4LHQB

Ricin a chain bound to camelid nanobody (vhh8)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
VQLVETGGGTVQTGGSLRLSCSASGGSFSRNAMGWFRQAPGKEREFVAAINWSASSTYYRDSVKGRFTVSRDNAKNTVYLHLNSLKLEDTAAYYCAGSSVYAEMPYADSVKATSYNYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Ricin Toxin's Enzymatic Subunit (RTA) in Complex with Neutralizing and Non-Neutralizing Single-Chain Antibodies.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Hydrolase/immune system
molecule keywords Ricin
total genus 28
structure length 128
sequence length 128
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lhqB00
5JHLH 2XFXB 1IAMA 3FN0L 2R23A 7FABH 5JLZA 2AV7A 2AABL 3LKSB 4U1IA 4PLKD 2FGWL 3FB8A 3EDJA 4X98B 4JRXD 2BC4B 1DQDH 1T4KA 3JV4A 3SKOA 1ACYL 3FT2B 2BHYA 1T66C 3UC0L 4Z7VA 5E7FA 1Y6MR 1JF5A 5HD8C 3RGHA 4BJLA 1JBJA 4NQCD 1G9MC 2UY7A 3ILPA 4JG1L 4QRUA 5C0AB 4MDJA 5DXWA 1G0YR 2PF6A 1KTRL 1E6JL 1YEEL 2P1YA 2QQKH 3P30H 2X1QA 3ARGD 1H3TA 4OGYL 2PYED 4KDTA 3L3IA 1DTUA 4KRNA 1MCJA 4Q6YA 3ILPB 4JEGB 4FFVC 2R56L 1IT9H 2FBOJ 1HH6B 3C6SA 4P99A 4P4KA 3MRQA 1W0VB 3MRJB 3LKNB 1AY1L 1M7IA 5ID1B 1NAMA 2W9EH 1KIPB 2UZYB 3WNMA 4J2XA 3G5VA 3KPRD 1XR9B 3VGHA 1RURL 3NCEB 2HFGL 4G6JH 3CH8A 4LDOB 4N8VG 3AAZB 1I3GL 1B4RA 3QO1A 1VGEH 3MUZ1 1UADC 2OXHA 2P48B 1T04A 1MCOL 3ZYIA 1ZVYA 1FZMA 3DUUB 4D9QD 4QXWA 1FZKA 4UNTA 4GUPB 2UYLB 2WUCL 4HF5H 3HI6L 1YECL 1U8QA 4DGYL 1WQVT 3KNBB 1XF2A 4HIJB 3MCKA 4JE4B 4E5XA 3WFEL 4G9FA 4WTZG 4YLQT 2F8VA 1C5BL 5ACZB 2B7DT 5EULV 4YHOL 1B0GA 5LBSH 5EO9B 1UVQB 1DBBH 2Q8AL 4IMLA 2PW1B 1EV2E 5JHDE 1A9EA 1DLHB 1ZHBB 4O51B 1NUFA 2NXYD 5I8KH 2G9HB 3GK8L 5FYJD 2DQUH 5E0QA 1JYWA 3MYJB 2HT3D 2HVKB 2AXHA 3L5WB 4XVJH 4KY1L 2XWJB 1GC1C 5IKCB 4Z76B 3WS6C 1FG9C 2D7MA 4JDZB 2IMNA 3OJMB 2EYRB 4J3UA 2BCKA 1MAKA 5IIEA 3VXOA 3KPQA 1MNUL 3QIWC 3RRQA 1NCBL 3MRKB 5D1ZD 4EEEA 2VNCA 5EIIB 3WL9A 3ARTA 1IEBB 1ZHLB 2A0LD 1Z0NA 4P9HC 3UPRB 3T0WA 3DRQB 4JFED 3D3VA 1PLGH 5T5NF 4Y4HD 1QP1A 2QHRH 3CK0H 3TEUA 3MJ9A 1UJ3B 4LEXH 1GCFA 5FKAB 1QFUH 3SO3B 1TIUA 3O45A 5IW6B 1RPQA 1BBDH 2ED7A 4IRSC 3TBSA 3ESUF 5CILH 4JQVC 3BVNB 3LN4B 4L9LB 3AM8C 2BCKB 1PQZA 5C0AE 3RUGB 3TO4C 1MFDL 3QT2A 1GGCH 4XCNB 1UENA 3LHPL 2C7UB 2V17L 2EDLA 3O4OB 1LD9B 4PJFB 3DXAA 2XTLA 1E4XL 4TTDC 4KVCL 1G9ML 2LTQB 5CEZH 2Z4QA 3FFCA 3NH7L 5KTEH 3RJQB 1S9KC 3RWDA 3WLWD 3HZVA 5K59E 5JW3L 3RY6C 4KKLC 2COQA 2X4OA 5C6PB 1MHEB 4OIIL 2X7LA 1OAKH 3AU1A 1C5DB 1GZPB 3LMJH 1QOKA 4PG9A 1JNNL 4MNGE 1UH4A 1PZ5B 2YK1L 1L0YA 1R24B 4HUXB 4HXBL 3RWEA 1FN4B 2E9BA 3L7EB 4MJ5A 2K1MA 2OQJA 1G6RL 4RMTA 4K7PX 1RY7B 4HJ0C 1CL7L 4OCWL 4JG1H 4HZLA 5C0RL 3DSFL 3E6HB 3CZFA 4FQLH 4F9LC 1ZHKA 2ZWLT 4HV8B 3ZL4L 5HYJA 5DRNB 5KVEH 1KXQE 4MNQD 1N3NB 1ORSA 2CK2A 2EXYC 4QXTB 3SE3A 3F7RA 2CQVA 1NGPH 2BNUA 4G80A 3OSKA 3GMOA 4GRWF 3GSRA 2DLTA 4C57C 3B9KD 3MPCA 3OJDA 4MXWH 4LCWE 5BRZA 4PJAA 4UAOC 1WVZA 2OL3A 4FQJL 4DWHA 4ZSOE 3WSQH 2EIDA 1CICA 2H32B 4C55A 1I1AB 5DJ2B 4EOWL 3L3KA 5DFVC 1T20B 1P9MC 4HWBL 5DHXB 2JF1A 5CEZE 5H37G 1NFIB 2YUWA 4WWID 3WXVL 4POZD 4M7LT 3BJ91 3HE7A 3WSQL 3QUZC 1HHIA 4QF1B 4ZFFA 2HT2C 5EFIB 4J7RA 3ULVD 1KELH 5FO9B 2EDXA 3VRJA 2BC4A 3BQUD 5HHQB 1YEKL 3O3AA 1G6VK 2OSLB 4KTDH 2WBJC 1UKQA 3BKYH 2W0PA 4ZUUA 2QADB 1HEZA 4QRRE 3BIAX 4NGHH 4AMKH 3SGJC 4G8EA 1U3HA 4LARH 3UTSD 3FB7B 4EQ3A 3TZVC 3H9HB 3B8SA 1NLDH 4H20L 3T0BA 3CAFA 4Z7WE 1OCWH 5K59F 5BVJB 3VXRD 3VMPA 1NEUA 4F7EB 1F3JA 4YXKH 4XZUB 4PJ8C 1NFDA 5SWZD 5EH1A 5C08B 1I9EA 5JPNA 5L2KD 4ZXBD 5EB9A 5GZOD 2KKQA 1O5DT 3UPRA 3D0VA 4XCYA 1WWWX 3ZE2E 1OP5K 4F57H 1ZHKB 4L29B 4DOHE 4LOUC 2DJSA 5TQ2L 5FO7A 3W11D 5JIPA 1VB9A 4QRPB 4YHLL 3WNKA 4XH2A 1J05A 5DJYA 1RIVH 2IBBA 3TN0D 1OARH 3U46A 3LRHA 3TFKD 3KVQA 5JW4Q 2HWZH 2JJUA 1V3KA 1T1WA 3L1OL 4LASH 1BGXL 5E2WL 1U91A 1NGXB 1S3KH 2VLRD 1R5IB 3TNMA 3ZYZA 3L3GB 3VH8G 5K9QG 4JHWL 2ADIB 4GRWE 3U9UB 4NM8H 1TZGH 43CAA 1F8TH 1YEFL 3MNWA 4O2FB 4CBPA 3TZVB 3UTOA 2XWTA 3T0XA 1FFOA 3KPNA 4PBXA 1HN1A 1PKQB 2LVEA 1HHHA 2DTML 5INCB 2Y06H 2F5AL 1CDJA 1QEWB 1XGUB 1J88A 5KVFH 1ZEAL 3PUCA 4TNWK 4LFHD 5KVGH 3V5HA 4GRMB 5CJ5A 1NCTA 1AD0A 1JK8A 3ARBA 5EN2A 5IM7B 4BSWA 4Y5VB 1RFDH 1G7LA 3CFJA 1YNLL 1ZT1A 4ODHL 4WW2F 4ZAKC 2XA3A 3MRHB 5F89B 1UFUA 2L4OA 4KMTH 3D9AL 1LE5A 3KPMB 3D3VB 2VN7A 2F5AH 5ELIA 5IMOA 2GFBB 3CVHL 1MIML 4NRZA 3PHQA 1Z5LB 3M1BB 1EJOL 4O2CA 4N0YH 3G04B 1RSFA 1QR1A 5IOPB 3O3UN 1KG0B 3SO5A 1MWAH 2OZ4L 4OT1L 2D4FA 4KRPD 1FL3B 4NUGL 2Y6SD 3WIIH 4PV8B 3HMXA 5C0AA 2VDKL 1BQHG 1XH3A 3FO1A 4Y5XB 1EUTA 4XVUD 1EFQA 3R1GH 4X6DB 5I1CL 4U4BA 3PJSB 2VR5A 2Y23A 1R5WA 2CDGA 1CBVH 1EO8H 1HYSC 3UAJD 2IPKB 5TE7L 3PXJA 4LSRH 1TTFA 1CGUA 4K8RD 4HWEL 4E5XB 3LQZA 3OX8A 1Z3GL 3SDXF 1A6TA 4GQ9H 4I3SL 3SKNA 2ITCA 3N9GH 5B8CB 1AR1D 3DNKA 1JGLH 3R8BB 3IJHB 4ELKA 3F7YA 3UJJH 1MCEA 1DQJA 1R0AH 1CLYL 3TO2A 4YHMH 3MRCA 4LDEB 4YDVA 1R3IL 3RA7H 3WNNA 3PWPA 4PJCF 4L1DA 3EIFA 4PJAF 3U1SH 1IGCH 4ODSL 2AKRB 5FF6A 2FECI 2VZUA 4MNQA 4OLWH 3RIAF 4Z0XB 1JZ7A 3F62A 5EC1A 3QXDB 4PP1C 4WNQA 5DFVD 1OP9A 2IQAA 2RR3A 4TYUA 2ESVE 3HAEB 4JKPH 5C07A 4ZFOL 2XKUA 4OLVH 1ZSDA 1QSVA 4FFWC 4TRPL 1MY5A 