4LHUA

Crystal structure of 9c2 tcr bound to cd1d
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
272
structure length
272
Chain Sequence
RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CD1d-lipid antigen recognition by the gamma delta TCR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d
total genus 68
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lhuA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4lhuA01
1TVHB 3TA3A 1FN4A 1LO0L 1Q9KB 2Y5TA 3PHQA 2H32B 3HNTH 4U6XA 3TJEH 3VW3H 5KVGL 1BZ9B 4V2CB 4G7YL 4DAGH 4X6BA 2JIXB 2VDNL 2FX8L 4NO0B 3T08A 1MCLA 1MPAL 1NUNB 1X44A 3MNWA 1T21A 5IR1B 1MF2L 1PFCA 4OLWH 5CBEB 1YEJH 1GJIA 2CIKB 5C0GA 3RVUC 4X7SL 1AGBA 1KYOJ 2OP4H 3UJJH 4MVBD 1TMCB 1SJEA 3PWNA 1UEMA 4HWUA 3RAJH 3CH1A 1NCWL 2H3NB 3HC3H 2R1XB 5C92A 5KANI 3AAZA 1N2RB 2FHFA 2X9YA 1HKLH 1G6RH 5I16A 2Z31D 4LPVA 3EO0B 3PWJB 3EOBA 5TH2B 5D7SL 4PJBA 5C0CE 1C08B 3VWJA 1DUZB 1I1AC 4HGKC 4MD5A 3VFRB 2QSVA 4BH8B 1OL0A 3NIFE 3QG7H 4ZO7A 4ZSOA 2BMKB 2CLZB 4NO5B 1TFHA 4WUKL 1S78C 3BVNA 1CR9L 3KWWB 4X9GA 1I1FA 5HHNB 4H0GA 1BP3B 4KVCH 1I8MA 5JIPA 1UXWB 1AFVL 5D5MB 3C8DA 4BH7B 4NN7C 3OF6D 4IRZH 1DLHB 2GQHA 4NRXB 2W92A 5A43C 1FNFA 4UQ3A 5I8KL 1H3WM 3SE8H 4X4ZA 5F1IA 2RFXB 1YA5A 4S1RL 4IJ3C 3WNOA 4HJGA 3HRZA 4RSVA 4KPHL 4APQB 1TZHB 1MI5A 1JRHI 5CWSB 3JV4B 2NXZD 2B1AH 2HJFB 3RGVA 5T1KD 4P59L 2RHEA 3R4DA 4EIZC 1IL1A 3LKNA 1JPFA 4X7TB 4NN7B 1KTLB 4JJ5A 3LKRB 1RIVH 1ACYH 2Y25A 2C3VB 4GRLA 1NCAH 5DQ9A 5EO0B 4PJEE 4PRNA 3VXSE 4YHOL 2HLAA 2PXYC 1KJ3L 1FH5L 1I4FB 3M07A 5FV1L 1JF1B 3RL1B 1LK2A 3HLAA 3P4MA 4FXKA 1YY9C 5F7KC 5HI5D 4FQIH 2H6PA 4HJJH 4Z5RB 5L9DH 2OCFD 5D7JD 3G5YA 5DUBB 2GSIA 4JFZH 2NXYC 3RTQD 4OV6F 3VI3E 3OX8A 3RQ3A 4KUZH 4AEHH 3EDJA 4PB9H 1KJ2B 4OLZL 2MQCA 3O6LL 5HGHA 3MV7B 5CUSL 3P77A 4JCMA 2Z8SA 2WP3O 4U6YB 1NAKL 1K2DA 3TBSB 5D7JB 4I2XB 3W39A 5F6IC 5LQBH 1MNUH 1KEGL 1XGRA 4U7KA 1PG7X 5E99L 3DX9A 2F8XC 2YR3A 3CXHK 2YRZA 3E0GA 5C6TH 1PZ5A 3BH8A 4JVPA 1XF2B 4D0BA 4D0DA 3O3AB 3BSZL 1UVQB 3KPNB 3MJ6A 3UYRL 4OM1L 3PGFH 3QHFH 3HNSH 3UPAA 2E27H 1MH5A 2QADD 4ZO6A 1CFVL 4K7PH 1A5FH 5AZ2H 2G9HA 3N0PB 3VGEA 5E7FA 5KZCB 1MFDL 1CFBA 5EIVA 1IM9A 1X9QA 4MA3B 4R2GC 3U2SB 1L6XA 2EDJA 1LK3H 2FIRT 4JGUA 4PY7A 1P1ZA 1IC7H 1JL8A 3U83A 4AEHL 3LEXA 2F54D 5J3HC 4ODVL 3VG0H 5IJKA 1LP9A 3BZFA 3TBWB 4N5EA 2G5BB 3FQRA 5FOJA 5AYUL 5DRNA 3CMGA 1F2XK 5D2NB 3BKYH 3I02B 1L7TL 3VXMA 1CDJA 2AJYH 3KPSB 2DI9A 2D03H 3FFCA 5BVJB 2OR9H 4X8JA 3TO4C 4JDVA 1MSPA 2IEPA 4ZD3H 1VACB 2CJUH 4Z7NE 1KCUL 1C5CL 2R2EA 4FQXD 4X98B 4OIBA 1F45A 2HWZL 2MFNA 5JOEA 2IQ9L 5I1DB 2E27L 3CDGA 3DXAE 2V5YA 3H3PH 4UB0L 3SKMB 3WIIL 4PBXA 1YDPB 1VCAA 3VXQB 3PL6A 4L29A 2NTFA 3OAUL 1T7VA 2BHZA 1PLGH 1UB5B 5D2LE 5FYKD 5DSCB 4RDQG 3X3GH 3L6FA 4LLQA 1U0QA 4KXZH 3KS0J 2O5YH 4GW1B 5K9QG 2J1KA 4YH6A 1U8QB 3PIQA 4OLUL 4OI8A 1YMMA 1MAJA 2FX7L 3GSXA 1A14H 2OL3B 3IAQA 1JZ4A 3T0ED 5GRXG 4PJ8C 2BERA 4JZJC 5SWSD 3TLRA 4RAUA 2Z91B 3RUGF 2R23A 5DHYB 5FUZH 2Z8RA 4PBWD 2D03L 1P84K 5HDLA 5ICXA 2NXYD 3RTQC 4OLVH 4BZYA 3KYNB 3QDMB 4XXCC 1HWHB 1S9XB 1ONQA 4TVPL 3CVHL 3QUKA 1R3IH 1XZ0B 1K5NA 5FHAL 3VG0L 5SWSB 5ESAB 2ZPKH 1QFWM 2IALB 1NAMB 3BQUA 1T04A 1KFAL 1W72A 3FFDA 5D7IB 3KLAA 4NZJA 1Z0MA 5IVXF 2AJXH 4JLRB 3B9AA 5D8JL 3LKSB 2IANA 3P0VH 4P5TB 4DOHE 4X5LA 1UWXK 5GGSA 1I8LA 3QWOA 1WITA 4PTTB 5JPNB 2PTTB 1KJVB 1D7FA 4GBXA 5KTEH 3RZCA 2EDRA 1J1XL 2W9EL 4F7CA 5CILH 5CEYB 4ZFOA 1UA6H 1C5BL 3SDXE 3UAJD 4RQQB 4F9LA 2AK4B 1DN0A 2A0LC 4HWNA 4WFGD 3QUMH 1CL7H 5F6HI 5JIHA 5EU4B 1DVFD 1J1OH 2ORBH 2FIKA 4OZGF 5ETUA 4Q9QL 2XTJB 2FYYA 4UNVA 1KPUB 2JKXA 4WIQA 4MHHG 1S78D 2OR8A 4M7LH 4F2MA 4XHJC 5I73C 2X4NA 3CC5A 5ESQB 2AK4D 3VRJA 4HKJA 2MKWA 3QEUA 2F53D 3BRGC 4MAUH 4OJFL 5F7HA 3ULVH 4CJ0A 5EBMA 3U7WL 4MAYB 3K1KC 1E6OL 1LGVA 3A6BH 3VFWB 3LKPA 3VXSA 3PV6B 4PS4L 4FQJH 1NFDB 3S96B 4U3CA 4G43A 4N0UA 3V4VL 4CUCA 1NCUA 4YAQB 3TM6A 3QRFM 4NQXB 1VKXA 1F58L 2L7JA 1MUJB 3MLSH 5ISZD 2B4CH 1LO5A 5FYJD 3TFKC 5FYKH 2HLFC 3FN0H 3FHAA 2YBRA 2BNQE 1J0ZA 4TQEH 3WO4C 1I3GL 4B5EA 3IXTA 5I6XC 3L9RA 4G80A 4LCYB 3GSWA 4LASL 2GKIA 3E6FB 3QBTB 4QRRB 5MP6H 3G6JB 1Q94B 3EYOA 4TUKH 1UH2A 3UBXB 5E08H 4RMWA 4Q0XH 3RA7L 2AVGA 4WFHD 4P4KD 5LKNA 3AS3A 4JM2F 5IEKA 4I3RH 3PQYD 3O0RL 2DYPA 2PNDA 5HYFA 4OZFB 5BXFA 1FGNL 5D1XC 3QUML 4UT9H 3CNKA 1CI5A 1WZKA 1GGBH 3WDJA 2CGRL 1N7ML 3OKLA 2VISA 3K2UL 3RDTA 1DEEA 4PS4H 3O4OB 1S5HA 5CHNB 4QRQA 1NC2D 1X5ZA 4TSCL 4WO4D 1S9YB 3SJVD 5I71C 4P23C 5JUEH 1QBML 1YNLH 3MODL 1D5IL 4O9HH 2R8SL 3OR7A 3U46B 3HTLX 2FX8H 2WWMD 1N0XL 3U9UA 1HKFA 3FN0L 4LCUB 2ADFL 4PJGB 4LEXH 3QXTA 1QLEH 3KAAA 4OZIA 1RJZB 4KI5E 5IB5B 2LAGB 5DHVB 5GXBB 3Q5OA 5LJYH 3GMQB 1QBLH 1F2QA 5DJAB 4BK5A 1RPQA 2H2PC 1BPVA 5ANMB 1DQLH 2EH8H 4ZO9A 4YHZL 1TVBB 4G7YH 3MJ7B 3VXOA 1J88A 4MGXA 5T3XE 2VDLH 4OZGB 3HFMH 