 4LA2A 5JR7B 4TZDA 5CVRA 4N7IA 2D97A 4GWNA 1JYBA 3SS2A 4A2UA 1HRV1 1C1FA 4YARA 1GLHA 3PWFA 4NHLA 3JU9A 4YW2A 3VGIA 4K9SA 1RUH2 4XF1A 2AYHA 4CTEA 1F2NA 1PIV1 3WCSA 4FPYA 3H1YA 4AFBA 3AKPA 2JI3A 3WOGA 4ATFA 4CZSA 1WD3A 2PPTA 4XMIA 1LB2A 1NXGA 1S2KA 2ZTNA 1E57A 4AK3A 2XG3A 5DUXA 2R061 4LO4B 1ZBA3 5AFBA 4YZ2A 3MLLA 4CEWB 1YCIA 4P9LA 1OFSA 1R091 2ZGRA 2XJRA 3N7KA 1LODA 2QZ2A 4LLOA 1LHVA 4CEWC 3J8F3 2GDFA 1NQDA 4E2GA 1ULFA 1ENSA 3KZ4C 1V9U3 3PKIA 2BVBA 1ZBE3 3M3CA 1TQ5A 4IEUA 1EAH3 1QQP2 3AP4A 4JGYB 2EXJA 1DGWX 2Y0IA 2CR8A 1LOGA 1YUZA 2ZX0A 3DL3A 1ND2B 2W0XA 2ZZQA 1NG0A 1DIWA 1CAXA 4JGYC 3O7OA 2CYFA 3HD8B 1I6XA 1ND2C 1HRV2 1UIJA 4NWWA 5J3UA 2NMNA 1MZFA 1S24A 1FYUA 5GZFA 4YW4A 4R9CA 4M0HA 1PVC3 5GJ6A 1OA4A 1PIV2 3GF6A 1BKZA 4XHBA 2R30A 4XMAA 3WNXA 3LB9A 4EWAA 1H8VA 2W68A 2V3BB 2ZGTA 4BOWA 4F3JA 3ALQA 4Y22B 2B5ID 5MFPA 2IXCA 2R062 1N3PA 4IEVA 5GADc 4PIZA 5T3NA 4AEDA 1RUC1 4QPGA 1ND3B 3FLPA 1R092 3FBYA 3H8UA 2ERJA 3JQXA 4TVMA 4YM0A 3OPZA 4E27A 2PHWA 3VBRA 2WINB 3AB0A 4QGMA 1ND3C 2A7AA 2GMEA 3USUB 4F83A 2ZAAA 1VP6A 1RTVA 3ZIXA 1QY4A 5JOXA 1G9FA 1AX1A 1OD5A 4G9SB 2WA4A 1R081 2YROA 4GB33 2WLQA 3RYKA 1QNYA 1W6MA 4OI1A 1WMFA 1S0FA 2LCQA 4A3XA 4PDWA 5A3LA 4YYOA 3K51A 2ET1A 2VOXA 1CIWA 2BPA2 1LEMA 3ZO0B 1UKRA 1XYNA 3KYXA 1U5YA 1XE8A 3OD4A 1OQEA 3SISA 3USSA 1QOTA 1VAVA 3V0BB 5DUWA 5DUUA 4Q0QA 4IEYA 5CFDB 4HK8A 4G6BA 2WA3A 3KYVA 4Q29A 2XWJB 4QM9A 4R9DA 3WW2A 4D69A 3B02A 4D94A 1ASJ1 2OVUA 4IV1A 3VBHA 1FXZA 5A33B 1RUC2 4FTBA 3X29B 1O91A 3ZPYA 3U4XA 1AJOA 3D8CA 3S7EA 1TNRA 5I0SA 2MS3A 1X8EA 2G4IA 1WUVA 1YRZA 1CVNA 3NV3A 2ZHKA 2ZPXA 5F9TA 1PM7A 1Q8QA 1U5IA 2IXLA 4XJWA 3FMGA 1R082 4OVEA 1LESA 3L2YA 4QPIB 4AR4A 4LEJA 3NO8A 5BNPB 4AVAA 