4LHNA

Structure of the n-terminal domain of the flo1 adhesin (n-flo1p) from the yeast saccharomyces cerevisiae, in complex with calcium and mannose
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
251
structure length
251
Chain Sequence
ATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFKFATVDDSAILSVGGATAFNCCAQQQPPITSTNFTIDGIKPWGGSLPPNIEGTVYMYAGYYYPMKVVYSNAVSWGTLPISVTLPDGTTVSDDFEGYVYSFDDDLSQSNCTVPDPSNYLEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flocculation protein FLO1
publication title Molecular mechanism of flocculation self-recognition in yeast and its role in mating and survival.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 52
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4lhnA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lhnA01
4LHNA 4AHXA 4COVA 4COUA 4ASLA 4AHWA 2XJTA 2XJQA 4GQ7A 4AI2A 4AI0A 2XJPA 2XJSA 2XJRA 4AF9A 4AHZA 5A3LA 4LHLA 4LHKA 2XJVA 4D3WA 4AI1A 4A3XA 5A3MA 4AFCA 4AFAA 4AFBA 4CP2A 4COZA 4AI3A 4AHYA 4CP1A 4CP0A 4COYA 2XJUA 4COWA
chains in the Genus database with same CATH superfamily
1Y1VL 1U12A 1I3HA 4CXWA 3ZN6B 1MR5A 1O4TA 1N1SA 3JB8A 1H0BA 3P8BA 3GJAA 4BXFA 3N9PA 3MW3A 1S0GA 1N3OA 2RJ2A 2P4EA 2VBPA 1JU3A 3OD4A 4H7LA 5A7SA 5JIAA 3NWKA 4EQVA 1CAWA 4FFIA 1QJY2 1PX4A 5K9YA 4S2HA 2FDIA 4MGSA 3H3ZA 1OWCA 5IP9L 2YV8A 4XJZA 2ZGMA 3B08B 1GZ9A 3G7DA 1US3A 3VHNA 1J1LA 1GWLA 5FZ4A 3S7EA 4CDQB 5JPMB 5ISLA 3NV3A 2YBPA 1GZWB 1HQWA 1X33A 2JA7L 4I0AA 4EN6B 2C1FA 2ZX0A 4ZS3A 4E27A 2KM2A 3ZX7A 3N4MA 5FMOL 3WF1A 2WFF3 3ETQA 4Z1VA 3A7QA 2IVIB 2RVAA 4PDWB 4YWAA 1XBFA 2YMZA 3T2TA 1POV0 1WD3A 2B8MA 5G04L 3ACLA 1MPXA 2TEPA 2CWSA 3T4HB 4POGA 1KJLA 1OI6A 2YDEA 3AZXA 4K8RB 4WM7A 5FZMA 1TME2 5FAXA 4RHV3 1W2TA 2VUDA 3OCPA 1LOGA 1GOFA 1TEIA 1WD4A 2W08A 2Y6FA 4LIUA 1RYYA 3SKJE 3KLSA 4BYYA 5IVFA 5IVVA 4N43B 5HV0A 4EN9B 3L9JT 2JDZA 1OURA 5AFEA 4N53B 3D3AA 3POWA 4P02B 4TXWA 3GDBA 2GMGA 1J83A 3PIGA 4AE2A 1KJRA 5HCHA 4V2VA 1V6IA 3E5XA 4RR3B 2QQPA 1R0JA 1YQCA 5DDJ3 5JI9A 5FQ0A 2DVAA 2QZ3A 3W9AA 4MVTA 1LHVA 4Q4Y2 3RJ2X 1MZEA 3OPWA 1RXFA 2Y8KA 1O8PA 2XKPA 3HOUL 3GBGA 1AR73 3GXUA 5J37A 3IU3I 5DUUA 3GCXA 1WLDA 2GH8A 1YHFA 3D8CA 4AVVA 1Y9QA 4G6BA 2XG3A 3DKQA 1DF0A 2UY9A 4HZFA 1F15A 3N7KA 2HWB1 5I8SA 2A73B 2EIEA 2RDSA 4L99A 4UBHA 2XR4A 4NO4A 3WW1A 2FMDA 1LECA 1OOPC 2Q8CA 3U78A 1LU1A 1DZRA 4XQDA 4S2DA 1QWRA 2B4KA 2I45A 3FZ3A 3LFMA 3M3OA 4QAWA 1QXRA 5LEKA 2WAAA 2GMMA 1KS4A 5FPZA 1POV1 2JDUA 3BKZA 3NNJA 3RRDA 1MS1A 5DMYA 3KYWA 5L19A 2DU0A 2R30A 2ZZJA 2CGOA 5BNPA 2WQZC 1OHFA 2ARXA 4XMIA 1V9U1 4CEYC 3AL6A 4JCKA 1YFXA 3U11A 3USUA 1QJX2 4DS0A 3OPTA 2YUEA 4KH9A 1BBT2 4I2OA 3GCWA 4XGHA 4E2QA 3I2GA 4QPIC 4YM1A 4RQPC 3P3NA 2QTWB 4D8MA 3WDVA 2NVXL 3FFQA 5JPNB 3PVOA 2VZUA 4GJZA 1LHWA 3OG2A 4IEPA 4LKDA 4RFT0 3T2QA 2VOTA 2OW4A 5IWFA 5SV8A 2G9GA 3ZMOA 4A2UA 4QX0A 1DYKA 3WWLA 1RTVA 2XBO3 2OUJA 1SDDB 4ATFA 4X8PA 3IAPA 5JI7A 3ZSMA 5FWJA 5HXMA 1VRH2 2JDMA 4RS5C 3VBOA 1UY0A 1VAKA 5MFPA 4QX1A 4Y26A 2WC2A 1I9RA 2PQSA 1NQJA 2Y0IA 3KT4A 1HN0A 3CL1A 2D5FA 4AFDA 4UY81 3GNEA 1CZTA 3K3NA 4RGAA 4YARA 1VRH1 3CO2A 1AL0G 1ZRIA 3IDEA 2HBTA 5KHJA 1CN1A 1JUHA 2YYOA 4QKNA 4A42A 1AR62 4F3JA 4J6GA 1SLAA 4PQQA 2ZX4A 3AXDA 5F6KA 3HOVL 3VHRA 5A6YA 1VMFA 3GHNA 1DX8A 5FRAA 3PUQA 1F4AA 3P1IA 2RMU1 3K2OA 3MO4A 2IVJA 1ZRCA 1GZTA 4L9BA 4LE3A 4CPBA 2VW1A 4OMCA 2PAKA 3KT7A 4K9FA 4LBLA 3SH4A 2ETEA 1VBC3 5CKQA 3V56A 2BWCA 4OHXA 3IIIA 5A3OA 3H8RA 2XJPA 1LULA 2Z79A 2HWC2 3EJKA 5JZGA 4UFHA 1IROA 3ZSLA 2PFWA 4XQWA 3AP9A 3I3DA 1CPMA 1VR3A 3VV1A 4LEJA 1CAWB 4JGZA 1JXNA 1M06G 3E97A 3THPA 2A6XA 3AZZA 5GZEA 3TB0A 2HWC1 4V2WA 1UMIA 3IDAA 2XL9A 3K3OA 5LATA 4RSUA 3UJQA 1KFUL 1ND3A 1RUF2 2HLEA 3I2DA 3A0KA 4EWAA 4AR2A 3AP6A 3FHQA 4HSLA 2VUCA 3ZXJA 5ACA3 5ABJA 1E5RA 2VMFA 4RXNA 4J25A 4BU2A 4DRRA 1WCDJ 4QMAA 4A45A 4P9YA 5F6LB 2J1EA 1GICA 2FDJA 5KXDA 1I50L 1AXKA 5MLC3 3MLJA 2J7MA 1XSRA 3M2MA 5FR3A 2WS93 2OT7A 5FYVA 2I07B 4WM8C 1OH3A 3ZOIA 2QKDA 1U5XA 1XYPA 1R64A 4WM7B 2DCYA 3U75A 5DPNA 3OGJA 1K5MC 4A3XA 1B71A 1DBNA 2PA7A 3I7DA 3OBTA 2WYFA 5JSPA 4META 3WHUA 5JXGA 4G4FA 1ZZ9A 1XOYA 1RJ8A 5FYHA 1NE4A 3FLRA 1ONAA 3WQ1A 2CDOA 1LOBA 2VMEA 4I3GA 2JG9A 3KGLA 3AM2A 3E5QA 1R081 1RIRA 3DF0A 2HYXA 3KMHA 4LHSA 5KWRA 2JDAA 2JI3A 4B7KA 3NJXA 2D40A 3ACGA 1BVP1 3P5BA 4LBKA 3SCFA 4BQYA 4AQSA 3D4KA 5F2WA 1EYBA 1IPKA 2ARAA 4FPGA 4XJ8A 3J7NA 4HBNA 1C5IA 4W8JA 4FO9A 3T2OA 2FZ2A 3NRUA 2Q1MA 1H9PA 1W6OA 3CJXA 3HMYA 3K4ZA 5H1Sc 3DYMA 4XE9A 1RL3A 1DG6A 3WUCA 4A3FL 1Q8PA 1GQHA 2VU9A 2RS51 2GP3A 2YROA 1GKBA 4XCBA 1HB1A 2XOMA 5CFCA 2OQ7A 2R071 5GZFA 3ZFGA 3BUCA 2BEOA 5JLVA 2VOKA 2GDFA 4UI9L 3QLQA 3VPBE 2CYFA 3ECQA 4IEXA 4URTA 2DCZA 2KD7A 5FO8B 3T1LA 4XZUG 1CIYA 3AJZA 3POJA 4URAA 1RVF3 2CKAA 4LO6B 4FXGB 1IS4A 2VVFA 5DUXA 1SHWB 2D5HA 4DEVA 3KV5A 3HOBA 4C3IL 2Z2SB 4IE4A 1CESA 3CLPA 4QB6A 5GALA 1A34A 1RYTA 2OPKA 3GTKL 3U10A 5CFDA 2BZDA 1LOAA 1DZQA 2BV4A 2WT1A 5D2AA 3TBDA 3VBUC 5F32A 3M3QA 5T5JA 3MEPA 3AVSA 2OA2A 2JEMA 4D7YA 1AR83 4TLGA 3USUB 2PHDA 2RS33 1S55A 3POFA 5J09A 4AR5A 5F2SA 2CAVA 5IK4A 2VOVA 4GA9A 3H8OA 3RNSA 3AYAA 4QPYA 4XTMA 1R092 