1RQ5A 5BV7B 2B1HL 1EEQA 4KRPC 2EIBA 1RJYB 2GTZB 4XCNA 1ZGLB 1XCQB 4XVUD 1WLHA 4PV9A 2I9TB 3DECA 4K7PY 1KB9K 4OD1H 3TF7A 1PQZA 3WV0A 4NJ9H 1ZT1B 2W60A 3P9LA 4OZFG 5EZIH 4LLWA 4HXBH 1CD8A 1QR1A 2HFEB 4KK6D 5DTFA 2EIZA 5ENWB 4F9LC 4GAJL 1MRDH 4DTGL 3DSNA 4PGDB 2WWKT 5MEPA 4OF6A 1YC8A 1CDGA 4NPYB 3HPLA 5BRZA 4X4MA 1L9MA 1T3FB 4KJYA 4GOSA 4WWID 5DURB 1YPZF 2EIDA 4HUXA 5B38B 4YHZH 5F9JA 3HPLB 4F7EB 3QCTL 4RZCA 2YK1H 1GGUA 1MHHB 4U3XA 4AJ0A 5SWQA 2NLJB 3JWOC 4ZOEA 5HDQH 1VGEH 2PW1A 3FOMA 2H41A 4RGOL 2BXYA 4PJ5A 1KCRH 4PB0H 5EOCJ 5I8EA 1K6QL 4P3DA 4LLWB 1T89A 1MVUA 4PJ8D 5D1ZD 3IFPA 5I19H 1IGMH 3P9LB 3L3DB 1T80A 4PRBB 4L8BA 1QQDA 4LPWA 5DK0B 4K3JH 3V2AR 1NBZB 5IWLC 4QXTB 1U41A 1EUUA 3OKEB 5KSBF 4XPFH 5F3HB 4R4BB 2WANA 1ZE3C 1XT5A 1MWAL 3EFDL 4BZ2H 2X4OB 2IGFH 4O58H 5C9JA 1A9EA 3LS5L 1HK6A 4PB9L 5IB5A 3NAAH 1AP2B 3GSNH 5BRZD 1IGFH 3PXHA 1EEYA 2XPGB 2XV6B 1SJXA 3T04D 1FAIH 5ID0A 5HVGB 2XIDA 1MRDL 3WE6B 4EKXA 1UT9A 1DQJB 1NANH 1UWGH 3C9NB 3WSQH 3QUZB 5BMFH 4M48H 3MRRB 2BSRA 2DWDA 4JZNA 1RZGA 3UP1A 4YIQB 1HXYA 2DIJA 4U1KA 3KR3H 4PFEA 5BS0D 4UTBL 2OTWB 4Q9RH 3OKKB 3FRUB 1DEEB 3UDWC 1D3CA 2WBKA 3T4AB 3WCYA 3UAJC 1DTUA 2MHAB 3P4LA 4OCLC 3OKLB 5I71B 1L0QA 1A5FL 5C0RL 5TE4H 1QRND 2FBJH 2NXZB 3HR6A 2DYPB 1IKFH 2G2RA 3ILPA 3S35X 5IEKB 3TO2A 2ZSVA 3BDBA 4BM7A 1ZA3B 1A7PL 1BIIA 5AYQA 5IJKC 4KKCC 2RGSA 2VLJD 3UBXA 4NZRH 3CLEL 5IW1A 2ZSWB 5DMJB 1KB9J 3FONB 1PAMA 1MIEH 2R56H 1Q9OA 4PIRF 4JY4B 4PJIE 4Y2DB 3QI9D 3BGMA 3J8F7 2VLME 3MRIA 2WBJB 2ATKA 3MLZL 2QJDA 4PJXF 4AQOA 4FZEL 4AM0B 2IAMB 4W81A 3RWCA 1RZ7L 4MQXC 2MSPA 4NFBA 2AQ1A 5GSRA 1WTGT 3RWDA 3VFNA 3L5HA 3VFWA 1IC4H 2XFXA 1GCFA 1MFAL 1RZJC 5TE4L 1TJGL 2XKUA 3QCVL 1DL7L 1A6TA 3TVMD 5HHOD 5EBMB 4XB7A 4JFDE 2EDKA 3VXPA 2VH5H 4K7PX 2B5IC 3G5VA 4NCC2 1IKFL 3CUPA 3VRJB 4TULL 1INDH 4F2MB 5C08E 3W9DB 1DVFA 5CGMA 3MRMA 1T1XA 5H94A 4DVRH 1AE6H 5IMKB 2YRLA 5FCSH 1SBSL 5I1EL 2FO4A 2QADB 4KK8C 1M05A 5JW4Q 4P0DA 5HHOB 2ICEB 4LVNC 3L3HA 3FT3A 3S4SB 4X9BA 5FECB 1V05A 1U8NA 2UZIL 4F8QA 3FO9A 4P2CG 3ZZ1A 5B39B 2AK4A 3RWEB 4Z7WB 1H3GA 5D5ME 3CH8A 4IMLA 1R3IL 1FFQA 4F7CB 1DBML 4Y8DC 4EDWH 5J12C 3QWOB 4PTTA 2PYFA 2NMSA 4JN1L 4JRYA 2V5TA 1WC7A 4XMKH 1B2WL 2CK2A 4PG2C 3FT2B 4Z9KB 5GGVH 2BNUA 1QO3A 5F7EL 4Z7OE 1DFBH 1JGLH 4J7RA 1BFOA 1VERA 2OQJA 3BEWB 5T3ZE 3INUL 4XNQA 3V7AE 2BDNL 1OD9A 2XACC 3HAEG 1ZVHA 2B2XL 4OM1H 3N1FC 1E28B 4I3SL 4O2FA 3VXNB 1OPGL 3ULUL 3NCMA 1QRNA 3JWDH 5D1QD 5SWSA 4PRPA 3PQYE 1KN2L 3NFSL 2WWKO 1HWGB 3QUKB 5HHOE 1S5IH 2I9LA 1OGAA 5D71L 3WJJA 4KKLD 4WV1B 1EHXA 2ARJQ 1LO4H 3QZWA 4PY8I 2UYLB 5IW6A 3U4BH 1F5WA 3AGVA 3IDJA 4S11A 5DHYA 5EC2A 3EHBC 3P73A 3UTTB 1IGCL 3L95A 3UO1H 4YXHH 1JWSA 4DVRL 4LHUB 2QV2A 5EPMB 3QPXL 32C2A 3C5ZC 1UC6A 1JYWA 4UI2A 4RWYH 2G75B 4FQLH 2K7QA 5DR5H 2VAAA 2C26A 3VE0B 3CFIC 4LLQB 3L6FB 5C71A 3VXUA 2EIEA 4ZS7L 2MOVA 3V0WL 3SGKC 1LO3L 3DRQB 1CF8L 2XQYK 1YDPA 2AV1B 3SKMA 3SN6N 4JFPA 4HS8H 1UENA 5K9KB 1I7ZA 4BQBA 3KHOA 3KYOA 2YD7A 4I4WB 4Q6YA 4PG9A 1RZKH 1QLRB 3QIBB 2ZG1A 4IMKA 3LVEA 5MHSE 1T22A 3DROB 5E8DH 1I9RL 1R3LA 3F7YA 3HNVH 3K8KA 5D1ZC 4JO4L 4M4RA 5JHDD 1OGAD 5IWLA 3UPCA 1GGIL 3D3VA 3JV5A 2A6KB 2ZUTA 4XVSH 4PJEA 5CIPH 3CFDB 5DLML 3RWFB 5KSAD 4YHYB 1Z5LA 5F70A 4LSSH 4NRZA 4CMHB 4OLUH 2XOTA 5CEZH 3NFNB 3WD5L 2A6KA 2CR6A 5K9JL 1N59A 2CK0H 4HX1A 3W0WA 4PRDA 1X5HA 5D1XD 1S9VA 4XHJD 1MOEA 2J8HA 4MCYB 2R2HB 1G0XA 1LVEA 4N8VG 4PG9B 3WHXB 3MRDA 3OAYH 4MB3A 5TDOB 3NZHH 1HZHL 4KDTA 5K9KA 5T1LD 4D9LH 1U8MA 3GKWL 3O3AA 3N9GH 1XF2A 1CLYH 4M93C 1S7SB 2QADC 5MHSD 3STLB 3EZJB 4LLYA 2YPKA 4KI1A 4I2XA 1MCPH 1Q38A 4U1HB 1LO3H 3MLWL 3VE0A 2KBGA 3EOYG 4OGYH 1ETZB 4DQOL 4H26B 5D1QC 3MV7A 3O4LD 1WGOA 1SVZA 32C2B 5EPMA 3FB7A 5HGHB 1NBYB 5FGCE 2UY7A 2C1OB 4YXKL 5E03A 1MJ7L 3ZSSA 4AIZB 1C7TA 3LN5A 1NQBA 4J3SA 4PJAE 2VL5B 4RX4D 3QZWB 3ALXA 4ALAL 5HHVH 3KPRB 5DWUL 2H6PB 3UBXG 3V5DA 5I1GL 4B7LA 3NTCL 1LK2B 5CEZE 1JF1A 5HI3C 1CLZL 1KJMA 2I9LB 2BY0A 2IPKA 4P2QB 3V5KB 4XVTL 3VXNA 2EYTB 2C3VA 4DEPC 5FA3B 4PJ5D 1IL1B 1BQLH 4FTVD 4YHNB 1H3PL 3CIQA 3TPKA 1FORL 3WXWL 2OQJB 3BEWA 1ZAGA 3BPCA 2CLRA 1B6DA 4N8CH 1QO3B 1KTDA 2HJFA 2DL2A 2HVKA 3QXUA 4N9GA 3LIZL 4APQC 1MHPL 4R6UA 5DUML 4YZFE 3U1SL 1TPXC 4GG8B 2A73A 2V5RA 4PRIB 4V1DB 4HUUB 3U30C 1RZ8B 1DLHA 2VMFA 3MNVB 2V2XB 4LF3A 1QVOB 1IC1A 3AFLA 1A6WL 1IVLA 4E41D 4DUXA 1VEOA 5F88A 1SJHA 4ZYKA 4OD2B 2VR5A 2OXGA 1BF2A 3FO9B 3KWWA 2VR4A 1HI6A 3S37L 2OYPA 4LASH 3BKJL 4WTWA 5IGXH 4OFPA 2DLTA 1I3GH 1S8DA 3V95A 3MRMB 4BSVA 4DKEH 5IM7A 2Z8VC 4FQCL 4RIRA 5E8PA 3EYFA 4X5WA 3GHEL 4EVNB 3OZ9L 2RCSH 3RUGA 3UTSB 1G7JA 4Z7NF 4O9HL 4XI5C 2J8OA 1WBZA 2EH7L 3H9ZA 1N2RA 3AAZB 3R8QA 1T2XA 3GRWH 5LBSH 1QOKA 2VXQL 4L4VD 4NYLB 1AHWA 1SJEB 3BXNA 2XZAL 3RL2B 4H8WC 1BECA 4U7MA 3O3EB 3BXNB 1A4JA 1TNNA 1AGBB 2HKFL 1S9KC 3LRHA 4XP5L 3WEXB 5C0GB 2E8YA 