3I4IA 3VKOA 1X8MA 4QPIC 1CONA 3WV6A 1AYN3 1UD1A 2J9UB 1JUIA 3THPA 1BRFA 2D98A 4UW6A 5BNPC 4M00A 2NPIA 4WVMA 3JB4C 5LRSA 3RI8A 4A7KA 2RS11 3IDEA 5L7OB 1O3RA 1S0BA 2AH2A 1DQ5A 1DQ1A 2VQAA 3I59A 1H8TC 4Q8LA 5L7OC 2Q5TA 1C57A 1G9BA 5JSPA 1B2OA 2CWMA 4CDXB 1W6OA 4BCUA 1ASJ2 4DMIA 2WWSA 2ZMNA 2A3YA 3M7AA 1JYIA 1DVBA 3WP5A 1PK6B 2ZA9A 4I09A 4CDXC 1S1AA 2ZACA 3A44A 3H3UA 3WDVA 4W65A 2GC3A 1PK6C 4Q1PA 1GKBA 3ES4A 2YY1A 4MH0E 4ZN3B 3ES1A 3H1MA 4YGEA 3W59A 4MUVA 1UU5A 2HWB3 2DVAA 3D5OA 3DKWA 4M0NA 2PELA 4UW5A 2KKDA 2GMMA 2XKOA 3BIWE 4LE4A 5CBLA 1S0GA 3TN91 2GSYA 1V70A 2D44A 2WT1A 3OGGA 2GNDA 1XNKA 2NM1A 3BPZA 3Q9OA 4QMAA 3H0OA 4L11A 5JPNB 1O3TA 1W6NA 3OCPA 4ZU7A 2RS33 2GU9A 4I30A 1D4M3 4PLMA 2RS12 1ZX5A 1RINA 2YXSA 3DF0A 4UXAA 1NXD1 5KC6A 1EPZA 3I54A 1RUNA 1ULEA 5JZGB 1MS3A 2WIIB 2BTVC 4JVAA 2VG9A 4HK9A 4CRQA 4RA0A 2R071 3MICA 4AR6A 2XVKA 4URTA 1EV13 3HAGA 4XJ9A 2E9QA 3FJSA 4WM8B 4OUSA 4WM7B 1AL0G 4P5HA 4BQ1A 3EQEA 5K8SA 1UIKA 2K2DA 4WM8C 1S0JA 2A69D 1YK4A 4WM7C 2RMU1 1FX5A 2ZKLA 1RJ7A 4KH9A 1RUH3 3THTA 1CAWA 4RGGA 1G9AA 2BWCA 2Q4SA 3KB5A 4IETA 1VZHA 1C8NA 4HN1A 2PHUA 4PBPA 3ZSEA 5SV5A 4CEYA 3AYDA 5JIUA 5H9SA 4H7MA 3TN92 1QJU1 3N7JA 1SACA 1O3QA 3GNEA 1OQDA 1ZZ8A 2DU0A 2D6OX 3RI9A 3HT2A 4GKYA 1POV0 3ZYGA 1RUI1 3VZOA 2Y0OA 5CU1A 1DHKB 1IS6A 2CGPA 1RL3A 5LEKA 1DF0A 2HEVF 4KQ7A 3OY8B 5GAEc 1CAVA 3A4UA 3QH7A 4Q4Y1 1REEA 3EO6A 4FXGB 4LA3A 5JIAA 1LR5A 4H14A 1ONAA 5FRAA 2E53A 4OI0A 2R072 1JYCA 1QQP3 4HPKB 4FOYA 3NJZA 1NOVA 4C1WA 2EALA 4I3GA 5DDJ1 1VB4A 4M3CF 1YJKA 1LGNA 1YI9A 5DUVA 4AHXA 1GQGA 2MEV1 1BEV1 4MGZE 3U0ZA 5LK5A 1HRV3 1AJKA 2Z3RB 7RXNA 4IXLA 4J1XA 4PIYA 4QQLA 2XLGA 2RMU2 5GZGA 5FTTC 1NA1B 2CAUA 5FLHA 4O9EA 4A7ZA 3FZ3A 