4XTPA 4XACA 4KWKA 2FHRA 3UYJA 2PHWA 4XABA 3KYYA 2V0EA 2BGOA 5IUQA 2R93L 4FPYA 4NWWA 1PZXA 2XWJB 4RL7A 4RR3C 4YZ4A 4S2FA 1JS9A 3URFA 4UOJA 2BNOA 3O0WA 1JN2P 3IN9A 5IATA 2FDKA 1RUC3 4M4PA 4GH4A 5BV6A 3TEWA 3JQWA 3N9NA 5FPAA 4Y4RA 1UOGA 4ES9A 1HXS3 5C3RA 5JIUA 5BUVA 1EAH2 5LRSA 1OFSA 1UOBA 3VBOB 1KS5A 2C9KA 3ENRA 2PHXA 2J1RA 4PIYA 1BKZA 1W39A 1UZ0A 5T50A 3SS2A 2Q30A 1MQTC 2K9ZA 2IWGB 2WZR2 1NA1A 2AQCA 4YW4A 2JG8B 1UX7A 3MIBA 4JAAA 2A1XA 1WMEA 1Y3TA 5L73A 1GUIA 1UZYA 4W65A 5LY2A 4DPNA 3WG1A 4JGYB 3VL8A 3TAYA 3AKQA 1AXYA 2HWE3 5DM71 5K7PA 1IHMA 1IS6A 2ATFA 5BNQA 1UYXA 1JZ4A 4FTBA 1W8HA 2ZEYA 3PVBB 1REFA 1QXPA 2R32A 3IT8A 4ARYA 3I2FA 3NNMA 1C5HA 4QDRA 4RN5A 4IE6A 2IZWA 3HJYB 1UMZA 4FAGA 2BP6A 3DV8A 3UESA 2XDVA 4A6SA 2PN5A 2MS3A 5JZGB 1MEC2 5LZ6A 4O61A 1LTEA 3ITQA 1IGOA 1SFOL 3N35A 2V4AA 4RHV1 4JGZB 1UD1A 2RV9A 4Z8BA 1YFWA 2A75A 4LMFA 4Q4W2 4XXPA 1PZ9A 4JDMA 5CU1A 4AZZA 1JYIA 2AYJA 4CP0A 3OY8A 1ND3B 5IYDL 1W8OA 2KKDA 4JKMA 3LEMA 1YO8A 4COUA 5FY7A 1NXGA 5ABJB 4AHWA 2ZGLA 5BPXA 4ARXA 5FYBA 5DDJ1 2PVEA 4N8MA 1P7PA 1LGNA 5T54A 1SLCA 1AR71 4Q1PA 4IL7A 5ANQA 3SNMA 2VNVA 2Q8EA 4AEDA 5KHIA 3BU0A 4AAXA 1C1FA 1O3SA 4ZS2A 5FZKA 4DB5A 3VZJA 1W9TA 3VLBB 5GAEc 1MVQA 5HI0A 5FUPA 3ORJA 4AR3A 3H8UA 2PPTA 4AEKA 2CY6A 4MUVA 1JZ8A 3ZN5A 3NKTA 3R6SA 3TN93 4Q8LA 5IVEA 4I09A 3KM5A 2NM1A 5FZIA 2HEVF 1COV3 1X36A 4JV4A 5J36A 1JYTA 1MS5A 4LJHA 2XLGA 2WLPA 1AUYA 3WF3A 1V70A 3J7Z1 2DCJA 4U671 2HYKA 2JG9B 3DECA 4NHKA 5IVBA 3U0ZA 3QACA 4CU8A 3VKNA 1QOOA 4XJWA 1W3VA 3QOPA 5FP4A 5L9BA 5A7QA 2XVKA 3BIEA 2EA7A 2VNRA 3H1WA 5DQ0A 5DG2A 2DV9A 3R05A 1AZDA 5FXXA 4N7UA 2ZEWA 4BH9A 3NJZA 5DN2A 2WUHA 3P6BA 1QJY3 3PDQA 4JHTA 4H14A 4NOTA 1GANA 1UPIA 4BQ3A 2NVTL 3GBFA 3O1MA 4HKLA 3HQUA 4HANA 5CFCB 4AQ2A 4IV3A 5DUVA 3MF9A 5EQUA 3H8XA 4MGYE 4I0BA 1CZVA 1W2OA 3A0NA 4AVAA 5C3EL 3N9MA 2A69D 2WO3A 5I0DA 2SBAA 3RYGA 2W5FA 4KBBA 1OFNA 1WWYA 1H2LA 4QGNA 4FFGA 5A3PA 1WW5A 1RWDA 2V5DA 1WCSA 4OFGA 4QX3A 2XBO1 4UFMA 4YW3A 1SCRA 2YZ4A 1Q8SA 5A3TA 1TG7A 3BI3A 4ISRA 5FLHA 8RXNA 4B29A 4IEVA 4ZU7A 5CFDB 4ZU4A 1K12A 2X29A 5EPAA 4ZY9A 1SLIA 3BB6A 4ZONA 2EICA 2OYZA 5C7GA 3BU7A 3ZXFA 1TME3 3MZHA 1LNSA 4BA6A 1TWAL 4XYXA 1UY1A 1JYNA 2ILMA 4XJ9A 3S2HL 2VULA 4D94A 4NIAA 1SPPA 4Y3OA 1YJKA 1VZIA 5FXVA 3ZO0B 3LFIA 5C5TA 3ZXLA 1XU1A 1PZ8A 3Q8BA 4Y5SA 1IG3A 1EPZA 1BYHA 4LXLA 2JENA 1PNGA 4YGCA 5L9RA 4GH4B 3T3YA 1RUOA 1VBC1 1PO22 3PL5A 3MYXA 3OGGA 5LCWL 1YV1A 1REEA 1SDWA 2GALA 4QT6A 1A3KA 2AR6A 1NXD1 3O14A 4Q4Y3 1QY4A 1FAYA 4NR1A 4C1XA 2CGPA 1C1LA 2BWAA 1R1A2 2M4VA 3U14A 1IKPA 1RUH2 3WW3A 4XETA 4UW5A 2ES3A 1PO21 4IEYA 1AF9A 4M00A 5H9QA 2QQOA 3UKVA 4TZDA 1NA1B 4C1WA 5A6QA 1RUJ2 2VCBA 1DQ4A 4Z07A 3O1VA 3WQ0A 1POV3 2R0FA 3S1QL 2W3JA 3B93A 5C8CA 2E7QA 4AXOA 5EIYB 3ZR6A 1S2ZA 5ACA1 3LSDA 5FZLA 5LW9A 4WV8A 2L9LA 2YBKA 4Q26A 3RDIA 4AI2A 3IDCB 3ABZA 5HV4A 2OX0A 2WR9A 4MSVA 1YI7A 3J7MA 3LKJA 1W99A 4XHXA 5LRRA 5BNPC 5BXXA 1Z0HA 4L8QA 1GV9A 4FOVA 2WS91 2BTVC 3RWNA 1RUI2 3NNFA 4ME3A 1ZRRA 1D4M2 4OHYA 1X50A 1UWWA 2W47A 4HVRA 1LR5A 1QJX3 1Y4WA 4LUKA 1BBT3 5LB6A 1OQDA 4H55A 4Q0UA 5M5WL 1AYN2 3MW4A 5IY0A 3ZYIB 1OD3A 2QFEA 2O0OA 2VE1A 1JHNA 3DUIA 4OI2A 5IT6A 2GU9A 3NJYA 1KITA 1CVNA 3CF6E 3OY8B 4XZPA 4P08A 1IRNA 2PAMA 4NRPA 2CTVA 4XQ4A 2W1SA 2WSUA 5FOJB 2XQRA 5M0TA 1OF4A 1B2JA 1VBD2 2MNGA 3THDA 3ZSKA 3VBOC 1BXHA 3G6JB 4TN7A 4UFIA 1UO9A 4IQPA 4YW7A 3WF2A 4EN0A 1VRH3 2ORZA 3K77A 4BISA 4Y1ZA 1PO12 3WG4A 2JX9A 3MBWA 3DGTA 1QOTA 3BIWE 1DVBA 3JUUA 3PURA 1PMJX 1GZWA 4WVZA 1GP4A 5GLZA 2CWMA 4UXAA 3I3BA 3CJIA 3BYWA 1AR63 1D2QA 4Q4X2 1XNTA 4J1XA 3FBMA 2ZHMA 3I97A 4Y20A 1Q43A 4WZCA 1O6UA 3WDYA 3WT3A 1CX4A 5C4XL 4IERA 5FK8A 1K83L 5GADc 3MPSA 1EUTA 1W0NA 2R042 2V0FA 3AFGA 2OVUA 1YRZA 2HWC3 4N43A 3RYRA 1AR81 4JGZC 4AFBA 4E4DX 3KCYA 2RS31 4KWJA 2VM9A 1OC1A 3KQRA 4UFLA 2MEV2 3ON7A 1HRI2 4MV2A 2EXJA 4PI0A 2D3SA 1J84A 2Y6LA 2SLIA 5JVH1 4B7EA 1ND3C 1UF2C 4HN0A 4MH0E 1OVPA 1G6NA 1I6XA 1O91A 2DYCA 3DPRA 4NRQA 5DG1A 2VQ0A 2ZHKA 2JWPA 2OPWA 4IV3B 4AFMA 2ZHLA 5F5QA 1Z92B 5ABJC 1RUF3 3POYA 5BNNB 2VOXA 2B9UA 3LEIA 1YUXA 3MUZ1 2CDPA 3SKVA 5T5OA 1RUC1 2J42A 1OUXA 4QPWA 4P00B 2ZMLA 1DGRN 1HXS1 1UN1A 2QDRA 4ISQA 4QX2A 4CDUA 3BVCA 3LAGA 4YW1A 4PLMA 3ZXAC 3LDKA 2M4YA 2QE3A 4GZ9A 4KU8A 4B4QA 2GNMA 5JXHA 1GLHA 2WWJA 4KNCA 3OEAA 4LOSA 2XUEA 3HBZA 2E51A 2MHFA 4LR4A 4FTEA 1C28A 2DU1A 3HAGA 4LBQA 2WDBA 1N1VA 5DAPA 2A3XA 4EWDA 2YC2A 1UQXA 1ULPA 2HWE1 2R6QA 3TRSB 1NAEA 2JG9C 1SPPB 4A3LL 4XURA 4XMAA 5FO7B 4AEMA 4BQ1A 1LRHA 5C5UA 2B5HA 3H9AA 2LCQA 1NCQA 2XJSA 3POGA 1UAIA 1S0EA 2W68A 4IEQA 5FY4A 5K0UA 5EIOC 2PHUA 3AXEA 3QH6A 3GALA 4MGZE 4QM9A 4M0NA 5GJ6A 3E6CC 3LQCA 3HD8B 2O5JD 4N9HA 3ZLIA 2J1TA 4NAOA 1FHHA 1RJ7A 3UKTA 3GTJL 1J58A 1LB2A 1MS0A 2YXSA 5AI3A 1EPWA 5AVAA 3ZXEA 3VZMA 3KS7A 2TNFA 4I0WB 2WT2A 2H0BA 2PQQA 4CSWA 3U07A 4CCNA 3RZKA 2F6BA 4FFHA 5CFCC 3U37A 4QQLA 4FSJA 1S0IA 2E2IL 3ZFGC 2VTXJ 2KA3A 1HB3A 2D44A 1XQNA 2X5IA 3KV9A 3W5NA 4LA3A 3LA2A 5JUVA 5FZ3A 1WMFA 5C8CB 5K4LA 4HPKA 1FATA 5MGNA 1GWMA 1S2EA 1VALA 2CNAA 4RD7A 3SEEA 5JR7B 4MOAA 1J59A 2XVGA 3SH3A 3IPVA 4QXKA 3M70A 1FHMA 3MIEA 2DVFA 4K9SA 3CEWA 