4LHQB

Ricin a chain bound to camelid nanobody (vhh8)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
VQLVETGGGTVQTGGSLRLSCSASGGSFSRNAMGWFRQAPGKEREFVAAINWSASSTYYRDSVKGRFTVSRDNAKNTVYLHLNSLKLEDTAAYYCAGSSVYAEMPYADSVKATSYNYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ricin
publication title Crystal Structures of Ricin Toxin's Enzymatic Subunit (RTA) in Complex with Neutralizing and Non-Neutralizing Single-Chain Antibodies.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Hydrolase/immune system
total genus 28
structure length 128
sequence length 128
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lhqB00
3MLSH 4KTEH 3WIHL 3V6OE 5E70A 5JZ7C 3FRPG 5C0IA 3MRHA 4NQCE 3IJYB 1T1YB 4PLJC 4XCEA 3KPPA 4N5ED 1AC0A 1S7UB 3RY5A 2FEDC 4XP1L 2X4UA 2JJTA 3O6FB 2YC1A 2NLJB 4I2XA 5TF0A 4YHMH 1UG9A 3FMGL 2CLVA 4OD3L 4AEIL 1ORQB 3UDWC 1G7LB 4KK5C 2C1OA 5CZVL 3BP7A 3BKCH 1BBDL 2PO6B 3MO1A 4LLVB 1J11A 1YDPB 2JJVA 3NA4A 2A77H 3FQXB 3KYOB 4L1HA 3DYMA 4Y19D 4DW2H 2CSPA 1AFVL 2W59A 1A7RH 3SO3B 32C2B 2NY0D 1OM3H 2GK0A 4QXWA 4JFHE 2R0ZL 2VE6A 3OF6A 4MAYB 1A4KB 3TYFB 1N7ML 2ZSVA 4NQDB 5HDOA 3QH3A 1VFAA 4HS8H 1LO5A 5EOQH 3WS3A 2CXKA 3K2UH 5KSAB 3PDDA 3FOMA 4HIHA 4OGXL 3C08L 4Y4KB 1QSED 4LLUA 4AM0A 1I3GL 2QSCH 3O3BB 4OZFB 3D9AH 4QRRD 1YJDC 3AFLA 3FB5B 3Q3GB 2ZSWA 4X9HA 4HFUH 4GKZA 2BY2A 2KUTA 1JF5A 4PJBB 3VI4F 4PPTA 4LCUA 3V4PH 1QR1A 4N8VB 3WIFA 4X4XB 3BWAB 5F7EH 4JVUA 3GUTB 4TN9A 1LILA 3RIAF 5T3XL 3MFGB 1UXSA 5EUOA 3DHJA 1AKJA 3ULUC 4Y2OA 1RHHA 1OAQL 3QCTH 1YY9C 4Z7WB 3PWPA 4HQQH 1TFHA 3QO0B 1BVZA 3OXRA 4PV8A 4HWZA 3HS0A 3QG6A 4KKBC 1J0JA 2P46B 2NR6C 1ZA3A 1FZOB 2P47B 3ARVA 3TPUB 4CN1A 1F42A 3QI9C 4LQFL 4OZGE 2ZOLB 3ETBF 4JDVA 4MNGA 3WFEH 5ISZD 5J3HD 1MAJA 4Q58C 1JWSA 4Z5RA 4P9MH 5I1EL 1IM3A 4WU7A 1NPUA 3M1BB 1IM9A 4WTZG 5CJOL 1MHCB 4N9GB 4WTWA 4JKLA 5IBLC 5HHPA 1XCTB 1VADB 2Y36H 5CBAA 5D7JD 3N1GC 1UM5H 3KPMA 3CVIL 4GH7B 1D6EA 4K3EH 5T5FL 3HZKB 5K33A 1WTGT 3S5LB 4I0PD 4K8RC 4GLRI 1NGQH 3MRMB 4NO3B 2YUXA 3ALXA 4WFHD 2ZUYA 1RHFA 4UTBH 1K5NA 4KDVA 5FYLH 1U41A 2Y6SD 3EOBB 3VFNA 3ARSA 4NNXA 1UKQA 5IFJA 4WEMB 5C0RL 3BP6A 2GY7B 1T0NA 3TT1H 4O4YL 1CYGA 5EO9B 1WAAF 3JTTB 3F7VA 4AH2A 5AAWA 3RIAK 1WZMA 4OM0L 5K59E 4BZYA 2DTMH 4U1JB 3S36L 1FFPB 5FOBA 4CKVX 5I16B 1KLGB 5JPMA 5CILH 1HH6A 4NWTH 1H8SA 5IHUH 4IDLA 2W0LA 1WLHA 3MJ7B 1HDMB 1RJYB 1S7VA 3U0TB 5BQ7B 1UYWH 5FYKH 4KHTL 3CXHK 4ZD3L 2IH1B 3VRJB 3LV3A 3OSKA 4OKVB 1N4XL 4KK6D 1GZPA 2VLKA 1YMHA 3CCHA 1IBGL 4QXTA 3AREC 4Y5VB 3ZDXF 5E8EB 2OJEA 4JY5L 1ZE3C 3I75A 1MWAL 2VAJA 2GHWB 2P1YA 4XHQA 3VXRB 1DFBL 1M6OB 3U7AA 5LCVH 3AVEA 5D93B 3UTTE 5EU7E 1OCWL 4K7PX 2H26B 4G9FE 1N5AA 4M6MH 4R7NA 3QUMB 1AQKL 4G6AC 4MDIB 1JPSH 1INEH 3VFSB 2ZUSA 4PJCB 5IJVB 1LE9B 5JXAL 1OQOA 2A2QT 4WW2A 2ESVE 1PZ5B 3OB0K 4KTDL 3BZFB 3QWRD 2P45B 1A9BA 2GIYA 5B38A 4YBQC 2P42B 3HPLB 2R4RH 2H45A 4ZS6C 4EUPA 5D7SH 4G43B 4KI1A 2FR4B 5C8JA 1AIFB 3SKNB 5DEFA 1NMCB 1NC2B 2NNAA 3DNKA 4JKMA 3PQYB 4GQ9H 4WDIA 2ICEA 3PG2A 3WN5A 5JIIA 1FO0A 3VJ6B 3W81A 3JWDC 4FXLA 3T2QA 1FIGH 3P73B 1CFQA 4UILL 3DLQR 5ECJE 5EUOF 2MKLC 5HGAB 5EA0L 4YFLI 2F74B 2HT3D 1T04B 3ZTNH 2BC4A 4I3RH 5BW7A 3BPLB 2VJXA 4KRLB 4M48L 4FNLH 5AUMA 2N56A 4MQTB 4NZJA 5D2LE 1T1ZB 2PW1B 5HHMB 1P4LA 3DSNA 5DF0A 1ADQH 3IJSB 2W0FA 4YBHA 2YA2A 4JFDD 3RVWC 4NRZA 2BNRB 1F58L 1QTYT 4HIXH 1QR4A 1FNHA 3MRBB 2NXZB 3UO1L 5C0DB 3OJVC 5HYSG 1X5KA 4OSUH 2AJUL 3SDAD 5CEXB 3SKOA 3QXUA 4Q74A 4QHMB 2IAMB 1JGLH 1J0ZA 4MA3A 4RFEB 5K9OB 5C3LD 1PD6A 3AB0C 1HNFA 5SX5K 4RFOH 1JV5A 3CFCL 1G7MB 1KCSL 4FTVA 1AH1A 3O3UN 4NKOB 5FYJH 1ZHKA 4OLEA 2DLGA 5DO2C 2I5YL 4W70A 4GW1A 5CJQL 2EDNA 3P3YA 3L9RA 4XMPL 3GBML 3SDDC 4UNTA 2W07A 4ORGA 1IC4H 3K7UA 3GBLA 4NKDA 5GS1C 1CG9B 1U8QA 3UX9B 3EOAB 3LHPH 4H26A 4C55A 5E1AB 1J0KA 1KT2A 5F88B 5CZXD 5FK9A 4Z18A 4OBSA 4PJHA 2DBJA 3PABA 3RJQB 3MODH 3G5XA 5GGTA 2C4FT 4KZDH 2OTWA 3VRIA 2DIJA 4RMWA 4RDQF 3C8KA 1CFBA 1T20A 4JO2H 5T1MB 4B0MM 4HKJB 4JPIA 2HWZH 5D1ZB 3MRCB 1YN6B 4WGVB 4HIIA 2PYFA 1ZANL 5EC2A 1A47A 4S1RL 1YA5A 4Y4FD 2DWEB 1GPOH 1NGYA 1VFUA 4YJZL 1I9JL 1KXVC 3OJMB 4AQOA 2JELL 4U0RC 5IVXE 1SYVA 5KSUA 5JPNA 5KTEH 3EHBD 1F6AB 4JCMA 1KJ2B 1BIHA 4G80A 4IIQA 4YEEA 1NMBH 3U30C 1MAMH 3ZT5A 5T3XE 1YEGH 1NL0L 3MCKA 3TVMB 3VWKB 5GRYA 4F7CB 3AS3A 4DFHA 3LB6C 5I9QB 2MKWA 2R9HD 3I9GL 4NSKB 2P5WB 4QHNB 3ZKND 3O45B 4P2OA 5CSGA 2DQGH 4WW2F 1IC5L 3MGOA 4RQQA 3AXLB 1B6UA 2JB5H 1C16A 1U0QA 2CKBH 2AV1B 4CADA 2RFXB 3BISA 4PJ5B 4F58L 5CHNA 3MRRA 3QPXH 4U1HA 1HINL 3BEWB 1GCFA 4XMKH 4Z7UE 3ZKXB 1TDQA 3QIBC 2HH0L 3RGHA 3TBWB 5E2VL 1RVFL 5EOCJ 1CDBA 4XI5C 1J7VR 5D1QD 3RUGA 4WFGE 2PUQT 1TIUA 4WHTB 4PBWD 2A0LD 1BJ8A 3L7EB 4PJ8D 1JVKA 1G7JB 4RX4A 35C8H 5TDPA 3QUZD 2C7UB 4S1QL 4JPVL 4O58L 3GBNL 3GSOB 1S7WB 3OHXB 1AHWC 3OG4B 4OI7A 4ODWB 3HE7C 2XWTA 1GOGA 1IGMH 4DGYH 1OSZB 1D5MA 2HKHL 5DT1H 2FGZA 2W9DH 4MQ7B 1MEXH 2X9XA 5DGQA 2ADIB 5CEZH 4AK1A 5GGRB 5IROC 2AJVH 5KVFH 4GKNA 2E7LC 1G7IB 4ZUVA 2IALB 1AR2A 4BH8A 1OB1B 1XGUA 5GS2H 2GK2A 5F7LB 4D8PB 2FX9H 4IMLB 4K94L 3IT8D 5KVEH 2AABL 4MD4A 2GJZA 3WXVL 4NN6C 2DM3A 5L2JA 4PRDB 