4NN5B 5H35A 4YHPB 1ZSDB 2NZIA 4ODSH 4OLWL 5L7XH 2N4IA 5DD6A 5D96B 5FO8B 1DL7H 4OCLC 2PR4L 5C0NC 5I0ZA 1NMAH 5L2JB 1NCAH 1ZXQA 1W0WA 3MRFA 5F6IC 2CXKA 1AGEB 3G6JA 3ZKXC 1H3WM 1KLFA 3OKDB 4NBYB 1CQKA 3OXRB 2R9HD 4GQPH 1JPTL 2AW2A 1DQJB 3BIBX 4W70A 4UOJA 4IRSA 1A3QA 5B8CA 4WI3A 3GSXA 4QLRA 1HDMB 1IZKA 1P4BH 3ARGB 5DHVH 2R0LL 1HH9A 2ZUUA 4BQ8A 3MOQA 1UB5B 2CPCA 3GSUA 1OQOA 1A6AB 2G5RA 4UT7L 5HYIA 4M6OL 3RDTD 3O3DA 2R23B 4FTVA 2BMKB 5ICYA 1YY8B 5JIHA 1JL8A 1XF4B 2GHWB 3ESVF 5T1LD 2P5WD 2NY4D 4CJ1A 1OVZA 5DD0L 4Y4FD 4PJ8B 4M5YL 2H6PB 2BY0A 1CDCA 1GGIH 3NCYP 4Z7NF 1U8JA 4UTBL 5GJTH 1AKJA 4HS8L 4AIZB 3NPZB 5F9JA 2EH7H 1X5LA 1YNTA 2W92A 3QEUB 2PYEE 4I18C 1WZ1H 3JSSA 3GDBA 5D5MA 1NJ9A 1PDKA 5GIRA 3DETD 5DD0H 3TCXA 4IS6B 5I16A 1RULL 5JUEL 5KS9B 3TCLA 2GFBA 5FUCE 3IDNA 2B5IC 2V5YA 3WN5A 4P9HH 3MGOA 1K4CA 1HYRC 1WBXA 1UXSA 4K3DL 1F6FB 2DOCA 5EBMA 4OFVA 3GZKA 3DX8A 5JW4M 3TN0A 3PWJB 4NHCL 5C71A 3TF7C 1MCCA 3DJ9A 4LCUB 3H6JA 3KJ6H 4J8RB 4JGJA 4PRPD 5ACLA 3IJHA 1N6QL 5ISZE 1S7SA 4OT1H 4HH9A 4MD0B 1RZIB 4JFZH 1V3LA 4NQUA 3H9SB 2VXTL 4MHHG 1V5JA 3X3GL 2ESVB 4I5BA 2XZAL 3MLTA 5F7UA 2AEWA 4XNQA 4M8QA 1VFAB 4XP4H 2I9LA 3MFFB 1CVSC 4LLUA 2WWMD 1S7WB 4GAGH 1Q0YL 5I1JH 5ENWA 5LBSL 4ZO7A 5DA0B 3Q5TA 1B4JH 5GHWL 2FJGA 4I0PA 4ZFZB 5C0CD 1FL3A 5E8NA 3OHXB 1A14H 1T1WB 3GMNA 1C16B 3L9RA 2BY2A 3FQNB 4ZUVA 1D9KA 3FHQA 3M8OH 3QA3B 2GY7B 3PWNA 4LSUH 4OUUB 5F9JB 5GRJH 4X7TB 2G75A 3H3KA 1DQLL 1NLDL 4S1SH 3CDYA 2XKNA 3QUYA 3P4OA 3DX7A 1EZVX 1BQUA 5BRZE 5JO5A 2XRAL 4XI5C 3RX5A 1KLGA 2B1AH 2YEZA 1QSZA 2FO1A 3M8OL 4FN0A 2D2OA 2F19H 4PBVC 1ZA3B 1KCVH 1NAKL 3OKNB 1U3HB 4PB0H 4Z78A 3O6FC 3WUWB 5DI8B 1BZ9B 1CQYA 3VXPB 1MLBA 3AC0A 5LGJA 1LK3L 4HD9A 5I30L 3GNML 3BT2L 4M6NH 4W6XB 3KYMB 5F9OH 4WHTA 4ORZC 1T7WA 1MHPH 2MCG1 4JFEA 4NN6C 1MFBL 3QHZH 3LEVH 3ULUL 1NC4B 2IFFL 2EDNA 1HHKA 3BYTA 1HQ4B 3QUMB 4LSQL 4RZCA 5HHMD 4Y1AE 3JVGC 3ZE1F 3WS3B 5KN5B 4KVCH 4HIIA 4BELD 1KIRB 5CUSL 3QFDA 3SCMD 3DVNB 3SPVA 5C07D 5FGSA 2E5EA 3B43A 3EO1A 3ORJA 4LPTA 2LVCA 4N8CL 4PTTB 5DD6B 2P8PB 1TFHA 4YBQC 5C0CB 4WI6A 3W9EA 2Y7QB 4G7YH 3BEVB 3DGCR 3AMLA 1MRDH 4H8WH 3L95B 2YC1B 2C4XA 5CUSH 1N0XH 2X1XR 4NQEB 1KTLA 2VLME 4BQBA 3AS0A 4AQ1B 3VXTA 1FVDB 1FYHB 2A83A 2YR3A 1TQBB 5CGYD 5IHZA 1KJ2A 2MCPL 4PJDB 3CXDH 5EUOF 4WFGD 3QBTB 4M9PA 4OFPA 4L4VB 5J13B 1HQRA 2Y9RT 3HNTH 4GSDH 1A4KA 1FG2B 1QSFE 3PGFH 4GXUN 2Z31B 5FGBC 1D9KC 3MUGA 3GMRB 4IDJH 2ILLA 1XGQA 1OAYH 1QFWI 4GO6B 1XGYH 1B6UA 1FFRA 1BPVA 4N0UA 4ZO8A 4PJ8D 3QRFM 3EOAB 3QIWD 5LCVH 3BOVA 4OIAA 5TE6L 3WFBH 5F6HJ 3S96B 5GZNC 2AK4E 4Y4KA 1UKSA 3HE7B 4MJIE 4WUUD 5IB1B 2VDOL 2ZUYA 4MA8H 4Q97A 1U8IB 5F1IB 4XXDB 5CCKL 1J1OL 4LPYA 1U8IA 5F1IA 3MO1A 4QNPF 1TPXC 5DJAB 2HMIC 1JGUL 1LD9A 2GJ6D 1LE9A 2F53E 4J3WA 4I18A 4JJHA 3C8KB 2BHZA 3DX6B 3B5HA 4EN3A 2FD6L 3AS1A 1EAPA 2F54D 3HB3C 3I3DA 2ESVD 4L9LA 3FZUC 4XX1E 4C58B 5BRZB 2VDOH 3QG6A 1Z3GH 5T1LA 1CF8H 4N0FA 3RL1A 5IROC 2ICEB 3HC4H 3MV8D 1CFQA 4MD4B 4HK3N 5C6TL 2FCBA 3ALWA 2MNUA 2O5XL 4F33A 2YD7A 4NGHL 4AMKL 2FD6H 3LDBB 4A6YH 3SOBH 1R3LB 4YHNB 5D5ME 1HE7A 1U6AL 1U8PB 2IPUG 2IAMC 4NFDA 1RJLA 3MRNA 1FVDA 3S88L 2D31B 2ATPB 3B6SA 4LAQH 1D5ZB 1IJ9A 4LNRB 5C0BD 4Y1AB 1FCCA 2Z31D 5GRVL 2C3VA 4RQQB 3V4UH 3GJFH 1HSAB 4UDTB 1N5AA 4Z7WA 2A9MH 1KB9J 2G9HA 4QYOA 4EKXA 3MJ9L 4LCYB 1C5DA 5CLWA 4KUCF 4PJGB 1LVEA 2F19L 2OTUA 2BVEA 1I75A 3U0PA 3OR6A 1B0GB 3JUZA 1RMFH 3QUMA 1F58L 1KXVC 2BNQD 2HRPH 3QJHA 1DDHB 3BPLB 2AGJL 5HHNA 1S3KL 4ZODA 1HZHH 1JTTA 1MCSA 1H0DA 4NNYB 3BT2H 3VFGL 2YBRB 2GSIB 3MJ9H 3P77B 4PJBB 3AS3A 3QEGH 4I77L 4HK3J 5HDOA 5JXAL 5E4EB 4DW2H 1SJVA 1SY6H 3MRNB 2EH8L 2FB4L 4JN2B 4XAKE 5TDOA 5BZDA 1KCSL 3ZDZE 1UCTA 1MAJA 5T1KD 4XCFL 1J1XH 4XMKL 3SDDA 3UTPE 3QSKB 3FB6A 4JO3L 4Z77A 2BZDA 5JO5B 4M61A 4NC1C 5D6CB 1A5FH 5SWSE 1A6WL 1INDL 5F6IB 3PP3H 3UJTH 3QAZC 5T1MB 4UTBH 4U1LA 4HS8H 1FSKB 1IEAB 3QPXL 4X7TA 1L4IA 3KJ4B 2MQ3A 3INUL 2NNAB 3CH1B 1KN4H 4OLZH 2DMCA 1IAKB 4PG2C 2B4CC 3H3PH 3MNVB 3UDWC 1C5CH 4OM1L 4ZSOA 3C8HA 2A0LC 2J7LA 3NCJH 1PVHA 2MCPH 2YPKA 1NEZB 4JHAL 4UINL 4ZUWA 4DAGL 3MV7B 2Z92B 2YZ8A 2YD6A 2W91A 1OF2A 3PDDA 3HZKB 3P73B 3GI8L 4I2XB 4LLUB 4ZFGL 5DK3A 4PJEA 3EJJX 3GRWL 4C4KT 1MRCL 1KCRH 1QLRA 3C5JA 4KQ3L 5AZEH 1LGVA 3MRLB 4W6WB 2P8LB 4N1CA 3VA6A 2VOTA 3EOBB 4XP9L 5F97E 1MCHA 2HVJB 5CBEA 5IB2A 3LEXA 1B0RA 4ZYKB 2GUOA 1JHKH 2UZIL 5K93A 3QAZB 3NCMA 3MRBA 4KDWA 4HC1H 2XN9B 3BGFC 5CD3A 5DFWH 4HPOL 5IHZB 4PGDA 3KLDA 2HTLC 1Q0YH 3TT1H 4GAYB 3P40A 1FLRL 5CHNA 2VDMH 3VXQB 3CC5A 3E6HA 3LH2H 3DVGA 3QIBB 5EU6A 1FFPB 3GGWB 3OR7A 4BFEA 2A74A 5I71C 5GXBB 2MPAL 5BQ7B 1GOGA 2APXA 2CGRH 3UYOD 1MI5A 1CGYA 5CD5C 5TE4L 1S9VA 4ODTL 2JB6A 1BX2A 5ITBH 1DQLH 5A40E 4M93C 3L5XL 3BZFA 1SHMA 5IVXE 3HE7C 3STBA 1HOCA 2ITDA 1P2CA 3RWHB 5C0BB 3IU3A 1JGEB 2NX5D 3V2AR 4Z7VB 2UWEE 5D7SH 1NCNA 5TE4H 2F54A 3EYVA 1MCPH 2V2TB 4F3FA 2C1PB 3V6FA 3FMGH 3V4UL 4WFEE 3BDYH 5IG7B 5BS0B 3TV3L 5D7LA 4KROB 3PGCB 4Z0BL 2C1OB 3K8MA 1V7ML 2EKSB 3QNZA 4U1MB 1MUJB 4MS8D 5EPMA 1N4XL 2MFNA 3LDBC 1OAXH 5EBWA 4TVSa 3PGDB 1D5IL 3O8XB 3EYSL 2FATH 3C5SA 4M7LL 1KEMH 3HLAA 3KPQB 