3KQ4B 2VZTA 2IC1A 3OUHA 3H42B 4W6XA 5GLWA 5CFDC 4YW2A 4OHZA 2W2IA 1G7YA 2ZX3A 3WNMA 5AC92 3AC0A 3CU7A 3RZJA 3ASIA 3LEGA 2B46X 4PIZA 4AHYA 3KB5A 2C0ZA 3TNPB 2WB1P 2H0VA 3THTA 2J1UA 4HL0A 1SFYA 1WLCA 1IW7D 3R0RA 3TN91 1R093 2V4VA 1NOVA 4JRAA 1RB9A 4PIXA 1WW6A 1COV1 2G4IA 3OYWA 5FZBA 3VDAA 5H9PA 4IGQA 3TEXA 2VH9A 1GZCA 3IDBB 5FWEA 2OQ6A 2QNKA 3N7LA 1AX2A 3E6DA 3DCQA 4GH4C 1DQ2A 2LALA 4IESA 4YYOA 4C91A 5C4WC 3USSA 3ZYRA 2ZGPA 5F3IA 2P1BA 5JCTA 5KXEA 4CXYA 1OA2A 2BRTA 1GU3A 3THCA 5FY5A 3ZYFA 3KYXA 1CGPA 3HBKA 2DUPA 4D3WA 1UPSA 2IFWA 5M3ML 1EAH3 4A3ML 3OUJA 4PHZA 1UMHA 3WCRA 1VMHA 3FUQA 5JWPA 3DYPA 4DRVA 2VMHA 1NCRA 1NA1C 3CZUA 3N7MA 2RDVA 1QJY1 2PELA 3NNGA 5KC5A 2NLRA 2WBKA 3AMNA 2WZR3 4JQTA 4XUOA 4WVMA 5HXVA 5HBAA 5FZ1A 5JOWA 3ZPOA 2RM22 3ZFEC 4BLIA 1YUDA 4QXBA 4TTGA 3CJIB 2D43A 1LCLA 3S17L 1W0OA 1ZVFA 4OYUA 4TSVA 3WNKA 2ZS6B 3H1YA 2DUQA 2FCUA 1YFYA 4GQ7A 5CIRA 1J1TA 2JDPA 5FP7A 5FZDA 2AUSB 3I54A 2B5ID 2XGXA 2BNNA 1ACCA 1IQDC 4AF9A 4Y20B 3W20A 2QDNA 4HETA 3LIHA 1NZCA 3O1PA 2AREA 1I1EA 3A22A 4D0QA 4LE4A 4R8HA 2VZPA 3K4AA 2EVXA 4B4RA 5D8AC 5C9AA 1SMVA 1OF3A 4LBOA 1VB4A 1MEC3 1EUUA 4IE5A 4NE9A 5L7OA 1QGLA 4LBNA 3I3QA 3CMGA 3JQXA 4XVHA 1TME1 2EIGA 4M4RA 1DLLA 1LEDA 4COWA 4Z92B 5A32A 1BHGA 2VCAA 4BIOA 3VD9A 3IB3A 3WQ7A 3POEA 1CPNA 1NT0A 1GNZA 4I30A 1AL22 1D0GA 1F9KA 2WZ8A 2ZJCA 3DPRB 3POIA 4ONUA 4QKBA 4QDSA 4AR6A 1JYCA 2WNUC 4LA2A 4XOGA 1Q8VA 1TNRA 1ZREA 3CIHA 1UXXX 1Y7BA 2VGDA 2DWRA 4HFSA 3TEYA 3W21A 4ZN1B 2Y0SP 2E53A 2MPFA 2Z5WA 4C0BA 3NO8A 3EB7A 4Q4Y1 4AEDC 3BTAA 2VZ3A 3ZFFA 4GWIA 4CDUB 4LO7A 1I5PA 2VUJA 4MG2A 5IYBL 1WW7A 2BVBA 2Y34A 2FDFA 5K8SA 1NQDA 2VTXA 3WX5A 1OA4A 1I5ZA 3UETA 2EIDA 1T9QA 4QGLA 3S14L 1ZA7A 1YYNA 4X6RB 3B02A 2J1VA 4R52A 4NIIA 3HN3A 3O5SA 1R0GA 1ULCA 2KR2A 4LBQB 3RPQA 5A7OA 2WYSA 1JOJA 1OMIA 1O3QA 3GTPL 3MQKB 5FZCA 1IKQA 4YNIA 3VBRC 4CDWA 2BYVE 2Y38A 4XFAA 5F7UA 1DHKB 2QQJA 3CHXA 4Y22A 3AK0A 4YWMA 3VKOA 1NCQB 4P9JA 3O12A 4CEWA 2GAUA 3OGRA 4WBBA 2CHHA 5LBEA 5K0UB 2OXBA 2QQKA 4WZFA 1NKGA 2BBVA 2K46A 3NAPC 5IW0A 3SISA 4BIFA 3AZYA 4CCJA 5IP7L 1JZ6A 2A3WA 2IXKA 2Z42A 4FPOB 1UZZA 5FOBB 5L36A 2EY4E 5EWSA 1F5JA 3M3YL 4TVMA 1QOSA 3K7AL 3TYJA 1QJX1 1QJZA 3ZMNA 1VBE2 2DFCA 3PUAA 1BBT1 4I3PA 1JW6A 4CU7A 4LTAA 3ZYJB 4O7XA 1S0JA 2VMGA 4LOTA 4IE7A 1O4ZA 1JUIA 2WWUA 3MF6A 4IV3C 3VL9A 3LF7A 3OBRA 1V6KA 5C3SA 3WNLA 4DUWA 4LKEA 4UAPA 3LPFA 2X5IB 3VD5A 1YIPA 2BERA 3ZYPA 1XE0A 2Q1ZB 4N90A 3DXUA 1ULGA 3UJOA 4HPKB 1QQP2 1IS3A 1UNBA 3I2IA 2CV6A 2EXKA 5JSRA 5CG8A 2RFKB 2VZQA 1BMV2 2P17A 4YZ5A 4L92A 3IPVB 5E1RA 3ALQA 5JMOA 5EINC 2ET7A 3B7MA 2JG8A 1RUG2 3WOGA 2C26A 4GMP0 3S2DL 3PTYA 2E33A 4NPRA 4YG3A 5FZ7A 3HJRA 2P3KA 4JGYA 2JB4A 5F5AA 1W9FA 4GWMA 1LODA 3B9IA 1U5IA 4E9KA 3SC7X 3D0JA 5B2GB 2ZKLA 3V64A 2DTWA 5DAWA 1RUG1 2JIGA 1OXCA 4AG4A 3GZUC 2VG9A 2JI2A 1SQ4A 2XQXA 4YWLA 3IMMA 1AR61 2ZX2A 4UFJA 4XF4A 3OYWB 2DBNA 1UY4A 2CL2A 1N47A 3KYUA 2YHJA 3Q8AA 2HH9A 1TWGL 3RZMA 1WGPA 4P9XA 1WLWA 5I0UA 2FMYA 4OZOA 3WP6A 1Q5OA 4K20A 4CE8A 4BQ5A 5JXJA 3I49A 3HOZL 3UL2A 3ROUA 4MHUA 2WZPP 4D7SA 1PO23 5JAXA 4W6WA 1Q56A 1VMJA 5EJ1B 2NVQL 5CYYA 1DGWA 1R1A3 4ZHNA 4MGTA 1RUH3 5B4XA 2XMLA 1NCRB 3N36A 2F4LA 5F5CA 4YVWB 2GZWA 2QQWA 3B00A 1K5JA 1RUJ3 4MO3M 4WVMB 5E6HA 5C8CC 3V0AA 1DP0A 4Z2WA 3AMPA 1RUF1 2VVEA 1VZHA 5ANNA 5FYIA 4CUGA 1LEMA 1ZZBA 5F8PA 1DDLA 3S5AA 5KHHA 2JD4A 3WWNB 4E2SA 1PNFA 1H4GA 2Y6KA 1OKQA 1L7LA 1W28A 5FY8A 2YU1A 4YM0A 3O7OA 3B9CA 1N1YA 4XBNA 1O5UA 2GNTA 2ZAAA 3POSA 2RJLA 2VL6A 5CEHA 5C9AB 2WNEA 4ZKTB 2VNOA 2ZA9A 1RUI3 4IV1A 2VBDA 1D4M3 3ZR5A 4FCAA 4PLNA 2ZOEB 5L7OB 1JYWA 2UWAA 3NL1A 4JZRA 4KG0A 5H9SA 1FYUA 1RUE2 3MUY1 4FTSA 1AYN3 5A32B 3RMXA 4CUBA 5FIXA 3LOBA 1LKPA 3PIO1 4NRMA 1H6XA 1PM7A 1QCVA 3ZIWA 3FBYA 4Y24A 4IW3A 4ASKA 3K46A 4XHBA 4BOWA 2HWF2 3CQOA 3B94A 1E8JA 1OA3A 1RUE1 1G9CA 3KV6A 4HLTA 4IEWA 4Y1XA 1RUNA 1HJGA 1VJ2A 5EZWA 3D5OA 4YW5A 5LBFA 3RZDL 2VZRA 4BXSV 1KRIA 2Y60A 4R9BA 5A3MA 1A8DA 1VBD3 4QIWP 2Y6GA 1U5ZA 4QKDA 1JU4A 2YC0A 5A33A 4DINB 4FP3A 1LOFA 2NMNA 4XBLA 4HSJA 5IAVA 1QIQA 3ZFFB 4HKOA 4Y5Z0 1IZ3A 4CDQC 1LGCA 1NX9A 2OZJA 1J3PA 2D97A 4CYDA 2VECA 3DL3A 1PO13 1PMIA 5FDBA 1B35A 2WSVA 1X9TA 4CCOA 4A6OA 1OLQA 1EP0A 3CJIC 3RZHA 4EZ4A 4PDWC 5FPBA 5CG9A 1CADA 3PHMA 3HPNA 4E4HA 1RITA 2WAQP 2AC1A 2C5DA 4CDWB 4P14A 4Q4X3 4XBQA 1QXJA 4FPFA 4KWLA 5JXIA 4A3EL 1XYNA 4Y22B 1XE7A 4CEWB 5FYYA 1ZNPA 5EXOA 4GALA 2JE8A 2J22A 3QVDA 1QJU2 1BQ8A 2EAKA 2Q8DA 3J7Y1 1AYM2 2ZCWA 2XONA 4N43C 4ES8A 1HQNA 5I91A 2P6HA 1X8MA 5T3NA 2R043 1RB8G 1VAMA 3JD72 4N53C 3M3IA 1OBNA 2ZHNA 1TWHL 2AENA 4YZ1A 2DSXA 2Q0AA 4QU1A 4BY7L 4GJYA 3CKHA 2MEV3 5C33A 1HRI3 3U1XA 2BJSA 2C24A 4IETA 2R1DA 1R091 3C8XA 4JQRA 3SCGA 4NPMA 5T52A 4A3GL 3WNXA 4YVSB 3FLTA 3GYDA 5A7NA 2A71A 3R4UA 2O8OA 1ST8A 1ASJ2 1UX6A 1XNAA 2QQMA 4UWDA 3HQRA 4RGGA 4K1ZA 1UYYA 5FZ9A 3UGHA 3WVJA 3ZDSA 2GC3A 2PLV2 3GZTB 4Q4V2 5FPLA 5FPUA 3O1RA 1W2UA 4B3NA 2VD7A 3J4UH 1ENXA 4AR4A 4QDQA 1ASJ1 5I0TA 1EAH1 3FX3A 4IGPA 1W8WA 3LNLA 3DN7A 2PSMC 4XJAA 4JTOA 2YG0A 1R0HA 2XJUA 4Q4V1 5FMCA 3VDDA 1C8NA 3NV4A 5C44L 1QDOA 4FQZA 2WZR1 2O14A 4BE3A 3BODA 2WLQA 3B0AB 1QHDA 