5DS8B 3VXUB 3IGAB 7FABH 4WY7L 1MFEL 3ZE2E 4QT5A 3VFOA 2R39A 2VDOH 4PJAB 2Y7QA 4PJEA 1BQHA 4JCLA 5J11B 4PJ9D 3FN9A 3L6FA 2YKLL 2VLRB 4HIJA 3RWFA 4F80A 5KS9B 1W0YT 5LXGH 4C56B 2F53D 4Y89A 2RHEA 4MWFA 3VFWA 4RGNC 1YMMA 1LVEA 2I9TA 1P9MA 4N1EA 3VI3F 5ILTL 1L9NA 2WBJB 1FFOB 5EFIA 4U1GB 4LU5H 4R4FH 2FZ3A 1KTDA 1UXWA 4ZUWB 1RUPH 1FN4B 3HNTL 2YMXL 5DJDA 3V5DB 1KTLB 3HFML 4FQXD 3LKSB 1SY6H 2ZJSH 4PJHF 3QYCA 3GO1L 4ODUB 1AGEB 3P77B 3TV3L 1BFVL 1JMZA 3EO9H 3MRFA 4ETYA 1PKQE 2IFFH 5DTFA 2CH8A 1WV7T 1BECA 1RZIA 2F5AH 4KY1L 5C86A 4JQIH 1MF2L 3CVHH 4ONHB 4QLRA 4P23D 2HJKB 5FKPB 5C70A 2Z8WC 4XNQB 5L7XL 3KWWA 3DX8B 5D7LE 1A7PL 5HHQB 4ZG1A 3S36X 2B4CL 3R0MA 1F3JA 1L0YA 2D0GA 3KYNA 3OGCA 4OQTL 5D7IA 3OAZH 4NBXB 1UCBH 2XACC 2NY2C 3FO0H 1BF2A 3OX8A 4YHZH 5I1LB 1EAPB 3O4OC 2X4SB 3TBSB 1U8NB 3S8WA 4V1DE 1ZLSL 4F3FA 2WQRA 1PX3A 3ISWA 2HFFB 3VD4A 1N5YL 2YPKB 1XR8B 3JTSA 4GW5A 1CGYA 4FS0A 3CFJA 1KEML 4JM4H 4P2RD 5I76A 1I1AA 1M7XA 3NMEA 4M93C 3TC9A 3BPCB 4GG8A 3EW3B 5IB5A 3HR5A 1RZJL 3QFJB 3LH2L 1UZ6E 4M4RA 1VCAA 5DZNA 4XPFL 4KVCL 2XFXA 4IRSD 4YZFE 3L3OB 4OLWL 1A14H 4GMTL 2ED9A 3BAEL 1V7ML 3ARDC 5EBWA 4FXKA 3S3SA 1I3RB 3MJ8B 3MPCA 2ERJB 4XH2B 2P4AB 3RUGF 2R1XA 4UT9L 2A1WH 1FP5A 1XF1A 5F7MC 3RVXC 1GC1C 1XGQA 4JFFD 3P2TA 4KKAC 5JW4Q 2R69L 1FNEB 3RAJH 1SBSL 1G7PB 3C09C 3GEWB 1UB5A 5MENB 2D4FA 1ZT1B 5E2TH 1EVUA 1CCZA 3QUML 4XNZC 5SWZD 1NFDE 4RA3A 3ARUA 1Z9SA 3VFUB 2RCSH 4WI5A 3GNML 1WZ1L 1KJVA 5E08H 2IQAB 4OFVA 2WP3O 4LPCA 3GKZA 5GGQL 4QRPE 25C8H 5IV2B 2WINB 1IEAA 4JPKL 3IDJA 4JJ5B 3QQ4B 3FN0H 1L0QA 3HI5L 5BS0A 4GUPB 5FM5O 4OB5H 1QKZH 4QRSA 4LSRL 3GSVA 2V5YA 1DANT 2FJFB 5F97E 3U0WH 4AG4L 3HB3D 4BZ2L 5ACZB 4MD5B 1EO8H 2LU3A 4PJEF 3O6KH 1U95A 3Q48A 4IDJL 4TQEH 5GS0L 5FXCH 2R23A 1L0XA 4XP9H 3PHQA 2WV3A 1F4YL 3TJEH 4LMQI 1WT5A 3GSNB 4HX1B 1KYOK 5CWSB 3B83A 4EVNA 5GRUH 3HZMA 3IDXH 2OJZL 2YEZB 5ICYB 2CLRA 4UQ2B 3V8OA 1AD9B 4KPHH 4OZHB 1XGTB 1DDHB 43C9B 2X4RB 1MREL 4KFZC 3HMXL 3O8XA 5GRJH 5CBEA 4CMHB 1E28A 2VSCA 5CJBA 3JVGA 4PUBL 2E27H 4Z7NE 3SE8L 2EZ0D 3R1GH 3MV9E 4XGZB 4G8GD 5HVFB 2AK1L 1A2YB 4WUKH 3O9WB 2EYRA 1R3IL 1MNUH 4JJHA 3RY6C 1VHPA 3GI8L 4C83A 4PV9B 2Z91A 4BA8A 2Z8SA 4M5ZL 5F3HB 1JHLH 4PGBB 1M71A 3GMRA 2NY3B 4TYUA 1OF2B 3QWQB 3QA3A 4LRNH 1FAKT 1W8NA 4GBXD 5D7IF 1I8LA 4XC1H 1KPRA 1AXIB 1KN4L 3SQBA 4NUJB 1EV2E 3SDDA 4NC0B 4PR5A 1F2XK 4QHUA 3L5IA 3BN3B 5I6XB 1S3KL 2VZ1A 1G9MH 1G84A 3MROB 4LSSH 1GGTA 5FUOH 1H8NA 4Y16B 4ONOA 4WUUD 3NZHL 4PREB 4MNQA 3BXNB 4U1SA 4UINH 3T2NL 2H8PB 3KLAB 5DD5H 3Q6FA 3CSBA 3IDMA 3MRQB 5TJWK 1EJOH 4WVRA 4PGCB 3VE0A 3QIWC 3KAAA 2FSEA 4NQDE 4KZEH 1B6DA 4KC3B 5ANMB 4HT1H 4I8DA 1E6OH 5J7CC 3TH2T 5KANI 5GZNC 1NCTA 2WIIA 5BZWA 5DI8B 5J1AB 1KEGH 1G0YR 3KLSA 4JFPB 3O6MH 3BKMH 5EN2A 1S9XA 3LKNA 4HXBL 2E7HA 1JNHA 1IRAY 3HTLX 4PJBE 5B3JF 4URTB 1SVZA 4X6DB 5GPRA 3VG9B 1LE5A 1CLOL 2WWMC 1RJLA 2BERA 3MLUH 1KJ2L 3IFPA 5D2NA 3QJHA 1DEEA 1CICB 2ICES 1AXSA 1F11A 3OBAA 4D0BA 5JQ6H 3WE6B 4AY0A 1ODAA 2FX7H 3PHOB 4UUJA 5IFHL 1P84J 1HCFX 4Z7WE 1INDL 4Z0XB 5C0IB 3PL6C 3MRHB 3MFFA 4J12A 2CK0H 2D7MA 4NJAH 4M7KL 3KPPB 5GRWA 3QEHA 2QV2A 3WDJA 2X4UB 5HI5D 2YC1B 4I2XB 3U9UA 1A5FH 3VGBA 4QXUL 3UTTD 1WUNT 2J5LC 2CLVB 4FQIL 1NKRA 3BW9B 3BP7B 2D7NA 3VMOA 3MO1B 4JZJC 1UZ8A 2VQ1B 3BN9C 4Z7VA 3AM8C 4OFKA 4FRWA 3EYVA 4L5FL 2YD2A 3B9KA 3B9EA 4D3CL 4NHCL 3OKNB 2GK0B 1IVLA 1T2QH 5CUSL 3G6DH 2ZSVB 5IK3A 1MFBL 2DQEL 3QH3B 1VFAB 5FUZH 1TLKA 1LO5B 5HGBB 1QHPA 3S97C 3FOMB 4HIHB 4ZPTB 1OP3K 1BBJB 3MLTB 4AM0B 4UU9A 3UTSB 3C5JA 5DMGC 1IAIM 2ZSWB 3GK8L 4WV1C 4GKZB 5HYJD 4XX1E 3TEUA 1QFWH 4LCUB 4RWYH 1QR1B 4JY6A 2ZNXA 5C09A 3WIFB 2VKXA 3DXAA 4HJJL 5E00A 3T0EB 1S9WB 3MOBL 1J10A 1P69B 5BO1H 5BOPA 5DD3L 5DR5H 1UXSB 1S5IH 1YC8A 5EUOB 3ZT6A 2WMPA 1AKJB 1AE6L 4IRJA 5HGDA 2ORBH 2XG5A 1I1YB 1JF6A 3PWPB 4L9LA 1KGCD 4U1MA 1BQSA 3ARBC 3HS0B 3QG6B 4MXVE 5MHSE 1CFVL 3UXFA 5GGRY 1E4XL 1ZA3B 3F12B 4KMLB 2YPLD 1YYLL 2B1HH 5CGMA 3GIZH 5EWIH 2FL5B 2X70A 1DVFA 4Z5RB 3OKMA 2Y72A 4WU7B 1E6JL 1IM9B 3MA9L 3QUYC 3WD5L 2DQIL 5DLML 4KROB 5IMKA 5DHVA 1SMAA 5CBAB 3SDCD 5AZ2L 3VXRE 5BRZA 2YRPA 4KV5F 5T1DH 1NKOA 1ONQA 1X5AA 4LARH 4UDTA 4F9LC 3HUJA 1J1PL 3T3ME 3HLAB 4NQSB 1BZ7A 2GTZA 3FB7A 1K5NB 2DQHL 3WFCH 4M7LH 3VFNB 4PJCE 3VXMA 3NPZB 4WTXA 5E99L 4MA7H 5C1MB 2VXUH 1XF4B 3BP6B 4GRWH 2XTLA 2FJHB 4DN3L 4H1LH 5FUCC 3AUVA 1Q9OA 1I9IL 5EIIA 3F7VB 3BP4A 4YEFA 1JUFB 1O5DT 4X6CA 4BQ8A 5FDYA 5FOBB 3ZL4H 5DURD 3LKPA 5C0BD 2I60H 4QOKA 1ZEAL 1HH6B 3PQYE 4N8VG 4OLZL 1OWRM 1PG7L 3SCMB 4M62H 5I1KL 1F90L 1DN2A 4JN1L 2FH6A 3TA3B 4R2GB 4KJWC 1CL7I 4U6VL 4DQOH 1PSKH 4OGAC 5JOPD 3REVB 1GZPB 1LK2A 1YMHB 5B22A 3O6LH 1PY4A 1RUKL 3D85B 1TZHA 3NABH 5DMKA 3HC4L 1A6TA 5HHME 3I75B 3NCMA 2ZZUT 1Y6KR 2WNGA 3V7AE 1RY7B 1OOAA 5J9PA 2Y4SA 1N8ZA 5T3XD 2DJ4A 2BNRE 2PXYC 2X1QA 4UBDD 1GH7A 2Z9TA 1JTTA 3HHRB 1B3JA 1IILE 4Z7VF 3B2VH 5FF6A 4M9OA 1MIML 3UBXB 3DMMA 1G7HB 3QNZB 4WW2B 2APFA 3FT3B 4MSWB 5F6IC 3KR3H 4G7YH 4MB4A 3RTQC 2QSVA 3TWCH 2VDLL 1NCBH 5B38B 3ZE0E 3ARFC 4NP4L 4ZO6A 5TQ2H 4FA8A 4G7VL 4EUPB 5DWUH 3O11A 3E0GA 4I13B 2B0SL 1BGXH 1K2DB 2CD0A 4XX1G 