2JEMA 3AP9A 4YVWA 2EXIA 4LBNA 2IXIA 3MW3A 2EAAA 1PIV3 1NA1C 1G7YA 1WJVA 3AZZA 3WWLA 2VQ0A 4AHYA 5FQ0B 2E63A 2YZ4A 4XQ4A 5JPMB 1RITA 3WP3A 4P9WA 1QCVA 2PHDA 1QJU2 1VLNA 5EYYA 1ZNPA 2RS51 4CDUC 4M3CB 2XVGA 3IT8A 2R063 1RUI2 4FT8A 5FO7B 1CJDA 1R093 3HN1A 5D8AB 1J1TA 1OPMA 2A70A 1LGBA 2XBO1 2QDRA 3QLQA 2AREA 2GNMA 1CPNA 4Q4Y2 1APNA 5D8AC 1NCQB 4R4ZA 4R9BA 1BE7A 1CR7A 1VCXA 2VW0A 2BVVA 2ZGSA 3U07A 4RD7A 3ILNA 5A32A 3FC0A 5DDJ2 4D7YA 3KT7A 1NLRA 4AE2A 2GC0A 1JW6A 2MEV2 1BEV2 1V6LA 1VBD1 1H1IA 1I5ZA 2D3SA 5GALA 5HCAA 1AR71 4DRRA 3H1WA 3P2AA 4U671 2WNUA 1VJ2A 2WZR1 4JV4A 1LU2A 4FO9A 4AEMA 1YI7A 1O4YA 2W52A 4FVVA 2ZABA 2VPVA 1ODHA 4XBQA 3O0VA 1GSLA 2ZBJA 1W6QA 4BZ4A 1PGL1 3OGJA 1IS5A 2RS52 1O4TA 2M6OA 5EINC 1QOOA 1IU5A 1KS4A 2DV9A 3N36A 2MPFA 1O4ZA 1RUC3 1LOFA 4XBNA 2O8OA 2JENA 2WFF3 3OJBA 3S6PA 3V56A 5EJ3A 2XBO2 1VZGA 5H1Sc 1VALA 1XE7A 2W39A 4ORFA 1QWRA 3B08B 1AR61 3DPRA 2Q30A 2A6ED 4Q4V1 2ES3A 1OI6A 1T9OA 1SLTA 3ZDSA 5FLJA 5BNNA 1R083 4OI4A 2OZ6A 4AR3A 2A6YA 2FBEA 3VBFB 4JCKA 1F5JA 4IEQA 2GZWA 1RB8G 4C0BA 1FNZA 1L3JA 4Q4X1 1QXJA 3ILRA 4WZCA 5AC91 3VBFC 1MQTB 1WW4A 3JD71 1VBD2 5L36A 2H6BA 3ZXAC 2C6AA 4RR3A 1AR72 3KCXA 4IQPA 1MQTC 3RJ2X 3B3QE 3VZJA 2WC2A 2WZR2 3FBMA 4MGKE 1WA4A 4Q27A 2WSUA 1HV1A 2JJ6A 2WJSA 4XF4A 4Q8KA 2CKCA 3R4DB 1LHWA 2IFRA 3GHMA 1QJY1 1DGWA 4U36A 2GH8A 1PGL2 3ZYRA 1S0EA 4Q2FA 3AKSA 4L9BA 4NHKA 1ASJ3 1VBA1 2DFCA 2RM21 1QMJA 4XHXA 5FPZA 4S2DA 3ZFGB 3MFAA 4AGVA 4D7SA 1FAYA 3MZHA 3QVDA 1OFNA 4CDWA 2V09A 2RDVA 5AI2A 5AN9H 4IEWA 4COVA 3J7Z1 3VL8A 3J4UH 2Y38A 3J7Y1 3I2DA 1AR62 2VOVA 1YXWA 4Q4V2 3LAGA 2NLRA 5CADA 4D3WA 3MW4A 4I3PA 1N1SA 3TB0A 1IQAA 3VPBE 4HMZA 2B5HA 2E7AA 3GHNA 1RYQA 2V0EA 4ZU5A 2XGXA 3UJOA 