4HG6B 1SZBA 4K1YA 1B13A 1AJKA 3M3EA 4XF3A 4FPLA 5J3UA 2ZABA 3OBZA 4XXBB 3PL0A 3MV11 2JIJA 5FBJA 1NCQC 4AHZA 4I02A 2XH6A 1OLRA 1HKDA 4CCLA 1SEFA 2HVYC 5K0UC 1NNQA 2P3YA 2WABA 3LD8A 4LPLA 1NYWA 2R7ZL 1XU2A 2AH2A 4AL9A 1W6MA 3K35A 1BFYA 2A7AA 1UY2A 2Q1FA 1UU4A 1H4HA 3HQXA 3FMGA 1AX0A 1MEC1 3S57A 4MGIE 1DCSA 1WLTA 5DUWA 1VBB2 1T6BX 4NROA 2JA5L 4MXWA 5FO9B 4A93L 1APNA 4QGMA 2VMCA 3KGZA 3N9OA 1SLBA 4Q4W1 3C2UA 3JCIA 1NXMA 5EHDA 2Y64A 3V0AB 1CWPA 4GKYA 1FI2A 3KD4A 1PFUA 1CAXA 4A3IL 2QJVA 1VBB1 3WW4A 1QU0A 4Q0VA 2VL4A 2ZACA 4PT6A 5CKNA 4LHKA 2RR12 4NHYA 3OB8A 2ZBJA 5BY5A 4GD4A 5JOXA 4Y5TA 2AEZA 3R4SA 4BY1L 1LESA 5LEJA 1CX1A 3WV6A 2A6WA 2RS12 2V3BB 2UY8A 5AC93 1GYKA 1NLRA 4IV1B 4AHXA 5FKBA 4OUMA 4OULA 1WCKA 2X05A 3O0XA 1RMU2 1IQAA 3RS6A 1QKQA 3C7HA 1W8UA 2CR8A 1Z7S2 3JBG2 4JC1A 4ZPIA 3WDWA 2FDGA 3ZDVA 1YXWA 2QBXA 4ZZ5A 1VCXA 4LHLA 3KVAA 4OMDA 4LO5B 1HV0A 3H0OA 2D6LX 3Q8FA 3AFKA 2P34A 1US2A 3SHRA 3PWFA 1S0CA 5KHGA 4JAFA 2WJSA 5FJKA 2FBEA 2O8QA 5A33B 5BYNA 1MS4A 1CJDA 3P2AA 1NCRC 4CP1A 3ST7A 4D6QA 3VD7A 2OS2A 5BNNA 1BVVA 4CPBD 4CCCA 1QDCA 3H3VM 2PHRA 4CEYA 4G9SB 1B35B 5EJZB 1FPN2 1V6JA 4QD2A 1UIKA 4DUVA 3WG3A 2YB7A 1E57A 3VDBA 5DZFA 3LWVB 2VXRA 2XLFA 2VCMA 2RM23 2ERJA 2QQNA 4LKFA 4LUMA 2M6OA 4RQPA 4AK3A 3C7OA 1W05A 1OT5A 4P9GA 4QX7A 4W6YA 3GTML 4TPUA 1YFUA 5JDBA 3ACFA 4WM7C 4AI1A 4PI2A 3W5MA 2B63L 4H2AA 1C3HA 1S4CA 1V6NA 1DQ0A 4RFRB 3BPSA 4O9GA 1OKOA 1S0DA 3S7IA 3FL7A 5FY0A 5C9AC 1VBA2 2G1MA 2GC2A 1YCIA 2R062 1VIWB 3BN6A 2ZMKA 4PBPA 4FP2A 1BZWA 2H6CA 1IPSA 4OHWA 2GH2A 5GLTA 1W8NA 2ORXA 4HONA 2ZGSA 4LITA 1GSLA 1VRBA 3VKLA 5IYYA 4GWJA 1XE8A 2FCTA 4UF0A 3ZXGA 3HJWB 2VAUA 4BZ4A 4CVUA 2VPVA 2PMZP 3WUDA 1L7RA 3JB4C 2B45X 1DGWX 5DAVA 3E6BA 4NAMA 1AL23 5FZEA 3TWIA 5G05L 5AFBA 3GZEA 2Q5TA 1A78A 4UBGA 3KHBA 1YQ5A 4XW3A 2EF6A 1QJFA 3NKGA 1W2AX 1KQRA 4CRQA 4EROA 2DCTA 4BK4A 3LPGA 3DXTA 3ZFFC 4ZXEA 2XXZA 4EV0A 1FX5A 1NE6A 3L2HA 4FT8A 3VZNA 2E7AA 5FYMA 1C57A 1Q3EA 3Q9OA 1R1A1 1RUH1 5IVJA 2EAAA 2EXIA 2GN7A 3MV01 2ZGTA 2P6CA 4UW3A 3VDDB 2WO1A 3LB9A 3IAQA 2ZX1A 1IS5A 2J1AA 1RUJ1 4XCAA 1LKOA 4CDWC 2ZZQA 3LDRA 3RWKX 3WCSA 5DM61 2QCSB 1XRUA 1T6GC 2VMIA 4A7YA 5RXNA 4CEWC 3ILNA 1SG3A 3WZ1A 1NUKA 4Y1UA 3HWJA 4CZSA 2VUML 3MIGA 4KG8A 4FPHA 1HRV2 5FK7A 4KU7A 4P9IA 4AYUA 2WL1A 1W6MB 1ZRFA 1NY72 1TWFL 3IKWA 4GWNA 1GQGA 1RUI1 4LHNA 2DBIA 2JXAA 1D4M1 2OZ6A 5JOYA 3U4XA 1HRV1 4ASLA 5GZGA 1NLQA 1VBE3 3PU3A 3VD3A 1CD3G 1D0HA 4RA0A 4XUNA 5H9RA 1AYN1 1YUZA 4MXWB 3AMHA 1R0FA 1RHI2 3FFZA 3EBRA 1Y43B 1U5YA 2LROA 3MDPA 3WW2A 3ZYGA 3KZ4C 4AGGA 4CCKA 1ZZ8A 5A3LA 1ZRPA 1CAXB 3J8F2 1FOD2 2ET1A 2UYAA 3FJSA 3INAA 1S30A 1QQP3 4AFCA 2A6VA 2W87A 3AL5A 2CU5A 1U0AA 5AI2A 1O3RA 3AMQA 1H6YA 2JG8C 4AI3A 1VBD1 5FYCA 5A3WA 4E8DA 2QVSB 4XUPA 3ZVXA 1JODA 4JGYC 1RUG3 3RYPA 4MGQA 1FOD1 4H7MA 1BRFA 1YLLA 5FZOA 3RI8A 4PQ9A 4NJ4A 1PO11 4CDXA 2ZGNA 5FCCA 2HKXA 3K4DA 3DYOA 4MZUA 3MIFA 5LK7B 3M7AA 5A80A 3PIP1 3PUSA 4BMEA 3QD6A 2WNVA 4DZGA 4INDA 1TNFA 3K75B 3IBMA 4CCMA 5C3PA 4CTEA 4FOQA 1DQ1A 4Q4X1 5JZGC 2WO7A 4Q0PA 1H1AA 3QQCE 1H9WA 4LIVA 1YK4A 4LBMA 1N1TA 1TQ5A 3GGLA 3ZKUA 3ZYBA 4D6SA 2CGNA 4XFBA 2WO2A 3MHZA 5DXDA 3WP5A 5KC6A 2BOJA 3NMBA 2I2SA 2ID4A 1LHOA 2R041 1ZZ7A 3MFCA 4UW4A 3O1TA 1XYOA 4YLZA 3T0AA 4TYSA 3J7LA 1PGW2 3AKTA 1NG0A 1BCXA 2M6PA 3GTGL 1F31A 1FNYA 2VW2A 3AYEA 3HNYM 5LA9A 3T30A 1O3TA 3S1RL 2MEV1 3H7YA 1HRI1 5DAQA 3VBUA 4BQ2A 4AWDA 2DFBA 3AYCA 2VJXA 3SH5A 4CEYB 2C6BA 4GMP3 4D69A 3S30A 1HB2A 1PGW1 2WA4A 2GN3A 4RQPB 3VGIA 1ZYBA 1X82A 2RJKA 5L9VA 1B09A 4UFKA 1ULFA 1W0PA 5IJRA 2DF7A 4ET7A 5KXBA 1YI9A 3FKIL 3HOWL 1QYBA 2BDRA 2ARCA 5FJ8L 2N7GA 3AZVA 3MW2A 5EV7A 5FY1A 4ZZ8A 4BBRL 2XHKA 2GMEA 3LWRB 3JZVA 1PFYA 4XFIA 5CAZA 1H2NA 4CU6A 3OGSA 4PCRA 4IV1C 5MF6A 1GNHA 2CSGA 1JYXA 1W8FA 3PKIA 2VMDA 2VC9A 2X09A 3PUIA 3BCWA 3IZOA 3N3HA 4TWTA 3BGAA 1S2BA 2VZOA 1GFF2 3H3LA 1OSGA 1X9PA 2RG4A 4UF0B 1RUE3 5FFOC 1MQTA 1TMF2 1PVC2 2BW8A 1PGSA 1OLMA 2PXJA 1EV12 1QMJA 3I59A 3FDJA 1XNKA 1EY2A 2XJVA 2A5ZA 3HN1A 3M8LA 4Q27A 4QM8A 2WFPA 4AFAA 5FLJA 3Q8EA 2HWF3 3CQZL 2B39A 2JE9A 1TMF1 4YM3A 1KGYA 3VHPA 1AVBA 4LK6A 1GOHA 3PUHA 1LOFC 2E9QA 4COYA 1ZZ6A 2JD9A 2C9AA 5J48A 3GM8A 5FYSA 3KV4A 1ZBA2 4NHXA 3RZOL 1B35C 4POFA 4E6YA 1S0BA 4FVVA 1D4VB 4NUBA 4BDVB 3ELNA 3I4IA 3NV2A 4YPJA 3H9CA 1SFPA 3BOPA 3H99A 5FYZA 4ZXKA 4XUQA 1LJ7A 5IYCL 1UXZA 4H3WA 3T0BA 1ENQA 2BPA2 4B8CD 2YFZA 1ND2A 2AACA 1FMD2 4M01A 2HR5A 5M5XL 3V65A 4YW6A 3WEZA 2TUNA 1L3JA 1AR92 2O1QA 2YPJA 3HOXL 1PIV2 2ZMNA 5FMBA 4A3DL 1QEXA 4A3KL 4JHZA 3KVBA 4NWVA 4EWEA 1FMD1 1V6MA 2D3RA 2R7EB 4QXHA 5GZDA 1QJU3 5I93A 1BE7A 2YY1A 3AYDA 2XPJA 1AYM3 1WJVA 3B3QE 2D6KA 1LHNA 1UZWA 5AC91 3OEBA 5CADA 2QQVA 2X10A 3JD73 3WNOA 3LCPA 5FKCA 5GLVA 2NYYA 4BBSL 1LGBA 1Z78A 3B5LB 3MSUA 1G9BA 1SFNA 2W46A 2X8KA 3TEZA 5LBBA 1RUD2 4JAEA 2W94A 2B7YA 1JOBA 1JMUB 1SMWA 5EFUA 4QQOA 4BQ4A 3PVNA 4Z82A 1WA4A 3QCWA 2VUAA 2ZTNA 2J9UB 3ZXKA 4LK7A 1YNAA 4D7TA 4A3ZA 2BGCA 4IEZA 1ZBE2 2VXJA 4K6BA 1CAUA 1TE1B 3JR7A 1ASJ3 3K48A 3KCCA 4O65A 4V1PA 2K2SA 3MICA 1RUD1 4W50A 1RGSA 2NZ9A 1G8WA 2CAUA 4Y1YA 5JMCA 5LY1A 5IHRA 1W8TA 2PLV3 4NVPA 4Q4V3 5DABA 