5DEFB 2NNAB 3MREB 2GSIA 3LPWA 2H2PC 3RA7L 4WDIB 2ICEB 3MBEB 4V2CB 3WN5B 3MV8D 5C0GA 3SJVB 1FO0B 4HKBA 4U1KA 3P0VL 4UQ3A 5HVGB 4XZUA 4PRHD 1RULL 4FG6C 4ERSL 1BP3B 1VPOH 4JQVA 3P9MB 4Y1AD 3C60B 2VWEC 4ODHL 4YHPA 2ZUUA 2DD8L 1F2QA 4FFZH 2OP4L 3GSUA 4PYHA 5D72H 5BVPH 2ICCA 2IG2L 3E3QC 4W6YB 2QBWA 2VL5B 3VCLB 2FNBA 4C4KO 2AK4A 2BHYA 4L3EA 4PB9L 1CDUA 4PIRF 1NEUA 3IDIB 1P4LB 1T03L 1P2CA 4OLYL 1PBYA 4XCCH 1TJGL 3GSNL 1HKLL 4YHYB 3R4DA 3PF2A 3TJHD 3HFMH 2QKIA 3MJ9H 4GG6A 4WFEE 3MR9A 4P46A 3RI5K 4U6XA 1A1MA 3IJHB 5I71B 3SKOB 1B4JH 4PD4K 3MRKA 3LEYL 2GTWA 3W0WD 2WBKA 4OCXL 3RVTD 3IFLL 3L5HA 1DLFL 1TMCB 3HUJF 4POZD 5KG9A 1GSMA 2XWBA 4FTVB 4NKIL 1DUZA 2CDGA 1ED3B 1T3FA 3DTXA 2X4TA 2O5YH 4NO0B 3DRQA 5CKGA 4U1LA 2DQDH 1YYML 5TE6H 1B9ZA 5MEPA 3FQNA 4JZOA 5D70H 4G5ZL 4HUXA 3VGAB 2FYYA 1T80A 3MCG1 4BM7A 1ZAGA 1U8QB 2OLDA 5I66B 2J4WL 4P4KD 1MCSA 4X6CF 4H26B 1LO3H 4JY4A 5E2WH 1K85A 4HXAH 1QLFA 4JHAL 5FK9B 1OW0C 4PJHB 3PABB 1Q0XL 5EG6C 2OTWB 2C3HA 3VRIB 2NXYC 2VZVA 3BD3A 1ND0A 5AG8A 2G75B 3RWIB 4CJ1A 2DQCH 4LAQL 4IMKC 5EOCH 3ZKMC 4KAQH 1T20B 5GRVK 3MXWH 4ZTPL 4NJ9H 4I4WA 3FTGA 1P4IH 2ZUQC 2PYFB 3RBSA 5HHOD 2DDQH 5EC2B 5AYQA 4ODVL 2NY4B 1G6VK 5EOTA 4L4VA 1SYVB 2DMCA 5KSUB 3HA0A 2ITDA 1Y18A 2LVCA 3FRPA 4XRCB 3B2UD 1MLBA 4Z0BL 1NAMH 1AD0A 1J8HB 2EDXA 1UADC 1OWWA 3CUPA 3RQ3A 3BP5A 1VGKA 1EFXA 1LHZA 3MSPA 1FYTD 1WCQA 1B0GB 4EJ1C 1T7WA 3A6BL 3LQAH 2YN3A 3D0LB 1CGSH 1Q94A 3G6JA 4OI9A 2PYEA 3D39D 3VXUE 3D48R 4PJAE 2WIMA 1KJ3L 3LOWA 3P30L 2A6JA 4XB8A 4CADB 4G6JH 4X0KA 1ZVHA 4MGXA 3BPOC 3BT2L 4OT1L 2VLRE 5TDNB 5CHNB 5I8OL 4RWHA 1DE4B 4JO3L 5KS9E 5DYOA 1CBVH 4LSRH 2YD3A 4C56E 1SM3H 2MHAA 2V2XB 4HPOH 3T8XA 3QIUC 3N9GH 3G6AA 4MJIA 1MCOH 2OL3H 3RUGB 3CFEB 3T08A 1IEBA 4AJ0A 3V0VA 4P5MA 2XQBH 5F1OB 5TDPB 4LVNC 4OCYH 1TVBA 3NAAH 4U3XA 5HHNA 1HXMB 5KW9H 3GSQB 3ULVF 2DS4A 3GHEL 3SKJL 4FFVC 3QWOB 1FZMA 2XWTB 4PS4L 3NIFF 3T0AA 1D5MB 1H3PL 3T0WA 4R0LA 4EKXA 4OLUH 1OAYH 1A1NA 3OZ9H 4JDTH 4ZUVB 3WSQH 5EBMB 5HYFA 2UZIH 4X4ME 1C5BL 3QEUA 2AAVA 1PYWA 4GG6F 5ICXB 4JFYB 4HULB 4XCFL 4MD4B 2GJZB 2VC2H 5I17A 1R0AL 2H3NA 4HMCA 3U4AA 5C08A 3TBYA 1BD2B 3D5OF 4Z95H 2ZPKH 2BNQB 4QT5B 3VFOB 4PJEB 4RBPK 4WTZA 2GEEA 2XNAB 4KJPD 4DUXA 5IGXL 1NCCL 1ACZA 3WNMA 3C5SA 3EOTH 3S37L 1SBBA 3RWFB 5I75C 2APBA 3BKYL 3K46A 5HYEA 3PJSA 1NGXA 4ZAKC 1FAIH 1XF2A 3V6FB 4TSAL 3WS6A 5IWLA 4PRAA 1MQ8A 2LE9A 4PJXE 3CSYB 4MWFB 3WLBB 5DQ9B 2I9TB 3I50H 1TETH 2NPLX 4FFWC 3QFJE 3ARZA 3RKPA 3QI9B 5EFIB 4XVTL 5LGHL 2FZ3B 1KTDB 1UXWB 4LPTA 1FORH 3DBXA 5A2JH 1T4KB 1U8PA 3CLEL 4K3HA 5HDLA 1QBBA 4LAJH 2NX5B 4GS7B 2D7OA 2VXQH 2CUHA 12E8L 3TIEA 4EI5D 1XR9B 5DTFB 3HI1A 5IVZB 1JFQL 1QBLL 4GRLC 1RZIB 1T7ZA 3REWB 2BX5A 1IGFH 2I24N 2W65B 3CDYA 4BSVA 4OD2A 1QP1A 2FX8L 5MENE 4BYHA 3KWWB 4WO4C 5CCKH 1CU4H 4PP1C 4NRXA 3R8BB 3T65A 4J4PA 1F3JB 3LEXA 5D7IB 3V6OA 4OJFL 4JG0L 5I18H 3TFKC 3O6FD 1CLOH 3FO1A 1MUJB 4NQCA 5KVGH 1FLRL 4JO1H 1Q38A 2OZ4H 1IAKA 1BOYA 5LWYH 1GJIA 2VDKH 4RAHA 3NCBB 1TCMA 2ZWLT 5EO1A 4AL8H 2PO6D 1ADQA 3ZO0A 1PVHA 1GHFL 4XP6L 1QFWI 4I48A 3G6JF 1P6FA 3DROA 4APQA 5IT2L 1SVCP 4KTYA 4ZUUB 2IWGA 2C3WA 2ADFL 3CFJB 1RFDL 4X4YA 1I1AB 4GG8B 5DK0A 5IB5B 5CMAA 4QHLA 3CXDH 4NQDD 4PBVC 4UT6H 1IGIH 4K2UH 4HK3N 3DUUA 5D1XC 3RIFF 1E27A 4LVOC 4Y4KD 5DMYA 1C5CL 1WJ3A 5IQ9A 4OLXH 4OBRA 3STLA 5EBWB 2AXGA 1NBQA 3KLHD 3GMMA 2VLJB 3EYFB 4OZHE 4BQBA 2XXCB 2CIKB 3EDEA 2R1XB 3VI4E 1MVUA 1IQDA 1XGQB 4Y7MA 1M7DB 2ARWA 3ARQA 4MD0A 3DUHA 3H3BC 1JK8B 2EH7H 3FN3A 4XVSH 1DLHB 4ODSL 3MRGB 3RDTC 3QHZL 1X5GA 3QXAA 4KJQD 1XAUA 1G9MC 4LSPH 4DK3A 5CINL 4HEME 4NQEB 3WO3B 2VAAA 1Z5LB 4X5WA 5IQ7L 1KJVB 3JXAA 1Q0YH 3V0WL 4HC1H 1RK0A 4E0RA 4XVUD 4PG9A 1ACYL 3ROOB 2AJ3A 3NPSC 4P48A 4KK5D 1QG3A 5SV4A 4OZGA 3GSVB 4WI7A 4KUZL 4FQ2H 2CQVA 1FFRA 4YWGH 4ZO7A 2VZ3A 1KSRA 1R5WA 2AI0L 4N5EC 4Y4HA 4A6YH 3SKMB 3OXSB 1FO0L 1V7NL 3EO1A 1JWUA 5HYSA 2R23B 1S7RA 2K1MA 3PHQB 3RIFK 5K9JH 1J05B 1UEYA 2DIAA 2EECA 4EVNB 3HZMB 5SV3A 3GSWB 4FQLH 5DHYA 5DRNA 2W91A 3QDMD 4HMEA 1RU9L 3TN0A 2YK1H 2F8XC 2CLRB 3GGWA 5CD3B 3SO5A 1JZ6A 5E8OA 1EIBA 1E4WH 4TVPL 2IGFH 3GRWL 5ANME 2ARJB 1EHLH 2NY0C 1O0VA 3MLXL 5GGSA 1BIIB 3O8XB 5I8EB 5FKAA 3U0PA 1QFUL 2J6EH 3LRHA 3RU8H 4RAUA 5J6HA 4F7MB 4LSQH 5C0CB 3PNWA 3LMJL 4X6DE 4QHKI 4K7PH 1EGJA 1R5IA 4R8WL 4C83B 3TZVA 3AB0B 3QDAA 3H3PL 1M71B 4N0CD 5IB2B 3DVFA 3GMRB 3PWJA 3BGFB 3BSZH 1Z6JT 3TCLA 3FFCD 3AGVA 2FB4H 5KN5A 3QA3B 3F62A 3KPOA 3BZEA 1KPRB 3C5ZA 3SDDB 3MLWH 1GGYA 4PR5B 4QHUB 2VSDA 5GS1B 1MLCA 3BIKA 3QSKB 2N4IA 1CXLA 2CJUH 1FH5H 3DYOA 4H8WC 3FCTA 3D2UB 3U9PL 4KMQA 5IF0A 5J3HC 5DUMH 4YDLB 1Q72L 1JGVH 3GHBL 1PEWA 4U1SB 2Y06H 3C6LD 3EYSH 5GGTL 3S35X 3Q6FB 3IDMB 5F89B 5BJTA 5DRXA 3NCEB 1PQZB 5D7JC 5I15H 3RWEA 2WZPD 2ESVA 2E9WA 4I9WE 1AO7A 1FNLA 5BZWB 2ICWI 4XAKE 1BEYL 1KACB 2DTSA 4I0PC 5EN2B 3UTSE 3MA7B 1QOKA 3UZQA 3LKNB 1QBAA 3AY4A 3HC3H 1JNHB 5E03A 2Y6SC 1DBAH 4L3CB 1RJLB 3BUYB 3BESR 3ECBA 2ZKHH 4N8CL 3T0EE 1IGTA 3T0VA 1EEYA 1CT8A 1B2WH 3QJHB 1AXTH 2AJXL 1F11B 5CGYD 5EUOE 1CK0H 2JF1A 4OFYD 1VFOA 1FCCA 2XI9A 4TUJA 3A0OA 4UUJB 3SE4A 3I6KA 3PWPE 3KJ6H 2CKNA 3BQUA 