3TV3H 5T1MB 4OAWB 1KLFA 5F7NC 3LSOB 4AENA 1Z3GH 4D9RD 4Y2DA 4X5WB 4JY4A 4YR6A 2FLRT 4WW1A 2GAZA 5HI4C 3ZDZF 2E7LC 3C5SB 4R90L 2IWGA 3HB3C 4JRXB 2DQUH 2YUZA 2MCPH 3EYVB 5D7SH 3NIDF 3A67L 2VABA 3CMOH 4ZAKD 1HI6B 4WEMB 3S5LG 1DANT 4L4TD 1JUFB 2WQRA 1UJ3A 5GISH 4G8EB 4XI5D 4HZAA 1UM5L 3CVHB 4JRXD 2XZCH 1A3QA 1PDKA 1QSFD 1QVOA 4OF5A 3T4AA 2JE8A 3HCVB 3PXJA 1KEML 4GG8A 4MXWL 1MCIA 4OD1L 4QXUL 4BSWA 4Q9RL 1HXYB 3E8UL 5IOPA 3U79A 5KVFL 1KBGL 1H0DB 1U42A 2HVKB 2YK1L 1ZLWH 3QIBC 1TLKA 2J12B 3AMLA 3CAFA 4POZC 4Q74A 2VDNH 3BPCB 4PJ9A 2WIMA 1ZANL 5HJ3A 4Y4FA 2CDEA 2DKUA 5GS0L 3I9GL 3W2DH 5E7BA 3TN0B 3V5KA 4X4ME 4E5XA 2X4TA 4UT6H 5KJRL 3BHBB 1VA9A 1YQ2A 4RFEB 3X14B 3VG9B 3IXAA 1KJMB 4OF7A 4OTXL 1A7BA 1E4XI 4WFFE 3EYQC 2VL5A 5ID1A 3BKML 3TIDB 5C0AD 4YX2H 1KEGH 1NEZA 2IBZY 4D8PB 5AWNH 3D25B 4NZUL 4BA8A 3NACL 5DK0A 2FDBP 5ERWA 1QQDB 3LS4L 3ZKQD 4OIIL 1I7TB 2P42B 4MSWA 4QRSA 1FVEB 4Y5XB 1KCKA 2WUBH 5KVEH 3BMWA 1JGEB 3WUWA 4MD4B 1QRKA 3U6RB 4LLYB 1FAKT 4PLJC 4JM2A 3DGGA 4OD3H 1SEBB 1WBYB 1AXSB 4FQXC 3WKML 5KSBA 1VGKB 1AH1A 1T0NA 1U8MB 3MRJA 2Y36H 4P2RB 2UWEE 4BZ1H 3GMNB 1KF9B 2PTVA 2D7TL 5DJ6B 4I77L 3WHXA 1R24B 5E2VH 4KJYB 1VPOL 5IIEA 2ARWA 4PP2A 3S9DB 3O2DA 1BD2E 4KROC 1S9VB 5BVPH 1OQXA 5BW7C 5TE7L 3T1FB 1N59B 1HN1A 2OR9L 1EUTA 3QUYC 4RFOL 1DQTA 2P5EB 1A7QL 4RMRA 3RI5F 1KSRA 3EJYD 1DVFC 3D2UD 4JFOB 3CFDA 4P3CL 3RWFA 1PQZB 2AJUH 3D3VB 4MZ3A 3HG1D 4PV9B 3CPLA 3DROA 4Z7VB 3VA6A 3FO0H 5FA4A 4DUWA 5AD0B 1RIUL 5C7XH 1Z2KA 2FL5A 5K9OB 1F4WH 4NM8L 3FMGL 3D85B 2A6JA 4OSUH 3NVQA 3MJ7A 3VXOB 5CP7B 3ES6B 3WNKA 1BFVL 4ORGB 2WLYA 3R06A 4Z76B 3KPOB 5ISZA 5J9PB 2DWEA 5ANMA 3ZE2E 2CPCA 2VXUL 3DSFH 5HDOA 4OF3A 1MVFA 1EFXD 1B0RB 3VGFA 3QFJB 2YMXL 4LCUA 5SV3A 2HVJB 3BW9A 4ZODA 1ES0A 2VAAB 4F57L 4JFDB 1P4BL 3S35L 1FIGL 3SPVB 2EE9A 5F9WC 1E4WL 4LHUA 2P48B 1A7QH 4I1NB 4M7KH 1FNLA 4GG6B 4QRQB 4QF1A 1S5HB 1CGYA 3CFJB 5EC2B 1C16A 3VH8G 5HYIA 2HH0L 2UYLA 5D93C 1YPZA 3MRHA 1P7KB 3WDIA 3HZYA 4NQUA 3U0TA 43C9B 1BFVH 3BEVA 2YN5A 1UXSA 5TQ0H 1DZBA 4X7DC 5H35A 2EDFA 2DQHH 1XGYL 2GY5A 5LGJB 1MCFA 4PJDF 1E28A 3MACH 4ODTL 4GT7A 1NGZB 2YXFA 1U8HB 3MRFB 1INDL 5DF0A 2XZZA 3QULA 5DEGA 1BFOB 3VG9C 1GPOL 2BNUB 4YZFF 3UTPD 1I3UA 1UG9A 2H8PA 2HJKA 1FYTA 1MFNA 3VW3L 4WV1C 5GGVL 4YDVB 4GRWH 1ZHNA 2XQYG 4JRYB 4RWHA 2EKJA 2ZNXA 1DBMH 1XEDA 1ZLWK 2JJWA 2P5EE 4LSUL 5E8EB 3P0VL 4YQXH 1GHFL 5C8JA 1UJTA 4YGVB 4N0UB 2IANE 1NGQL 4GKSB 1QA9A 5GGQL 3E2HB 1L7IH 4M7ZB 3RWEA 4H1LG 1PYWA 4U6VL 2P8MA 1V5JA 4NBYB 1FYTD 3BYTA 2AJYL 4UDUA 2NNAA 1LNUA 3I3BA 4L8SB 1E4WH 5AG8A 4GBXC 3G9VA 2E6PA 43CAA 3EFFA 3ZSTA 2D4DA 2NX5D 4OT1H 2DF3A 1DBBL 3OB0K 3C5ZD 4Y4FC 1MELA 2NNAB 5FUZL 3HUJF 3MFGB 1JHTB 1BVLB 3NZ8A 5E0QA 3MRKB 3T0WA 1Y6KR 3VD7A 2XFXB 3MJ8A 4HQQL 5F9WB 2VWEC 3NTCH 2AV7B 4GXVH 5JHDB 4WFEE 1IAMA 4IIQC 1KB5A 4A2MA 1P84J 4KKBD 3NCYP 4GSDL 3RVUD 4TNVK 3RX8A 1H3UA 4PJDA 1V3KA 3BGMB 1FYTE 2EEDA 4ZUTA 3IDYB 1I3RB 3LKOB 4IMKC 1RUPH 3FONA 1JZ2A 1A7OH 1D6EA 4I13B 5D7IA 3AU1A 5ESVB 3BD4A 5B39G 5FIEA 2CRIA 4EN3C 2CMRH 2OR7A 5T1LB 1KCVH 3ARFA 2Z31A 5LGJA 3OKNB 5HI5C 2R15A 3TO2B 1EBAA 3LN9A 4UBDD 4C83B 1XF3A 5FYLE 5E70A 2J6EA 1F4XH 2MWCA 4FXGB 3QDMA 3HZYB 1H8NA 1TIUA 2ZCHL 1IM3B 5MI0B 1NGYB 4DKDC 2YD3A 2JCCF 2IADA 1V8HA 1DBKL 2CO6B 4PGBB 5BV7C 1NPUA 3JWNC 2PKDA 2Z91A 4EOWL 1AIFB 2EKSA 4U1KB 4HV8B 2OL3A 1XR8A 4XP4H 1FFPB 4X7EC 1U8QA 3PIQB 3SPVA 5DO2D 2NTSP 4RISL 4BYHA 2DL9A 1DQJA 3C9NA 3WE6A 1VFBB 2FX9H 4LNVA 2YD5A 3QA3B 2OJZH 4Z7UE 4YXLH 1EEYB 3OGCA 2IBGA 4LPCA 4L29B 4PRAA 3TH4T 1AP2A 1CXLA 5E4IA 2X9WA 3T77A 1YY8A 2DIAA 1AO7E 4OLYH 1KNOA 5I1DA 4X98A 5ISZB 4Z76A 4Y5XC 3SDYH 1WWBX 4ODXA 1KIPA 3QUYD 3ARBD 2JB5H 3D85A 4KKLC 3QUZC 1A7NH 3FFCB 4DQOH 3ULVL 4AY0A 1KJ2H 5CCKL 3GO1H 5DRZB 1FE8H 2NY2B 4LVHC 4TSBH 7CGTA 3L3DA 1RV6X 2VXSL 4P4KB 3TNNB 1ZSDB 3V52H 3BZFB 4Y19A 4M5ZL 4W68A 1WZ1L 3WFEH 4QRPB 4P57A 3LEXB 4LK4A 3ZKMC 4DN4H 1KUMA 1T03H 4R9HA 3ROOA 1J0HA 3R0MA 5SWQB 4JREB 1TZGL 3I6GA 5I1IL 5IIEB 2PUQT 3FQXA 1Y6NR 4U33A 5DJ6A 2YOCA 5HHXH 4HXAH 3HS0B 4I18B 2OP4L 2DQUL 1F8TH 1IGYA 2FH8A 1VGKA 1C5CH 3AC0A 2AI0H 2BZDA 1RK0B 1NBQA 3CMOL 4GO6B 3TT1L 3ROOB 3DGGB 2AS5M 3BO8B 5T3ZL 5I75C 5ENWA 2R8SH 3W39B 4P57B 3CVIH 4MD4A 3EIFA 2PF6A 1IQDA 5DVLA 3WIFB 3TPUA 3AS2A 4RNRA 2NY5L 4S1SH 1UM5H 4H88H 4U6YA 2Q1EA 1I7TA 4MSWB 2PO6B 5KBNC 4RRPG 4CKVX 5J1AB 1WUNT 1CFQB 4X5XB 1DN2A 3CX2A 1BJ1J 1XCQA 3D25A 4K3HA 4M6OH 1KXVC 35C8H 3SDYL 2ATPB 3FB6B 2EH8L 2VQ1A 4Y4FD 2HT2C 1S3KL 1PG7W 3DYOA 3OGOE 1AGFA 2VDQH 4FXKB 3SGDH 2FH6A 5JORA 1I4FA 1KNOB 3GMQA 3MUZ1 3JTCA 4PJBE 2DTMH 5C0CA 4ZDHB 5DHVA 4PRNB 4E5XB 1ADQL 2W38A 4QHKI 3X3FL 4PJGA 4JJ5B 4UT6L 2ZKHL 5EZJB 4Y4FB 3QA3A 1CXHA 1BM3H 1VFBA 4HUMB 4N0CA 5EO9B 3IGAB 1OP5H 5I0DA 4KROB 2YA2A 3NABL 5ADPH 3QXAB 1T5WA 1S9YA 2CH8A 5F1IB 2EXWC 2YXMA 5CHNA 2AJXL 