3HS0B 3S5LA 3WHE0 5IQ7L 1U2CA 3O4LD 4G7YL 4NWTH 5JQ6L 2EH8H 1KENH 2XACC 1T80A 1F4YL 3W81A 5DK2B 5DEGB 2GKIA 3S3SA 1OGTB 1JZ2A 3H42L 1DUZB 4ZS7H 1GAFL 5JTWA 1AGBA 2NY0C 2J8UB 4M7KL 1RJYB 4JPVL 4UV4H 3HPLA 2XQYK 1BVZA 3CX2A 4OZIE 3U0WH 4OD2A 3SBWC 1RQ5A 4CKVX 4GOSA 4TSAL 1QBLL 4TUOA 1S7VA 4JPIA 1I7TA 1D3CA 4GRWH 4YAQA 4L8CA 3WFHA 3MBXL 2DN7A 4G8IA 4XMLH 1KJMB 3ILQC 2VUYA 5IB2B 4JANA 4WIQA 5INDA 3C6LD 1JNJA 4K3HA 4J6RL 5HPMA 3CSBA 2ZPKH 1BVLB 3WIHH 1CR9L 2OS7A 3WNPA 1MI5E 3KLAA 5B3NA 1Q72L 1AO7B 1UXSB 2YWYA 3V4PH 2E9IA 3VGBA 5CCKH 3CMGA 3E6FA 2IPTL 2NY2B 3STZA 2DDQH 2PUQT 4PV8A 4LSPH 4DGVL 4PJHB 2EDWA 3LSOB 1JWMB 5IBTH 3ZZ1A 2YPKB 4MZ3A 3C60D 4I9WE 3VXNB 5I1JL 3T2OA 2P5ED 2M1KA 3MA7B 4YK4C 2X2YA 3D85D 5DQJA 5GIRB 3IAPA 3NOIA 4OM0L 4LL9A 2IMMA 4DVBA 2NNAA 3CH1A 1XCQB 2QKIA 4Y19A 3N50A 4NP4H 2DDQL 5GS0D 5LVEA 4XB7A 1MH5A 5ICZA 1HILB 5GRUL 3F12A 4L4TB 5LQBH 3P2TA 5IHUL 1FH5H 5T5NG 3RGVC 1YEDB 4ODWA 3F7PC 1BBJA 1KC5L 5CP3A 5EZOH 3T65B 3L7FA 4Y2DB 1HI6A 4LK4A 3NAAL 5M94B 3D2UA 1UKTA 4G8GE 5D7IE 3L3HA 4PP1D 5IG7A 3C60A 4OBSA 5L2KE 4XNXL 1HHHB 4KKCC 2BVOB 3KR3H 4QTIH 3DI3B 4PJXB 3LN5A 5EWIL 4GW1A 4E41A 3D18A 2YBRA 4PUBH 5DS8B 4DK3A 1K8DB 2CKBA 1VADB 1DUYB 4OZ4B 3KYOA 5EU7E 1WEJH 4YUEL 3OR6B 1AGEA 1V3MA 2EYTA 2Q86A 4PR5A 5D7SL 1Q94B 5DGRA 3ZE0E 4LQFL 3H2WA 2X42A 3DMMA 4LSQH 4LCYA 5T1DH 1I1FA 4M00A 3MJ6A 1A7NH 4RBPK 3NIFE 4LSVL 4D8PB 1ES0B 3GJFB 3RU8L 4R9HA 1ZANL 1NSNH 5F6HI 2DI9A 1PYWA 2VQUA 4YXLL 2D31A 4XMPL 4IRJD 5HVHC 4NRYA 3MV11 5IVZB 3N1QC 1NCCH 5TDPA 4O5LH 1KOAA 3NN8B 5JORA 2JK5A 2D0HA 2FDBP 3W5MA 1H8NA 3B9DA 4RSVA 5DJXB 3QCVH 3WNOA 4Q0XL 1NFDB 1SVZA 4FQ1H 5E94B 3K2UH 1L7IL 3ZHLA 1Z9SA 2FGWH 5CBEB 3RVWD 3UZVB 4L3ED 4E0RA 1A21A 4QHMB 1KLUA 1Q8MA 4X4YA 4XPHL 2LFGA 5I0DA 3NACL 4XPTH 4UV4L 3KHQA 5IHLB 2IAMD 4HAFA 3CLFL 4LQ1A 2J4WH 1J18A 1ZLSL 4JHAH 4KPHH 1ZS8A 4J3XA 5GGSB 3TVMB 1S8DA 4UNVA 4MB3A 3K8KA 1PG7X 2DQEH 3T77A 3GI8H 1DANT 4PYGA 3VGDA 2DJ4A 2ZKHL 1ZTXH 2QSTA 4J6RH 1CICB 4M7ZC 2R0KL 3CLEH 1CXLA 5DSCA 2YPLA 2H2PC 4AG4H 1AGDA 3NBNA 4J12A 4P4RB 2CKNA 1SMOA 3MBEA 3T0VA 1A1MA 3QHFH 4XB8A 3GMRA 2GK0B 1KB5A 5GS1B 5D7IA 4PRHB 4NQCB 2H26A 4PB9H 1R5VA 2A6KB 4JRYB 3NFPB 1NDMB 3SCMB 2VL5B 4UB0H 3BZDA 5FCSH 2DBLL 3CLEL 3MRPA 1BLNB 5J3HD 4WI8A 3HMXL 4D9RE 3M17B 3MOAH 3MZTA 3PABB 1AQDB 4KKNA 1P4IL 3MRDA 1Y0LB 2UUDK 3IDGA 4NDMB 3CMOH 5L6YH 3I02B 1KV3A 3IDXH 1FP5A 2VLKB 1FNGB 4NZRH 4HUXA 4Y2DC 3MOAL 4G8FB 3QIBC 4OAWA 2EO1A 3K3QA 1RVFL 2VQ1B 4PLOB 2WBWB 1NCWL 1E6OH 3VFUB 1MHEA 5J7CC 4KDTC 2A9ML 2HP4A 4URTB 3EYOA 3VFUA 1TETH 4OZFB 1TVBB 4PJBF 3IDMA 1J10A 4XCCH 4D0DB 2R2CA 3IVKA 1JPFB 4MAYC 2FJHA 4ZFOA 4U33A 4YNYA 3FOLA 4WW2B 1NCWH 2XT1B 3FMGL 2H1PL 4MA7L 2CDEB 3CIQA 3BDYL 5DJYB 4GMSH 4WUUB 4X0KA 4W81A 2DQGL 1YEGL 4JDVA 1F45A 5KSAD 4FP8H 3X12A 1W8OA 4PP2A 5C0IA 4RFNB 5E08L 4XCYB 4P0DA 4PGBB 1T6WA 1EMTH 1KCLA 1N64L 2XA8L 1CXKA 1A8JH 3Q1SL 1WGOA 5T1DL 2W38A 1T1XB 3S36H 4ZDHB 3IDJB 1K6QL 1PBYA 2EXWD 4NKDA 5GZOC 3LV3A 2ICEA 1ZHLA 4JFXB 2BNRB 1FHGA 5I1DB 1YQ2A 3UJTL 3FZUD 2AABH 2PO6B 3PWNB 1N64H 2XA8H 2IG2H 3A67L 4O4YL 4E42A 4V1DE 3OKYA 2Z8RA 2ZOKB 5FUZL 4QRSB 3CNKA 5JDSB 1M71B 3LKPA 3OKMB 5ESAB 5DJAA 4BQCA 1IM3A 3JV5A 3O2VH 4FQQA 2AJUL 1C5CL 2R0ZL 1X7QB 2YPLE 3S3PA 3ZE2F 5EC2B 2BVPA 4U2ZA 1I9RH 4Y4KB 3D25A 3KPOB 4OSUL 2Q1EA 4HDIA 2GAZA 5I1AB 2IH1A 5E2UH 2VSCA 5JIIA 3O0RH 3HHRB 3SGKA 2XTJC 4JRYE 1RZ7L 1VGKB 2HH0H 2ZUVA 4RMRA 3S5LG 5LG1A 3TBVB 2Y36H 1S5HB 4FHBD 1XIWB 2AV1A 2DQFA 5DJ0A 2C3HA 5HI3D 4QNPE 5E99H 4GG6A 3A6CH 4YE4H 1IILE 3OGCB 5C2UB 5HHXH 2CRYA 3MGOB 3CU1A 3P4NB 1G7PB 4WCYL 4JB9H 1KTLB 2EKJA 4I0PC 4LRIC 3TT1L 4K55A 3EJYD 2VDML 2Q76A 3VGAB 3QEQD 3BEVA 1CLOH 1N7MH 3A6CL 1P84K 4S1QL 4MA3B 1WFOA 5D1QD 2WLZA 4OI8A 2BVYA 4WDIB 3P9LA 1ZMYA 4JFOB 3JXAA 4UB0L 1AXTL 4Q9RH 4XXCC 2V2WA 1ZHNA 4JN1H 2YD2A 3EHBC 1FC1A 3QUYC 5GRUH 5IK3A 2CIKB 1IKNA 4R4FH 3CDGA 2MWCA 3VD3A 1S7RB 2J8OA 3RVTC 2W59A 2H9GB 4GKZB 4LLYA 4JR9L 1Y6NR 3TO4A 6CGTA 4R2GC 1XF4A 4KY1H 2P5EE 5CEXA 1AXTH 4NKOB 1LO3L 5FCUL 6FABH 4HUMB 4IRZL 1UB5A 1W8NA 4H26B 1N2RA 5DO2D 3GI9L 4U1SB 4DGIL 4KXZI 5JLZB 3QDMA 5HYFA 4V1DA 2DWDA 3LD8C 1FO0B 4X7CC 3M07A 4X9HA 5M7QA 4PJFF 1UH3A 3BKMH 1FQ9C 1XF5A 4P2RE 3S97C 4BKLB 1FJ1B 3O2WL 4XBPA 5F9WB 3O2DL 3P4OB 4NFCA 2J3SA 4LKXB 2DQIH 5EUKA 25C8H 3QUYD 1F4XL 1YY9D 2EIBA 2FX7H 4WENB 2H1PH 4KTEH 3DYMA 3MNZB 5I8CA 2HWZL 5HDBF 2BRRH 3VRIA 2VLJA 3ZDZF 5CBAA 1HHGA 3FQNA 5LKNA 3VD5A 4NCC2 4UMGA 3ROLB 4MJ2A 1CFSA 5ECJE 3BMVA 1QD0A 4YXLH 5DVNA 5IWLC 3ARED 3C87A 5HYJD 5C07B 3BGAA 4OZGF 2PXYA 1TZIB 2NW2A 3KDMB 3TBYB 4N68A 3WFDL 2ID5A 4OV5A 3JVGA 1QFWH 3SJVB 1FVCA 3HZMB 1GYAA 1JUFA 3AFLA 3ROOB 3RJDA 3SE9H 4APQA 3MRIA 1MQKH 1KJ3H 1BFOB 5ADOL 1GPOL 1T1ZB 4FXGB 2XZQH 1NANH 5CJQL 1P69B 5HVFB 3RKDD 2OR8A 2CLRB 4CJ0A 4OF7A 2UYLA 5C8JB 1C12B 2Y07L 3QQ3A 1GHFL 5I15H 4QTHA 3L3OA 2ZUTA 1BJ8A 3CFKA 5EBMB 3CSPA 1XR8A 4H1LB 2I60H 2DWDB 4PFEA 3SGDH 3FQWA 4YPGB 1D6VH 2VIRB 2R2HA 1KJ2L 1XCTB 5I1IL 1AGBB 1MCBA 1G0XA 2Q6WB 2PN5A 1CGSH 2HH0L 3PP4L 5EUOE 1KIPA 1MCDA 3DTXA 2VR4A 1INEL 2V5MA 3T4YB 4L8DB 