4WI6A 5I19H 3MMEA 4GRMA 5KSBB 5BV7H 1SY6A 4XBPA 3U9UB 3B3IB 1KIRA 3GMLA 2YD6A 1FVEA 4ISVA 3PDOB 3RZCD 1DQQB 4NUGH 1XGYL 5TE7H 3LQZB 3L5WA 3QRGL 2P48B 3CVHA 1RZKC 3QIBB 4OZGF 2D7QA 2HJFA 5E9DB 1A7QL 3BWUC 1RQ5A 2O5XH 2YRLA 3QIUA 4KK6C 4U7KA 2OYPA 1E4JA 1WFOA 5EB9A 2DYPB 2IAMD 5J8OA 3OQ3B 4HH8A 3OV6A 1LDSA 1UKSA 1FDLL 1TZGH 5JOEA 3HNVH 2LU7A 5IK3B 1MFCH 3CK0L 2BSED 1NCNA 4KQ4H 4L8DA 3PP4L 1G6RH 1DQML 1KCUL 3QQ3B 2Y9RT 1Z3GH 2D0FA 2IF7A 2LTQC 5DJCA 3RGVD 2V2WA 3WL9B 4UU9B 5IW1A 3WFBH 1ZT4A 3C5JB 5E6YA 1KCVH 2NY6B 4D94A 1T89A 3I02A 5T33L 1AY1H 4JY6B 4K3JL 4ONGL 5C09B 3AU1B 4U1NA 5E00B 2VRAA 1MHEA 2CDEB 5GRXG 3O2DH 2O5ZH 5IR1A 3NBNA 4KKLD 1T0MA 4NFDA 4UV7L 4L8CA 5ENWA 1YJDL 4NN6B 4U1MB 5I74C 2JJUA 4DCQB 3D0VA 3IFNH 3SDYL 1DEDA 2C1PA 4YPGA 5D1ZD 4BFEA 3WJLC 1MVFA 4OCNC 1X5ZA 3MRDA 1DVFB 2VQTA 2YXMA 3OKMB 2W0KA 3S98A 4J3SA 3FB8A 2H32H 2HT3C 2BFVH 5E6IA 4RGNB 5DHVB 1AQDA 2D31A 1QLEH 2EH8L 4JAMA 3BGAA 1CLZH 2VDQH 5BRZB 4JFZH 1VESA 2HRPH 2HLFD 2QHRH 1JMXA 4B41A 4UDTB 3NFSL 1ORSB 1UM6L 3TVMD 3VWKD 5SWQB 1E4KC 2OQJA 4X7EC 3VWJA 2P5WD 3FB7B 5ICZA 4R90L 3F7PC 4G8FA 3WO4C 1IFHL 4R26H 5I1CL 4NT6A 4P2YA 5DJZA 3MNZA 2BVUA 5J12C 3SDAC 5DD1L 3VXNA 1M4KA 1KBGH 4PJ5D 3BH9A 5EIIB 5C0ND 2E8ZA 2IQ9L 3BP4B 4BK5A 2ZCKL 2VITB 4OZ4B 4YQXH 1EEZA 2IBZY 5I1JH 5FGBC 2V17L 3LKPB 1NSNH 4D9QE 4Z7UA 3C6SB 1GYAA 3OAUH 3BZ4B 3SJVE 3C2AH 1MCFA 3O4OB 3QEQB 4P5TA 5HHXL 1FFQA 1WSST 4OIBA 2OM5A 1T83C 1I7UB 3MOAL 1FG2A 3U7YH 5E8DL 1AR1D 5MP6L 2GUOA 1G9NH 1LK2B 1U93A 2X4PA 1QUNA 5ID0A 3OKLB 5CZXC 4JGMA 5T1LA 1TZHB 3RWGA 4XPBL 1A6TB 4TVPE 2R2HB 1IKNA 4R7DB 2EDHA 1H3UA 1GXEA 1A6PA 1GOHA 1MCBA 3EO0B 1N8ZB 3F7RA 1JGUH 1UFUA 3WNNA 2ZOKB 3ARDB 2KQNA 4EOWL 5AD0A 3VFVB 4BSWA 2VO5A 4N9OB 3F7YB 5DJAA 5FF6B 5BOZG 4Y4FC 3V95A 1FSKC 3X14A 2CRYA 3EYUH 4HW6A 4M1DH 2X42A 1QSFD 4ONFL 5GHWL 3EHBC 4EI6A 4JRWA 1NC4A 1T2JA 3C09B 3O3EB 4XVJL 1P7KA 4O9HH 1KULA 2BOBA 4OM1L 3CFDA 4F2MA 1TJHL 2OTPA 3O2VH 3PGCB 3ARGA 4XNZB 5IKCB 1NGZB 1VACB 2WAHA 3DURA 4PRNA 5LGKA 4RA0C 3ZKNC 1MY7A 3PWNA 3TCXA 1K8DA 4I0CC 1OT2A 3WNKA 4UQ3B 1IAIH 2FLBT 1J0IA 1EXUA 3EGSA 5GJTL 1XCQB 3GKWH 4YHPB 4PJHE 2CO7B 3VDAA 4PRBA 1K6QH 3N85L 3TO2B 3GSUB 3EDDA 1QFOA 2NTFA 4H25A 3LQAC 1RUMH 2AK4B 4L3EB 4S2SB 3VFTA 5D1QC 4G6KH 3TBTA 3VW3L 3JWDL 1F8TL 4K9EL 2A0LC 3LKQB 5C0JA 1P2CB 4XTRD 1PKQA 2F8OA 4PJ8C 3V4VH 3IAGC 1F4WH 1WQVT 4QXGL 3QUZC 5DQJA 1RIVH 4JRYB 3ZDYE 1BVLA 1YEEH 5A16A 4Y2DA 2QKIB 4GG6B 3MR9B 3SE3C 4Q9RH 4QEGA 4U6XB 1A1MB 5D7LA 3WNLA 3MRKB 4OD1L 4F37K 4M5YL 1MRFL 2ID5A 1EH9A 2KZ1B 1J8HE 43CAB 1FV1A 1U6AH 4ZOAA 2XWBB 4HAGA 1DUZB 2CDGB 2EE6A 1T3FB 3DTXB 4MJ4A 2MSPA 5JW3L 4RGMC 3AS2A 3UBXG 1T1WA 3DRQB 1SJVA 4HKZA 1U92A 4V1DA 5JXEA 1D5BB 4EDWL 5E8PA 4OJFH 4OLVH 4LCIH 2IPTL 3FQNB 3FQTB 4JZOB 2YUVA 2FBJH 4QTIH 4HUXB 2FYYB 2Q6WA 2VDRL 1A0QH 3B9DA 1KC5H 4OCSH 3V5HA 1UKTA 4PJ9C 2IAND 3CH8A 3DO7A 5E5UB 1BAFH 4Z7UF 3K4AA 3V4UL 5F7WC 1CZ8H 1ND0B 3N50A 1JF1A 1H3GA 4JVPA 5ERWA 1LEGB 5E5MB 3VD3A 5IJKC 4DKFL 4JRXB 4BSJA 4I4WB 4TSBL 4YBLB 5MEND 3WIIL 5JW4R 3FTGB 4HFWA 1HWGB 2DICA 2EDWA 1OTUD 1UH2A 2VOTA 5ISZA 2VR4A 2X40A 1HEZA 4LCWD 4G6ML 4FQXC 2Q86A 2ITDB 4LCCA 4X6EB 1Y18B 1NFDA 5I2IB 2UUDH 1KENH 1IGCL 3DRTB 2E3VA 3N0PB 1BOGA 4OCWL 1MLBB 4LLAA 2R29L 5AEAA 1XZ0A 3CUPB 2W60B 3GSXB 1UWEL 1MJ8H 4P23C 4QRPA 3MLYL 1MPAL 4BUHA 3P0GB 2X4NA 3DVNA 4X8JA 4MX7A 3LAFA 3LN4A 4K55A 2PYEB 2X7LA 4X9GA 1BD2E 1MOEA 2BNQE 1N0XH 4PJEE 1P53A 4RSVA 2DLFL 3UPCA 1EHAA 3OKDA 4M6NL 2A6JB 2V9RA 2VZUA 1XIWA 3QZWG 4LF3B 5BMFL 4TOYL 3ES6A 3QO1A 4MJ5A 4XBEL 5JW4N 5DYOB 4P57A 1YQVL 2MHAB 1FGVL 1IC7L 3TPKA 5F9OL 3T8XB 2Z31A 4UAOC 4MJIB 3LPFA 1NBVH 4EEEA 3DX6A 1IEBB 1KNOA 2DBLH 4P5MB 5J56B 4P2QB 5ADPL 1A7OL 3H42H 2CRZA 3HC0A 5HHNB 3ZMRA 4IRSC 1NDGB 3VFPA 2Z93A 5DVNA 2DWDA 1FZMB 4LSVL 2NX5E 4L9DA 5IG7A 2Z8RA 1TITA 3BHBB 3ARXA 2XZQL 1JNNH 1GAFL 4N68A 4K7FB 4NC1C 3MV9A 3TP4A 4J3XA 4NRYA 3GRWH 3ZHKA 4EQ3A 1MRCL 1OPGH 5FHBH 1P4BL 4HCRL 4L4TB 4J3OC 2NY3D 1KN2H 3FO9A 3QEUB 1TQCB 1RAMA 4K23H 1FPTH 2W9EL 4OCRH 5D7IE 4LSUH 4R6UA 3TBYB 5DJXA 2V6HA 2K7QA 3IJYA 1S7QB 1F97A 3B5GA 5HYIA 1S7UA 1TVHB 1BZQK 5D7KE 5DQDL 4YO0A 2Z0BA 4KK8D 4UT7H 4Y16D 5FFLA 2HP4A 3RVUD 4UV4H 3HE6D 3ZTJH 1XF2B 4M7ZB 4PRAB 4LLVA 3ARBB 3CXHJ 3IDUA 3HB3C 4OTXH 3HI6H 2AGJL 5ESAB 2LU4A 1ZWIA 4DKAA 3MLZL 2IBGA 5DVOA 5GRVL 4MAYA 4PLOB 4YDKL 3ABZA 1UZ6F 5F7FA 1PLGH 1U8PB 2DKUA 3DO3A 1QRND 2N1KA 5KSAA 4D9LH 4JKWA 2VLJE 4XXCC 1N3NA 3U36A 4DTGH 2AJYH 2WP3T 3L95A 2OX5A 3P0YL 2UV3A 5I30H 4WEBL 2DRUA 2PTUA 4NWUL 4BSVB 4ALAL 4HG4K 4N8VA 5C2BL 5SWSA 4X4XA 3BWAA 1FE8H 4JFOA 4JFDA 3MTRA 4J3VA 3GUTA 5BXFA 1RJCA 2XZCL 5C2UB 4MQXD 4NQEE 5JO5B 4UTAH 2EZ0C 1UJTA 4Z77B 4Z7WA 4Z8FL 1DSFH 1F4XH 1BQLL 5I8KL 5FCUL 1NFDF 3PHSA 3FO1B 1G7QB 5KOVC 3UC0H 4XCYA 2CR3A 1IAKB 4RZCB 4NZUH 4DGIH 1FZOA 1YZZA 1OHQA 5EO1B 4OZFH 1JGDB 2VDNL 4G42B 2ZOLA 4I48B 5FV1L 5ALBL 4MNHA 3DROB 1R3HB 3SGDI 3PGFL 3M1BA 1CTOA 4GBXC 5J6GB 4HIEB 3MJ9A 3Q1SL 5DK0B 1XCTA 3CU1A 1VADA 3OF6D 5CMAB 1A6UL 1ZGLB 4WJ5A 3U7WL 1CE1L 4I9WD 3OR6A 1I9RL 3HZKA 3HNSH 3V52L 4P3DA 4Q9BA 4XAKD 