4JX0A 3ZPYA 1SBFA 2OIIA 3EMRA 1CIWA 1E5SA 3OTFA 4XAEA 2VTFA 4YVWA 5CA6A 1AHSA 1ZBE1 5CBLA 1DLCA 4CP9A 2EXHA 3VDDC 5A70A 1PK6A 2ADDA 2PHTA 2W1UA 5FZOB 4CDXB 3SQOA 1LKMA 2Z4FA 2I74A 2D6NA 1N3QA 1S2KA 3CDZB 4MLOA 4OI0A 2PYAA 3LDBA 3LWPB 2WNVB 3QBQA 2RM21 1AX1A 2IXCA 5GM0A 1UOJA 4HKWA 1OQ1A 4GAZA 2R49A 3GBWA 5FXWA 5LA1A 3PO2L 3RFRA 1WKYA 4FBFA 2XB6C 1W6NA 1WCQA 3L2YA 4ITCA 5K2ME 3BTZA 4KQ7A 1JI6A 2APOB 1GBGA 3NSTA 5FY9A 4R9CA 5KHKA 3APBA 4Q0SA 3RVHA 4K8FA 1VZGA 1CAVA 2BBAA 3RI9A 3SMHA 2E63A 4EJRA 1G9DA 2HWD2 2PAEA 4L0PA 2XLAA 2JDYA 3LSEA 4FPEA 2HBUA 3PZAA 2Q8OA 2IXLA 3TOJA 1JYVA 5F1RA 4K7JA 3VBUB 5FZGA 2BE5D 2DDUA 1UY3A 1VBB3 1GOGA 3EYPA 5IK7A 2ERFA 2HWD1 2XKOA 3FLPA 3K51A 3EXUA 1AL21 4ORFA 2NN8A 3X29B 3WP4A 3KF3A 1FNZA 1HQLA 2PVXA 3C7FA 1L7QA 5DAXA 4OQ8A 1UOFA 3I2OA 5C4JL 3KYVA 1H8TA 3LPEB 2RR13 3S15L 1UYZA 1C4RA 1W6QA 2AEYA 4P9WA 4DO0A 4EYUA 2LTNA 4ASMB 2AYHA 2G9FA 2HWB2 2RS13 3I8TA 4XIKA 2HEYF 3H1MA 1SLLA 1PGL2 3C3VA 2QQLA 3T4VA 3MIDA 5A7WA 2A6ED 2RDNA 4JTNA 4PF1A 2WKKA 4QB1A 1RMU3 3H9BA 3WNNA 2DVGA 3T2PA 4R4XA 5I8TA 5IVCA 5GKAC 4EE2A 1H2MA 1MQTB 1H30A 1Z7S3 1HN1A 3JBG3 1PGL1 4DXRA 4NIHA 3NQHA 3I59B 4QXCA 4BMBA 4HK9A 5T5PA 4B1LA 4B4PA 4R9DA 1HB4A 4A3JL 4N7IA 4FQ4A 3VBSA 1V9U2 2HEWF 1XNBA 1SLTA 3D6EA 4L2NA 4YFZA 1TWCL 3OBAA 1I6HL 4DUXA 3BTXA 4CXXA 1QNYA 2NVYL 4XF0A 4YVSA 2XJQA 2WIIB 1B2OA 3NFPI 2YBSA 3ILFA 5BNNC 3O1OA 2VR4A 1ZM1A 3FWEA 1VBE1 5IK8A 3VBHA 2XJRA 4JKLA 1DGRA 3KT1A 2UU8A 4FPCA 4LLOA 4Y52L 7RXNA 4XF1A 1FPN3 2WN2A 3WSOA 4AQ6A 4E8CA 2E26A 3MLKA 2TBVA 5A3UA 1ND2B 1CZSA 1BK1A 1LAJA 4FI9A 5DZEA 3WF4A 1W06A 1QQP1 3FHIB 4EN8B 1JHJA 3EQEA 4QQ2A 1ULEA 5CB7A 1PFWA 2Y26A 4M3CF 4XEZA 1BMV1 3IWZA 1BEV2 4KL1A 5BNOA 2BFUS 2C6AA 3MLLA 3AKSA 3S6PA 3HVDA 3WR0A 5SV5A 2PTMA 4Q0QA 1LU2A 1VBA3 3VBFA 3KCXA 3PMSA 5JVG1 5A6ZA 3AVRA 1CAAA 4A3CL 1S1AA 2R063 3VKFC 4XF9A 3LWCA 2OKXA 2VQAA 5FUIA 3E1F1 1BEV1 2JA6L 1RINA 2JDKA 3SCHA 2VQUA 2D3PA 4LO4B 3BTYA 1SBDA 2FQPA 4BQXA 2RMU2 1A6CA 1DYOA 4CUCA 4COZA 3RQ0A 3OF1A 4XDQA 3O0VA 3RG0A 4OQ9A 3VDCA 3I3MA 1CAUB 1GR3A 4LNVA 1LENA 4BM8A 4KI5M 5T5LA 3GJBA 5I0SA 3RZTA 2ERSA 4YG0A 1D2SA 4LBQD 3FN9A 2XHNA 1W03A 2B9VA 1UW8A 1W6PA 1DIWA 1Y9GA 3WF0A 4DFSA 2ZXQA 1UU6A 5FYUA 2ZGUA 3T09A 4RGKA 4AGVA 4CP9B 2QQUA 3MIHA 1PK6B 4Y7NL 4Q4W3 3WG2A 1YJLA 2FD8A 2W1WA 2IXHA 3OGVA 2WZEA 3ILRA 1OVSA 4QU2A 3ZKYA 2WN3A 4GMP1 4IXLA 5CVRA 4GXLA 3ATGA 4L11A 5JR2A 1JZ3A 4GB32 3I2KA 2XL7A 3MI8A 4WFN1 1ULOA 2ARBA 4SBVA 1KEXA 2XUMA 3C7GA 4OHVA 1W6NB 3FHAA 2Y0OA 2L0ZA 1R9TL 1WMDA 3MFAA 4CU9A 1BK0A 3HR9A 1HRV3 1ZA4A 4GB31 4WVWA 4S2GA 1CAVB 4DIQA 4PJYA 3J26N 4B1MA 1GWKA 2BQPA 4CA9A 2GP5A 2VNGA 4MYEA 2VZVA 3AJYA 4MXVA 3RMYA 4BWOA 2QUOA 3N9LA 4OCTA 5B4NA 4V196 1LKNA 2D93A 4F8AA 1XXNA 3OOXA 3HT1A 1R082 1RHI3 2GC1A 3I2JA 2FDHA 1KDMA 4NHMA 1JBCA 2LM3A 3GF6A 4C90A 2ADEA 2HWF1 4HN1A 3J8F3 1FOD3 1OLME 1NLSA 1WCUA 5D21A 4DXTA 2R16A 4U2AA 1H8TB 2WA3A 4O9EA 4XC9A 4AQTA 2IUWA 3ES4A 4NN0A 3KWVA 4XJUA 5FLML 4QX5A 1W6QB 4XFGA 5CKMA 1W3XA 2RS52 3AP7A 3ETPA 5FQ0B 4CDXC 3F95A 3C7EA 1XPWA 2R072 1URXA 3SEPA 1C8M2 4R4ZA 2WNVC 5A7WB 4LO8A 1VE0A 4HVQA 3SITA 2VVDA 3PIJA 5KR7A 1R0IA 1RDVA 3RZGA 4LORA 3KF5A 2P37A 1C8M1 4RYDA 5A6XA 4C2M1 4DQAA 1F5FA 2P3JA 5FPXA 1SMUA 1QJEA 3LE0A 1IPJA 2VW0A 2G9ZA 2NMOA 2RHPA 3ACHA 4D6RA 2R92L 4OI1A 1XNCA 3VBSB 1HJFA 3NVCA 4I01A 3UV9A 1QJU1 5FBZA 1VP6A 1AYM1 2LW8A 2XJTA 1ZZCA 3DPRC 5IFPA 1POQA 3RGBA 2E32A 3JD71 4P9LA 4PBOA 5BNPB 2VZ1A 3VZOA 2C6SA 2JDNA 1QH6A 1QF3A 3BALA 2WRAA 4XUTA 1PX3A 2VBBA 3DKWA 1ODHA 5E88A 1VPHA 3PJYA 1T9OA 3VBHB 4QPGA 5EYYA 5FZAA 4AVSA 1G9FA 3DEMA 4TLFA 2YC4A 5F9TA 1GMMA 1W2NA 2YGMA 3ZSJA 4JVAA 4FOWA 4CDUC 5FUNA 2JB8A 5FREA 4A7KA 4Q8KA 3OD0A 1ENRA 4MADA 5M3FL 5J7MA 1PFVA 4AGRA 3RYKA 4BXXL 1W9SA 1O4YA 1V00A 2PLV1 1E5HA 1DQ6A 3PTRB 4FPKA 3QH7A 1S0FA 4C3JL 4L97A 5C4WA 3UK9A 5BNOB 4NIGA 4Q2FA 1JTZX 2RDQA 4EZHA 2PMWB 3VBFB 4M3CA 2FCVA 3N9QA 1JZ5A 5C6CA 5T55A 4DOUA 5FP8A 2BU9A 3S1ML 1OH4A 2HJIA 3V0BA 1JZ2A 4LQRA 5AN9H 5EYXA 5F3CA 3D0SA 4BLJA 1F4HA 4FOYA 4UYBA 4A7ZA 4FPJA 5M5YL 1GP6A 1TMF3 1PVC3 4K3UA 4KGGA 1T9PA 5FZ6A 4AEJA 3A4UA 4YGEA 1FV2A 1EV13 3VZLA 2WFF2 3LEKA 1MZFA 3ZSEA 3ZFEA 2VCCA 1UU5A 1LHUA 2PYTA 1F2NA 3WINE 4C8DA 1TZOA 3U4SA 1IOAA 2WQ4A 5A3NA 3S0MA 1W6PB 4R9AA 2VQTA 1LOCA 2WINB 1XSQA 3GHMA 2A6HD 4RHV2 1BJQA 2WFF1 2X5IC 3JXSA 5JOZA 4A4AA 4XXAA 1PM4A 1ZBA3 2BGPA 3P3PA 4PF5A 4QX8A 2AZ5A 3SXWA 5GLUA 4KWUA 5D8AA 3UGGA 4BQWA 2WNOA 1YQ2A 4SLIA 4LT5A 4UT5A 1S24A 3ZIXA 1ND2C 1DYPA 3O1UA 4W4ZA 1HDKA 1W90A 3LA7A 2A6ZA 5DDJ2 4ZU5A 3O1SA 5KBFA 1FMD3 2ENRA 3MPPG 1AR93 5EJ3A 1AR72 1YEWA 1PIV3 2RR11 2WNUA 4Z2AA 4FAHA 1DFQA 2BNMA 1MZ6A 1GQPA 2A70A 5E8AA 4OUSA 5J98B 3S16L 3B69A 3TNQA 1H2KA 3HNBM 2D6MA 2RS11 1W9WA 5FZFA 3IIAA 4KBZA 1UKRA 1Y9MA 3WDTA 2GNDA 2W9XA 1O5LA 1ZX5A 1WMXA 1MS8A 2ZEZA 4XILA 3ZN4A 2ZAHA 1RMU1 1YC61 4P5YA 1OOPA 1FT9A 2R0HA 2Y6HA 4Y1VA 4IGOA 1RUD3 2P2KA 2A6YA 3IMNA 1Z7S1 2JKXA 3HIFA 3HKZP 3JBG1 4Q29A 4Q1RA 4AI8A 1V6OA 4HK8A 4WVVA 3OJBA 4XFFA 1SACA 1ZBE3 1ENSA 5MFZA 4Y4YA 3VBRA 4COVA 4AVBA 4NHLA 1UKGA 4YVWC 1IU5A 4DMIA 2GC0A 2E6VA 4CUAA 3FC0A 