5HGBA 1QFUH 1T1WB 1CU4H 4E42A 4JHWL 2IADB 2VJXA 1L6ZA 4NZUH 1V7MH 4MJ4A 1F42A 1NGYA 1T0PB 4BH7A 1UXWA 2XQBL 4OM0H 4CU6A 4FXGA 4KROD 3TJEL 3AXLB 1UJ3B 2NQCA 4PJHF 5HHNA 5J6GA 3C5JB 1W8OA 1WFNA 2M2DA 3IDXH 2Z31B 3QYCA 3ARFB 5EZOH 1W8NA 1RUQH 5DFVD 2CLZA 4NO5A 1EXUB 3EYVA 5GJTH 3CGTA 1MWAA 4BH8A 4MD5B 3VFRA 4JRXA 2Y36L 3EJJX 3E6FA 5GGTA 2VDPL 4LCYA 3AU1B 5IW3A 4H0HB 35C8L 5TH2A 3PWJA 1P53A 4NGHL 4MQ7B 5DMIH 1UJ3C 5I8OH 4N68A 2BNRA 5F8RC 3HKFA 3RNQA 3ZTJH 5HPOA 3QDME 3LSOA 1FZOA 3PUCA 4HJ0C 5BVPL 1CFTB 4PJDB 5T1MA 4LMQI 2R1XA 3SDDA 3L1OH 4C55A 3DMMA 4Z7UF 4QEGA 2ENYA 1MF2H 2EXYC 5IVOA 5JHDA 1BQHB 2R2BB 3O11B 2R4RL 5C6PB 1HOCA 3MRKA 1AE6L 2BVPA 1QLFA 3LOWA 4ODHL 1T21B 1J0YA 3RPKA 4HKBB 2VTFA 3SDAB 4XNMB 3UJIL 3RUGB 4NQCD 2UZIH 2EDEA 3OJ2C 3KJ4C 2EYRB 3NABH 4FRWA 4JZOB 4K3GA 4D9RE 5ADPL 4R26L 1FRGL 5ITBL 3RWIA 3KJ6H 2DJSA 3ARQA 2VZUA 3DHJA 3WMSA 5DFVC 1RZIA 4WI6A 43CAB 2OM5A 4BSVB 5JXED 3W2DL 3RGHA 2W59A 2VAJA 1HNFA 1TXKA 2VDPH 1QNZL 2Y7QA 5FB8B 4Z95H 4NQCB 5JW4R 2WZPD 4NKMB 3BZ4B 3PWUB 1QFWH 2R0WH 5F88B 1QA9B 1CE6B 4AT6B 5DGRA 3VRLF 4PJHA 2QL1A 1UWGL 3WSQL 3TF7C 2G5RA 1YYML 3FRPG 1KJVA 4F58L 1YECH 5J13B 1RZ8A 4FFYH 4P4RA 5FFLA 3D9AL 2NY4C 1X5XA 2EXYD 1BJ1H 4NNXA 2X40A 3B2VL 3D3VD 5EORL 3LS4H 1M6OB 2P5WA 4XWOD 3VXUD 4MNHA 2X6MA 3D0LA 5A2FA 3ECBB 1EMTL 2WUBL 5KVEL 4Z7WE 4Y19E 1W72B 5TF1L 2WAHA 4TNWK 1NCBL 1B2WH 3WFDL 1IBGL 1EDQA 1Q0YH 3BPOB 3VD3A 3GJFH 5EWIH 3SDCA 3ZYIA 3RIFF 5F3BB 1Y0LB 3OBAA 1N0XH 5ESAA 4OCWL 4JG1H 1K5NB 1A14L 1ZEAH 2HP4A 3EYUL 5D2NE 1Q9LB 3SDCC 1GOHA 4P2OB 1IGTB 2FEEL 3KYNA 4LIQH 1RIUH 5KZCD 2BVQA 4XBGA 4Z7UB 3MPCA 1C16B 3M8OL 1JPGA 5L8KB 4J3VA 3VCLB 3MLXH 2C1OA 4JDTH 4GG6A 2NY2C 3MBXH 3GSXB 3FB7B 4N8VA 5EORH 1A02N 3HE7C 1NGQH 2X10A 3RKDC 4PGJA 4EBQH 2Z8WC 3KPSD 3STLA 3PL6B 1B0RA 3VXME 5EFIA 4JM4L 3LQAL 4KMLB 1ZLVH 3GB7B 2E6QA 5ADOH 1XMWA 5IROA 3R06B 3B9KD 3PNWB 2FJHA 4ZO8A 3O9WB 4IJ3B 4OQTL 4GQ9H 4XHQA 4I48B 4X7SH 5D7LE 1BREA 5DD1L 2AGJL 2BOBB 3PL6D 5F89A 3F62A 1X5GA 4ODUA 4PRDB 5JTWA 3C8KB 4Y88A 5L2KD 1PKQA 3TNMA 1YYLL 5GS1C 3TBTA 2WSKA 1L8JA 5JXEC 3QHTC 3DMMC 2D9QB 3TBWA 3BIBX 1G7IA 2OLDA 3QWQB 3DX7B 3TJHA 1BEYH 3F7YB 2MKLC 4JM2C 4U2ZA 5C0FA 4LSRH 2BOBA 2P49B 5F89B 1JNNH 1JRHL 1JGUL 5JW4N 3QIBA 5IB3A 4PP2B 5C0AE 5L2KA 4IRJD 2WW8A 5FGCB 2A6IA 4O00A 2ZCHH 4O51B 3O9WA 1MH5B 3QI9C 2FJHB 3GMNA 5D5MF 3MACL 4EUPH 4CNIA 1HKLL 3GB7A 4XPFL 3QUMA 3FJTA 1MCEA 1EBPA 3GMPA 3ZDYE 4M9PA 3VI4E 1PZ5B 3BH8B 5EFIB 2Y07H 1WBYA 4HLJA 3MOAL 4Y8AA 3F7PC 1RHFA 5IMLA 4Y1AD 3N50A 4RISH 1JGEA 1K2DB 4WHCA 5I30L 1JBJA 1KENH 4LDEB 5CP3H 5E2WL 3P77B 4DW2L 2OJZL 3DV6A 1EK3A 2VLJA 4M1CD 2Z93B 1JWSB 1ZK9A 4U6TA 4KDTC 1BBDH 3L95B 1DBKH 3OTTA 1CTOA 4D8PA 4XCEA 5F97E 4TOYH 1M7DA 3C6SB 1JPGB 4YQXL 5GGSY 3NMEA 3ZTNL 1AI1L 2E3VA 2GSIB 1FYHB 3UEZA 4P99A 4J4PD 4YC2C 3C09B 5D70L 3ARED 3HLAB 3P4MB 3VFOB 1AJ7L 3BQUC 1OGAB 3WNMA 5GZNC 1X5YA 3SGEI 5IV2A 1U8JA 3DRTA 5A2KH 4MJ6B 1KJ2L 2BRRL 5CEXB 4NN6B 3HE7D 2P43B 3OB8A 1ROWA 2X7LA 5IFHH 1Y0LA 4HLZG 2NY7H 3LB6C 1XR9B 4PJ9B 4JGJA 1WZ1H 4GRMB 1TJIH 4KY1L 4CMHC 3TFKD 3MLPA 4JFEB 4P5MB 5B8CB 3JV4A 1JNNL 1JRHH 5JZ7D 3ECBA 1Q8MA 4DOHB 1QUNA 2P5WB 5SX5K 3N1MC 3CLEH 1OAXH 1WV7T 5IBUB 2UVFA 2DLFL 1CZ8L 4F7PA 4P4RB 1NUFA 2GJ6A 5D5MA 2XG4A 5I9QB 1L0XA 3FB5A 3MRCA 1I8MB 4Z7WA 1CLYL 3T4YB 4CADA 1I1FB 2C3GA 3ARPA 4EZMA 4NQVA 2JELL 3SDXF 3BVNB 3CVIL 1RUKL 2VABB 1P2CB 3O4LB 2V7NA 4I3GA 4ZOCA 4ZSOB 3KG5A 2BRQA 1YNKL 3H3BC 4GKZB 4K9EL 4MHHI 4M7ZC 1FNSH 5JXEA 1BHGA 4YR6B 3VGGA 3CUPB 1EAPB 1LEGA 4WFHE 4ZXBB 1F4YL 3SDAA 1I1RA 1M1SA 2N7AA 3PQYB 3EGSA 1YN7A 2FEEI 4OAWA 1A6TB 4JFHD 3SHSA 2Y72A 2BVPB 3B2UD 5IF0B 2NYYC 3FFCD 3L7EA 4NCDA 4MNQE 4RBPK 4L3CB 1A4JB 3RWDB 2J6EL 5BOZG 2F15A 2XA3A 4HJ0D 4K8RL 2DTML 2JCCA 4LP5A 2YZ1A 2VC2H 2YUWA 4M43L 5FK9A 3DXAB 3WFBH 1Z0NA 3MRIB 4ZXBD 4OZIE 2DBLH 3WFCL 1BJ8A 5CZXD 4FABH 4KAQH 2VNCA 2DMBA 5J11C 2PTUA 4MQ7A 1UM6H 4MNGB 3SJVE 1OAXL 1R6VA 2MPAL 3I6LE 2ZSWA 1NEUA 1RMFL 1EO8H 3VGHA 5AAWA 5IM7B 3WS6A 5IHLB 4GKZA 2Q8AH 5DD5H 1DE4B 5J12B 4WJ5B 4D9QE 1EXUA 3A6CH 3MUHL 2QR0B 3INUH 4MXWH 2ZSVB 4NQVB 5JLZA 5E9DA 1FL3A 1A6ZA 3ZE1F 2P7TB 1SJHB 1BOGB 1J12A 3QRGL 2VSCA 3IJSB 4CN1A 2XN9D 3CSBA 2JELH 4XCYB 1WWCA 3WLBA 4LQFH 1XAUA 4AYFA 1IAOB 5HYJD 1JYNA 4PRIA 3FRUA 4V1DA 1T1WA 4YE4L 1LO4L 1C5DB 5CLWA 3P11L 3BAEL 4J1UB 1G9EA 3QXAA 5I18L 2P24A 3UTSD 3LN4A 3MRRA 4JZNB 3PJSA 4UIKH 2CUIA 3PDOB 4JFEA 4P5MA 5KOVC 1T83A 4KXZI 3QEGH 3DX6A 4NO3B 4YHNA 2IBZX 5BMFL 2XPGA 3D39D 1WAAA 2I24N 4FOMA 2N4IA 4MJ5A 15C8L 3DRTB 1A9EB 5IVNA 1CF8H 2GTWB 2MNUA 4HIJA 4HZLB 3KPPB 3V5DB 4XZUB 4FABL 2OZ4H 4KRNA 1DLFH 3KPRA 1OP3H 4NP4H 3VH8B 1UKSA 4L3ED 1GC1H 5EOCH 3MLRL 2ATPA 5GRWA 3WO3B 3LEVH 4KK9C 1M7DB 3C6SA 2VXTH 5DA0B 4U49A 1B9ZA 2OXHA 1OTTC 4G6KH 5E2UL 1JNLH 4TVPD 3UBXI 3S4SG 3WIHL 4L8BB 