1NCWL 3VDCA 4DGVL 3VGDA 5IQ9B 1Z9OA 1MRDL 2AXGB 4LP4A 3GMMB 4J6RL 3MRMA 4NO3A 5I8CB 4QO1A 3VGGA 4LASH 3LS4L 1IQDB 1NFIB 1RUQL 1IGYA 1B0WA 2HLAA 4OQTA 4MD0B 4ZFGH 3MXVL 3C9NB 4WCYL 2BOCA 3KPQB 2PXYB 1T5XA 1AKJD 4YFDB 3RL2A 2R2EB 3IU4H 5IFAH 5TF1H 1X5JA 1KOAA 3QXAB 4M1GL 5C0CE 1RI8A 4U1JA 5DJYA 1FFPA 3X11A 2VAAB 4X5WB 4AYFA 1RIHL 5F6IB 5H2BA 1GC1L 2KBGA 1KLGA 5EU6B 2Q1EA 4HK3J 3RTQB 5CFHA 2DQJH 4HWEL 3QJFA 1KPVA 1YEJL 3SE9L 4PG9B 2XZZA 5KOMC 4P9HH 2AJ3B 3MJ7A 3EIFA 3JSSA 3U0TA 1IM9D 2DKSA 3RWHA 1R24B 4KROD 4OKVA 2XXMB 3DIFB 3CFKA 4KV5E 1R5WB 4Y4HB 1NLBL 1JWUB 5HI5C 5TDOA 4EQ2A 2VXTL 1M6OA 4Z7QE 5EBLB 2YZ1A 4DAGL 5EU7C 3ULUH 4YHKH 1NAMA 4BFBD 5DHYB 5DRNB 1JHTA 3CPLB 3TN0B 4MB3A 3SOBL 2EC9U 4PGJA 3GGWB 2DQFB 5DMGD 4WHYG 3UYRH 3QUMA 4F9PC 5E8OB 4QTHB 3DX9A 2WBWB 5IJVA 4POYA 3M07A 2H2SD 3QDGB 5GJSH 2OK0L 1YPZB 5GGSB 5BV7C 4X5XB 5KAQG 3U0PB 2CKBB 1KFAL 3BMVA 3LD8B 3EUUA 4RAUB 3O0RH 3MLSL 5CP3H 2CLZA 4KTEL 3EOYG 4W4OA 3PNWB 5EORH 2FR4A 2OMBA 2WUBH 1AIFA 4B7LA 4I1NB 4M3JA 1NC2A 5A2LH 3CNKA 3TZVB 4CDGC 3EZJB 3PQYA 2OL3A 5HBBA 4YR6B 2O26U 3ARYA 4K8RH 4K3GA 2AJSH 4YHML 3B4NA 5EULV 2VLKD 2DM7A 1ZGLP 3TCLB 5HGAA 3T04D 4ZYKA 5KN5B 1RUAH 3BKCL 3BZEB 1AI1H 4PJFB 5E2UH 4Z7WF 5KSBE 1WISA 4AEFA 2EDQA 2K3TA 5JR1H 2A77L 4DW2L 2EEAA 4YUEH 2VLLA 1A7RL 2PW1A 3BIKB 1J1OH 4FABH 4PJ9A 1OM3L 3I3EA 1H0DA 4KWUA 1OLLA 5E9DE 3QQNA 4RISH 4HS8L 5EOQL 2BNRA 3K2UL 2EE2A 3MGTB 3MRBA 2QSCL 1GZQA 3D9AL 3SDCC 2DM2A 4YXHH 4HFUL 3RWEB 1MQKH 3TO4A 5F8QC 4PGDA 3V4PL 5K9OA 5C9KA 1AO7B 5F7EL 1GIGH 5IB3B 4U7MA 1G7MA 2ADGA 4GKOA 3KHOA 4M43H 2P44B 3BE1L 4MAUH 4FQXA 5ACMA 3QCTL 3KPRA 4HQQL 2FJGB 2XA8H 1J0YA 3O2WH 1W0WA 5C09E 4JKPL 3U79A 1IGTB 1EEYB 1CT8B 3PE9A 4CGTA 5A43C 5K9QI 1OP9A 1CDCA 4YK4C 3BD4A 4TUJB 4TTGA 4QRTB 1W72H 1CG9A 3I6KB 3WFEL 4GQPH 1LO0H 3BQUB 5CJ8A 4P9ML 5E1AA 4BQCA 3MMEB 4GRMB 3RWJB 2DLHA 1GGCL 3OAYH 4XBPB 1WTLA 1YY8A 2Y36L 1KIRB 3BPOB 1NEZB 5EZLA 1HYSD 4K3EL 1PJ9A 1CD1B 3QHFH 5GJTH 3L5WB 5T1MA 4HKJA 3CVHB 5J1SC 1YN6A 2HJFB 4U1IB 4HWNA 3C8HA 4RGNE 1NGQL 3QIUB 3H7BB 4UTBL 5FYLL 5BRZE 5L0QB 2YSSB 4HUNB 1EEQA 4HWUA 3NIGF 2XKNB 5L2KA 5LJYH 4S10A 5TPWH 2ZUVA 3TT1L 1YEKH 2G9HB 4FTVD 3KYKH 2OZ4A 1TTFA 1OAZH 4UBDC 2V2WB 4FFYH 4GAGH 5IW1B 1ZLWH 1AJ7H 1ZT4B 2BRRH 4MMZC 2R0WH 2DTML 2ENYA 1KB5H 3GI9H 3O45A 2E7MA 3I02B 5EDXA 1H9VA 4O51A 1X6LA 5CILL 4U1NB 4NWTL 4JFFA 3AXLA 2EIZA 5I1AA 3ZYJA 1MHEB 1T6VN 4KI5F 5IHUL 1VSCA 4M00A 2AV1A 4PJDA 1UYWL 5FYKL 5ALCH 4OUUA 1F13A 4NNPH 3F58H 4MLSA 5T1KA 3KPSB 1YEHH 5GS3A 5JHLH 3DETD 3OKEA 1CIUA 3QEQE 1J1XH 4NO5A 1UVQA 4YPGB 3MUHL 3MGAA 2BRQA 4WHTA 5D9SA 3L7EA 1G7JA 3MRDB 4E41B 5LCVL 5CJXA 3EZ8A 3FB8B 3UAJD 3OHXA 1S7WA 2BJMH 2NY4D 4M6ML 4ZAKB 1AQDB 2D31B 3LN5B 5DD6A 5HVHC 3UPAA 1FGNH 1INEL 3ROLB 1ZLVH 2BSSB 1HIMH 4DKFH 2C4XA 2ADIA 5INDB 3UTPE 2UZXB 4LPWA 2OQJB 2DLEA 4HC1A 5IHLB 2IALA 2CDFA 2HYMA 1ZKAA 4G8FB 2EYTB 1OSPH 2YPVH 3QUXA 4P2OD 5DRWB 3TJHC 3IKCB 4IMLA 2JB6A 2R4RL 4NT6B 5D7SL 1P7QD 3H9YA 4RMQA 4C57C 2JJWA 3VXNB 5CAYB 3MX0A 4NZRH 4LLMA 4PRDA 5DS8A 3VXUA 3HCVA 3IGAA 4GAJH 4ZOEA 4GQ9L 3DI2B 1T21B 3BH9B 5J1TC 4PJAA 1T5WA 3DPBA 4GKSB 2Y23A 3RVTC 4DVBA 2E9BA 4WO4B 1RIUH 2NQCA 4POZC 1EEZB 1MFDH 2VLRA 3ZE0F 5H35B 4QNPE 4C4KT 4LVEA 5KS9A 3ZTNL 2HG5B 3FT4A 1MJ7H 1KIPA 1QA9B 4I3RL 4C56A 3P4NA 4RX4D 4FNLL 2DLIA 2OR9H 4XNYH 4IOFD 4F57H 1K3ZA 5DFTA 4YX2H 2WBJA 4FQQA 1FFOA 4LHUB 1FG2B 1ADQL 1BF8A 1MFAH 2VLMD 4P4KC 2GUOB 1WBXA 1XT5A 1U93B 1MHPH 3NIFE 1A6AA 5ID0B 4ZUWA 2YA0A 1FN4A 4HIXL 4Y5YC 4JM2A 5T1LB 3RWGB 3QISA 2AK4E 5CEYB 4L3EE 3LKSA 1AGEA 2X89D 3P77A 1KYOJ 5IVOA 5JW4M 1X5FA 1B88A 1JGLL 4I3GA 5D4QA 1IGJA 4JRYE 2FATH 5F96L 3F7QA 4I77H 5LQBH 4GG6E 4KDTC 1WVZA 5FKPA 5BZDA 3G9AB 4BSWB 5DJAB 4XNQA 2B20A 3S34H 3GMPB 5T3ZH 3DX8A 3X14B 3U4BH 5FYJL 4D0CA 1OLZA 3I6LD 1J8KA 3HAEH 4BQ9A 1NC4B 1A3QA 5I1LA 4N0FA 3B2UC 1EAPA 1P7KB 2BOBB 2E8YA 2YN5A 3NVQA 1IC4L 4F2MB 3TBSA 1U8NA 3RDTB 3ARGB 4NOBA 1ES0B 4CN6A 3V5KB 2VYRE 2GAZB 1D9KA 2GJ6B 1YMMD 3LHPL 4PY8I 3O4LA 3DURB 1NUDA 4PRNB 2ADJA 2FDBP 1K8DB 3RPIA 2YPKA 3PP3H 3MODL 4PJXA 4U7SA 4KZDL 3VU2A 3IFOB 4OGYH 2LABA 3WYRA 3EGSB 3QFJA 4PJDF 4IOSD 4JO2L 3VH8B 3L3OA 2HWZL 5L9DH 2HVKB 5DD0H 2FIKA 4LDOB 4PRBB 1Q1JH 5F1IB 3K8KA 3NGBB 1GPOL 1HOCA 1U3HD 2ZP0T 4JRXE 1H15B 5KTEL 2YD4A 3L7FB 1I3VA 2NTSP 1RZ7H 5DQJB 1NMBL 3RFZC 5GRZA 1MAML 4PJ7A 1G7PA 4Y2DB 1YEGL 1ZT1A 1A6ZA 2PR4H 4WU5B 2EICA 4WI4A 3RBGA 1KTKE 1ZA6A 1R3KB 5KJRH 2DQGL 2NY0B 4IM8A 4O02L 3ME0A 4NKQB 5A3ID 5D7KD 5C2BH 5DEZA 4HD9A 2JB5L 2CKBL 2WINA 1NAKH 4JJ5A 3QQ4A 3E6FB 4HJGB 1T1WB 2A9MH 4GUPA 4HKZB 1U92B 1CF8H 3QPXL 2PYEE 2DB8A 4XMKL 5KBNC 1I1AD 2A6IB 5HVWA 2FJFA 3UTZB 1I1CA 5GGSY 3CDCA 5JNYA 2Q6WB 4PJAF 1UENA 2VKWA 3BUTA 3HPJA 4M7JH 3V5HB 5GIRB 2H6PA 4LKXA 4ZFZB 4IJ3C 35C8L 1D5IH 1BM3H 1MCEA 1T66D 1G6RA 3GSNA 3E8UH 5KS9F 3ILQD 5FYLE 4MZ2A 1D6VH 4MJIE 3MJGX 4IOIA 1IGML 4DGYL 2YEZA 5DT1L 2J1KA 1JF1B 2QSQA 3K8LA 5ICYA 5ERWB 2W9DL 4HK0A 4P2QE 1MEXL 4OZHA 1DDHA 1OAXH 3WFHA 5CEZL 4M3KB 2H9GA 2UZYB 1HSAB 4KVNH 2AJVL 5KVFL 3ZLQC 5ISZB 3N06B 1U8JB 4L4JA 1HEZB 4J7RA 4JM2F 2FX9L 