5D2LB 2R0KH 3V4VH 4NNXB 3RVVC 4OZHA 3QEUA 3G04A 4IDLA 4G7VH 3OZ9L 3RZCD 2HJFB 1WF5A 2HG5B 4F7MA 2VABB 1CGVA 1W72L 3D69B 3L6FA 4XCEA 3K4ZA 4UOW0 1IGTA 1JE6A 1XGRB 4K07A 5KW9L 3GSQA 1I8KB 5ACMA 4ISVA 4X6CE 1EO8L 4P2QA 4HPYL 1ZT1B 3BP5B 3SDAD 5FA4A 5HDBE 5IM7A 2VERN 1GSMA 1JN6B 3AXLB 4MX7A 5JW5B 1I4FB 3PWLA 3EJZC 4WWKD 1QFHA 3C08L 1JIBA 4G6KL 2V2TA 5C9JB 5ID0B 1HXYB 4D0BB 5GJSH 1FRGH 3FN3A 5FGCB 4R7NA 1JF1B 2I5YH 4G43A 4Y5YA 5D70H 5KVDH 3RWHA 1S7QA 2BNQE 1INQB 4JR9H 4P3DB 4G9FE 4KZDH 2QQLL 1BZ7B 5DQ9B 1TETL 1RZGB 43C9B 3K2MC 4G8GA 5T3XL 5TJWK 4MQ7A 3HE6C 4WRLA 4IJ3B 4JKLA 3FT4B 3VFRA 1QLFB 1SJEB 3ULUF 4NO2B 1M1SA 3MBED 1IZJA 3OAYH 4O58L 1U58A 1ZGLB 3UCRA 2BVQA 1NSNL 4IOSD 3T04D 3JWDC 3RWJB 5DJDA 3B2VH 4JQIL 5DEZA 4BH8A 1IM9A 2YD9A 1KN2H 1M71A 4BYHA 4Z7UE 3MLVL 3OGOE 1BEYH 3OBAA 4U6VH 1CFTA 4GKSA 3VXUB 4NM8L 5DYOB 3VE0B 1DQDL 3TYGL 2W0FB 3UTQB 2VLJD 5JR1L 3RPIA 5I9QB 3UBXI 4KI1A 4JZOA 4XTRD 2P24A 4HEME 1KTDA 2YPVL 3ZTJG 4JGMA 4NNPH 1VFBA 3A6BH 4AEFA 4DOHB 1DQQA 1CGTA 3PQYD 3PWUB 3V0VB 4H0GA 3QFJB 4PJ9D 1PEZA 1PSKL 4O2EB 3CFEA 3C5JB 1OWRM 4X6DA 4OV6F 1NAMH 5A2KH 4X0KB 1IGJB 2VXUL 3SE4C 3PV6A 2QTEA 1ZLSH 1JWSA 1A2YB 2YN5A 3DXAD 3SE9L 5FKPB 2EH7L 4F37F 1T20A 5D7KE 3S4SA 1PSKH 2P42B 2D3VA 1JPFA 2NY6C 2XXCB 2ICCA 2HFGH 4ORGA 1KG0A 4XVSH 4NKQB 1Q0XH 4X6CA 1FL6A 4PJAB 4PY8J 2KH2B 4R7DA 1ZLVH 4X4ME 4OZFA 2NY7L 2VXVH 1NH6A 2GIYA 1MCOH 1UT9A 4U1LB 4NRZB 3GSRB 3TPKA 4JJ5A 4XNZB 2KBGA 3NGBC 1IE5A 3V0AC 3P9MB 4YC2C 2VQ1A 3JV0A 4KK9C 2NY0B 1SVCP 2GT9B 1LK2B 4GBXA 5ERWA 1WT5C 3QRGH 2EZ0C 2HFTA 3BSZH 4PRAA 1INEH 3VDAA 3VCLA 4KAQH 5FGCE 5D2LF 5I1GH 2LQRA 3I02A 1QEWA 1XGUA 4OTXL 3HPJA 1DBBL 2DYPD 4PJHF 2EDEA 1I85A 4MDIA 4X6EA 1P5UA 5DK0A 4AENA 3GJFK 2MOVA 2VL5A 2AERT 5B3JF 5I66B 4PPTA 2DRUA 5KAQG 5GGUB 5DMJB 2WNGA 4LPVA 3CD4A 5GGRB 5ANMB 1OP5H 1BD2E 3QHTC 3V6OE 3LIZL 1M7DA 1H3UA 4YWGL 4YR6A 5KOVC 3VI3F 3DXAB 4OCRH 1FL5A 4P5MA 2HTKD 3HTLX 1F02I 3U2SB 3FO0L 5C09B 3UBXB 1BQSA 1WIUA 4J23A 3UTZB 5IGXL 4L29A 4ZS6D 2Z35A 5E1AB 2EC9T 1DSFL 3FOMA 4HHAB 2ERJB 1U8KA 2HKHH 2WBJD 4EN3D 1GXEA 5KG9A 3K46A 2ZOLA 2CLVB 4YH6A 4QHMA 4PJ7B 5B38G 2DQIL 4LLWB 1EEYA 3GJEA 1K8IB 2A6IB 3VXRA 3NCCB 4JO2H 3GNMH 1UWGH 4JHWH 3RZCA 3RWCA 4Y2OA 1OAZH 5ITFA 4PREB 3ZKMD 4U2YA 5JOEA 3AUVA 1IC5L 1NUDA 1S9WA 3AROA 2DQDL 3O8XD 5EO1B 1QFUL 4QRRD 2XWJA 3L5IA 4BZYA 4CVZA 4Z8FL 2VISB 1CGXA 1F00I 1S9YA 1K4DA 5C0EB 1ZLUK 4AK1A 4IMLB 2X1OA 3REVB 5IEHB 3RTQD 1QLFA 4KROC 2PO6C 4G9FD 5GJTL 35C8L 1CCZA 4JQXC 4N9OB 2DICA 2VXSH 1JZ8A 5D7JA 5BOPA 3S35H 4UIMB 4YDKH 4OCSH 5I73C 2GJZB 3LB6C 1XZ0A 5HGHA 1Q1JL 1SYVB 5J1SC 2Z91A 1A4KB 3QIUA 4N0YL 5D1QB 2WWMC 5DJCA 1U8NB 5L2KB 2Z93A 1JYXA 4K7FA 2I60L 4HUWA 5J0BA 5IUSA 4YDLB 4UQ2B 5E6IC 4G8GD 4PJXE 4BM7A 1KJ2B 5DMKB 5E99L 3ZDYE 2BJML 3BN9D 4PJXA 3BZEB 4WVRA 2NY3C 3RNQB 5EOQL 4NQEA 1MJ8H 1CGSL 1YN6B 5FA3B 2R69H 3PL6C 2H2SD 2BERA 3WS6A 3QZWG 1U0QA 2GTZB 4XBGB 2F8OA 4PRAB 3L7EA 1M7IB 5EU3B 1P6FA 4M4RA 3RTQC 3QO0B 5E5UB 3TNNA 3DGGB 4UT9L 4M7JL 5ANME 4Y8DC 2BJMH 1WBZA 3QFDB 2PCPA 5MI0B 3UJJL 1V7NL 5GGTH 1RUML 4JCLA 5C3LD 5D9SA 1NMBL 2EXYD 5C09E 2MKLC 1OTTD 2WLYA 2EYSA 1OWWA 1FPTL 5FOJA 3RGVD 2A2QT 4BUGA 1DFBL 4Y16A 4AEIL 4NBXB 1T6VN 5FKPA 4JFDA 3UPAA 4AM0B 4OJFH 2R1XB 1NFDE 4U1IB 1DBAH 4OCYH 3ZKND 4U31A 3VFSB 1IAIM 3BE1L 3D85A 3QDGB 5IQ9A 1LEKB 2JELL 3CFKB 4PJCE 3SCMC 5E2JA 4Y2DD 1WIOA 5DR5H 2EE9A 3IXAB 4UBDD 3QUML 3H9SE 1EGJL 5B39A 1T22B 3BQUA 3S88H 2JIXD 1E4KC 1NCAL 1FV1B 2P24B 1E4WL 1F3RB 2YZ1A 3LRSA 3NTCL 3V9FA 5ISZD 5GISL 4NQDE 1VKXB 3I6KA 2W0FA 1VESA 4ZMAT 1OCWL 4PJ5D 3VD4A 2XQBL 4NN7C 1CDHA 2ARJB 1IGYA 3OQ3B 4HG4J 4GMTL 5KOMC 3G6DL 3K4AA 3RWJA 1T1YA 5DWUH 4RGNC 1J7VR 1A0QL 3JTSA 4D3CH 3H7BB 1PX4A 3Q5OA 5HTSA 1U42A 3BP4B 3FT3B 5CINH 5F1KC 3H0TA 1WC7B 5C09D 3SGEH 3DURB 3QI9A 4YHYB 2X89A 1HZHL 4PGJA 1JVKA 3VFGH 3I6GB 4MAYA 3NABH 5B21A 5J6GB 3PWVB 1UA6H 3ZKQD 4AJ0A 3O6KL 4P23A 5JA9A 2D7OA 3KNBA 5A3ID 1ZA6A 4PRBB 1ZT4A 4RNRB 4X4XB 2NY3B 4Y4KC 2FB4H 5IR1A 4UNUA 5C6WH 4IM8A 3SE8H 1FZMB 4NZUH 4QGTA 1N0XL 1JMXA 4ZTOL 2EZ0D 4HFWB 5HHPB 3E3QC 4HFUH 4MQXC 5C0DA 1CZ8L 3V7MA 5IBUB 1VFOA 5F88B 1YYLL 4Y5VC 4OLEA 3W5NA 2VYRE 3CXDL 1N2RB 3SDXE 1OSZA 2OZ4H 5JXEA 3EGSB 1JNNH 2YK1H 1RK1A 4R96A 1VDGA 4X9IA 2HA1A 1G7IB 5E00A 1ZEAH 5FGBA 2IQ9H 3MREA 3JWDL 4QXGH 4JFHD 4HFUL 4GS7B 3JV6B 3P0GB 1RD6A 4LLQA 2DM7A 3JWOC 1OTUC 4QRPD 5GGVL 1HINH 4FTVD 1Q9WB 4LVHC 1J11A 3WE6B 3IJSB 2EIEA 3F7QA 4JO4H 3TIEB 3MV9A 2QV2A 4JG0H 3IU4L 5AYUL 3VWJB 2IH3A 4NWUL 3UPCA 4M6AA 1IC7L 4FABL 4XWGL 1TITA 2ED9A 2XNAB 4M1CC 3VDCA 1T2QH 3PNWA 4KGLA 3RVUD 1A1NB 4XPBH 3O3DB 5I1GL 4PRNA 5EZJB 5CWSB 4RMWA 5DGQA 4IOIB 1REIA 3P11L 4HULB 3ARBC 3EYFB 3IJYB 3RVXC 3IS0X 4GG8A 4I0PD 4BFIA 2YA0A 1JHKL 5CHNB 4FABH 4NO3B 2BOBA 3IFNL 4F7CB 3LKQA 4P46A 3RIAK 2IALB 3OKDA 5IMMB 3T0AA 3DPBA 1WFUA 3IDIA 1IQDB 5IR1B 3NVQA 2AV1B 2EC9U 4M03A 2FX9L 1U8MB 4F2MA 5F1NB 1XF1A 1UWEL 4K7PY 1J8HD 3W0WB 3VXMA 1RUPL 2OJEB 2W60B 2E9JA 4JM4L 1CK0H 2ZSVA 4PTUA 1FIGL 2X4TB 4DFHA 4DVRH 5DC9B 3MLUH 4V2BA 1RHHB 1WBYB 2F53B 1VENA 2JB5L 2NW3A 4DUVA 3SDCA 