3DV6B 1QHOA 1ETZA 1YEEL 2DN7A 2PCPB 3NACH 1IC7L 4CL7A 4P3DB 4DKFH 1BM3L 2Q87A 3BO8A 3MLUL 5GS0C 3QDGA 2WWMC 1RK0A 5HHME 3FT4A 4RZCB 1CD9B 3FQNA 1H3TA 3MLYL 4I18A 5HGAB 4JJHA 4N1CA 2PETA 5TDOA 4OGAC 3MRDB 4KJQC 4WUUE 2B0SL 4WUUD 2R2HA 4MWFB 5E94B 4NPYA 5BRZB 2CQVA 3NZHL 4BKLA 3MROA 5MEPB 1R3KB 3RAJL 5KG9B 4HX1B 3QEGL 4XNXL 2VB5A 4Z8FH 4LSTL 1G7IB 3QUZD 1INEH 3ARDA 1QR1B 1FZJB 2B4CL 1ZSDA 3KYMB 5GGVY 1O0VA 4LDLB 3QEQD 3JXAA 4TULH 4WO4A 5FM4A 4LLVA 1I7RB 3TIEB 3TBTB 1WAAF 3SQBA 4XCNB 1OP3K 1R3LB 1HHHA 2P47B 5DRWA 3BJ91 4ZUUA 4GFTB 5CJBA 2VDRH 1NEZG 3SOBL 5T3XD 4Q0XL 1Y18B 5EULV 2X42A 4FQ1L 3DURB 4PG2A 4C57C 4I48A 1OVZA 2O61A 4U1LB 4F7TA 3EYSH 3V6OE 1TVBA 3FMGH 1K3ZA 5IKCA 5I6XB 3QQ4A 3VD4A 4JFPB 5DK3A 4JAMA 3S34L 4OGXH 2A9NH 3T77B 2P5ED 5H37G 1F90H 4XMLL 4YPJA 3DRQA 5DMIL 4EI5B 3B5HA 3RPIA 2ZPKL 1O7SA 4APQD 5CSZA 4YWGH 4TSCH 3SY0B 4S1RH 2G75A 2ZUSA 1O7VA 2JJTC 2FBJL 5C07D 5TPWH 3VCLA 5DDHB 5L88H 3I3EA 3P73B 3UTTA 2VLMD 1GGBL 3IDJB 4Z7UA 1UCTA 2R1WA 1W0VA 4GKNB 2VZ3A 4UTBH 4HG4K 2VLRE 5AZEH 2C7UA 1A6VH 3F5WB 4O2EA 1G9MH 1G9NH 1IGTA 4LCIH 5HDBE 2DM4A 5CKAA 4XBPA 3FO1A 5D6CA 4BFBD 1WZMA 3FQTB 4PRPB 3FFCE 2A83A 4RMUA 4QOKA 1BGXH 3ILQC 4O2FB 4K8RD 2UUDK 4OD3L 4HIXL 2YN3A 4HPYL 5EBLA 4HD9A 4JFZL 4K3EH 4RAVA 2XWTB 1Q94A 5DA4A 2APFA 4PP1D 2VKXA 1ERNA 4CVWA 5C0BA 3D0LB 3QQ9C 1JN6B 3ZL4L 4U6VH 4M1GL 1N6VA 1NC4D 4KJWC 4NNXB 1ZHLB 5FEBA 1J10A 4WDIB 5BZWB 1VKXB 1NFIA 2H9GA 1JHKL 4HEME 5FO7A 4PV8A 2VZVA 4LVHB 4M1DH 4PUBL 3S96A 1K8IA 2VXQH 2VLJE 2F8OA 4M62L 2DQCH 2JJTA 4XAKD 4P3CH 3PP3K 1BVLA 3NZ8B 4NKMA 1SBSH 5I1EH 5ISZE 2Y7QB 3S4SA 5FB8A 5C07E 1M05B 1GYAA 4LSDA 2KL6A 4AEFA 3S37X 5C2BH 3CC5B 1RZIB 4OCRL 4QXWA 3HE6D 3EFFB 2GEEA 1MREH 3PHSA 4TOYL 2BJML 3MLTB 4U1JA 4JZOA 5ETUB 4OCWH 1FL5B 4K3DL 4PP1C 5EU4A 4HKBA 3P9MA 3LQZB 5IHUH 4NBXB 1DSFL 1HOCB 4JPWL 5GS0D 3JVGA 4S2SA 4YFDB 4G59A 5C0BD 1BGXL 3CFCH 4PV8B 3NA4A 4AM0A 4OQ1A 4WO4C 3IDUA 3OB0H 5EOQL 3SDDB 3EZ8A 1S7TB 2BNQB 4WCYL 2GCYB 1CIUA 1ZHNB 4LAJH 2BNRB 3QXWA 1GOFA 3FQUB 3LKSA 2NY0C 2N1KA 4L1HA 4CN4A 2H8PB 3ARSA 1LEIB 5C0BB 4FZ8L 1GH7A 4WUKH 2QTEA 1MJUH 2OL3L 4MDIB 2EE6A 4IEFB 4S0UC 1MCPL 1Q1JL 3NN8B 3QULB 2HLFD 3MODH 3UZEA 3SCMB 1U8HA 4R97C 5HVHB 1BIIB 1ZANH 2V5SA 4ODTH 5CP3A 4XBPB 2G2RB 3H9YA 1AFVH 5H35B 5J6GB 3HE6A 4K94C 3QPXH 1EEUA 4QOKD 4G9FD 3MRHB 1XH3A 1YPZB 1NUDA 3GK8L 5HHMD 3SGDI 3LH2L 2OTWA 2QQNH 3CFJA 5HGBB 4KPHH 2EDHA 4QF1B 2DQJL 4PJCB 5JHDE 5DXWA 4RGNB 5LG1A 2OMNA 3WXVH 2DWDB 4N0YH 4G9FB 3IGAA 4PLJD 3C6LC 2HVJA 3IFOA 2FCBA 4OCSL 5EZJA 2M26A 3JTSB 1JIBA 1CWVA 5CZVH 2NTFB 4B7IA 5I30H 1JWMB 5IHBA 2X1XR 1S7RB 4UTAH 1AY1H 4JAMB 3VXRD 3QQ4B 3LD8B 1CICB 4XCCL 2E7LA 5J9PA 1DQQB 1FBIH 2R2EB 4F7TB 3ES6A 4J6RL 2O61B 4HBCL 3QDJD 2H32H 3GHBL 1TTFA 3I50L 1L9NA 1NBZA 1UM6L 4ZTPL 3I02A 2X89D 3CPLB 1SEQL 4OIAA 2XTJD 5EB9A 4LLVB 4DAGL 4XP9H 1MIEL 5ANME 2Q8AL 1GGCH 4JM2D 1MVUB 3SE3C 4RNRB 3DGCR 4XC3H 3R8BB 3WIFA 1T2JA 1I8IA 1B6UA 2Y5EA 3F7VA 2NY7L 2PW1B 3T1FA 3ZTNH 2AJSH 2HT2D 2IBBA 2NLJA 5T3ZH 5F9JB 1TQCC 2UVEA 3BE1H 4NQED 5B38A 1G1CA 1R24A 3ARBB 4NKIL 5FYKU 5IROC 3UTTE 4OZHE 5EU7E 4PJGE 4P2RA 5FUOH 5HGAA 1J18A 1SVCP 1T3FA 3KPNA 4U4BA 5JXAL 1UVQA 2PYEB 4TVSa 3W9EB 1MNUL 3RDTC 3DUHA 4D0DB 4U0QB 4A6YB 4XCCH 3O3DB 1GGTA 4Y4HD 1A1NB 1DQDL 3BDYH 4NOFA 3MXVH 1XGRB 3JVGC 3N9GL 1RY7B 2ZOLB 1V3LA 3ARBC 3MJGX 1YUHA 4QWWD 2C9AA 4HBCH 3MLSL 1KB5L 4TUOB 4P4KA 3TNNA 4QRSB 4Y5XA 4UILH 4A2LA 3ZKXC 3B8SA 2AQ3A 3S88H 4MVBA 4X4XB 4BFIB 2X41A 4DFIA 4HCRA 1RJYA 5ALCH 1FIGH 4YHLH 2JB6B 1LMKA 2I26N 3DXAD 3MGOA 3ARYA 4LCWB 1P6FA 4B53A 3KPLA 4Z0BH 3SQOH 4ODXB 4OLXH 4WW2B 1FJ1B 4XZUA 4NUGH 1EHLH 4HZLA 1I9JL 1EGJH 4RFEA 4E41E 3L7FA 1MEXL 4MJ5B 4OZIB 4PRAB 2WLZA 4PJFF 3GIZH 2CKNA 3LKNB 1FNSL 5JDJA 5FYJU 4DKFL 5JO5A 3GM8A 3ZE1E 2B2XH 3C09C 3L5IA 1MI5B 4ZSOE 1EGJA 4DK3A 4J1UA 2N7BA 1JMZA 5FO8A 4WGWB 1CN4A 2BC4A 1FG9C 4PGBA 4KTDH 1KLGB 4HSQA 2B20A 3U9PL 1UWEH 4ESKA 4LRIA 5EIQA 3T0EC 4YFLI 1GAFH 4K23H 3GSVB 3NFPA 5BXFB 1XF3B 4G8EA 1JUFA 2BVTA 1BOGA 2FGWL 2P7TA 5HYSA 1DBAH 4EXKA 4YXHL 2XG5A 2L7UA 4HIEB 4PP8C 4NRYA 2RCSL 3OKNA 4UAOB 2FZ3A 1CDBA 2EE2A 5HDBF 1CFVH 4K7PL 5T1LA 1JF5A 1XGUB 1QPPA 2X4SA 1DE4A 5LGHH 3KYKH 4QRRA 1BLNA 5ESVA 4HC1A 3JUYA 4LFHG 3ZYOA 3IXTB 5FYJL 1D6EB 4G6JH 3SKNA 2GAZB 5GPRA 3IDIA 3B2UC 3STBA 3S97C 3LKOA 2VZTA 2VDOH 4GMSH 1IE5A 3K4ZA 4GMTH 1CG9A 1MUJA 2JIXD 3V6OC 3LY6A 4P46B 4Y19D 5I1KL 5FK9B 1N6UA 3RDTD 4L8DA 4NN5C 4IOSD 1QSFB 3L1OL 2AKRA 1WAAE 4OZHF 3LKPB 3VXSB 1B0GA 2CIKA 1ADQH 3TPUE 4HFUH 1JHTA 3QAZC 5JW3H 4MAYA 1YN7B 1WBZB 3EGSB 5IBTH 3REWA 5GGTL 4O4YL 3UZQA 1DLFL 1G7JB 5KN5B 3BFOA 3TV3L 1LEGB 4AH2B 1IC5H 2X4NB 1H3VA 5E8PB 3RZCC 2H32A 4U6XB 5HGDB 15C8H 4QCIA 1K6QH 3TA3B 3DUUB 4NO2A 1P2CA 3O4LA 4R90H 5F1KC 4UDUB 1OM3L 4YHML 4F3FB 1F4AA 1PYWB 1A7RL 3BZDA 