2Q86B 2A74A 4XGZA 3EFFA 5KVEL 4U05A 1GGBH 5CIPH 4LMQE 2ATPA 1CL7L 4RMSA 2D0HA 3MLRH 4EI5C 5C71A 2X09A 1BOGB 4L4TE 7FABL 4QCIA 4NZTH 1JYVA 1XZ0B 3RHWF 5BS0D 2VDOL 2XRAH 3VXPB 4Q6YA 5FYKE 5FIEA 4I0PB 3C2SA 5F3HA 3FONB 2X4NB 3DVNB 4PGBA 4MX7B 1DBJH 1O7SA 3EFDH 4NBZB 1HH9A 3GB7A 5LXGL 2R0LH 2XTJD 4XT1C 3OKDB 3O6FC 2C4FU 2EE9A 1R3LA 3T2OA 4NUJA 5HI3C 4MA8L 4HGWB 3KHQA 3ES6B 3QO1B 1S7SB 4MJ5B 2COQA 5E95B 4LU5L 4P57B 4NM4H 3LPGA 4R4FL 2PO6C 1ULVA 4MQSB 1BZ9B 3MROA 1TZIB 3IDYC 1RUPL 5C0BA 3EYOA 3BXNA 3WFDH 1SY6L 2ZJSL 2H8PA 3EJYD 3DX6B 3KLAA 3MRLA 4PJXF 1KNOB 4CJ0A 3EO9L 4UMGA 1CWVA 1G9EA 3O8XD 4PGCA 2IFFL 4GRWB 5EU3B 3HC0B 4H1LB 5ANMA 3VFPB 2F5AL 2Z93B 4JQIL 3CVHL 2DWDB 4FQCH 2MQ0A 4Y4KC 1AC6A 5DI8A 5FA3A 5IG7B 3ARRA 5J1AA 4M6AA 1T7XA 3KLHC 2HKFH 1KCRH 4RMVA 2MMXA 1KG0A 3BDBA 2EIEA 4NRYB 4AEHH 1ZK9A 1QSVA 1UCBL 4X6DA 3RHWK 3FO0L 1U91A 4YHZL 1F5WA 3ILPA 1J12A 3S35H 2LTQB 4PJ7F 3FO9B 1CICA 1YEIH 3WE6A 3JV6A 3PHOA 3SGEI 2E6QA 2X4OB 4KJQC 4Z0XA 4EZMA 5HHVH 3TH3T 4YIQB 5DJXB 1P84K 5FUCE 2VTFA 5IMLA 4JM4L 3S96B 5FHAH 3UTQB 4YO0B 2AEPH 4WIQA 4XVUC 3QFDB 5AYUH 5K9KB 4KGJA 3BW9A 4MNQD 3CMGA 1A14L 2LVEA 4EN3A 2B8OT 3M8OH 2VQ1A 2P7TB 3K80A 1UJ3A 4JO4H 1CLCA 1ZWIB 2PCPA 2A1WL 3OKNA 3UYOD 2I9LA 3NACH 4PRHA 1PG7W 3RAJL 4E5XA 5HGBA 5LBSH 5EU4A 3JUZA 4P9HC 5E2TL 1N3NB 4ZPTA 4G9DA 1BBJA 3H6JA 3MLTA 5FYJE 3U36B 3VFMB 1ZLUH 3UTSA 3QBTB 4X7SH 5I1IH 2W0PA 3L95B 4ELKA 2DQUH 2RCSL 4OZHF 1HHIB 1KXQE 2A38A 5E08L 1R5VB 2Z92B 1OQXA 3PDGA 5SWSB 2CGRH 1KLUA 1A22B 25C8L 4JFOB 4JFDB 3T0EA 2PETA 1L6XA 1S9WA 1V5JA 5BXFB 4XC3H 3U1SH 3FN0L 3HG1A 3OJDB 3BE1H 2NZIA 1F3DJ 4OFIA 1I1YA 3BEVB 1QKZL 4OB5L 5J12B 5EU6E 1QBMH 4U6TA 2WM0A 3U0WL 4JKPH 4XCYB 5SX5H 1EO8L 1MY5A 5J13C 3QDHA 4YXLH 3EBAA 3F12A 5DRZA 3EYQD 3LY6A 1I9EA 3O6KL 4TQEL 4XAWH 3ZHLA 2VR5A 4XP9L 4N0CC 2FL5A 3TJEL 4MNHB 3KXFA 5DK2B 1YECH 2YBRB 5GRUL 1NH6A 3B9KD 3EDFA 4JQXA 3IDXL 4Y5VC 4MDJA 1GGCH 5CSZB 4BFIB 4KPHL 4WJ5B 5D93C 3OR6B 4LDLB 1K8IA 2Z4QA 3BGMB 3NH7H 4P3DB 3KVQA 5GRJL 1MHHB 2XY1A 3MNWA 1K4DA 3E3QE 3HLAA 4NQSA 2NY6D 2E27L 1DQTA 3C6LC 3R1GL 5FGRA 4ETQA 3L3IA 5L6YH 2HLAB 1IGYB 4LLWB 3QDGE 4OF0A 5C09D 1KF9B 3DXAD 1BQUA 4WUKL 1YPZE 2B2XH 1MNUL 3T1WA 1XF4A 2OSLB 2BOCB 2FJHA 1T5XB 4PG2C 3RL2B 4IRJD 3PWUB 1KXTB 3J8F7 8FABB 1JHLL 4Y4FB 3MRPA 1JUFA 1AGCA 5DJYB 3TLRA 4ZXBA 3X11B 3SGJA 4JLRA 1NMCC 1EMTH 4PTTA 2WLZA 2P5EA 5H2BB 4LRNL 1UH4A 4ZUSB 5AAMA 1PEZA 4I18C 5D5MB 4XC1L 5J57B 4X6DF 3SCMA 5IHBA 4OUOA 3QJFB 1KPVB 2DLTA 4HGKC 1DVFD 3D6GA 1A6VH 3TA3A 3WXWH 5CGYC 1Y6NR 4DUVA 4DKDC 3RWHB 1G9ML 3NCYP 3U2SA 4PJFE 2VABA 4LSSL 1LD9A 5FUOL 5IOPB 3REVA 5KANG 1TXKA 5BRZD 3CFKB 4UINL 1I1FA 4EXPX 3D85A 5DD5L 2EDLA 1EJOL 5C0EA 5TDOB 4ELME 5CEZE 4HH9B 2A6KA 3MRNA 1RZFH 4KZEL 3P9WB 3K2MC 3RZCC 4HT1L 1E6OL 1NAMB 3VXMD 1MJUH 1JHTB 1EK3A 1N59A 1KEGL 3MOQA 3QEGH 4GSDH 3O6ML 3BKML 4JG1H 2ED8A 3DX9B 4LL9A 5D1QB 1IQWH 2IAMC 1TNMA 3UBXA 1G7HA 3QNZA 1BLNB 3FT3A 4MSWA 2MCG1 3UJJH 1AO7E 4ZS7H 3MLUL 4JR9H 3B8YA 4NQXA 1CGWA 5MI0B 4LFHD 1KV3A 2ZCHH 5JQ6L 1A3LH 4QOKD 4YGVB 3QQ9D 2FX7L 3RGVC 1DJSA 2CLZB 1GRWA 1I85A 2AVGA 4U6YB 1C7SA 2CK0L 1DANU 1K2DA 5JA8B 4NJAL 3MREA 2F58H 2OL3B 5HXMA 3MBEA 5IMOB 4PJGA 1A5FL 3SJVA 4YDJB 4ZNCD 2VXSH 3V0AC 4RGMB 3MYZA 3QUKB 1VA9A 4KKLC 4ZYKB 4RAVA 3D18B 3P9MA 3C60A 4ZUTA 5TFSH 3B8SA 4BUGA 4AIXA 3QNXB 5IB4B 3PV6A 2VL5A 3ARWA 3VCLA 3EJZD 5A1AA 5DFVD 5DSCB 4P3WA 2MQCA 4QHKJ 2VLLB 3IDIA 3GRWA 2FLRT 4PJ9B 5D1ZC 1T2QL 2HRLA 3CDGB 1DQDH 3G6DL 1H0DB 1UB6A 1NLDH 5FUZL 4Y5XA 4IRZH 3MLVH 3X17A 2IBBA 3GJEA 3DMMD 2D03H 3FAXA 3FQUA 4TUOA 5EZIH 4N90D 5IVNA 1GZQB 1HQRA 3IJHA 1JZ2A 1D7FA 3TO4B 2HLFC 4PGDB 1QFWL 5F44A 4RWYL 4H8WL 4OV6F 5F96H 4LBEA 1JI1A 1K4CA 1SJHB 3TVMC 3VWKC 1H5BC 3CDFA 2ADGB 3QZWA 5BO1L 2AV7A 3CLFH 5DR5L 1S5IL 4TNVK 1ED3A 2VZSA 4F15C 4FQXB 4NO0A 2KL6A 2ORBL 3KPRB 4NCDA 1G1YA 1M7IA 5IB1A 1MI5E 1W0WB 4YHLH 3R06B 1UCTA 4Q6IA 3BPNB 4H88H 3ULVD 2AW2A 3E2HB 3L3DB 5C0NC 2EDDA 1CFNA 2B1HL 1KTRL 2QQKH 3GIZL 3SBWA 1YUHA 4J2XA 5I66A 5EWIL 2UWEA 3ZKXC 1FL6A 4S1DD 3IS1X 3KPSE 1WEJH 2ICWJ 4PJIB 2AK4D 1FL3A 3K8MA 1KCKA 2Q76B 2V7NA 1YY8B 4LRIA 2G75A 5FGSA 3RWIA 3NIDE 5EZLB 4NCC2 4RMRA 3TT3H 4E41E 4OZIA 5T1DL 4WI9A 5CZKA 4LARL 1YC7A 5ACLA 3I6GB 4LQ1A 4P46D 4TRPH 1AR1C 4UAOB 3L3JA 3WFCL 4PB0H 4M7LL 1IKFH 4P2RB 3SGKC 1JN6A 4EBQH 5L2KB 5DHXB 4MA7L 1CLYH 2VXUL 2GCYA 1WFTA 3T2PA 3VFRA 4XRCA 3INUH 4IRSB 1J8HA 3UYPA 2E7CA 1K9TA 5IBUG 4P59H 1EBPA 3MLPA 1B0GA 1FIEA 2F54E 4JGUA 4J3TA 3D0LA 1PY9A 2A9NH 3ZL4L 1UA6H 2I60L 2OBGA 3NCJH 4O51B 3RX5A 4JFFB 4O02H 3ZDZE 2EIZB 5I1AB 4M62L 2AP2A 5J11C 3MV7A 4PJDB 4HWBH 5TDNA 5C0AA 3AS1A 4FZEH 4OUUB 2VXVH 1DE4A 4CRPA 3S88H 4DQOL 1PSKL 5SX4I 4L8SC 1I7TA 5T1KB 3SQOH 2QR0A 3OKEB 2V2XA 3O6LL 4NO5B 1UVQB 3NABL 3CFEA 4K3DH 4PJGF 5D9SB 4K71C 3PV7A 3UDWA 1MCWW 3SDXB 1HXMA 1FRGH 3GSQA 4L4VD 3QWOA 3B2VL 2D9CA 2NW3B 5DD6B 1LWRA 5IHZB 3WFZA 2V7HA 1NEZG 5IBTH 2EXYD 1RK1A 2DI8A 2UUDK 4FQPA 3KR3L 4G7YL 2HMID 1EFXD 4XTRC 3Q6GH 4GMSH 2ZG3A 4J3WA 2DAVA 2CDFB 4XPTH 5EBMA 3TWCL 1NCBL 3VXSD 1CGUA 3QUXB 4JN2A 2PYED 5TQ2L 2JB6B 