4QHNB 4PJDF 3VXMD 2VN4A 4FQQB 2E6JA 3RVXD 2E8ZA 2H3NA 5MEPB 3Q6FA 1S78C 4Z0XA 4I0CC 2OTWA 1JGVH 4HKZB 1M05B 4H5SA 3KYKL 5SV3A 3VJ6A 4R97C 2JB5H 3S7GA 3R4DA 4PJ5A 2AGJH 4MXVF 2XY2A 4U05A 1MFNA 1OARL 4L9LC 2AJSH 4L4JA 3FQXA 1A6TB 4HKJA 4HKBB 1BGXH 1YPZF 1UM4L 1OW0C 5F3BA 3ARSA 5B39B 1A0QH 2VLRB 5BMFL 3HE6D 2YN3A 3DV4B 1E4XH 3TYFB 5E1AA 1GGBH 2XPGA 3HG1A 3VFNB 2OI9B 2NXZC 4JRXE 4XMKH 3C5ZA 5E03A 4H26A 4ZQKB 5MHSE 4IBLT 4JPWL 5TFSH 1VFMA 1LNUB 3OJ2C 4YNYB 5FHBH 3N85L 5AYQA 3FTGB 3PQYA 1E27B 2NY6B 4NJ9L 1GC1H 1VFUA 4U6XB 1AIFB 2P5WA 4HX1B 4HXBH 3O2DA 4JY6A 3O6FB 4XNUH 2MKWA 4M7KH 4MYWB 3GIVB 1IARB 2AJVH 4LSTH 3ARFB 1AGCA 1NMCC 2XWBB 2AI0H 3BP7A 5LAXA 1IT9L 2OLDA 4OF8A 1JWUB 3OAUL 5I1LA 1JFQL 4LVHB 4MNHB 5GRYA 1BFVH 5LCVL 4I1NB 1Q9KB 1J0IA 3BJLA 4FQHB 5EN2B 3GB7A 3O4LB 2VE6A 1OD7A 2AXJA 4XBGA 4Y1AA 4G6JL 3PIQA 4RA0C 4FQXA 4D2NA 2PKDA 4MSWA 1XIWD 3U83A 5IB3B 4JQXA 1YMMD 1W72A 2F15A 2BY1A 1FYTB 1YNKH 1JHLH 3B83A 4OTXH 5F9DC 1D5XB 2APBA 3MV9D 1QYGH 1F3DJ 3MTRA 3MC0A 3FAWA 3LAFA 3MNWB 4EUPB 5IMKB 3V4PL 1QO3B 2EE6A 1BOGA 3QCTL 5LAXB 1XIWA 4NQCA 1BM3L 4RMVA 3RDTB 1JPSL 4KI5E 1LO5B 1T83A 4MXVE 1I7RB 1AGDB 1X4XA 3F7VA 2BDNL 2Q8AH 2ATKA 2LU4A 3OTTA 3BH8A 5CMAA 4HDIB 3IFNH 1KELL 2AK4A 3T2NL 4N0CD 1YEKH 5H2BA 1T66D 4QHUB 4ZUTB 1S9YB 3ZE1E 2ICWB 2MQ0A 3RA7L 4YQXL 3EZJB 1JZ6A 4PB0L 4EI6A 5E8EA 1OAQL 2HJKA 3BESR 3QEQE 4RISL 3HUJE 4NO0A 3CUPA 3PHOB 3CFEB 4QRSA 1A6ZA 2NXYC 1CVRA 2E27H 1WWAX 1GOHA 4Q6IB 3MRRB 1BD2A 2X70B 4JFYA 4XZUA 5F9OL 4XI5D 3I3BA 1NBZA 1VFBB 2GJ6A 5K9KA 3RWCB 4X8XA 2J6EA 1SBSL 1NGQH 2E7BA 5GRJL 3U79A 2R39A 3P4MA 1T21B 1T5XB 1ZVSA 4M6ML 3RVVD 3T3MF 4X6FA 5L7XL 1MHHB 1I8IB 4W68A 4CW1A 3ULUC 3BWAA 2X70A 4HMDA 4NUJB 3IRZA 4KVNL 2XRAH 4Z7OE 5EFIA 3LQAH 5D8JL 4XPAL 1OT2A 4NRYB 5IVZA 4Z0BH 3LHPH 5FYJE 4P9MH 5L88L 2BSTA 1CDBA 1NGZA 1WICA 3X13B 5CINL 2CDEA 4OZFH 4XNYH 4ZS6C 3QPQD 3GSVA 1QFPA 3PP3K 1L0XA 3NIDE 4KVNH 3GSOB 1HWHB 2X4QA 2ZZUT 4FG6D 4P5KB 4MQ7B 1P4BL 4ODVH 1RJZA 1YJDH 4ERSH 2I07A 3LEVL 3ULUH 3F7VB 3G9AB 1H5BC 3T4AA 1P4LB 3W0WA 3MV7D 3G6AB 3VI4E 3U7WH 2VXSL 4R4BA 4TTGA 2RJMA 3BZ4B 4G80B 4RWHA 3CFCL 3ULSB 3SJVD 4Y4FB 3ZKMC 3QG7L 3TJHD 1U2HA 3G08B 2R29H 1FYTE 3BO8B 3HNVH 4XBEL 3N85H 2CK0H 3FJTA 2AXFB 2GCYB 3D9AH 3U82B 5IFJB 1GIGL 3S3JA 4CUCA 4ZUSA 1DQMH 3KPRE 5ILTL 3PWLB 4M48L 2X4UA 1A6VL 2D9QB 3BHBA 5MEND 3VGGA 5CIPB 3IKCB 1FZOA 3BPLC 3EDEA 5C7XL 4P2QB 1DEEA 2ZPKL 5J1AB 5FYKU 4ZOEA 1TZHA 1JF6A 1FE8H 1KPUB 5BOZG 3SDDD 4MXQC 1OQXA 4HG4K 3DX9A 3WIIL 4IDJL 4OQTH 3QDGD 1UZ8A 4OZHB 2E7LC 3CVHB 1L6XA 3UO1L 3VGAC 5HYJE 4N90D 2PYFA 1CBVL 1ADQH 1YNKL 4S1RL 3GSWB 2A6JA 3EYUH 4CVXB 1KPVA 3IFLH 3OXSA 1QBMH 3HG1D 3WMSA 3NMEA 4RAUB 2WSKA 1X3DA 2PO6D 4F9PC 4O2EA 1ADQL 3D0LB 1FNLA 4C59B 2WQ8A 1NCDL 1II4E 4LARL 5ITBL 3U1SL 1VACB 4GKNB 3V6OC 5HDQH 1NBYB 4RNRA 1UWEH 3GHEL 5M95B 5A16B 3VRLF 5SWZE 4HWZA 1K2DA 3LZFH 4KJQD 4WHCA 5D2NB 1I85C 3TLRA 1LILA 5T3ZD 1TVHB 4UDUB 4JFEE 3VJ6B 1R6VA 3VH8A 4HKXA 4P59L 5DJ6A 1LQSR 5GRZA 4FRWA 1Y18A 4WU5B 2CXGA 5KZCB 2BVQB 3KDMA 3TBYA 2ZSWB 4ZO6A 4LHJB 4XWOD 4OCXH 3TGXA 4LEOB 5DRWB 5E8PA 1SBSH 2F58H 4G9DB 3HR5B 4LIQH 3IDYC 5CJOH 1IL1B 1A7QH 2J8HA 4P2OA 5J12B 1MPAH 1HHJA 4OCMC 1FO0L 2C26A 1EEZB 2BOCB 1TZGL 4NQVA 5SX4I 4KKLD 4DEPB 1U8MA 1QRND 3QEHB 1YEFH 3SKUD 3TT3L 3QP3A 4GUPA 4W6YB 3BRGC 1A4JA 2V5RA 4M6OH 4PJGF 3SE4A 1A7QL 2AJXH 3HG1B 4H25A 3S36L 1CD1B 2Y06L 2G5BB 1TCRA 3QYCA 4NQSB 1G7MA 1MWAA 4U7MA 5DD3H 3HC0B 1XIWC 3G9VA 3EYFA 3IJYA 4FFZH 5IVNA 1J8HA 5ETUB 4N8CH 5D4QA 2WBJA 1FVEA 2IGFH 2V7NA 4GW5B 4KHXH 4YX2H 2P7TA 2X4PA 3QQNA 2FGZA 4H8WL 4V1DD 4LLYB 1MIMH 4GW4A 3QXAB 2NXZB 2IH3B 3F8UB 2ORBH 3QG7H 2L0DA 5CZVH 5DDHA 4YEFA 4QRRB 1N8ZA 4KDVA 2KDGA 1S9VB 4TULH 5EIQA 1HNFA 1BF8A 1SYSA 2NY5H 4N5UA 3V6OA 1DQML 2CUIA 4UV7H 1KT2B 3HNTL 5MENB 2RCSH 1RUQH 3QEQA 4K3DH 5TDNA 1ETZB 4QWWC 4NFBA 3UX9B 4GW5A 3JV4B 5E5MB 3SKOB 1RK0B 2XN9E 3IT8D 3X17A 5DMGC 4TUKH 4LVEA 4ZD3H 4CN1A 1FCGA 4QGYA 5T3ZE 5F1OB 1IC1A 1MWAB 1QG3A 5E9DD 5J11B 5C0DB 4JFDE 4NYLA 3MBEC 1X5JA 1FDLH 4K7FB 5HVGB 1WCQA 1XGPA 1IQDA 2JLLA 3KXFD 1OGAD 5K9JL 1AC0A 2QSVA 1ZWIA 3BXNB 4XWOC 5BZWB 3IFOA 1Q38A 4KUCD 4F58L 4ZD3L 1XZ0B 1R3IH 1ED3A 2WM0A 3DV6B 2CRIA 3U7YH 4B50A 5CEYA 5BRZD 3ARPA 4YGVA 3T09A 5I75C 1F90H 8FABA 2A73B 4MB4A 1C8PA 4GRWB 1FH5L 3ZT7A 2C5DC 1JUFB 5A43C 4S1DD 2FH8A 2HLAA 1EO7A 2GAZB 3SJVA 4MAYD 4Q6IC 3VFWB 5C0BE 4RFOL 4C56D 2J88H 4JFPA 2NW2B 3OMZA 4G42A 2Q3AA 2DLHA 5J1TC 4TRPH 1PKQE 3DUHA 1RVFH 4RISH 4LVNC 5J57B 4J4PA 4X6BA 1D5BA 1YZZA 2EEAA 3KHOA 4UIKH 4U7KA 1P84J 2AJZA 1CFNA 4HT1L 5AUMA 1Q9WA 2MPAH 4P48A 1CIDA 4NSKA 3HE6B 4U1GB 4EN3C 3X11B 3ECBA 4MNQE 5AG8A 4GAFB 4XP5L 3MREB 4AL8L 2JJTA 3D87B 5J6HB 3IB4A 1A1OB 3DOSA 3FONB 5C0GA 2FJFB 1I9IL 3NIDF 4OFIA 5BVPL 4A6YB 3ZDYF 1YQVH 4JVUA 4L8SC 1J1PH 3W2DL 1ACZA 1R3KB 1MVFA 5E9DB 3QJFA 4XGZA 3QUZD 4HMEA 3ARFD 4KMLB 4EXPX 5HYSA 4JAMA 2J6EL 4MS8C 4FQCH 1NUGA 5D7JC 5A2JH 1XAUA 4OZGA 4K7PL 2R15A 4QOKD 4GRLB 4QRTB 4MWFA 1KULA 1NC2A 1J1PL 4MMZC 4NQVB 4M7ZB 1GGIL 1YN7B 4ZAKD 5IVXF 4HH8A 1SMAA 4GKZA 3SKMB 5FHBL 3T0DA 4ELMF 