4U0RB 2VITA 1FL6B 4OD2A 5DYOA 4CADB 4CGTA 1KBGH 1MRFH 4ZFOB 5CEYA 5MI0C 2CLVB 2AXHA 2PTTA 3SO5A 5C8JB 2DMCA 2V2XA 4LF3B 5I76A 5J57B 2GJ6B 2OTPA 1U9KA 3NCBB 5DHVH 3CFKB 2A73B 4YDVA 2UY6A 4GW4A 4HT1H 4RFNC 2V9QA 2IANB 2HJKB 4N9GB 4JHWH 2IJ0C 5AUMA 5ICZB 1ZLSL 5E6IC 1G7HB 3EYUH 1URLA 2EDTA 5CLTA 1EVUA 5EU6A 2YMXH 1V3JA 3FFDB 2CLRB 5GGTH 4YHKH 2NY0D 4TPRH 3X17A 3BQUB 5L2KE 1NAMA 1NGZA 1NDGB 2X7LB 1CTNA 5FYLL 1IBGH 1Q0YL 3GIVA 2QQLL 1N64H 4BSJA 4MJ6A 4HDIA 3N85L 3QIWC 1K85A 4KVNL 4N0FA 3GBMH 1UXSB 4OZHA 1C12B 1Z9MA 3R0NA 3U0TB 1BBJB 1P7KA 3VFGL 4EI5D 1MRFL 5ICXB 2DQFA 2M8XA 2Y4SA 5I1HL 3DI3B 4G8FA 3LN5B 4GBXD 3HMXA 2VIRB 4OZ4B 4AIZA 2QHRH 3Q3GB 3IAGC 4XCEB 2Q20A 2VLJB 3VFUB 5F21B 3NCYS 3MBEC 2FBOJ 4JB9L 1NBVL 5TF0A 1ES0B 5ITFB 4P2YA 2Y23A 3PP3H 2HTLD 5EU7C 4M62H 5BJTB 5I15L 3LB6D 5DSCA 3QFJA 1LO2L 1JNHB 1T66D 4PJ7A 1T83C 5DD1H 2VDRL 3D85D 3KPMA 1QFWL 4FP8H 4YHKL 3QXVA 5CILL 4YO0A 1QD0A 4KJQD 1YYLH 2PW2B 3QUMB 2GHWB 4FNLL 4XMPH 3SKOA 4C56A 1FRGH 1JTOA 1J9CT 4KJWD 4LSUH 1HH9A 2A9NL 2WBJC 1PKOA 1CXKA 5CP7A 3RWJA 4I2XE 3B9VA 1MFBL 3W5NA 4XP6H 1MCWM 4MCYA 4MDJA 4GG6E 3QFJD 5FA4B 2X4PB 1VHPA 4Z7VA 5AD0A 3V4VH 1OSPH 1YEKH 3QUXB 4NM8H 1NC4B 2Y6SC 2D0FA 1OWWA 4YDKH 3QDJA 4LSPL 5MEQB 2WV3A 2G5BA 1AXTH 3FQRB 4OCYH 5JQ6L 2WINB 4NRZB 3MYZA 1LP9B 2YRPA 4Z7VE 4PJEB 4JHAH 1CD1B 3TNMB 4UBDC 4YDIH 4MA8L 3GSRA 3C8KA 3IDNA 4TSAH 3RKDD 4KDWA 2CXGA 3RBSA 1T22B 1G9NL 1IM9B 4MA3A 4FQXA 4HUKB 1R3JB 4FS0A 2ZG3A 2NY1B 4N5ED 1YEDA 1FNAA 1JGUH 4RGMC 3P30L 3WS3A 4GXVL 4AEIL 4IDLA 4EJ1C 4ETQB 1AXSA 1PX4A 2Y1VA 1SEBA 2YSSB 5CINH 4KQ3H 4KGLA 1CLZH 3C6LD 4ZUWA 5DVMA 4L8CA 4TRPH 3U6RA 1MFBH 3WUWB 4EQ3A 5D7KD 1IMHC 2HH0H 1OAQL 1JGVL 4Z18A 5TE6H 1LO0H 2EO1A 1OSPL 4Y5VC 4HBQA 2F5BL 4OCYL 5HD8C 5MEOB 5ERWB 2BVOB 3L5JA 4I3RL 1KJ2A 4QHMB 5C9KA 4JM4H 1F3JB 5IVZB 1NEZB 3BI9X 5DC4B 3OX8B 1YZZA 1NCDH 5D1QB 5F96H 2CGRH 4XGZA 3LRGA 5IW6B 5ID1B 2BVQB 1N0LA 4JQVC 2BNRD 4Y5YC 5SV4A 4GQ9L 3H7LA 3RL1A 4MQSB 2K1MA 3BHBA 5EO0A 4ZTPH 2X4TB 3BDXA 1RI8A 2ZCKH 5ACMA 2ZUQB 3SCMD 1RU9H 4MQTB 1BQHG 4X6DB 2HTLC 4RMSA 2YD1A 3BIKB 2L0DA 1FIEA 1AGCB 5GS0H 1IKNA 3LEYL 2BJMH 1A8JH 1H0DA 1U95B 4LLMA 3HRZB 2UZYB 1JZ7A 4RWYL 1MFEH 4NJ9L 5IOPB 3CFBB 2F53E 4CBPA 1MJ8L 4QXGH 1QRNE 4FZ8H 5TGBA 4UQ3B 1RIHH 1A9BB 2PYFB 4NHUE 2I27N 3HCVA 2AK1L 2PO6C 3OKOB 4NC1C 4C4KT 1WK0A 4LEOA 3WKMH 3GRWL 2LVCA 1CE6A 5EOQH 4I5BA 2ZJSL 1AR1D 4AT6A 3V8OA 5CKGA 4HG4J 1OQOA 4OCMC 3O8XD 3L3OA 3LPGA 4QWWC 1N5YL 1U58A 1U8NB 1I9EA 1JGVH 2BVEA 3JZ7A 4KFZC 2QKIA 2GY7B 4WW2C 2V6HA 5HHOA 2Z92B 5I75B 1ZOXA 5CSBA 5IMKA 4WI8A 5SWSE 1YMME 3CX5K 5EA0H 5HTSA 4CRPA 4DW2H 1DVFB 3QZWG 3CSPA 1C08A 3VWJB 3C5SA 2F5AH 3RWIB 4ZPTA 5DHXB 4WW1B 4LP4A 4RGNE 1LWRA 1J05A 4XAWH 5A40E 4XNMA 4AENB 1NMAH 1CFNA 3BDYL 2NY1C 4DCQA 2F53B 1MIMH 1KB5H 1BZ7A 3O6LH 1BWMA 4JFFE 2BFVH 4NYLA 2MMXA 4E0RB 3C60D 4UTAL 5ACLA 3CFEA 4PRHE 3IJYA 2ATKB 4K8RH 4OKVB 3VI4F 3MNWB 4JFED 1T7WA 3RNQB 3IETA 3MLZH 1KN4L 1DBJH 4OV5A 4J3XA 1N5AA 4YDLB 3DV4A 5GQBA 1WFUA 3PL6C 1BZ9A 3GHBH 1WSST 1WEJH 2BSTB 5IW1B 3G6JF 4K3JL 1Q9KA 2Y5TB 3H9SA 3HC0B 5J6HB 3FO0L 2F9BT 1MWAB 3SE4C 1IEAB 1AQKL 2M1KA 1ZA3A 3NA9L 3AY4C 4QRUB 5F7FA 4KVCL 4P5KA 4ZYKB 4JY5H 5FAAA 4IRZL 3QP3A 3T0AA 1IAIH 2CKBA 3AMKA 1T0MB 4ODSL 2CUHA 3PGCB 3NPZB 4HFWB 2MHAA 3DYMA 4HGMA 3FHQA 3MNVA 3QDAA 3BKYL 4N5EC 4XNYH 4E42B 2X2YA 3MV9E 5J89A 4PLKD 1FFRA 4OLEA 3B9KA 5T3XH 5JW5A 5ELIA 5C09E 3T8XA 1T5WB 1VEMA 3VFMA 4YBHA 5C3TA 2EDXA 1J0IA 1IGJB 3P11H 5CZXC 1NC2B 1KTDB 5GIRA 4JN2A 5EO9A 2W9DH 3QUZA 1F4YH 1DBAL 3ZKND 3DUSB 5FA3A 4H1LA 8FABB 2EYTA 4POZD 3WNPA 1FH5H 3D39E 3MRNA 1F00I 2DLEA 4H8WH 4P2QA 2EYSA 2IPKB 4M03A 3X3GL 3KPQA 1MY5A 1RZFL 3U82B 1M4KA 2X4OA 3UTSA 5JORB 2ZCLH 5HYJB 2ESVB 3TYFA 4ZD3L 1IEHA 4HCRH 3QNZB 2ADJB 5BCAA 5JIKA 5F3HA 2VLKD 1WFOA 4Q58C 1ZT7A 2AEQH 2P1YA 5DZOA 2HWZH 3ARDD 1BD2D 2VLRB 4K2UL 2DBJA 5DT1L 4MA7H 2QLVB 4M61B 3MV8B 3MTRA 1GPOH 1NAKH 1CFQA 4X5XA 1A6AA 4YBQD 3IU3A 5J1AA 4PRBA 4WHYH 4KK9D 1FDLL 3IFPB 4XH2A 3D39B 2VLKB 1IQDB 1ITCA 3EW3B 4CU7A 5ACZA 5C0NC 2HJLA 3ESVF 3KNBB 4Z0BL 2VC2L 2YPKB 2R0KL 5FHAH 1KPRA 3FOMB 5F1OB 4X6CA 2R9HD 5GRUL 4TVPH 5J0BA 2Y06L 1FC2D 3ZT7A 3KLHD 3MV8D 1EHLL 1MHHA 1FV1A 2KUTA 1U2CA 3QDGD 3W0WD 3BT2L 5EUOB 5FUCE 1TQBC 5IB1B 1FZKB 3HS0A 4NNPH 1T1ZB 5IEHB 3FQXB 2AJVH 4WEBH 3MMEB 3DPBA 3I6GB 3RGVC 2NCMA 1OY3B 3KDMA 5IESL 1N6QH 3W0WB 3CDCA 5D1ZA 1ZV5A 2WIIA 5CEZL 1W0YT 4UIKL 3EKCA 4QRPA 2W9EH 2GT9A 3NFNA 3QRGH 4Y19B 3THML 1E6JH 3IFLL 3L3KB 1Z5LB 3UJTL 1DJSA 2AW2A 3MQIA 1ZGLA 4J23A 7FABH 1FDLH 3EOAB 4DEPB 4OZGA 1V7NL 2Y06H 4L3EB 1QLRA 2NZ9C 1MCBA 1R0AH 1B3JA 1FNEA 1YN6B 4H5SA 1I7ZB 3F12B 3ULVD 1HEZA 4WRLA 5E6IA 3M1BB 2DMKA 1CQKA 1YY8B 3U7AA 3SDXA 2AV1A 2BOCA 2LFGA 2DQTL 1JNLL 3DVFA 4ODWA 5IB4B 5TQ0L 3TBVB 3OGCB 1MAMH 5C0IB 5F7EH 3TCXA 3OAYK 