1R3JA 5JHDA 2R1YA 1CGVA 5DWUL 5ETUB 3MRIB 4H5SA 5ICXA 4JFYA 5JTWA 1BGXL 1CL7H 4LLMB 3HCVB 4HHAB 1BD2A 1M05A 1P7HL 2R15A 2BNQA 4Z78A 2XNAA 1T5WB 1F4HA 3CX5J 4A6YB 4OQ1A 3LSOA 4DVBB 5JMRA 4OFDA 2GJ6E 1HKFA 1VPOL 4TULH 5TE4H 4G8GB 3FT4B 1KIPB 2DL2A 1YNTA 3TBVB 1C12B 1GVIA 3V6FA 4FFZL 3CSYA 5D72L 5BVPL 3DSFH 3GMOA 1DTUA 3P4NB 4XP5H 4P2CG 3WLBA 5DQ9A 2ITCA 4MA8H 4FQQB 4LGRB 3WLWD 3QI9A 1H3TA 1VEOA 1X7QA 4QRUA 1WFUA 4WFFD 4MJ2A 5TQ0H 3SN6N 1U3YA 1BVKB 1BFOB 1WBXB 5DMIH 2UWEF 4G8IA 4C54A 4XCCL 1A6AB 3STBA 1T4KA 2Q8AH 4NM8H 4N8PA 4U2ZA 2DF3A 3FFCA 4JM2B 2R4SH 1DUYB 2ERJC 4GBXB 4PFEA 2BVTA 3MJ9L 2NX5A 1B4JL 1L4IA 2MPAH 1XR9A 1ZMYA 4OZIF 3B5HA 1IGJB 5IVZA 3DVGA 3L1OH 1S9YA 3REWA 2Q7NA 5J89A 2W65A 5BZDB 1OTUC 2P8MA 4X7TB 3W2DH 3IXAB 5FB8B 2FGWH 3ZDYF 3NZ8A 4WUUB 5C08D 3C6LA 2O5YL 2MTPA 4D0CB 2GYSA 5D71H 5AZEH 2DQDL 5A40E 5TE6L 3VFGH 1A21A 4AENA 1QZ1A 1MUJA 4N0FB 5D70L 3DV6A 1EJ6A 5E4EB 2YD9A 2J7LA 3BDYH 4ZPVB 1QSEE 3VGHA 1PAMA 4G3YH 1D9KB 1LEKB 5HPMB 2R2BB 1LO3L 3O4LB 5E2WL 4OIAA 4HXAL 1KUMA 4YXKH 2ADJB 3CIQA 3RPIB 4I18A 3MUGA 4ZUUA 5F9AC 4PJXB 1A7NH 2GY5A 3I3BA 2XICA 2PTTA 2DQCL 4UNVA 2YUZA 2EIBA 5EOCL 4KAQL 3MXWL 4NJ9L 4U0QB 1C1EH 5E5RB 1D5ZB 1ZT7A 1P4IL 2FIKB 2Y07H 1AGBA 2DDQL 5C07A 5CS7A 3VDBA 1HOCB 4N0YH 3AREA 5ID1A 2VLJA 3EYFA 2B7DT 4I3SH 2HT4D 2X6MA 2CIKA 4LHUG 1RZGA 3D3VD 1M7DA 5ISZE 4KK9D 1NAML 4PJ7B 4DN4H 5FO9B 4J4PD 1JK8A 1YQ2A 5E1HB 3T3PF 1OY3B 1DLHA 1KELH 2ARJQ 1A6ZB 1INQA 1EPFA 3BFOA 3MRGA 5EIVA 3LQAL 1CGSL 3O9WC 2DQTH 2X05A 2H1PH 4NQCD 3S9DB 1ZA6B 4NQEA 1Z5LA 4YHNA 5ESQA 2V5MA 5E8NA 5JDSB 4G6JL 5DJ0B 3ROOA 3AMLA 2NY3C 4APQD 3KS0J 3RGVA 1DBBH 3TIDB 4ZDHA 1HHKB 1CBVL 2O61A 1SM3L 4NPYB 4HPOL 5HYJB 4UOW0 4R97B 5JNYB 3N9GL 4ESKA 2XG4A 1MCOL 2OL3L 2B1AH 5I6XC 4YC2B 3HPJB 3BKJH 4JFHD 4J8RB 2XQBL 3OXSA 3SKMA 4LPXA 2H6PB 4LKXB 4NN5C 1CVSC 1MIEH 4OCYL 4Y8AA 3NAAL 3OTTA 4LCYA 2M8XA 2Q7YA 4KK8C 3ULUF 1G6RB 4Y16C 4LGSB 1J05A 5KW9L 4MXQD 3RVUC 3HE6C 1KB9K 3LKRA 5FYJD 3GSWA 4IOIB 5HDQH 4MA1C 3LKOB 5DJ8A 1RMFH 1IZJA 5CD3A 4HK0B 1Q8MA 3UJIH 4OLUL 4KKNA 3DGGA 4GRWE 1OAYL 1YNKH 3VH8G 3WFHB 3OZ9L 4JDTL 2VH5H 2VN4A 5HSFA 2H9GB 2ARJA 1BIIA 5I8EA 3IETB 3WSQL 3L5XH 4DZ8A 3IU3B 5JUEH 2EKSA 4LLQB 3DYPA 4LOUD 2UZIL 1IE5A 4F7MA 4AMKH 1JPGA 2A74B 3EFFB 1NGPH 2VC2L 5C0CA 3R0NA 3VG9C 2ATPB 3HZVB 2XA3A 4QCIB 4Z95L 2ZPKL 4MLIA 2W1NA 3CH1B 3QNYA 1MJJA 1JZ8A 1J5OH 1S8DA 3EOTL 3IDNA 3MACH 5IB2A 1LEIB 4HMDA 4BZ1H 4MQXC 4MB5A 2H32B 1HH9B 3GB7B 2Y1VA 1FAIL 1YN7B 4Y4HD 5H8DA 2JJTC 1R3LB 5E0QA 3A67H 3QCUH 4QYOA 4TNWK 4EDXA 3I50L 3N1MC 1TETL 3QXDA 4YK4B 1CXHA 5GS1A 2IH3A 3BYTA 2JIXA 1JZ4A 3HMWH 3TN0D 1FORL 3D2UA 1JI2A 1YEDB 1JTPA 5C9JA 5C0BB 3EYOB 3LDBC 2XPGA 4R4BA 5JW5A 1SEBA 3MRLB 2JKXA 1FVDA 2HVJB 2N7AA 2VXQL 5F89A 4HDIB 1LO4H 1EERB 3H0TA 3B5TA 4XP4H 1PQZA 1VGEH 2CIIB 4EIGB 1IGFL 1H3XA 3T1FB 5E7FA 4WI3A 5FA3B 3ORJA 1IAMA 5CCKL 5KAQF 1CU4L 1UACH 3MA7A 4LPVA 4W68A 3NN8B 4QGYA 1KG0B 4Q0XH 3TZVD 3RRQA 1WBZA 5I18L 4L3CA 1U91B 3BUYA 5SWSE 3ILPB 3PXHA 5KVGL 4JO1L 4JFDE 2OZ4L 3LIZH 5LWYL 2VDKL 3JV6B 4AL8L 3UZVB 3C5ZD 1KCLA 4HBCH 1U8MA 2QADB 1IT9H 3WEXB 3IRPX 2X44D 3KPLA 1QSFA 4OCLC 2FHFA 5IMLB 1N6VA 1F3DH 5KSBA 2V2TA 3DVIA 1R6VA 3B3IA 5H37G 3CXDL 1OAKH 3RL1A 4LSDA 4UT6L 1IGIL 3PDOA 1DQQA 4G9FD 4K2UL 1FCGA 2OI9C 3LQZA 3ZKQD 3B9VA 5ITBL 4L8SA 2YZ8A 4EN3B 4KROC 1NFKA 3QIBA 4JPWH 4OLXL 4P49A 1MCPH 3IB4A 5E9DA 1HN1A 1IMHC 2ZNWA 2ZCLH 1Q9KB 1XF5B 2I27N 4ZSOA 1UJ3B 3P40A 3U46B 2DYPA 4E9LA 2F19H 2PCPB 1MSPA 2ESVD 2X2YA 3QCVH 5I1HL 3MV8B 2I9LB 5IEKA 4PRHB 2JCCA 4HCRA 1FBIH 1UWXH 4XPAH 3ARPA 4E5XB 3QQ3A 4Y1AB 1AHWA 2EH7L 5EU4B 2HFTA 4XVSL 3HE7A 4G9DB 3WL9A 4TTDD 1NCAH 3FFDA 5HVHB 5F1NB 4LSPL 4ELKB 3FQRA 1QYGH 1U36A 5D6CA 1OL0A 1OTTD 4H1LG 1Q0YL 2H2SC 4H8WH 5IROA 3AU1A 2E7LA 1KLUB 4HC1L 4CUCA 2VDMH 2CDEA 4XNXH 3BQUD 3LZFH 2BVPB 2DL9A 3HG1B 4LIQH 1FZKB 2KPNA 1X44A 4WWKD 4YHOH 3TF7C 1J87A 5D5ME 4FQ2L 2B39A 4YWGL 4DCQA 3W0WB 3WHE0 3OAYK 1VFBB 4WRLA 2VERN 5DRZB 2CRIA 4A6YL 4HS6B 3IVKA 4YGAB 5H37H 1LQSR 4OCMC 5K9JL 3J7HA 3LEVH 3P4MB 1CR9H 3KXFB 4LSTH 4UDUA 3GJFA 3P4LA 5DMJB 4FQLL 1EA9C 3KPNB 2IPUK 4HZLB 4MDJB 1QLRA 3NIGE 2YK1L 5MERA 1L7IH 1E4WL 3RNKB 2IGFL 1K8IB 2Z4QB 2XWJA 1OGAA 1ORSA 1EHLL 4P4KB 5SWQA 3MNWB 4Z7QF 1K4DB 2AEQH 1FJ1A 2C5DC 2J6EL 4O2FA 2CMRH 3RU8L 4P4RB 1ZLWK 4UB0H 4KMTH 2Q20A 4Q97A 1F6LL 1T7VA 4ETQB 3L3IB 4YE4H 4ZNEE 4RIRA 4WW2C 5TH2A 4LSQL 1U2CA 2F5BH 4K7PL 2OTUB 4KI5E 1HHJA 4M02A 3QP3A 1RZKH 1J9CT 1ZXQA 5HHOB 4BH7A 3MQIA 1JZ7A 3MRPB 3UJTH 2VITA 4OZ4A 4AIZA 1AGCB 5M94B 2X9WA 4ZXBB 3BSZL 3GM0A 4JLRB 4PTTB 2FB4L 2P5EB 2NY1D 1DBKH 4K7PY 1ZVSB 3A6CH 1ZHBA 3C6SA 3WN5C 1RZ8B 2BHZA 3BZ4A 2D3VA 3MLWL 3QEQA 4KHXH 4YAQB 4XPHH 1CXFA 2BSRA 4RGOH 1IAOA 5HPOA 1I7UA 1FYTB 4NO2A 1Y0LA 2CJUL 1FH5L 5E6ID 1IC1A 3U2SB 2VABB 1LD9B 5BW7C 5IMMA 2I26N 3H9SA 5DUML 1C5DA 1JGVL 4NNYB 1HQ4A 5EPMA 3D39B 2Y06L 3EYSL 1I1FB 3OKLA 5KSBF 3U83A 1T2XA 5F71A 5MEOA 2R2HA 5C0EB 4DK6A 4R7DA 3PWLA 2A6KB 5CIPA 3MRNB 1UWGH 4CVXB 3V6BR 5I15L 5B3NA 3VWJD 1HYSC 4PBXA 3OR7A 3EO0A 5KZCB 2ZOKA 1N59B 3ARDA 3V8CA 1Q9WB 2WQ8A 