2IG2L 4NOFA 2FZ3A 1ZT7B 3GHBH 3DURA 4HIEB 1MCKA 1ZHNB 3GKZA 3BZFB 3RWFA 2AJ3B 2AQ2A 5CSGA 5TPWH 3BUYA 4JO3H 3SE3C 3HRPA 2AJVL 4LSTL 2DKSA 4PJEE 4XX1G 1XEDA 3GKWH 4TQEL 2EXWC 1YPZA 2M26A 1UM5H 4EDXB 1DE4B 4PS4L 2A74B 4K8RL 3N0PB 3B9EA 5ADPL 5FOBB 4TVPD 5DVOA 3BP6B 1DANU 3BEWB 1DZBA 3D6GA 5CJQH 2DQEL 3RNQA 3MRDB 1A6VH 4X9GA 4DQOL 3EJYC 3ALXA 4HK0A 3OKLB 1ED3B 2OI9C 1KGCE 2DIBA 1I3VA 4D0CA 2ZG2A 4RGND 4GG6B 1MELA 5KSBB 4NCDA 3LQAC 5TE6H 4J4PC 4ZYKA 1XF3B 5DHYB 5GPRA 3RWIA 1A1MB 4LPCA 3U6RB 2R2EA 1I1CA 3GRWH 3WO3B 1A6UH 2C9AA 1G9NH 3AY4A 1CFBA 3IETA 2AEPL 3V52L 3BH9B 1RK0A 4CU6A 4LVOB 2ADJA 3IDUA 1A7RH 5MERA 4I18B 1AGFA 1U3HC 3P73A 4I2XA 2VH5H 5MENA 1JPGA 5TH2B 1NGZB 4LMQE 1MIEL 1A9BA 2NTFA 1OAUL 5FDYA 2F74A 1JPGB 4JREB 5I8EA 1MHCA 4MQTB 1T03L 5ESAA 5FYLL 5IFHL 5IBTL 4F7TB 3L3KB 5JDSA 3RBGA 1CIUA 3X3FH 1FLRH 4KRLB 3QFJA 2J5LC 2UWEA 4PY7B 3KYNA 4X6FB 3V7AG 3LB6D 1G6RB 4B53A 5L8KB 3RZCB 2WK2A 4WI5A 4NP4L 3WD5H 2A6IA 3VXRB 5DJ8A 2FSEB 5E94A 1NBZB 2BNUB 1I8MB 4YUEH 3CFDB 1A3RL 3O9WA 1WAAA 2V9TA 5KSBA 4GKSB 2AXFA 3LPFA 5DZOA 1TCRB 2PYEB 2JK5B 3BI9X 4IRJA 1WUNT 4UQ2A 1U3YA 2BSED 2ZG1A 2OK0H 3VXTB 4TUJB 1KYOJ 5ESQA 3BKML 2HFEA 4XPAH 4NO2A 3OAZH 1CT8B 4PJGE 4KXZH 5FDWA 2E6PA 5CMAB 1U9KA 4HZAA 3ME0A 1YPZE 1MCPL 1AQKL 1R24A 4FTVE 5BVPH 4YK4B 1H3XA 4QHLA 2DQHL 3RIFF 1JTPA 4ONHA 3SDCC 1LMKA 3WDHA 3KS0H 3E8UH 4XPFL 4R0LC 4EI5A 1UGNA 1J0YA 2CKBH 2FEEI 3GMPB 3VFOB 5C0EA 3TPUB 1T7VA 4PRID 1VADA 4R8WH 2Z4QB 3VFPA 5IV2B 5F71A 2XTJE 3MLVH 5F7FA 4JFDD 2FEEL 5DD3L 2D7QA 3HC3H 3CFBA 4BSVB 2AJYL 4DKFL 2C7UA 1D5IH 1BJMA 5DRXB 1TVDA 2V6HA 3O9WB 4CW1B 2QQNL 2OJZL 3TJEH 3LEYL 4P2OC 3VW3H 1K2DB 1ZVSB 4ZTPH 5SWSB 2VE6B 3QDMD 5DQDH 2RFXB 1AHWB 3SDAA 4K94L 1I3RB 3GHBL 1ZA3A 3IXTA 5E2UL 5HGAB 1UYWH 4OLZL 5FKAA 2N7BA 1DJSA 1MVUB 5KG9B 4L4TA 5C7XH 3OF6A 3CUPB 3K2UL 3GIVA 4ZNCD 5T1LB 2QQKL 3P30L 1EZVY 3UTZA 4MLSA 2NTFB 1S9XB 2O61B 4DVBB 2VZ3A 3BUTA 5IIEB 1RUQL 4QRQA 3PQYB 4JDTL 4XVUC 5LGHL 4MA8L 1CL7I 3L9RB 5C1MB 1FL5B 5E8OB 1U95A 1X5ZA 2YD1A 1JWMA 3L5WA 3OB0K 4K23L 1EGJA 2WBKA 2DBLH 4FFYH 4G5ZL 4PJ9C 4BK5A 2IF7A 2W9EL 2C4FT 2XY1A 4U1JB 2FBJH 4KKCD 3DV4A 3TYFA 2VLRA 1VFAA 5C0AD 2BSRA 3MCG1 4RAVA 5CEYB 4LNVA 4AT6B 4GS7C 4OQ1A 4JN1L 1RZIA 2VZVA 2IBGA 2Q20A 5DC4B 2J8UF 4PGEB 4X5WB 3THMH 5JOFB 3FRPG 3BP6A 4Y88A 5BJTA 3PIQB 5FGRA 3BKJH 4S1DC 4I3GA 5JORB 4OV5B 1EVTC 5C0CE 1YPZB 1X9QA 1J0HA 4WGWB 3RPKA 1DUZA 5DF0A 4R0LB 3L3JB 4BZ1H 3MLPA 3FQTB 5CKAA 1MFAL 3DYPA 2F53D 3HZYB 1L7TL 4OB5H 5IJVB 3WEXB 4UAOB 2X4TA 1HH6A 3C6SB 4NZRL 5KJRH 4R7DB 3KPSD 1W0YT 4Z7OF 4X6CB 3O8XA 1AJ7L 5TF1H 3BD3A 3QQ9D 1VEOA 4X7SL 1P7QA 4F2MB 1H8OA 1NCBH 5FHAL 4I4WA 3JWOL 4KFZC 4PRPE 5MI0C 3IS1X 3QXAA 5EPMB 3C5ZC 4WEMB 3UYRH 3AVEA 5B38A 1JYNA 3TV3H 4CL7A 4Y5YB 1ZAGA 5BS0E 1KIQB 3CK0L 3BAEH 4P46B 4G6AD 5FAAA 4LEXL 2D9CA 5EU4B 1DBKH 2DIJA 4RBPH 3KYMA 5GGQH 3FKUS 1KB9K 5LWYH 1AD9B 1I8IA 3JWOH 3WFDH 5JHDB 3NCFB 1FAIH 2WP3O 3ZSTA 5F7HA 1T5XA 4LLDB 1YEGH 3CVIH 3E8UL 4LLVB 4N0CC 5HHVH 2FATL 4J1UB 1G6RA 4UBDC 4P2RA 4UU9B 2DQDH 2ITDB 2H9GA 4IRJC 2EDQA 3CDGB 3M45A 3QPXH 5ADOH 5CEZL 4NO0B 2BXZA 5I18H 3MOBH 3TH4T 2DIAA 1I7ZA 1F6AA 3DBXB 2VABA 3UC0H 3MACH 3QCVL 1QFOA 4YBLB 1IGFH 4QHKJ 3RBSA 4ONFH 4P2RD 2J8UE 5HYSG 1LDPL 3TJEL 2FRGP 4LKCB 1MF2H 3LMJL 1FNAA 3AGVA 1MCRA 4TULL 3LN9A 4Z6AT 2QR0B 1HYSD 5K9OA 4YZFF 3P3YA 4YE4L 2B8OT 3IETB 5I1EL 1TDQA 4I13B 3VXUE 3PDOA 1UB6B 3NACH 4XPTL 2IAMB 1CL7H 4OCWH 4OZFG 2MHAB 2R8SL 3KAAA 5F70A 4M3JA 3MMEA 1XF3A 4HKXB 2DLIA 5BZWA 3IDIB 1NDGB 3DUSB 2OXGA 3BD4A 4G7VL 4LGSB 5SWSD 3N1FC 1UQSB 1W72H 1BVLA 5H37H 4IIQB 3T2QA 1RZ7H 4J4PD 5EOQH 1ZT4B 4DKDC 4NO3A 1FC2D 4F7CA 3C6LA 2OX5A 3SGJA 4X83A 3BSZL 4BFIB 5ALCH 4ZXBA 4DGVH 3KPSE 2CJUH 3PWPD 4WW1A 5F96H 1TNNA 4L3CB 1JN6A 5GGSY 5A2IH 2E3VA 2RGSA 2N1KA 5JPMB 2FLBT 5GSVA 1RI8A 4MNHA 5BV7L 3RAJL 4ODXA 3GBML 4RFEA 2XWBA 4HS6A 1EH9A 5I74C 3WLBA 3O6FA 3HE7D 1CLOL 1DR9A 4HIXH 3MA9L 2X4NA 5I73B 4KK5D 4LLQB 4L4TE 3TWCH 3O4OC 4HLZH 4P2RB 1F6AB 3DBXA 1AKJB 2Z31C 3WD5L 3LKOB 5I9QC 1NC2B 3G5XA 3LV3B 2ADGB 1T0MB 3P0VL 3HI1B 4P3CL 5F89A 3T08A 1MNUH 3CFJB 1CE1H 4L8SB 3C8DA 4YXKL 1E6OL 4C56E 4JGUA 1L7TH 4M02A 3NFSL 4HFWA 5HHPA 5DUBA 3Q6GL 3EDKA 2VZTA 4LBEA 4KK5C 3B8YA 5TQ2H 3QFJD 1JP5A 4YHLH 3RWGB 4FXGA 1CE1L 1JGEA 3SQOH 1BECA 4MA7H 1OAXL 4UI2A 1IL1A 4HLZG 3ROOA 3KPLA 3TPUA 1TVBA 3RU8H 1WZKA 4ENED 3WEXA 4I4WB 2WIIB 3O2WH 2F54E 4PJIF 1EXUB 1H3VA 1P9MA 4HS6B 5EZIL 1DLFL 2YPVH 2V2WB 1MCWW 4QYOB 3Q1SH 1XMWA 1C1EL 4R90L 3FCTA 4Z7WB 4NN6B 5CLTA 4MA3A 1YYML 2C3WA 3WDJA 2Q76B 5T3XE 2ARJA 1A22B 4WI9A 4DTGH 5EU6B 4XH2B 1UEYA 2A73A 1EO5A 4WEUD 2NY2D 5D2NA 3TA3C 1HIMH 2O5ZL 3I6KB 3MLYH 5FV1L 1RJLB 3LRSB 2VWEE 5CSZA 2GJJA 3M17A 2IADB 3DROB 1KJ2H 5I1IH 3H9YA 4QY8B 1MFEH 4CMHC 3AREC 3UMTA 2GI7A 3KPSA 5DJCB 3IXAA 5I8OH 1X6NA 4L1HA 2H26B 3DYOA 3QDJA 5EOTB 3O6LH 4HIHB 3TZVD 5IBUG 4P2QD 1WAAF 5T1KB 5KSBF 4DZBA 5CJBA 5C0JA 3IGAA 3QR2A 1DCLA 4JM2C 4ALAH 1OTSD 2EDYA 5EDXA 1EAPB 2Q8BL 4ONGH 3LY6A 5E8OA 5EZJA 5HI4D 4PLJC 1R5WB 2M8XA 2HLFC 4Z7VE 1MWAL 1HWGB 4K2UH 4JO4L 4RWYH 4P3WA 3QUXD 