3VBSB 4AEKA 3WHTA 4Q4X2 5EV7A 3ZFFA 5AC92 1M06G 3VDDB 4COZA 2K0GA 2Y26A 2P2KA 4HL0A 3JD72 5GLWA 4OFGA 4B8EA 1GBGA 3HT1A 5K0UB 3M3OA 2ATFA 3VDDC 1KXGA 2BE5D 1N3OA 2C9AA 4FOWA 1D2SA 2R49A 5K0UC 2RS13 5EZWA 4S2GA 2RR11 1XYPA 4DY5A 4LR4A 1QJY2 4N53A 4C90A 2AUYA 4P9IA 3MPSA 4JADA 1IKQA 3WXPA 2GNTA 2P3KA 4RQPA 1VBA2 2Z42A 1VAKA 2RM22 2DVFA 3MW2A 4GQ7A 2DCKA 2B39A 2NP0A 1YFXA 1KITA 4BMBA 1FATA 4AI1A 3QACA 3OYWA 4PCRA 3AKTA 4QD2A 4YNIA 4DB5A 5C4WA 4IV3A 2WKKA 1AL21 3CL1A 4AVVA 1BZWA 2ZGKA 1KRIA 4N43B 1OPOA 2BQPA 5ABJA 1REDA 3NV2A 4HKOA 4NWVA 1GQHA 4N43C 3TN93 1Z0HA 2R0HA 1LKOA 4QQ2A 1KFXL 1DBNA 5I93A 1PHMA 1SFNA 5KWRA 5CFCA 2VNOA 1CN1A 4CP0A 1H2NA 4F7ZA 5KXEA 3EHKA 3AJYA 1ZREA 4JTNA 3RZ6A 2XJTA 5CG9A 4Z82A 2JG8B 2IC1A 3WQ7A 4LHLA 4N90A 2RR12 3SITA 1VB2A 1B09A 2P34A 5BNOA 3V0AA 3RG0A 1XXNA 4QU2A 2R073 3AP7A 1RHI1 1QJX3 4K1YA 4XF9A 4O9GA 1C5IA 1U0AA 3DGTA 4RS5A 1IOAA 1QF3A 3E5XA 3MGUA 1RVF1 2VMGA 3K35A 2RMU3 4XFAA 2D6LX 2PHFA 4FCAA 5DZGA 2E6VA 3KMHA 2CY6A 4GMP0 1GNZA 1AL22 1BBT1 3AZWA 3LKJA 2XL7A 2PFWA 3WD5A 1OOPA 2Z5WA 2KXLA 1WLWA 4LT5A 3T2TA 4BWOA 1DQ4A 1QKQA 3SMHA 4HZFA 1UCXA 1MS5A 1H7VA 2JX9A 1QJU3 4PLOA 5T54A 2XPJA 1QU0A 1LOAA 4B7EA 2YUEA 3IDCB 1IRNA 3PNAA 1SFYA 4ES9A 1RUI3 1UF2C 4E9KA 1FPN1 2PHTA 1N1VA 2DTWA 5JSOA 3AJZA 3CEWA 1HKDA 3UL2A 1AUYA 2ZOEB 5AVPA 1I3HA 3WDXA 4CEWA 1IZ3A 4Z8BA 3SH4A 2X8KA 3B5LB 3WT3A 1MZ6A 1UU6A 1RHI2 1SLIA 1NQJA 1RUG1 1O5UA 4Y24A 3WWNB 1J3RA 5DDJ3 4YZ3A 4UW3A 4GS7D 3LWCA 1MS4A 5J96B 5FPXA 2MEV3 1AYM1 1BEV3 5E88A 1WCSA 3NV4A 4I0WB 4P9JA 1RVF2 1DGRA 4OUMA 4Y26A 1IPKA 3AMQA 2D6NA 1KDKA 3PJQA 1BBT2 2DVGA 4WVVA 1C09A 4X8PA 4MSVA 4QHBA 3AXEA 5C8CA 1SDWA 3E97A 1CAXB 2ZGQA 1PGW1 3ZXKA 4YFZA 3LA3A 