3VFVA 3F7YA 5I71C 3S7GA 4XNMB 3HC3L 4F7TB 3RI5F 4HBQA 2Q8BH 1DBAL 4DOHB 4BQ6A 2QQQA 4KJYA 4NQXB 2ZKHL 4UIKH 2C9AA 2JCCF 4YFLF 1FC2D 1B2WL 3UROR 3O3EA 1AXTL 1CK0L 3ZHDA 4GFTB 3KPRE 3PGCA 1FHGA 5IKCA 3K4ZA 3KJ6L 1NGZA 1U42A 3JV5A 1VACA 3BI9X 4CN4A 4P5TD 3S4SB 1TJIH 5I19L 1HILB 1EBAA 4WFGD 5BV7L 3DJ9A 3W11C 4PJGB 4M61B 3FQWA 2NYYD 3X3FL 2NZ9D 4NUGL 5TE7L 1A4JB 1XCQA 4RAVB 5F9JA 5FV2A 5T1LD 3CZFB 4PJIE 1HHHB 1DL7H 4ZUTB 3TO2A 3H2WA 2O5XL 4G6FB 4GXVH 3DETC 3PV6B 4YH6A 1W0VA 4S2SA 1TZGL 5CP7A 3HNVL 3LKQA 2XZAH 1MFCL 1UB6B 4J1UB 4KQ4L 4Y5XB 1G6RL 4KRPB 4JRYA 4XMLH 1Z3GL 3HE6A 3GJEB 3UAJC 2NY4C 4O2CA 3FQUB 4TUOB 1U3ZA 4P2RE 3WFBL 1OD9A 3PGDB 5L2KE 1HQRB 2BNUB 3BX7C 3TNMB 1KCVL 5T5NG 1NC4D 3ULVH 4IIQC 3B6SB 3SPVA 15C8H 1AY1L 4LBEB 1K4CB 2ILLA 1F02I 43CAA 3ARGD 4XWGH 1HHGA 1DZBA 3LRSB 3O2DL 2O5ZL 3QZWB 2AV7B 4JZNA 3S3PA 4NC1E 1A3RL 1ITCA 4P2OC 4QGTA 1M7IB 1JCKA 5IB1B 1D5BA 3DHMA 2L7UA 4JFFE 3JWOH 4EI5B 4FQJH 3RY6A 3PP3K 3FQTA 4Q6IB 2BVQA 4W6XB 3X3GH 4LEXH 4XPGH 2QQLH 3IFNL 4PJDE 2FD6H 6FABH 1RURH 1CFNB 1FL5A 2E6PA 1YUHB 2NY5H 9CGTA 2UWEB 5SWZE 1FL6B 2J8UA 2QTEA 4MHHI 1FL3B 2HN7B 4U6HA 2BFVL 4M1CD 4HF5L 2V7NB 3BRFA 4R96A 1QLEL 2EDRA 4JB9H 1CLZL 2VDQL 3NCFB 4RFNC 4JFZL 4OZIB 2HRPL 4IOFC 1LEGA 2QHRL 5E5MA 4S0SD 4ODTH 4Y2DD 4JRXA 3SDXE 3GJFK 4ZTOH 4XXDA 1ZSDB 3IDYB 2FRGP 5D7LD 3L3JB 2R8SH 3MBXH 4I0KA 1ERNA 4FQHA 4R26L 1QVOA 1JN6B 3QIWA 2GCYB 4X6EA 1JJUA 5I2IA 3VFRB 1KBGL 3DRTA 4CU7A 2W60A 4I5BA 3GSXA 4V1DD 5JXED 3QDJA 1NANH 4L8BB 4YQXL 1TTGA 4HG4J 5I1JL 3WJJC 3JV0A 1CDJA 4YDIH 2OR7A 1NSNL 1PFCA 3CC5B 4OAWA 5DJ2B 1T1XA 5B4MD 1I8IA 3MV7B 3OAUL 2X1PA 2YD1A 3C2AL 4LF3A 4Q9CA 1CFTB 4KUCF 4S1SH 5C0AB 2YWZA 4X4ZA 2WUCH 4CMMA 1BWWA 4G8GE 1HWHB 3U7YL 3C87A 1I7TB 2G60H 3MCLH 3PL6A 3K81A 1G9NL 1CFSA 2QR0B 3N1FC 4YHIB 4QNPF 5I1DB 4PRPA 1P9MC 4HUWA 4TUKH 4NQVB 4GO6B 2R1WA 5LKNA 4P2QA 1U8KB 1JGUL 5D96C 1NDGA 3UMTA 4K07A 4JZJA 4GS7C 5A2FA 3AM8A 4GAYA 1JPST 4Z9KB 1DQLH 1YNLH 2V7HB 4DFIA 3BHBA 3PIQA 1J0HA 3EYUL 5FM5M 4M1DL 4K7FA 5M7QA 1LO2H 1RK1B 1DN0A 1BX2A 2BHUA 4XNUH 1U3HC 1EVTC 2VNCA 2F15A 4QRPD 4JANB 3VG0H 3THMH 3O81A 5J06A 3JV4B 4KKCD 4L4TA 5AWNH 1OGTA 4O9HL 3WDIA 4FQ1H 4JN2B 4WUUE 2VUYA 3O2VL 1G0DA 1R3JB 5JHDB 4DWHA 2R1YB 3QDMB 4H5SB 1RPQA 4DEPC 1XIWD 1A64A 4WV1A 1M05B 3L5JA 1S9VA 2MJWA 4Z78B 1S7QA 4NGHH 5A3IC 1EZVY 3LSOB 1TVHA 1N64H 5F93C 3DX7B 1IAIL 4NKMA 4FHBD 4DKEH 3V2AR 4G8EB 3O4LE 2Z31D 3GKWL 3OKYA 2DJUA 1YNTB 1I1AC 1WBYA 5GGVH 1U58A 1ZHLA 1K6QL 3ARBA 3GMOB 4XWOD 4Q7DA 5J13B 2LV4A 4OI8A 1RUML 1WCBB 2ITCB 3MV01 5HGHB 4TPRH 5ESAA 4G6KL 4PP2A 1X7QB 4QRUB 2Q87A 1O7VA 3V4VL 1F4WL 2J8OA 4G8IB 1RIVL 2J8UF 4B7IA 3FFCB 1YEEL 1T66C 3QUYA 3MZTA 1DR9A 2P24B 3MV9D 1OAUH 3ILQC 1JRHH 5FGCB 3TNNA 3SY0B 2V5RA 1VKXA 4Q9RL 4CDHA 2IMNA 2WK2A 1QFHA 3DVGB 3NA9H 4RNRA 1QEWB 4F9LA 1S9YB 1U8OA 4PTUB 4PJ7E 2WWKO 5J4MA 1PZUB 1S5HB 3OJ2C 1U6AL 3FJTA 3G08B 2P8MB 3W9DA 3NZ8B 3QULB 4X80H 3C6LB 3VRLE 5JO5A 4Z77A 2BMKB 1KIQA 2AXFB 1QNZH 4OLVL 4LCIL 2CR6A 2AXHA 2VB5A 4AENB 3FZUD 5HI3D 1G7QA 1PG7X 5IW6B 3DV6B 4H20H 2FBJL 4QTIL 2EYSB 3K1DA 4RZCA 5KSVB 5EO0A 3Q5TA 2CUIA 2MOVA 2V9TA 4HPYH 4OV5A 1A0QL 3NTCH 1KC5L 3H9HB 4OCSL 1ZS8A 1JGDA 4G42A 2BVEA 4DZBA 1X9QA 4TSCH 5HYJE 3KS0H 1R3HA 3MUGB 4I18B 1BAFL 3FB6A 3RWDB 2XTJC 4X7CC 5DVMA 5J6GA 1QQDA 4HIEA 1CZ8L 4WEUD 5KVDH 4JREC 4K9EC 4MAYD 4RMTA 2PTTB 1SEQH 1QO3A 2SEBA 2Z8VC 3FT2A 1ZGLA 2DMKA 1WT5C 5KSAD 1CDGA 4KXZI 3W5NA 1ZT7B 1WWCA 5ITBH 4F7EB 1KGCE 1AGBB 1NMAH 5C07B 3BDXA 4O00A 5EZOH 5ADOH 2R0KH 3AREB 5I8CA 5ID1B 1ZLUK 5GZOD 4PY8J 2YPLE 3EJYC 1WIUA 5I1HH 4DVRH 1RZGB 1NFIA 3MUJA 5SWSD 3O8XC 5LG1A 1KENL 4CAGA 3RZCB 3FL7A 2QJDA 3C9NA 2RAMA 3KPQA 2PXYA 3JVGC 1MJ8L 2R2EA 1JPFA 2P8PA 1W72B 3D69A 1INQB 1T22B 1GGIH 1OARH 2EEDA 3QG7H 1I7ZA 2AXJA 1N0XL 5EU6A 4YHNB 5D8JH 5ESQB 2D7PA 3RTQA 5E8NB 2UVFA 1V3JA 5ITFA 3ARFA 2HJLA 3BGFC 3RGVB 2NY7H 5IESH 3NCCB 4ZDHB 1R24A 1I8LC 1IEHA 2O61B 1FVCA 2D7TH 3DIFA 5FO8B 1I8MA 4JHWH 1NBVL 4WNQB 2DBLL 2GQHA 5EBLA 1FFNA 3P11H 3H42L 3OPZH 4LCYB 5B39G 4YDLC 2Q7YB 2CPCA 1AGDA 3LKRB 5C0BE 1LP9B 4CW1A 3LS5H 4HS3A 1WWWX 4P3CH 3CPLA 5DJ8B 4LPYA 2DQFA 2A6DB 4AEEA 1JNNL 1KB5B 3DGGB 4QTHA 4TVSa 3QDGA 1OPGL 5FHBL 1N26A 1YPZA 4X5XA 3WHXA 5JOPE 4DZ8B 4O5LL 2GT9A 2EKSB 2CKBA 4HWBA 1KN2L 4K23L 1FPTL 1JPGB 4OCRL 4U33A 4NN7C 4LSUL 2A73B 4N5UA 1DBMH 5MHSD 2PN5A 5D6DC 1XGPB 5D2NC 1A6WH 3GMQA 3QNYB 4MXWH 1MJJB 1PKOA 1H5BB 4YR6A 1S8DB 4OKDA 5DA4A 3IDNB 4Y0GA 3RPKA 1N2RB 4LEOA 4UT7L 4F15B 2PNDA 3KG5A 5IUSA 4UV4L 4AT6A 5C7XH 4YDVB 1T0PB 4OF5A 1P7QA 4PJFA 4D0DA 2Z35A 3VXRD 1JNLH 5F7DA 3KDMA 4OTXL 4QYOB 1LNUA 3ZE1E 4EDXB 3QXDB 3HI6L 4ORZC 1UQSA 3EYQC 2IH3B 5FECA 3CMOL 2JIXB 3WBDA 4ELMA 2P8LA 2ZUWA 1EGJH 4CL7A 1PLGL 2X41A 4QRQB 4FP8H 2HT2D 5C9JB 2YHGA 1QHOA 1JZ5A 1OW0A 2VZTA 2XPGB 4R4BB 4D9LL 1SEBB 3B9KC 4M6OH 4OF3A 5JW5B 3MGTA 1FVDB 4DTGL 2AJYL 3MV8E 1F3RB 3H0TB 4ZFFA 5DEGA 4X7DC 4KI5D 4IMKA 4PRHE 3BO8A 5I30L 1JE6A 4JFEA 3T4AB 5GXBB 1UGNA 4Y1AE 4PRIA 3JBG7 1FE8L 1L7TH 5IB3A 3DARA 2IPKA 5CGTA 5F9DC 2NY6C 1NC2D 3MYJA 4NBYB 4U0RB 4UTAL 3PQYD 1WBZB 2X89A