1S7RA 3L3DB 1WWCA 4FQJH 2DWEB 4ALAL 1U95B 1I8LA 2VDKH 3TIEA 3E2HC 4DGYH 5DJ2A 2JIXA 4KGJA 1EFXD 1HXMB 1I1YB 3BW9A 1MVUA 4FXKA 4IOFC 5FM5M 4G3YH 1QZ1A 2CUMA 2NY1C 3WCYA 2I5YL 5EO0A 2GY5A 2P7TB 2X4PB 1R3JB 5I1KH 3RWIB 3VFVB 2A38A 4DFIA 2ZG3A 4KJWC 2DI8A 3LIZH 1DVFB 3I6LE 3EGSA 3B9AA 1JGLL 4Y89A 5BV7H 1E28A 3CU7A 2VLKE 4HPYH 5SWSA 3PG2A 4KJPC 4U6TA 5I1KL 1MCFA 1QSEE 5F7KC 2HMID 3VXSD 4OI7A 1RUPH 1QPPA 4RIRB 4KQ4L 5D1ZB 3FOLB 4PJBA 5D71H 1ZA6B 5KJRL 3PDGA 3RY4A 5H8DA 5KZCD 4FFVD 4N1EA 3BUYB 3VRLE 2CO7B 3BP7B 1M4KA 1CLCA 3L3GA 1A7NL 4LSDA 4U1NA 3HZVB 2I27N 1NMAL 4ONHB 5ALBH 3KPLB 3H8NA 4PYHA 1Q9LB 2VR9A 4O9HH 5ESQB 1N5AB 5JW4N 4J3TA 2W9DL 1G1CA 1IM3B 4WUKH 4WU5A 3MV9E 3IFPB 1D6EA 4OZGE 5FDWB 1OSPH 1KBGH 2VDNL 4LNRA 1U8LB 3HR6A 1F4XH 4KTEL 3S37X 2IBZY 3VWKA 3TO4D 4E42B 3CFDA 1N5YL 3U4AA 5AD0B 1ACYH 2DYPB 4KJYA 1SY6A 5ALBL 3CVIL 5HI4C 5CSBA 5DUBB 4P23C 4XHJD 1MCNA 4LSSL 4ODWB 4XTRC 1NAML 1T5WA 3B3IA 2R2BA 3HI1A 1GGBL 1BHGA 3PE9A 5SWZA 3FFDA 4NT6A 5DJ8B 3QUYB 4U6YB 1ZK9A 3FOMB 4HHAA 5D93B 2DAVA 3VFTB 4HGWA 1G6RH 1NBQA 3T0EE 2HJKB 1MRFH 4NSKB 2YPLB 4NNPL 3QA3A 3HCVB 5FK9B 2VXVL 2OM5A 2EYRA 1MQKL 1WZ1L 4QOKE 2QJDA 3WUZA 4KMQA 2EDOA 3HB3D 4UUJB 5GS0L 4D0DA 5B3JE 2FYYB 1MJ8L 3I9GL 1WITA 5DEFB 4JFPB 3WN5C 5GGVH 4OGXH 1X5YA 3MFFA 1IFHH 1CU4L 1N6VA 1I1AA 3UJIH 2VC2L 4UILL 4BQ6A 2NPLX 2J12B 2ESVA 4I5BB 2XG5A 4NWUH 1Q0XL 5B8CC 4EOWH 3DGGA 4NHCH 1SJXA 4DZBB 1NC4D 3IKCA 2RFXA 3WFEH 2NY6D 5E9DE 3QQ4A 2B39A 1DEDA 3V4VL 3IDGB 1JRHL 3S8WA 3PWJA 3OZ9H 2Z8SA 1KB5H 1IM9D 4G6AC 4S1QH 5DJZA 2DI7A 4HC1A 4RA3A 4ETQA 3LS5L 5CSZB 5DJDB 4BH8B 3F5WA 4J3OC 1CN4A 2DTSA 3QIBD 4HUUA 4RGNB 4YHIA 3VU2A 5L2KA 1NBVL 3G5VB 4RDQF 4MA1C 5C0FB 2Z0BA 3GMLB 3TJHC 3T0EC 3JUYA 3RTQB 2GJ6E 2D7TL 5HGHB 1S78D 4QCIA 1DE4A 1IGCL 1EX0A 1HKLL 3E3QE 4HIXL 2NYYD 1FBIH 4WY7L 1NJ9B 1VEMA 3T2NH 4PG9B 3HLAB 3UTTE 1YN7A 1CWVA 4AIZA 4YBQD 1FIGH 3MV9B 2K7QA 2X4OB 1ND0A 3EYQD 4EIGB 4XCCL 2P5EB 2BNRD 4OD3H 1AJ7H 1BIIA 4U3CA 5TF1L 1HQ4A 2Q3ZA 2DQJL 3QWRD 3V8CA 2XQBH 2E27L 5JW4R 3C2AH 1ZS8B 1DL7L 1IQWL 2ZUQC 3RUGF 2M2DA 1MLCB 1QVOA 2PYEA 3L1OH 4LASL 1G7IA 5E00B 4NC0B 3FO9B 1PAMA 1PQZB 1NGQL 4LLAA 5EBLA 1A3LL 3Q48A 1EUUA 4FMKA 4JAMB 4KV5E 1I4FA 4NM4L 1QBBA 2PW2B 3BD5A 1CD9B 2X9XA 1Y6KR 2XFXA 4Y2DA 1PW3A 5EO0B 2R4RL 1CI5A 1SQ2N 2FIKB 4LLWA 1TJGH 3ECBB 4N1HB 1IKFL 1DSFH 2NY5C 5F8QC 4PY7A 5IW1A 3O6KH 5BCAA 1BIIB 3TVMC 3DIFA 3GMMA 4JRYD 4Y5YC 4H5SB 3TH2T 1X5GA 2CMRL 4WUKL 2CDFA 1IM9B 4K3JH 1D5BB 3ZSSA 3G5XB 1P7QB 5L2JA 4QOKB 1LO4L 5E8EB 2H3NB 5MEPA 3BMWA 1HHJB 4P23B 4XNYL 2VZSA 3DLQR 4NQCE 5C07E 3FB5A 3TYGH 1KFAL 4FQXD 1RHHA 4AY0A 4JDZA 1IGFL 4PD4J 2VWEC 1CYGA 3QIWA 4ODXB 1UM6L 4U7SA 1F4AA 4M62L 3QWOA 4NO5B 1MRDL 3RDTC 2OJEA 4O51A 1IGMH 4WNQB 1U93B 3QH3A 5A3IC 3ALPA 43C9A 3NIGE 3QDJB 5EOTA 4D94A 2V9QA 3KXFB 4OZ4A 3BXNA 4PRIB 4Z18A 4F15B 5HHOD 1X5XA 4ZXBB 5GS1C 3C6LB 1GIGH 2VLRE 5ILTH 1BJ1J 1JRHI 3I2CH 1HXYA 1IGML 3K80A 4D0BA 4A2MA 1OB1B 1OM3L 4V2CB 2BVOA 3AY4C 2GK2A 3BISA 1FZKB 3VXSE 2KZ1B 4JRXB 5HHXL 4MJIA 4RGNE 3WIHA 4HQQL 1U36A 2DB8A 3D0LA 2XG4A 4YAQB 2R56H 3TN0B 5DTFA 4L8CB 1U3ZA 4E9LA 2GQHA 3HRZB 3ISWA 4EDXA 3PNWB 3WUWG 3GBNL 3HZKA 4QT5B 1TMCB 1Q9KA 4RCAA 4LFHG 3P11H 5DLML 4Q2ZB 4EVNA 4OFKA 1NC2D 4HGKC 5E7BA 3CPLB 1DVFC 4POYA 1IGTB 2ADFH 2VAJA 5ESVB 3RAJH 1CLYH 2ICWJ 4XVTH 1JPSH 4WW2C 4F7PB 3MNVA 4Z7UA 1SYSB 1UZ8B 3TVMD 4OF0A 1Z0MA 3MROA 1YDPA 4Q9QL 2Y1VA 2HJLA 2XTJB 4R4FL 2JELH 2RBLA 2L7UA 1CF8L 3FFDB 4NT6B 3QB7C 5ICXB 2FHBA 4I48A 4F9LA 3PV6B 4OZIF 3P0YH 3B3IB 4YHOH 2AK1L 6FABL 4XGZB 3ZTNL 3O6MH 1YY8A 2D7TH 1EHAA 2Y5EA 2IPUK 2XXMB 2A6DB 4V1DB 4A6YL 4BH7B 4P5TC 3WFCL 4LLDA 1OOAA 3MLSL 4S1SL 4ZOBA 1OTTC 5DTFB 3GHEH 5I8KL 4MJIB 5KAQF 3BPOB 5IFJA 5DRXA 2DQUL 4M1CD 4FQXC 1A1OA 5HPMB 5DVMA 5EU4A 3KPTA 3EYVB 1IAOA 1AFVL 4U0RB 5KVMC 3IFPA 3K7UA 3MRIB 3B9KC 4HWBA 4B41A 4M6MH 2NY2C 4GXVL 4EDWH 3ZDXE 4YDJA 1VPOH 3KXFA 2FX7L 5KSAC 5IGXH 2AJSL 2LU7A 4X6BB 4EI5B 2CR6A 2ED8A 2OTUB 1MHPL 1EAJA 2X4SA 5EIVA 4CVUA 1RV6X 1KEGL 2HKHL 2E7HA 1A3LH 4TPRL 5D1XB 4WO4A 5L88H 2X4QB 4P5KA 2BNQA 4PG2A 5HGDB 2HRPL 4QCIB 2DTMH 5D1ZA 4KKAD 5IMLB 3HUJB 5CBAB 3GMLA 5KVFL 2AEIT 5KVGL 2G2RB 3FB5B 4PTUB 3EJZD 4WWKC 3U9PH 2I24N 5FO7B 4M5YH 4JPWH 2IANB 5KSUA 3ZYOA 5TFSL 4C54A 2OZ4A 5FUCC 3I50H 5F1NA 3AMKA 3SO3C 1W2KT 1J0ZA 3RGVB 3RX7A 5CJ8A 4MZ2A 4LU5H 5C08A 5JPNB 4Z8FH 1KJ3L 2JKXA 1SM3H 1BREA 5KS9E 3SGKC 1DVFA 4QKXB 3QDGA 3MMEB 1FO0A 3VFVA 1JCKA 3UTSB 1GHFH 3GJEB 1HEZB 4XBEH 4RX4D 2CK0L 2CLVA 5EOCL 4L3EB 3TBTB 4JCMA 2OL3H 3MRRA 5HHQA 1FGNL 3UZQA 2CDGB 1U92B 1XGTB 4OGYH 1LO0H 1P6AB 1NQBA 3RHWK 3BP5A 1NFIA 1EVUA 4ISVB 3WKML 5TH2A 5I1CH 1X5HA 3LQMA 2NY7H 2FH6A 1OL0A 4LCWA 5EUOA 4OUOA 1I7ZB 4CVXA 3NPSC 2WUBL 3F6IA 1B2WH 3CVHH 2JE8A 1BX2B 3TA3B 3JWDH 5J1AA 4LF3B 2R69L 2WIMA 5KW9H 1J1OH 1OT1A 1KPRA 3EHBD 4HIHA 3RDTA 3MUGB 4GAGL 5I74B 1FVEB 4G3YL 1SEBB 4OI9A 5ETUA 4PLKC 5FB8A 1WTGT 4PGZA 5DRZB 3VD9A 3SDDC 3BO8A 4PP2B 2Q87A 4LCIH 3RP1A 3GBLA 1T2QL 3HC4L 4ZPTB 4Q74A 5I1HL 1GJIA 4HWBH 5AD0A 4Z95L 4MNGA 3BPNC 5GJSL 3ULSA 3O41A 3L95A 1GZQB 1FNSH 2ENYA 