2AGSA 3LGRA 2H12A 1UL9A 3PKJA 1PK6C 4NMIA 2V73A 5FMOS 2NP0A 2IXIA 3S5QA 2NYDA 1YWKA 3OPZA 4BHPA 3NAPA 4QPIA 3GTQL 3M1HA 4DY3A 1W6OB 4M0HA 2DVBA 1H8VA 2JKBA 2UWCA 3H50A 3KSCA 1FPN1 1LOEA 3PVEA 4C0HA 1MZ5A 1SBEA 2P3IA 4QWNA 4DXZA 1X8EA 3LWOB 2EIBA 2YPDA 1R1ZA 1YIFA 3KHCA 5FTTC 5GAGc 2XBO2 2FZ1A 4GIQA 3VB9A 3ZFGB 5CISA 3J7HA 2UURA 4G3YC 1PVXA 1JYBA 2ZKNA 2EALA 3WXPA 5L7OC 4YRDA 2V09A 1N3PA 1P8JA 2G19A 2V5YA 1KXGA 2GSYA 4RS5A 4MGKE 3VKMA 1O7FA 1A8MA 1REDA 3R4DB 1FXZA 1MACA 1VBA1 3AB0A 2PHFA 3ES1A 3WQBA 2R061 1G9AA 1PHMA 1Y1WL 1AXZA 3W58A 2CKCA 1MVEA 1V6LA 2HWD3 1SCSA 3MPBA 5E89A 1JZ7A 2ZIXA 1BQPA 1DQ5A 2DURA 1KD7A 3GZAA 5FP9A 1M4WA 3RZZA 2IXJA 4QPGB 1GP5A 1CR7A 2WWSA 5DZGA 5I0RA 1W9YA 1OWBA 4X6AL 4FXKB 4BJ0A 1OPOA 2BOIA 4X8NA 2W95A 1JH5A 2J1SA 2A3YA 2BFUL 5HCBA 1VBC2 5HCAA 1H8TC 5F3GA 3WP3A 3D82A 3BPZA 1UCXA 4EN7B 2ZGQA 4YZ3A 3ZG6A 4KGQA 5J1XA 3NV1A 5C4WB 1WBLA 4IDZA 4YG6A 5IFTA 2RE9A 3FE5A 4F7ZA 1UZVA 3WHTA 1UYPA 3LOIA 3CZJA 1AJOA 2HWB3 4M3CB 4UW6A 1ALYA 3GTLL 3F2ZA 5CZKA 4AOCA 4AVTA 1LTLA 3M3CA 2VOWA 5FZHA 2E2JL 4E4SA 4AI9A 2C4XA 4HXCA 5ACA2 5LK5A 1IU6A 1F35A 3V0BB 1KDKA 3B01A 5C71A 4XFCA 2QQIA 1ZRDA 5APAA 3LWQB 1QQTA 4DXSA 3VBSC 4BCUA 3ZFEB 1MS9A 2WS92 1I3QL 5D1IA 1CJPA 1RXGA 3H3UA 3VHOA 5AVPA 1YQ6A 3CNAA 1V9U3 2YFUA 5FP3A 1BQ9A 4E2GA 3LIGA 3PU8A 1NY71 1DGLA 4YVSC 4WM8A 2K2DA 2Z3QB 1RC6A 3J9SA 3VBHC 3S1NL 1K5MA 2BUKA 2ZEXA 1WBFA 2DTYA 3FUOA 3M4FA 4Q5OA 5LA2A 4MX3A 1UIJA 2VZSA 4DEQA 4HMZA 5C3QA 2F17A 5D8AB 5IVYA 5A1LA 4CP2A 3AKRA 2JE7A 4JAGA 1RHI1 1ULDA 2D7FA 3PLQA 3ZXDA 1JOPA 1BLZA 4IEUA 2JI1A 1G86A 3AP5A 3EO6A 2E31A 5LWBA 5LBCA 3ZN6A 3UKNA 4YGDA 4DNYA 2QL0A 4QHZA 3I3EA 3J8F1 2W1QA 1CONA 2GMPA 5F37A 4K40A 1J3QA 4AYBP 3WY6A 3UT0A 1TVGA 2WNUB 3AMMA 5BNOC 5J96B 3AZWA 1K45A 5F3EA 3HAXC 4QKFA 1BEV3 3VUOA 2KXLA 3VBFC 4XAAA 1T2XA 2W91A 4GS7D 5E16A 4A41A 1WCML 1XB9A 3WNPA 5GAHc 2R1BA 4P5HA 1NXEA 3T0DA 3I4ML 4AEDB 5A1AA 5C8WA 4C3HL 2NPIA 4XPVA 1DU3D 5FLIA 4B8EA 4A3BL 1W04A 4GULA 4J1WA 4CDQA 1XC6A 2D6OX 2JICA 1F8VA 1OOPB 1RVF2 2W92A 3RSJA 3H97A 1O59A 2RMU3 4YFWA 5IK5A 1ODMA 4QB2A 4OZXA 2Z69A 3POBA 1KFXL 4X6QB 4JRLA 1K3IA 3ZM8A 4ATEA 2DCKA 3LA3A 3LZZA 4PDWA 3OSDA 1VLNA 2W0XA 1XJAA 4AVCA 1Q8QA 4IUGA 5LA0A 2WQ8A 1RVF1 2Q4SA 2JECA 2K0GA 3VBRB 3VN4A 5A1FA 4AI0A 3CBNA 1AR82 1WW4A 1J3RA 4JADA 2NQYA 2RS32 3ACIA 4BPZA 1ODNA 2WT0A 3RZLA 4XFHA 5JVVA 4OUEA 3WD5A 1RYQA 1W8ZA 3E5UA 1CQ9A 2YU9L 2DUOA 2W52A 3NAPB 4LKSA 4QPIB 4LLFA 1PMHX 5A7PA 3IM0A 1PZ7A 4N53A 1H1IA 4NPLA 4KMQA 3UNPA 1YK5A 2AUYA 3HT2A 1K42A 3PJQA 2X53S 1RUC2 4RR3A 2H6BA 4JDNA 4PLOA 4GB33 5FZ0A 1XNDA 2OUHA 1HXS2 5GZCA 3WDUA 2UWBA 5FZ8A 4K21A 4BK5A 3WDXA 3HOYL 3I4NL 3HEIA 5FXZA 3ME2A 4GKXA 5LASA 3OUIA 1H7VA 4RS5B 5F39A 3T1MA 5JSOA 2W39A 3A21A 2P5BA 4DY5A 3I2HA 5HPOA 1HIXA 2XVLA 4U36A 5F5IA 4YSFA 2GNBA 3H0GL 1RDGA 3NNLA 5FPVA 3PNAA 5FMDA 4HOOA 2LRPA 2LUWA 2HWE2 3AP4A 3A44A 2V72A 4M3CE 5FYTA 4CCDA 5TSWA 2JA8L 2JJ6A 4QHBA 2KN9A 4XDPA 1PVC1 4XIOA 4F83A 1QH7A 1R083 4E4ZA 4YZ2A 1HLCA 3M4OL 1EV11 2RDRA 3JU9A 4OVEA 2YGLA 4HT1T 1X7NA 4LULA 4BB3A 2Z3RB 5EP9A 4N9IA 4AW7A 5C3OA 1MS3A 1D7PM 5FJHA 2LS6A 2E7TA 3GTOL 2RS53 2VO5A 1ZBA1 1SMMA 1OQEA 1H1MA 3WLUA 1YQ8A 1STMA 1WZXA 2R073 6RXNA 4IE0A 4AAPA 3AX4A 3EHKA 1C8M3 4QQHA 2E2HL 2QZ2A 1HW5A 2PHLA 4NIDA 4YM2A 2XWBB 4MHRA 4QHOA 3W59A 1OPMA 1QNWA 5CNAA 1HV1A 1C09A 3Q8CA 5FV3A 3HNMA 2WAOA 1VB2A 2YU2A 3A23A 4LBJA 4OI4A 1AR91 3RZ6A 2D6PA 1OUSA 1E5IA 1PIV1 3MGUA 4OLLA 3PO3L 2D98A 4JDOA 3T08A 4XDOA 2VY0A 2B42B 2DVDA 4Y33A 2ZGRA 4YGBA 2Y6JA 3BOWA 5I8YA 1WA6X 4QQPA 5HCFA 5KXCA 3SLIA 2ZGKA 1OD5A 5C70A 4FFFA 1VAVA 1NZIA 1O8SA 4WM8B 2Y33A 2A68D 1F4LA 4JKKA 3N7JA 3UGFA 1GNYA 1HX6A 2UYBA 5ERLA 5IAXA 1IG0A 3TN92 1V0AA 3H7JA 4ZN3B 1K5MB 1WUVA 3NJVA 4IEOA 1COV2 4QPGC 3AKPA 3RJRA 3PMEA 3VZKA 3VD4A 1DZTA 3NW4A 4HVOA 3ZYHA 1FV3A 1Q8OA 2ZPXA 4CCEA 2ZGOA 4A44A 2JDHA 2IFRA 2F4PA 2BVVA
chains in the Genus database with same CATH topology
1U12A 1I3HA 3ZN6B 1MR5A 1O4TA 1N1SA 3JB8A 1H0BA 3P8BA 3MW3A 1S0GA 1N3OA 4H7LA 3OD4A 5JIAA 3NWKA 1CAWA 1QJY2 5K9YA 4S2HA 3H3ZA 1OWCA 2YV8A 4XJZA 2ZGMA 3B08B 1GZ9A 3G7DA 3VHNA 1J1LA 3S7EA 4CDQB 5JPMB 3NV3A 1GZWB 1HQWA 1X33A 4I0AA 4EN6B 2C1FA 2ZX0A 4E27A 2KM2A 3ZX7A 3N4MA 5FMOL 2WFF3 3ETQA 4Z1VA 4PDWB 2YMZA 3T2TA 1POV0 1WD3A 2B8MA 3ACLA 2TEPA 2CWSA 4POGA 1KJLA 1OI6A 2YDEA 3AZXA 4WM7A 1TME2 5FAXA 4RHV3 3OCPA 1LOGA 1TEIA 1WD4A 2W08A 3KLSA 4BYYA 4N43B 4EN9B 3L9JT 2JDZA 5AFEA 4N53B 3POWA 2GMGA 4AE2A 1KJRA 1V6IA 3E5XA 4RR3B 2QQPA 1R0JA 5DDJ3 5JI9A 5FQ0A 2DVAA 2QZ3A 3W9AA 4MVTA 1LHVA 4Q4Y2 3RJ2X 1MZEA 2XKPA 3GBGA 1AR73 5J37A 3IU3I 5DUUA 1WLDA 2GH8A 1YHFA 3D8CA 4AVVA 1Y9QA 4G6BA 2XG3A 1DF0A 2UY9A 4HZFA 3N7KA 5I8SA 2HWB1 2A73B 4UBHA 4L99A 4NO4A 3WW1A 2FMDA 1LECA 1OOPC 1LU1A 1DZRA 4XQDA 4S2DA 1QWRA 3FZ3A 2I45A 3M3OA 5LEKA 1QXRA 2GMMA 1KS4A 5FPZA 1POV1 3RRDA 1MS1A 3KYWA 5L19A 2DU0A 2R30A 2ZZJA 2CGOA 5BNPA 2WQZC 1OHFA 2ARXA 4XMIA 1V9U1 4CEYC 4JCKA 1YFXA 3U11A 3USUA 1QJX2 4DS0A 2YUEA 4KH9A 1BBT2 4I2OA 4XGHA 4E2QA 4QPIC 4YM1A 4RQPC 3P3NA 3WDVA 5JPNB 3FFQA 3PVOA 1LHWA 4IEPA 4RFT0 2OW4A 5SV8A 2G9GA 