1UL9A 2R0FA 4FPFA 1YJLA 2VECA 2BNMA 2XVLA 3H9AA 4CDQA 3OBTA 3ROUA 4DNYA 2RS53 1XRUA 4YW3A 5FFOC 1LHUA 5C8WA 3APBA 5K9YA 1CADA 1HDKA 3D6EA 3B94A 4X6RB 1FPN2 5JOZA 1DZQA 3ILFA 3ECQA 1ZZBA 3ZXDA 4QQHA 4C0HA 2XBO3 1OLQA 4B4RA 4HVQA 5J98B 4Z07A 3BOPA 1OQ1A 4HBNA 3H7JA 2VNGA 3ZXJA 3PTYA 4DQAA 3NAPA 3WZ1A 4Y1XA 4XFIA 4XFHA 1RUG2 4FPEA 4AEDB 2ZX1A 1V6IA 2QJVA 4IEZA 4QPGB 1IS3A 3RRDA 4AEDC 2HWC1 1SLBA 1IS4A 3VBRB 4QPGC 3WR0A 3R6SA 1AYM2 2VMIA 1VBD3 3SCFA 4LO5B 1N1TA 5MF6A 2D3RA 2QFEA 1QXPA 1CGPA 1ZRDA 4U2AA 3VBRC 1AR73 1VIWB 1KD7A 2WNVA 5T5OA 1FHHA 4ONUA 4KWJA 2WZR3 3AFGA 4XETA 5HCFA 3RYGA 2VY0A 2C6BA 1JXNA 3KS7A 2BEOA 1W6MB 2JD4A 1GR3A 4EN9B 3CJXA 1PGW2 3L9JT 3QBQA 4HLTA 4PDWB 1X33A 4YWMA 3CJIA 3E5UA 3RDIA 1LJ7A 2Q1ZB 4PDWC 4AFAA 3WP4A 5JWPA 5HI0A 1I1EA 3ZN6A 1LHOA 4IEPA 3AZXA 5CFDA 2B7YA 3E6BA 5E16A 4LO8A 3WQ1A 1Y43B 4MVTA 1AXZA 5IK5A 5KHGA 2NYDA 4MX3A 1QNWA 1A78A 2CWSA 3HQXA 4YRDA 1AR63 2E7QA 4Z92B 5A33A 4Q4V3 4M01A 1WLCA 3TNQA 1XNDA 3ZFEA 4DZGA 3MIFA 5F6LB 4N7UA 1XU1A 4IV1B 1ZRPA 2X5IA 4QGNA 3RJRA 3VBHB 4YG0A 3ZG6A 4AXOA 3PZAA 3R4SA 3WDWA 4BM8A 2BYVE 4IV1C 3B69A 3VBHC 4Q4X3 5AC93 4E2SA 2HWC2 2NN8A 1YIPA 3AYAA 4XEZA 4AI8A 3KM5A 1GZ9A 4KGGA 3JCIA 3FLRA 4S2HA 4XW3A 1RYTA 1DYKA 3SHRA 1VBE1 5F1RA 2JE7A 2UURA 3ATGA 4ZKTB 3G6JB 3O0WA 1W0PA 3L2HA 1H8TB 4XFBA 1AX0A 2HR5A 3HBZA 3N3HA 1QJY3 1HRI1 3ZSJA 4KL1A 4FP3A 5RXNA 2A5ZA 3DUIA 5KXCA 1D2QA 4AGRA 2IFWA 3TYJA 1NCRA 1BYHA 1ZRCA 1VBA3 4GA9A 4B4PA 4IEOA 3ZXLA 3PVBB 2RM23 4WVMB 1ZRFA 4K1ZA 4P9YA 2GN3A 4WVWA 2GH2A 2CV6A 4H55A 4JGZA 1PZ9A 4X8NA 2M4VA 4JQRA 1QH6A 2ILMA 2P3JA 2D6KA 1Z7S1 4BLJA 4GALA 1X82A 1W6OB 1R0JA 2DUPA 1ULGA 4Y5Z0 4YGCA 3MFCA 4E4ZA 1NYWA 1FOD1 2GMPA 2R32A 1NE4A 