3WJJA 2AQ3A 3SDYL 4CN4A 1U6AH 2R0WH 5E4IA 1SBBA 4I2XE 4YHZL 3UDWA 3VMNA 1M7XA 2PR4H 2X9YA 4PTTA 5FM5O 1GRWA 5J6GA 1RJZB 4Y4FA 4YHYC 5I1LB 4OCRL 4XP6L 4AZ8A 1N59A 4TOYH 3EYOB 1KIRA 4OD1L 3QI9B 4XXCA 3FQTA 1OF2B 2R0WL 1P4LA 1FIEA 3FFCB 3QNXA 3QUMH 5C08D 5I30H 5HVHB 2ZJSH 3V6ZA 1F11A 1EJ6A 3NZ8A 5D96C 4N5EC 4NN7B 3PHSA 2B5IB 4PJFA 1E4JA 4XP6H 4OCXL 5D8JH 2R0LH 4OLUL 3MLZH 3WKNA 2P44B 3O41B 1BQLL 2HFEB 3HFML 3ARQA 5JOFA 1KYOK 1T21A 3P4MB 1AQDA 1AXSA 4DN3L 1FO0H 5F7DA 1N5YH 1IKFH 2VDLH 4NKDB 2OCFD 2DLGA 5SWZB 5EU5A 4XBPB 3S37H 1KEGH 3PWUA 3V0VA 3UBXG 1JV5B 3MXWL 4AEHL 2ZUSA 1SY6L 3ARDA 2VDPL 3OKOA 1T5WB 3D85B 3JWNC 5IQ9B 1QR4A 1A7PL 1Q9OB 5HGBA 1ORQA 5TDOB 3RPIB 1L6ZA 3NIGF 5T3ZH 4U1JA 4WI4A 5DSCB 3BPOC 1KPVB 2RIKA 1I9JH 1WJ3A 2HT3C 4NQED 4PJDE 5EBGA 4Y16B 5I71B 4F7TA 3ZKNC 4UT7H 2OYPA 4L4VE 4HJ0D 3SY0A 1F11B 3CVHA 3O4LE 3UZEA 5JPMA 1KN4L 4L4VD 1L0QA 4ZOCA 3LD8B 5EORL 4EBQH 3OAZK 2YXMA 1XGYL 4UTAL 2ADJB 1D9KD 1NANI 3RI5K 1YNLH 3KS0J 5HVWA 4EUPA 1AY1H 5T33H 4KH2A 1B88A 1PD6A 5TQ0H 2JCCB 4JFQB 5CJXC 4HW6A 5T1KA 1RIHL 5J9PB 3DHJA 1AHWA 1FNGA 4XNUL 3G5YA 2OBGA 2P43B 4KZEH 1EJOH 4K9EC 4XP4L 3OG4B 4YBLC 3BZEA 1RAMA 3EYUL 2IANA 1W72B 5JOPE 5KSUB 3VXME 1ITCA 4HMCA 3BEWA 2NZ9C 4W4NA 4K71C 1AGCB 1A1NA 4U0RC 4HPOH 3IDYB 3QEQB 1ES0A 5D5MB 2IEPA 3CGTA 1YNTB 4FXKB 1I1YA 1HXMA 2ZNXA 3BW9B 3G5ZB 2NMSA 3DMMD 1ROWA 3JTTA 5HDQL 3X3GH 3GSOA 1AR2A 4GQ9L 3OAYK 1Q94A 4K3GA 3UXFA 5MEQA 3S4SB 2FZ3B 2WIIA 5E6ZA 1UXWA 2HTLD 4RFOH 4KTDL 4LCWD 5I1HH 1DBAL 1OGAE 5B22A 3C5ZB 1BFSA 4NJAH 4CVZB 3BE1H 3O6FD 3FT2A 3WFCH 3MLSH 1LNUA 1F5WA 1T4KB 4DZ8B 5F9AC 5JHDA 4R3SB 5F3BB 4KK6C 3LKSA 1G7MB 4OLVL 3FQWB 1PLGL 2D4DA 5HGBB 1EEYB 1BP3B 2VKWA 5CJOL 4EDWL 1G0DA 4A6YA 4TNWF 5DHVB 1UWGL 4JFFD 2PTTB 1KNOB 2Q7NA 3PHOA 1KXTB 3DARA 4R2GD 1IEBA 2BSSA 1WEJL 4PLNC 4I77H 5FO8A 4KUZH 2ICWA 2V17H 5DMIH 2J6EH 4F7PA 4I3RH 5DQJB 1QKZL 2DKUA 1LK3H 5D1ZC 2YS4A 2FJHB 4EXKA 1IMHC 3Q6FB 3OWEA 3D39E 3V6ZB 4WO4B 2ATKB 3MCLH 4Q2ZA 4FFZL 4EVNB 2ZSWA 4X8JB 3HAEA 1A6WH 1INDH 4G8GB 1I1FB 3MXWH 4AEHH 1A9EB 2EE2A 5IB5A 3DMMB 1CFSB 3QQ9C 4MGXA 4NQDA 2EDKA 12E8H 1CD8A 4ONOA 5GGUA 5KN5A 2HLAB 1F4YH 1N59B 2EE3A 2NR6D 1TVHA 4OAWB 2IALA 3MRCB 1G7HB 1I9JL 4OM1H 4ODUA 4AENB 2YRLA 1OB1A 1JMZA 2RB8A 4MD0A 1WCBA 3KJ4C 3RWGA 4GT7A 3DSFH 3ZT5A 2X44D 5EOCH 4RDQG 1IAIL 1NDGA 3DUSA 3I2CL 3QXVA 4OQTA 3SDXB 1FLTX 2YD4A 3MBXH 4TUOB 2YUVA 3LS4H 1LO0L 4P5TD 3OKNA 4GBXC 4M1DL 5I19L 2FHCA 2FIRT 2IAMA 3VI3E 4AEEA 3LCYA 2NR6C 3V6BR 1HINL 5JXED 3WIHL 4I48B 3HNSL 3DX7B 5K9OB 3O9WD 4LGRB 1MH5B 3LKNA 1U8OB 1JZ4A 3TIDB 2A77H 4QRQB 5C08E 1IC7H 2UZIH 1YDPB 1OAYL 1OGAA 2ZKHH 4LF3A 4KZEL 1ZTXL 2JJSC 1S9XA 2O61A 1OGAB 1EPFA 3GSNL 3VWJA 2AEPH 1OPGL 3FTGA 1D9KB 4K71B 2CIKA 5GRVK 3IRPX 3KWWB 1SEQH 2VMFA 5HI5D 2ZUQB 4OZGB 4AG4L 4P57A 5ISZB 2Z8WC 2FJGB 3CDFA 4JFOA 3QISA 3MUY1 2A77L 3K8LA 3N1GC 2QSCH 3EW3B 3P9LB 5HYSB 4FS0A 2C1OA 2LTQC 1KSRA 1TQBC 1I3RA 3IXTB 1DVFD 1FNHA 1U92A 1XGTA 3BPCA 3T1WA 1T03H 1R3KA 3BHBB 3P0YL 4LRIA 3ARDC 2CGRL 4XNQB 3CDCA 5CGTA 1EHLL 4OZHF 4L8BA 4GG6E 4HCRA 4JRXA 1FNSL 4JHBA 5GHWH 1L9MA 1H5BA 2W65B 4NQSA 4O02H 5IESH 1HDMA 4OGZA 1ZOXA 1WCBB 3CX5J 1EGJH 1S7SB 5JIKA 5L6YL 5DC0A 1CLZH 3DO7B 1I3UA 1RIUL 4G8IB 1P2CB 3W0WE 3CXHJ 3QDJD 3W9DB 1UWXK 3VE0A 4ODBD 4KK8C 3VG9C 5CIPH 1G7JB 1UJ3C 3S4SG 3KYAA 2P5EA 4AL8H 3I75B 4LIQL 3SOBL 3GM0A 4HKZA 5SX5K 3MLXH 4X5LA 3QH3B 4JZJB 5IESL 4PUBL 3RVTD 1I9IH 3H3BC 1FFNA 1UB6A 1RUKL 1CLZL 4HUKB 3RFZC 2A9NL 3IF1A 3QIWB 4QHNA 5E4EC 2OMBA 3HR5A 1MREL 5E6YA 4TSBL 3VFWA 4KROD 3HFMH 3BP4A 3FT3A 2Q7YB 2YHGA 2VJXA 3MLXL 4CU7A 4YJZL 2B20A 4QOKA 5E2TH 4DCQB 1YEIL 4P3DA 1CXHA 1G7JA 3LPGA 3GMMB 1DUYA 1IEHA 3BWAB 1RZ8A 3FL7A 5BMFH 4PREA 4XMPH 4J1UA 4UU9A 1I1RA 2X4RA 2BOBB 1A02N 3LN5B 1LO2H 1QHPA 3NIFF 5MHSD 2AJYH 2AEQL 3GSUB 4U1SA 4DKFH 3KYNB 2ZOLB 3MCLL 2OSLA 4RGOL 4W4OA 3WO4C 4ERSL 4G6ML 3VFMB 1N0LA 1MQ8A 4ZFFB 1MLCA 1QVOB 5FECB 4IRSB 4KMTL 4RAUA 3VXSA 3U7WL 2MTPA 3N06B 1KCSH 2W1NA 1J1XL 4XAWH 4QXUL 2FYYA 4WUUA 4QHUA 4ZUTA 5ICXA 4I0KA 4EBQL 4ENEC 1N8ZB 2AS5M 3FHAA 1BD2D 5AZ2L 5ICZB 4JKWA 5LXGL 4ZFOB 1T89A 4LHUB 3IAGC 4TUKL 1NUNB 3J7HA 1JFQH 4XP9H 2B0SL 3G5ZA 1IBGL 1MI5B 4PJCB 4KRMB 4FZEH 1RIHH 3TNNB 4BK4A 1Z5LA 3M1BA 3MR9B 5AYUH 3H3PL 3H9ZA 3DRTB 4XWGH 4JM2F 3GGWA 4PJHE 1TPXB 3DVGB 3QIBA 1J8HB 3W0WD 1J87A 1JNHA 1FZJA 3WIFA 3ZKXB 4G5ZH 1UACH 2VIRA 3P4NA 4UINH 3SDDB 5DMKA 1GOFA 2RCSL 1XR8B 2VXTH 3LH2L 3BX7C 1AD0B 1EDQA 4H0HB 2P4AB 3MLRH 3NFNA 3ARZA 4JLRA 3GSNH 3QQ4B 4EUPG 3HA0A 1S5HA 3F7YB 3WO4B 3CFBB 4WFHD 4BSVA 1OPGH 3KPNB 1NGWA 2CJUL 1LHZA 4JANB 3NA9H 2GJZA 4ODUB 4H88H 5D7JB 2BDNH 4ODTH 1P4IH 4PRIA 2P8LA 3QIUB 5D1QA 43CAB 3AU1B 2G60H 2QSCL 1A14L 3FRPA 4JPIB 1QRNE 4YHZH 4R4BB 4U1NB 5D7IB 3BYYA 1BFTA 2D7PA 3MBEB 4WJ5B 3D5OF 1EHLH 3B9KB 1CFVL 4GRLA 1X6LA 3C09B 4F8TA 1YQVL 2DM3A 2NY1B 2DQTL 1J05B 3RUGA 3MRMA 4Z7VF 5ITFB 2EDRA 3C5SB 3ARVA 5BW7C 5GRWA 2F9BT 5EO1A 1CFVH 5IMOB 3K74B 4PJEF 4N8PA 3BQUB 4M61B 2HKFL 2DQHH 1F3JB 4LSVH 5IW1B 3VWJD 4BKLA 3VG9B 3EKCA 2DQGH 2UUDH 4ELMB 1R3JA 1IRAY 2CRMA 3O3EB 3O2DH 3QDMB