1D5BB 3P3YA 4QTIL 4OUUB 3U7WH 1KT2B 4XXCA 3Q5YA 2BDNH 1NKOA 4FQJL 2X4QB 1FFPA 3V79C 1XR8B 3HRPA 3I85A 5E6ID 5IK3B 2WP3T 3WO4B 4HV8A 1KLUB 5DR5L 1AIFA 2EKSB 1IKNC 5CD3A 5KSVA 1I85A 5HHVL 3BPOC 4WUUB 3STZA 2VXVL 3CSGA 1IM3A 2IAND 1UKQA 3O6FD 4WV1A 4KH2A 3WNLA 1QKZL 2AABL 1IAII 2RR3A 5GZOC 1R0AL 2J4WL 2FATH 1GHFH 4C83A 1IZKA 4UU9A 1YEGH 2ADGA 1WISA 4I8DA 5C0AB 1QRNB 1RSFA 5I8OL 1E6JL 5BV7H 3BQUD 3E3QA 3EO9L 4LSQL 2P44B 1FLRH 2D7QA 2BVUA 4PRHA 3EYOB 4Q9CA 1N7MH 4G80B 3FT2A 1FGNH 1JWUB 4P23D 4TYUA 5DFWH 5E24E 3DYPA 2W9LA 3GMMA 4OIIH 1EA9C 5DEFA 4ELMA 3V0AC 1I3RA 5HYQB 4XPAL 1WC7B 4JGMA 4M93B 1SM3H 4R0LC 4ZUTB 2J88L 3P4OA 3WFEL 3GJFK 2VERN 4NQEA 3UJIH 1UA6L 4R96A 5DJXA 3QWRA 5T1DL 1FZMA 4IIQB 1NGWB 3P30H 1KB5B 4JEGB 4PJCF 1JE6A 2AV7A 3MJ8B 1ED3B 2YEZA 5B39A 5E8NB 1AGDA 1UZ8B 4X9HA 2AP2A 1OCWL 2DQDH 5GZOD 3HUJE 3K80A 2CIIB 2ICEA 3OKMB 3QEUB 4QTHB 1T1XB 2CO7B 1I1YB 5H94B 5TE6L 1X5KA 2P4AB 4JG0L 2A9ML 3EO9H 1GZPB 2EDNA 4LSQH 2Y6SD 1A7OL 3G5VB 1F11B 5FYLH 1VFOA 3V4PL 1LNUB 4L8SA 4ONGL 3O45A 1OHQA 4H25B 1BFTA 2J4WH 2P8MB 2W91A 3DVGB 2GITB 4NQDA 4P2OD 3IKCA 1KULA 1QYGL 1DUYA 3V0VB 1EMTH 4IHOA 4GKSA 4YDLC 1DSFH 2LABA 2IAMA 4OFKA 4M8QA 3RWGB 4YGVA 3FN3A 1EJ6A 5E8EA 2WBJA 5I2IA 1HINH 4KHTH 4M3KB 4QT5B 1EFXB 4NBZB 4F58H 1J8HA 3D3VE 4GAJH 2V9TA 3A6BL 4OGYL 3MA9H 3REVB 1JI1A 2Q7YA 3V4UH 3KLAB 4NQSB 3X3FH 3D69A 5JOFA 5DEGB 3RKPA 1FNGA 4NQDD 5KVGH 1T04B 1YNTA 1MJJB 4ONOA 1A1OA 1U3JA 4N8CL 2PXYA 1R5WB 3MOBL 1Z3GL 4N90E 4ODBD 3JTTA 1FHGA 3BP7A 3ILPB 1AR1C 1XZ0A 1RHHB 1EAJA 1OARH 5BZDB 1S9XA 4J3TA 1HE7A 1YEJL 3BEVB 3QH3B 4EIGB 1AQDB 2ICWA 5GS3A 4TUKL 3ZT6A 5E08L 4YHIA 4F9PA 3O6MH 3T0BA 3TZVB 4ZS6D 3MV9D 2ZKHH 3ZL4H 3OKKA 4OM0L 3MGAA 1ODAA 4MXQC 1FCGA 1QG3A 2R23B 4AIOA 4RAUB 2R29L 5E4EC 5FDWB 2J7LA 5ILTH 1CXEA 5EZLA 2BRRH 5JQ6H 1YMMB 2J2ZA 3I6KB 1RZGB 2BSRB 2DQJH 5ADOL 4TSAL 1HINL 4KHTL 1U8KA 1NAML 4LHUD 1CE1H 5A1AA 3IJHA 4P48A 3NAAL 4ZTOL 4LMQE 4HLZH 4S1DD 3O3BA 5F44A 1XIWB 1CDUA 4XT1C 1OTSC 2AXFA 2X4UA 2DI8A 3CU1A 3MRPB 4OKDA 1I1AA 4ORGA 2VLLB 4HH9B 4N9OB 2I60H 1VACA 2LTQC 3QDJE 3RIAK 3N1GC 4RRPA 4P59H 2P8PB 2FL5B 5K9OA 5HGGS 4HKXA 4LGPB 4LLDB 2F5BH 5KVDL 4XTRC 5D2NA 1G6RA 3IU4H 4KKAC 1Q9WB 4JFOA 1RUKH 2R0ZH 1PZUB 4JFYA 1W2KT 5JNYA 2BCKB 1S7VA 4UT7H 5I8EB 5ILTL 5JHLH 3G5ZB 4WENB 2P5EA 1AQKH 4XCFH 1U8LA 1EO5A 1P1ZB 1S7WA 3U2SA 3ULVC 4J3UA 1OP9A 1BEYL 4U1IA 4NZRL 3S7GA 3RY6A 2P5WE 3SE9L 2A1WH 3AREB 4XP5H 1HILA 2E7MA 2OTUB 1FGVL 3MRJB 1I8LC 1MCOL 1MY7A 4RFOH 4DTGH 3OKYA 2YPVL 1NANI 4FQHA 1WBXA 3EO1A 4U0RC 4JM2B 5SX4I 4HIIB 4G7VL 5DTFB 4UQ2A 4HK3N 2OS7A 2AJUL 2UUDH 4Y4HC 1G84A 5EOTB 1QACA 1IC4L 1JTPA 2W60B 4DN3H 5CIPA 3UTPE 2I9TA 4J3WA 2GFBB 3CZFA 1LEKB 3DARA 1TPXB 1ULVA 5K33A 2Z0BA 2FLBT 1CQYA 3FCTB 3ARRA 3MJ9H 3UROR 1N3NA 3TIDA 4PJEF 1X4YA 4MB4A 4BQCA 2IGFL 5L88L 3DHMA 4NIKB 5EU3A 3RTQA 1RUAH 5I17A 4Y4HB 3ILQD 2ZOKB 5EU6D 3HNSL 1ND0B 4G6ML 5GGRB 3X14A 5IP4A 5IFJB 1GXEA 2Q86B 1TQBB 1RJZA 1MFAH 3TN0A 3UTOA 2K3TA 2DLFH 4OZFH 3GSUB 3T0EA 4GAGH 4JE4B 3BKMH 3B3IA 3S3PA 2NY4D 4F8TA 1WVZA 3BKCH 5CWSA 4HJGB 4LCWD 1OTSD 4F9PC 2QBWA 5TDPB 2FGZA 4QO1A 4NWUH 3QG6B 1X5IA 1CDCA 1WEJL 2JF1A 4NN6C 1KPVB 1KTKE 3KYAA 3MNZA 1MCOH 3B8YA 3MJ9L 1J8KA 2VISB 4Q6IA 3WUZA 4ELKB 5FOBB 1OGTB 2F19H 3U9PH 3VJ6B 4LVOB 3ULUD 3QIWD 3L3IB 1EH9A 1T2QL 5J1TC 2DS4A 1MFCL 1IEBA 1BD2A 2FGWH 3LV3A 3UZVB 1JYXA 5E2VL 4KMTH 5JQHC 2AJZB 1A4KB 2YWYA 1UH4A 3T2NL 3ESUF 3G6JA 5TFSL 4UILL 2CRMA 3L9RB 3QIWB 4MZ2A 5D71H 1DR9A 3EOBB 2YBRB 1E4KA 3HC4L 4QRPD 1F3DJ 5F71A 4ZOBA 5I16B 4DFHA 1MI5E 5DK2A 1EV2E 4JPIA 5TJWK 4G6MH 4NQXA 2QEJA 4YAQA 3HR5B 1J86A 4Z7QE 4Z6AT 3WEXA 1VFAA 4NUGL 3V6ZA 4I9WD 2H1PL 4LSRL 3PWNB 4MNQD 3O3EA 2VYRE 2I07B 4X6CE 3QIUA 1DL7H 3DETD 4NDMA 3RL2A 1AHWB 3IKKA 3PV6A 1HXMA 4L8SC 2V2TA 4JY6B 3IRPX 4UUJA 5HVHC 1UYWH 4YHYC 1ZTXH 3V6FB 2W9DL 2DQIH 1QTYT 4QTIH 4CVZB 1ZA6A 4PR5B 4EVNA 3NPSC 5JW3L 4HAFA 4X6BB 5ESQA 1PSKH 4QGYA 3EYFB 1IRAY 1I7UB 4NWUL 2IMNA 4RIRB 1YEHH 5CGYD 5C0JA 4JFHE 1UWXH 4KMTL 1KPUA 3CXDH 2EO9A 1S8DB 2FIKB 1JCKA 4F80A 3MXWH 1AR2A 3RJQB 1J1PL 1AGEA 2VN4A 4HWBA 2XTLA 3QUYA 4RQQA 5ABDE 2R9HC 2GJ6E 4X8XA 4R0LA 1GGYA 3TO4D 4HWZA 3NIGF 1CGWA 3RZCB 1RFDH 2ICCA 4NHCH 4WFFD 5DJ0A 2NZ9D 5DT1H 1C5BH 2GJJA 3LAFA 1P9MC 4HUUA 3DO7A 3ISWA 4XP1L 4JFFB 4GRLC 1G0YR 1AD9A 5CJOL 3ULSA 4P5TA 4F57H 4WHDA 5E2WH 2DQHL 5DRXB 3HNVL 5SWZD 1CXFA 2D3VA 4NCC1 4TVPE 2NZIA 4UV4L 5I1JH 5BO1L 4DZBB 3Q1SL 2DLGA 1ZTXL 3MRQB 1H5BA 4MS8D 1BBDL 5DLMH 1HQ4B 4WTXA 3ULUH 4L4VA 5F7DA 4GAYA 4NN5B 4GMTL 4KTYA 1QSED 2DLHA 4G9DB 4S1QH 5DD3L 2IALA 4JFFD 4LPYA 1H15B 1S5IL 3LEVL 4JHZA 1IGIL 3W0WE 2CK0L 4DVBA 3PWVB 3BZEA 3WHE1 4IOIB 2GJ6D 5FM5M 5LGHL 1P69B 3PABB 3SGKA 3C08L 3JBG7 5E8OA 3HZMA 1MCWW 3G08A 2XN9A 1BWWA 3QO0A 1JFQL 1X7QA 4OI9A 1QSEB 1WIOA 2R69L 1OLZA 5D2NC 