2OZJA 4YZ4A 3V65A 1YFUA 3PMEA 3AZVA 4K7JA 1H4HA 5K7PA 1LGCA 1CAAA 3BODA 4GH4A 4AFDA 3SH5A 1V6MA 1J59A 4EV0A 2PLV3 1COV1 2B46X 4BIOA 1IKPA 4JDNA 1LENA 1TEIA 2ZKNA 3PKJA 2GC2A 2ET7A 1G9CA 1LKNA 1VBE2 4KNCA 1DQ6A 3LSEA 4BHPA 2LM3A 5EYXA 2GAUA 4XILA 1YUXA 3KCYA 4QGLA 2RR13 1J3PA 2G9GA 1BJQA 2D93A 1FMD1 1HRI2 3JZVA 5KC5A 4R52A 1W6NB 4LBLA 4JTOA 4UY81 1KQRA 3MLJA 3MLKA 5JZGA 1ZZCA 3PHMA 2ETEA 4ZN1B 5B2GB 1C3HA 1RUOA 3PLQA 3SH3A 1Z7S2 2DWRA 1DZTA 4FPGA 2PA7A 5L73A 1AL23 3O12A 2WS91 1AXKA 1FOD2 4Z2WA 1BFYA 2EA7A 1HQNA 4P9XA 3IM0A 2V0FA 1A3KA 1DG6A 2C1FA 1G8WA 1RMU1 4Q26A 1CAWB 1COV2 1ALYA 1KS5A 2W08A 3WDYA 1DLLA 3TAYA 4XJ8A 1S0DA 4HN0A 1PO21 4CEYB 5JVH1 2HEYF 1GANA 1VZIA 3WW4A 5IK4A 3VHPA 4FXKB 4CEYC 5GM0A 4A7YA 1LTLA 5EXOA 2XJQA 2VU9A 4R8HA 1FMD2 2ERFA 1BCXA 1PO11 2ZHMA 2F4PA 1CESA 5CA6A 2B45X 2SBAA 4LHNA 3TRSB 4LBQB 4Q0SA 2WNEA 4PLNA 3AYCA 5MGNA 2AR6A 1RVF3 3WUDA 4POGA 4UBGA 2AYJA 3POWA 2ZX2A 5FDBA 2CL2A 4ASLA 5LK7B 4L97A 3MIEA 1BBT3 2WS92 1K5MA 4XBLA 4L2NA 2DVBA 1HV0A 5F5QA 4PQ9A 2IZWA 4XIKA 1B13A 4CDUB 2MNGA 5JDBA 3ZIWA 2A6VA 1RMU2 5C33A 1Q3EA 1RDGA 3C2UA 3JB8A 4YVWB 4BPZA 2VXRA 3FWEA 1FPN3 1PO22 1C1LA 4L99A 4XPVA 4YVWC 3FFQA 4MGIE 5KHIA 4LNVA 5E1RA 2GALA 3RZTA 4SLIA 2VMHA 3PMSA 1R0GA 1BK1A 4YSFA 3ZYPA 3B0AB 2Z3QB 4IEXA 3KT4A 2YC0A 1PO12 2ARBA 1YK5A 1IPJA 2PTMA 4JC1A 1RUG3 2DCJA 4EN6B 5HBAA 4QQPA 5F6KA 2EF6A 2QZ3A 4XXAA 4Q4W1 4FOQA 1MS9A 1H1MA 3DN7A 4TWTA 1DU3D 1NCQA 4AVCA 1AYM3 4FPLA 1YIFA 3J9SA 4ISQA 1LULA 2WSVA 5MLC3 2XB6C 3BTAA 3IPVA 5J7MA 4AVTA 1QDCA 5A32B 1JBCA 3R05A 2GNBA 4W6XA 3PIP1 1B71A 3POSA 4XQDA 2PYAA 1Q43A 3U11A 2YGLA 3D4KA 3OBRA 4MXWA 3VBOA 1U5ZA 2I2SA 3UKNA 3NKTA 4YW5A 1W39A 3O14A 1W6PA 1I9RA 5KBFA