3ZMOA 4A2UA 1DYKA 3WWLA 1RTVA 2XBO3 2OUJA 4ATFA 4X8PA 5JI7A 3ZSMA 1VRH2 4RS5C 3VBOA 1VAKA 5MFPA 4Y26A 2WC2A 1I9RA 2Y0IA 1NQJA 3KT4A 3CL1A 2D5FA 4AFDA 4UY81 3GNEA 4RGAA 4YARA 1VRH1 3CO2A 1AL0G 3IDEA 5KHJA 1CN1A 1JUHA 2YYOA 1AR62 4F3JA 4J6GA 1SLAA 2ZX4A 3AXDA 5F6KA 3VHRA 3GHNA 1DX8A 5FRAA 2RMU1 1ZRCA 4L9BA 4LE3A 2VW1A 2PAKA 3KT7A 4K9FA 4LBLA 3SH4A 2ETEA 1VBC3 3V56A 2BWCA 4OHXA 2XJPA 1LULA 2Z79A 2HWC2 3EJKA 5JZGA 1IROA 3ZSLA 2PFWA 4XQWA 3AP9A 1CPMA 1VR3A 3VV1A 4LEJA 1CAWB 4JGZA 1JXNA 1M06G 3E97A 3THPA 2A6XA 3AZZA 5GZEA 3TB0A 2HWC1 2XL9A 4RSUA 3UJQA 1KFUL 1ND3A 1RUF2 3I2DA 3A0KA 4EWAA 3AP6A 4HSLA 3ZXJA 5ACA3 5ABJA 4DRRA 4RXNA 1WCDJ 4QMAA 4P9YA 5F6LB 1GICA 5KXDA 1AXKA 5MLC3 3MLJA 3M2MA 2WS93 2I07B 4WM8C 2QKDA 1U5XA 1XYPA 4WM7B 2DCYA 3OGJA 1K5MC 4A3XA 1B71A 1DBNA 2PA7A 3I7DA 3OBTA 5JSPA 4META 3WHUA 4G4FA 1ZZ9A 1RJ8A 1NE4A 3FLRA 1ONAA 3WQ1A 1LOBA 4I3GA 2JG9A 3KGLA 3AM2A 3E5QA 1R081 1RIRA 3DF0A 3KMHA 5KWRA 2JI3A 4B7KA 2D40A 4LBKA 1BVP1 3SCFA 4AQSA 3D4KA 1EYBA 1IPKA 4FPGA 4XJ8A 4HBNA 1C5IA 4FO9A 2FZ2A 2Q1MA 1H9PA 1W6OA 3CJXA 3HMYA 5H1Sc 4XE9A 1RL3A 1DG6A 3WUCA 1Q8PA 1GQHA 2VU9A 2RS51 2YROA 1GKBA 5CFCA 2R071 5GZFA 3ZFGA 2BEOA 5JLVA 2VOKA 2GDFA 3QLQA 3VPBE 2CYFA 3ECQA 4IEXA 4URTA 2DCZA 5FO8B 3T1LA 3AJZA 1RVF3 2CKAA 4LO6B 4FXGB 1IS4A 2VVFA 5DUXA 2D5HA 2Z2SB 1CESA 3CLPA 5GALA 1RYTA 2OPKA 3U10A 5CFDA 1LOAA 1DZQA 2WT1A 3TBDA 3VBUC 3M3QA 5T5JA 3MEPA 2OA2A 2JEMA 4D7YA 1AR83 3USUB 2PHDA 2RS33 1S55A 5J09A 4AR5A 2CAVA 5IK4A 2VOVA 4GA9A 3RNSA 3AYAA 4QPYA 4XTMA 1R092 4XTPA 4KWKA 2FHRA 2PHWA 5IUQA 3KYYA 2V0EA 4FPYA 4NWWA 4YZ4A 2XWJB 4RL7A 4RR3C 4S2FA 3URFA 2BNOA 3O0WA 1JN2P 3IN9A 1RUC3 4GH4A 5BV6A 3JQWA 4ES9A 1HXS3 5JIUA 5BUVA 1EAH2 5LRSA 1OFSA 3VBOB 1KS5A 3ENRA 2PHXA 4PIYA 1BKZA 1W39A 5T50A 3SS2A 2Q30A 1MQTC 2K9ZA 2IWGB 2WZR2 1NA1A 4YW4A 2JG8B 3MIBA 4JAAA 1WMEA 1Y3TA 5L73A 4W65A 1UZYA 4DPNA 3WG1A 4JGYB 3VL8A 3TAYA 3AKQA 1AXYA 2HWE3 5DM71 5K7PA 1IHMA 1IS6A 2ATFA 5BNQA 4FTBA 3PVBB 1REFA 1QXPA 2R32A 3IT8A 1C5HA 2IZWA 1UMZA 4FAGA 3DV8A 2PN5A 2MS3A 5JZGB 1MEC2 1LTEA 1IGOA 3N35A 4RHV1 4JGZB 1UD1A 4Z8BA 1YFWA 2A75A 4Q4W2 4XXPA 1PZ9A 4JDMA 5CU1A 1JYIA 2AYJA 4CP0A 3OY8A 1ND3B 2KKDA 1YO8A 4COUA 1NXGA 5ABJB 4AHWA 2ZGLA 5BPXA 5DDJ1 2PVEA 1LGNA 5T54A 1SLCA 1AR71 4Q1PA 4IL7A 5KHIA 3SNMA 4AEDA 1C1FA 1O3SA 4DB5A 3VZJA 3VLBB 5GAEc 1MVQA 5HI0A 4AR3A 3H8UA 2PPTA 4AEKA 2CY6A 4MUVA 3ZN5A 3NKTA 3R6SA 3TN93 4Q8LA 4I09A 3KM5A 2NM1A 2HEVF 1COV3 1X36A 4JV4A 5J36A 1MS5A 2XLGA 2WLPA 1AUYA 1V70A 3J7Z1 2DCJA 4U671 2HYKA 2JG9B 4NHKA 3U0ZA 3QACA 3VKNA 1QOOA 4XJWA 3QOPA 2XVKA 2EA7A 2VNRA 3H1WA 5DG2A 2DV9A 3R05A 1AZDA 4N7UA 4BH9A 3NJZA 1QJY3 4NOTA 4H14A 1GANA 1UPIA 3GBFA 4HKLA 4HANA 5CFCB 4AQ2A 4IV3A 5DUVA 3MF9A 4MGYE 4I0BA 3A0NA 4AVAA 2A69D 2SBAA 3RYGA 4KBBA 4QGNA 1OFNA 1H2LA 1WW5A 1RWDA 1WCSA 4OFGA 4YW3A 2XBO1 1SCRA 2YZ4A 1Q8SA 4ISRA 5FLHA 8RXNA 4B29A 4IEVA 5CFDB 4ZU4A 2X29A 1SLIA 3BB6A 2OYZA 3BU7A 3ZXFA 1TME3 4BA6A 4XYXA 2ILMA 4XJ9A 2VULA 4D94A 1YJKA 1VZIA 3ZO0B 3ZXLA 1XU1A 1PZ8A 1EPZA 1BYHA 2JENA 1PNGA 4YGCA 4GH4B 1RUOA 1VBC1 1PO22 3MYXA 3OGGA 1YV1A 1REEA 1SDWA 2GALA 4QT6A 1A3KA 2AR6A 1NXD1 3O14A 4Q4Y3 1QY4A 1FAYA 4NR1A 4C1XA 2CGPA 1C1LA 2BWAA 1R1A2 2M4VA 1IKPA 1RUH2 3WW3A 4XETA 4UW5A 2ES3A 1PO21 4IEYA 1AF9A 4M00A 5H9QA 3UKVA 4TZDA 1NA1B 4C1WA 1RUJ2 1DQ4A 4Z07A 3WQ0A 1POV3 2R0FA 3B93A 5C8CA 2E7QA 4AXOA 1S2ZA 5ACA1 3LSDA 4WV8A 4Q26A 3RDIA 4AI2A 3IDCB 4MSVA 1YI7A 3LKJA 5LRRA 4XHXA 5BNPC 5BXXA 1Z0HA 4L8QA 1GV9A 4FOVA 2WS91 2BTVC 3RWNA 1RUI2 4ME3A 1ZRRA 1D4M2 4OHYA 1X50A 4HVRA 1LR5A 1QJX3 4LUKA 1BBT3 1OQDA 4H55A 4Q0UA 1AYN2 3MW4A 5IY0A 3ZYIB 2QFEA 2O0OA 1JHNA 3DUIA 4OI2A 5IT6A 2GU9A 1KITA 1CVNA 3CF6E 3OY8B 4XZPA 1IRNA 2PAMA 4XQ4A 2CTVA 2WSUA 5FOJB 1B2JA 1VBD2 2MNGA 3ZSKA 3VBOC 1BXHA 3G6JB 4IQPA 4EN0A 1VRH3 4Y1ZA 1PO12 3WG4A 2JX9A 3DGTA 1QOTA 3BIWE 1DVBA 3JUUA 1GZWA 4WVZA 5GLZA 2CWMA 4UXAA 3CJIA 1AR63 1D2QA 4Q4X2 4J1XA 3FBMA 2ZHMA 4Y20A 1Q43A 4WZCA 3WDYA 3WT3A 1CX4A 4IERA 5GADc 3MPSA 2R042 2V0FA 3AFGA 2OVUA 1YRZA 2HWC3 4N43A 3RYRA 1AR81 4JGZC 4AFBA 4E4DX 3KCYA 2RS31 4KWJA 3KQRA 2MEV2 1HRI2 4MV2A 2EXJA 2D3SA 2SLIA 5JVH1 4B7EA 1ND3C 1UF2C 4HN0A 4MH0E 1G6NA 1I6XA 1O91A 2DYCA 3DPRA 5DG1A 2VQ0A 2ZHKA 4AFMA 4IV3B 2ZHLA 5F5QA 1Z92B 5ABJC 1RUF3 3POYA 5BNNB 2VOXA 2B9UA 1YUXA 5T5OA 1RUC1 2ZMLA 1DGRN 1HXS1 1UN1A 2QDRA 4ISQA 4CDUA 3LAGA 4YW1A 4PLMA 3ZXAC 2M4YA 2QE3A 4KU8A 4B4QA 2GNMA 1GLHA 4KNCA 3HBZA 2E51A 2MHFA 4LR4A 4FTEA 1C28A 2DU1A 3HAGA 4LBQA 1N1VA 2A3XA 4EWDA 2HWE1 2R6QA 3TRSB 2JG9C 5FO7B 4BQ1A 4XMAA 4AEMA 1LRHA 2B5HA 3H9AA 2LCQA 1NCQA 2XJSA 1UAIA 1S0EA 2W68A 4IEQA 5K0UA 4ZU7A 5EIOC 2PHUA 3AXEA 3QH6A 3GALA 4MGZE 4QM9A 4M0NA 5GJ6A 3E6CC 3HD8B 2O5JD 4N9HA 3UKTA 1FHHA 1RJ7A 1J58A 1LB2A 1MS0A 2YXSA 5AI3A 1EPWA 5AVAA 3ZXEA 3VZMA 3KS7A 2TNFA 4I0WB 2WT2A 2H0BA 2PQQA 3U07A 2F6BA 5CFCC 4FSJA 4QQLA 1S0IA 3ZFGC 2KA3A 2D44A 1XQNA 2X5IA 4LA3A 3LA2A 1WMFA 5C8CB 4HPKA 1FATA 5MGNA 1VALA 2CNAA 4RD7A 1J59A 5JR7B 2XVGA 3SH3A 3IPVA 4QXKA 3M70A 1FHMA 3MIEA 2DVFA 4K9SA 3CEWA 5CFDC 2IC1A 4W6XA 5GLWA 4YW2A 4OHZA 1G7YA 2ZX3A 5AC92 3CU7A 3ASIA 2B46X 4PIZA 4AHYA 3KB5A 2C0ZA 3TNPB 2H0VA 3THTA 4HL0A 1SFYA 1WLCA 1IW7D 3R0RA 3TN91 1R093 1NOVA 4JRAA 1RB9A 4PIXA 1WW6A 1COV1 2G4IA 3OYWA 5H9PA 2VH9A 1GZCA 3IDBB 2QNKA 3N7LA 1AX2A 3E6DA 4GH4C 4IESA 1DQ2A 2LALA 4YYOA 4C91A 5C4WC 5J3UA 3USSA 3ZYRA 2ZGPA 5KXEA 1OA2A 3KYXA 1CGPA 2DUPA 4D3WA 1UPSA 2IFWA 1EAH3 3WCRA 3FUQA 5JWPA 4DRVA 2VMHA 1NCRA 1NA1C 3N7MA 2RDVA 1QJY1 2PELA 5KC5A 2NLRA 3AMNA 2WZR3 5HXVA 4WVMA 5HBAA 5JOWA 2RM22 3ZFEC 4BLIA 1YUDA 3CJIB 2D43A 1LCLA 1W0OA 1ZVFA 4TSVA 2ZS6B 3H1YA 2DUQA 4GQ7A 1YFYA 5CIRA 1J1TA 3I54A 2B5ID 2XGXA 2BNNA 4AF9A 4Y20B 2QDNA 4HETA 1NZCA 2AREA 1I1EA 4LE4A 4R8HA 2EVXA 4B4RA 5D8AC 5C9AA 1SMVA 4LBOA 1VB4A 1MEC3 5L7OA 1QGLA 4LBNA 3JQXA 1TME1 2EIGA 4Z92B 1DLLA 1LEDA 4COWA 5A32A 4BIOA 3WQ7A 4I30A 1CPNA 1GNZA 4Q4W3 1AL22 1D0GA 1F9KA 2ZJCA 3DPRB 4ONUA 4AR6A 1JYCA 2WNUC 4LA2A 4XOGA 1Q8VA 1TNRA 1ZREA 1Y7BA 2VGDA 2DWRA 4HFSA 4ZN1B 2E53A 2MPFA 2Z5WA 4C0BA 3NO8A 4Q4Y1 4AEDC 3BTAA 3ZFFA 4CDUB 4LO7A 2VUJA 2BVBA 1WW7A 5K8SA 1NQDA 3WX5A 1OA4A 1I5ZA 1T9QA 4QGLA 4X6RB 1YYNA 3B02A 4R52A 3O5SA 1R0GA 1ULCA 4LBQB 3RPQA 1JOJA 1OMIA 1O3QA 4CDWA 3VBRC 1IKQA 4YNIA 2BYVE 2Y38A 4XFAA 1DHKB 4Y22A 3AK0A 4YWMA 3VKOA 1NCQB 4P9JA 3O12A 4CEWA 2GAUA 4WBBA 5K0UB 4WZFA 2BBVA 3NAPC 3SISA 4BIFA 3AZYA 2A3WA 2IXKA 2Z42A 4FPOB 1UZZA 5FOBB 5L36A 5EWSA 1F5JA 4TVMA 1QOSA 3TYJA 1QJX1 1QJZA 3ZMNA 1VBE2 2DFCA 4I3PA 1BBT1 1JW6A 4LTAA 3ZYJB 1S0JA 2VMGA 1O4ZA 1JUIA 3MF6A 4IV3C 3VL9A 3OBRA 1V6KA 2X5IB 1YIPA 3ZYPA 2Q1ZB 4N90A 1ULGA 3UJOA 4HPKB 1QQP2 1IS3A 5CG8A 5JSRA 2CV6A 2EXKA 1BMV2 2P17A 4YZ5A 4L92A 3IPVB 5E1RA 3ALQA 5EINC 2ET7A 3B7MA 2JG8A 1RUG2 3WOGA 4GMP0 3PTYA 4NPRA 4YG3A 2P3KA 4JGYA 4GWMA 1LODA 3B9IA 1U5IA 4E9KA 5B2GB 3D0JA 2ZKLA 3V64A 2DTWA 1RUG1 4AG4A 3GZUC 2VG9A 2JI2A 1SQ4A 4YWLA 1AR61 2ZX2A 4XF4A 3OYWB 2CL2A 1N47A 3KYUA 2YHJA 1WGPA 4P9XA 1WLWA 5I0UA 2FMYA 3WP6A 1Q5OA 4K20A 3UL2A 3ROUA 2WZPP 4D7SA 1PO23 5JAXA 4W6WA 1Q56A 1DGWA 1R1A3 1RUH3 1NCRB 3N36A 4YVWB 2GZWA 3B00A 4WVMB 1RUJ3 5C8CC 3V0AA 4Z2WA 3AMPA 1RUF1 2VVEA 1VZHA 1LEMA 1ZZBA 1DDLA 5KHHA 2JD4A 3WWNB 4E2SA 1PNFA 1H4GA 1OKQA 4YM0A 3O7OA 3B9CA 1N1YA 4XBNA 1O5UA 2GNTA 2ZAAA 3POSA 2RJLA 2VL6A 5C9AB 2WNEA 4ZKTB 2VNOA 2ZA9A 1RUI3 4IV1A 1D4M3 4FCAA 4PLNA 2ZOEB 5L7OB 2UWAA 3NL1A 4KG0A 5H9SA 1FYUA 1RUE2 4FTSA 1AYN3 5A32B 3RMXA 3LOBA 1LKPA 3PIO1 1PM7A 1QCVA 3ZIWA 3FBYA 4Y24A 4XHBA 4BOWA 2HWF2 3B94A 1E8JA 1OA3A 1RUE1 1G9CA 4IEWA 4HLTA 4Y1XA 1RUNA 5EZWA 1VJ2A 4YW5A 3D5OA 1KRIA 4R9BA 5A3MA 1A8DA 1VBD3 1U5ZA 5A33A 2YC0A 4DINB 4FP3A 1LOFA 2NMNA 4XBLA 4HSJA 3ZFFB 4HKOA 4Y5Z0 1IZ3A 4CDQC 1LGCA 2OZJA 1J3PA 2D97A 4CYDA 2VECA 3DL3A 1PO13 1PMIA 5FDBA 1B35A 2WSVA 1OLQA 1EP0A 3CJIC 4PDWC 5CG9A 1CADA 3PHMA 1RITA 4CDWB 2C5DA 4P14A 4Q4X3 4XBQA 1QXJA 4FPFA 4KWLA 1XYNA 4Y22B 1XE7A 4CEWB 1ZNPA 5EXOA 4GALA 3QVDA 1QJU2 1BQ8A 2EAKA 3J7Y1 1AYM2 2ZCWA 4ES8A 4N43C 5I91A 1HQNA 5T3NA 1X8MA 1RB8G 2R043 1VAMA 3JD72 4N53C 3M3IA 2ZHNA 2AENA 4YZ1A 2DSXA 2Q0AA 2MEV3 5C33A 1HRI3 4IETA 2R1DA 1R091 4JQRA 3SCGA 5T52A 3WNXA 4YVSB 3FLTA 3GYDA 2A71A 3R4UA 2O8OA 1ASJ2 1UX6A 4RGGA 4K1ZA 3WVJA 3ZDSA 2GC3A 2PLV2 3GZTB 4Q4V2 3MZHA 1W2UA 4B3NA 3J4UH 1ENXA 4AR4A 1ASJ1 5I0TA 1EAH1 3FX3A 3LNLA 3DN7A 2PSMC 4XJAA 4JTOA 1R0HA 2XJUA 4Q4V1 3VDDA 1C8NA 3NV4A 1QDOA 4FQZA 2WZR1 4BE3A 3BODA 2WLQA 3B0AB 1QHDA 4K1YA 1B13A 1AJKA 3M3EA 4XF3A 4FPLA 2ZABA 4XXBB 1NCQC 4AHZA 4I02A 2XH6A 1OLRA 1HKDA 5K0UC 1SEFA 1NNQA 1NYWA 1XU2A 2AH2A 1W6MA 3K35A 1BFYA 2A7AA 1UU4A 1H4HA 3HQXA 3FMGA 1AX0A 1MEC1 4MGIE 1WLTA 5DUWA 1VBB2 4MXWA 5FO9B 1APNA 4QGMA 3KGZA 4Q4W1 1SLBA 3C2UA 3JCIA 1NXMA 3V0AB 4GKYA 1FI2A 3KD4A 1CAXA 2QJVA 3WW4A 1VBB1 1QU0A 4Q0VA 2ZACA 4LHKA 2RR12 5BY5A 2ZBJA 5JOXA 3R4SA 1LESA 5LEJA 3WV6A 2A6WA 2RS12 2V3BB 2UY8A 5AC93 1GYKA 1NLRA 4IV1B 4AHXA 4OUMA 4OULA 1WCKA 3O0XA 1RMU2 1IQAA 3RS6A 1QKQA 1Z7S2 2CR8A 3JBG2 4JC1A 3WDWA 1YXWA 1VCXA 4LHLA 4LO5B 1HV0A 3H0OA 2D6LX 3AFKA 2P34A 3SHRA 3PWFA 1S0CA 5KHGA 4JAFA 2WJSA 5A33B 2FBEA 2O8QA 5BYNA 1MS4A 1CJDA 3P2AA 1NCRC 4CP1A 3ST7A 5BNNA 1BVVA 1QDCA 2PHRA 4CEYA 4G9SB 1B35B 1FPN2 1V6JA 4QD2A 1UIKA 3WG3A 1E57A 5DZFA 2VXRA 2XLFA 4LUMA 2RM23 2ERJA 4RQPA 2M6OA 4AK3A 4P9GA 4W6YA 4TPUA 1YFUA 5JDBA 4WM7C 4AI1A 1C3HA 1V6NA 1DQ0A 4O9GA 1S0DA 3S7IA 5C9AC 1VBA2 2GC2A 1YCIA 2R062 1VIWB 2ZMKA 4PBPA 4FP2A 1BZWA 2H6CA 4OHWA 2GH2A 5GLTA 2ZGSA 3VKLA 1GSLA 1XE8A 3ZXGA 4BZ4A 2VPVA 3WUDA 3JB4C 2B45X 1DGWX 3E6BA 1AL23 3TWIA 5AFBA 2Q5TA 1A78A 4UBGA 4XW3A 2EF6A 3NKGA 1KQRA 4CRQA 4EROA 2DCTA 3ZFFC 4EV0A 1FX5A 1NE6A 3L2HA 4FT8A 3VZNA 2E7AA 1C57A 1Q3EA 3Q9OA 1R1A1 1RUH1 2EAAA 2EXIA 2GN7A 4UW3A 2ZGTA 3VDDB 3LB9A 2ZX1A 1IS5A 1RUJ1 1LKOA 4CDWC 2ZZQA 3WCSA 5DM61 2QCSB 1XRUA 1T6GC 2VMIA 4A7YA 5RXNA 4CEWC 3ILNA 3WZ1A 4Y1UA 3HWJA 3MIGA 4KG8A 4FPHA 1HRV2 4KU7A 4P9IA 4AYUA 2WL1A 1W6MB 1ZRFA 1NY72 3IKWA 4GWNA 1GQGA 1RUI1 4LHNA 2JXAA 1D4M1 2OZ6A 5JOYA 3U4XA 1HRV1 4ASLA 5GZGA 1VBE3 1CD3G 1D0HA 4RA0A 5H9RA 1AYN1 1YUZA 4MXWB 3AMHA 1R0FA 1RHI2 3FFZA 3EBRA 1Y43B 1U5YA 3MDPA 3WW2A 3ZYGA 3KZ4C 4AGGA 5A3LA 1ZZ8A 1ZRPA 1CAXB 3J8F2 1FOD2 2ET1A 2UYAA 3FJSA 3INAA 1S30A 1QQP3 4AFCA 2A6VA 1O3RA 1U0AA 5AI2A 3AMQA