4UAOC 2RB8A 3GMRB 3SGEH 1SY6H 4J6RH 5F7LB 1L7IL 4MAYC 3HE6C 1NBYA 4PGZA 3OXRB 4PJCE 3TYGH 5IUSA 2Z9TA 3G6AB 3LRSA 2CR3A 2VXTL 2FX9L 1X3DA 4H26A 1QEWA 1AKJD 4GW1A 4LNRB 5I1GH 4M5YH 2AEPH 3RHWK 3V7AG 2CUMA 4ALAH 4U1HA 1CK0H 4WNQA 3M17A 3O6FB 3FO2B 5D72L 5GGRY 1KC5L 4IRJC 1UB5A 4W4OA 2GYSA 5E2TH 5CBAB 5EO1A 4AIXA 4X6EB 1S7SA 3F58L 1QYGH 3VXMD 1RFDL 2KPNA 4NHCL 2FJFA 4YJZL 3CDGB 1BZQK 1HSAA 4IBLT 3ARGD 3MGTB 2E9WA 2FWOA 1P7QA 4S1DC 5JUEL 4NFDA 2JB5L 1ZGLM 4J2XA 1S9WB 4YXLL 4LAQH 1MLCA 4X8JB 5BVJA 4MA1C 4PJXE 1ZWIA 3KPSA 3S36L 5H8DA 3VXMB 3CZJA 3WL9B 2R69H 4HMCA 2DM7A 3LKQB 1G6VK 4Y5VB 4LRNL 4XTRD 4JCLA 2XTJC 1CDIA 5I0ZA 2ID5A 4JRWA 5H2BB 3I3DA 1P4IH 3S3SA 5D8JH 4JKWA 1WWAX 4R4NC 1E27B 5L7XL 4XX1E 2PN5A 5AAMA 1HZHH 3MV7D 1UM4L 4NHUA 1YEGL 5D72H 4I4WA 1JPTL 3KYOB 2FATL 1G0DA 1JK8A 3TT1H 4D0BB 3O41A 3G5XA 1JPST 4QHUB 3VFPA 5CAYB 2D0GA 1DQLL 3DX9B 4HUWA 3S34H 4PREB 5KS9B 3VXUB 2Z35A 5D7JA 5T5FL 5C08B 1HYRC 4HXAL 3T65A 2CDFB 3HUJB 3Q0HA 3VFGH 3MCG1 5E00A 4F15C 5DZLA 1FFOA 1F58H 4FP8L 3IS1X 1NSNL 1JZ5A 5FYKL 3BESR 1XF5B 2F54B 3O8XA 3MV7E 3LZFL 4LLUB 4JKPH 3O4OC 5D1XA 2VE6B 1NKRA 4Y7MA 4HS6A 5MENB 1UM4H 1R5VB 2DI7A 4X99A 1NGPL 5INDA 2ITCB 4M6OL 1MRCH 4O02L 1A22B 3AREC 2HMIC 3DX8B 3LKRA 2BY1A 2V7HA 1KTLA 4LKCA 3VDCA 1CGSL 5F93C 4XNQB 3B5GA 1INQA 5FKAB 2E7HA 1JHKH 4ORZC 4RCAA 3BP6A 3VMNA 3RGVB 1IM9D 3TN0C 4P3WA 1TZHA 4JFXA 4APQA 5MP6L 2RFXA 4WWKB 3L5WB 1FFNB 3VDAA 2DD8L 3GUTB 1E4XL 1X4XA 4KV5E 4NRXA 4X4YA 4IRJA 1EJOH 3CDYA 2FHCA 3MRBB 3B6SB 3I75B 2XYCA 3BRFA 3RGVD 3MFFA 1U92A 4LU5L 4IMLB 3NGBB 1D5IH 2GSGB 4JVUA 2D7PA 5JHLL 2XZCL 2ADFH 4EN3B 1BJMA 3U1SH 4IRSB 2F8VA 4QHLA 4L9LB 5FECA 2XNAA 3FT3B 3L3HB 3H9SD 3ZYZA 2FO4B 5TDNA 1YPZE 1YQVH 3HMXL 4RX4A 4HFUL 5TDNB 4OTXH 4F37F 1HSBB 1A64A 3RU8L 1DUZA 1E4JA 3QDMD 4XB8A 5GGUA 5DD6B 3MUJA 1J8HE 3W9DA 1WCBA 1OTTD 1SY6A 4EN3A 3AM8C 1FVDB 1YJDC 2GSGA 2A77H 2NR6D 3GFUA 3VXPB 3OF6A 5KSUA 5DVKA 3D18A 5J56B 4R8WH 3MFFB 4PJIF 4QRTA 1CCZA 5B3JE 3S5LA 1GOGA 5DVNA 5GJTL 3RY6C 1S7XA 1PBYA 1W72H 2H3NA 4IRJB 12E8H 1QHPA 5GSRB 3VFNB 3GUTA 1MRCL 4O02H 4PJ7E 5FYLD 3MR9A 3RWCB 4ISVB 3L5WA 4WWKA 1G7QB 1J7VR 1ZLVK 2DB8A 5T5NF 1Q1JH 5CBEA 4JVWA 3BX7C 5IR1A 4BUGA 3RVWD 5JXAH 3EUUA 2BY2A 2IH3A 4S10A 5JOPE 5F96L 4Y1AB 1Q9OB 1ZS8B 2O5ZL 1N26A 1MQ8A 2IQAA 3U4EB 1CE1L 2EE3A 4HT1L 1YQVL 3ZKNC 4KUZL 3PHQB 4X99B 2X4RA 1T20B 4NQDE 5F1NB 4U1NA 5C0BE 2EEAA 3KPSE 4PJFE 1XGQA 1ZMYA 3VRIB 2BHUA 2I60L 2VL4A 4L4TA 1CICD 4Y89A 1FQ9C 2NY6D 3L5XL 3O8XB 2RIKA 1IAKB 2F54A 3TWCH 4CAGA 3O2WL 1LE5B 4HJJL 5JPMB 4B50A 3X11B 5KVDH 3ULVF 2CXKA 3FB8A 3WDHA 3NIFF 4K7FA 1H8SA 4HH8A 4Z7VF 2MTPA 5HYJE 3HUJA 2DOCA 4RGMB 4KHXL 4KI5C 1G9NC 5C08A 1LDPL 3HI1B 4XC1L 1FSKB 3CLFL 3HC3L 4YIQA 3OJVC 5ECJE 5E5RB 3P4NA 4PJ9D 4JZJB 3OG6B 3GGWB 5TPWL 4QHUA 1P4LB 3VFPB 4K55A 1YECL 5KAQG 1NFKA 4ZFFA 4P9HL 5F9DC 5ID0B 3MSPA 3SE9H 2O5ZH 4Y4KA 2X70A 5EUOE 3MRGB 3E6HA 1OF2A 4F33A 4BELD 4NC2B 4NKQB 1TETL 2H1PH 4HKZA 2WBWB 1G9ML 3B83A 3QHFL 5C9JB 1IGFL 1GVIA 1JZ3A 1CR9H 4Q97A 4N5UA 5D7IF 1QP1A 1SJVA 2D4FA 5EA0L 1JNJA 2IF7A 4M48L 2EC9U 2PYED 2FSEA 2VLKE 4R4BA 2IH1B 1I75A 3OKEA 4OCXL 4UIMB 5MENE 3F65A 3BP4A 4Y5VA 3MYJB 1CLOL 2ITDB 4NKDA 3U0PA 1EVTC 4QXTA 3MUGB 4DN3L 1ACYL 2X1OA 1XF4B 3WL9A 5IQ7H 4CW1B 4JN1H 5C09B 1TCRB 1SEQH 5DQJB 2NY2D 4Z7QF 2SEBA 3KYKL 4PJ5B 1K9TA 1ORQA 1A3RH 2FR4B 3U4BL 3IDYC 3OHXA 3QQ3B 4MA1B 4ONHB 3FTGB 2QQKL 1XGYH 2D7TH 4F7EA 4IOFD 3O2VH 2DQCL 4HUXB 1PSKL 4N0CD 3JV6A 5C09D 4YHOH 1FPTL 4NZDA 3PWPE 4R2GB 5EO1B 2PYEE 3IFLH 3NGBC 5HHPA 3GSOB 4XNYL 5KANG 3WLWC 2R0WL 1R5IA 3M17B 3O6FA 3QHZL 5LCVL 1J87A 1D5XA 2NY5C 2W1NA 1NLBH 1PLGL 2IG2L 3B9KC 4PGDA 5ALCL 3LQAH 4WW2F 3LRSB 2XXCB 2EIZB 1A7PH 2HFEA 1NGXB 4JY5L 3L3GA 4JQXC 3KPRE 1WFTA 1K4DB 1HHKB 3SDAC 4Z7WF 1T6WA 1ZT1A 5HBBA 5D7JC 3ZDYF 1EGJL 3T2NH 5FF6B 1WTLA 2GTZA 1JV5A 1UB6B 1CVRA 3HG1A 3H9HA 3QCVH 4IOIA 2XA8L 4YFLF 3SE4A 3G6JE 3F8UB 2B39A 5E8DL 3MJ9A 1GC1C 2VLRD 1FO0B 4P9MH 3HZKB 1H15A 1REIA 2XRAL 3GBNH 4OB5H 3RFZC 4G9DA 2D7MA 5DJAA 4L4VB 3GSNA 5F7DB 1VEPA 1HQ4A 4JPVH 5L0QB 4ZUSA 1BMGA 3MV11 1T7XA 5DVOA 1FVCA 1ZVYA 2V2WA 4YPGB 5C7XL 2Q6WB 1FG2B 4TUJA 1L7TH 3C60C 5AZ2L 4ZXBC 1SYSB 3U9UB 2ZCKL 1UYWL 3U46A 3OR7B 4JDZB 3DO7B 1LK3L 4HCRL 5C0CD 4PJXB 2EDWA 2VXUH 3DSFL 4U1SB 4OI7A 2I5YH 4QGTA 4ACPA 4HWZB 5IMOA 1U8PA 3RZCD 5E9DD 3UTZA 1YEHL 3D48R 4PD4K 5HPMA 5D70H 2OI9A 5T33H 5CEZD 4KJPC 3RDTB 4D94A 4Q2ZA 5E5MB 1AGEB 5LAXA 2XA8H 5BRZE 4NT6B 1RIHL 4PJ8B 1YMHA 2FJGB 4FFVD 2DJ4A 5DJZB 1DFBL 1JGLL 3N85H 1HHJA 5INCA 5SWZB 3IF1A 4ZAKB 4OZFA 1QBAA 3ALPA 3U36A 5DI8A 5A2IH 1P6AB 5I1AA 2YD4A 3AS0A 4LCCA 4JO2H 2ORBL 1VENA 2QSCL 3RUGE 5F7UA 3QJFA 4F7MB 3GSQB 1HDMB 4ZMAT 4UV7H 3JV0A 3OAUH 5IJVB 3JWDL 3VWJC 1J5OL 2LQRA 3GSWB 1LILA 4G6KL 5E2UH 5EIIB 2C5DC 3MLWH 1IJ9A 5EC1A 4JY6A 4XP9L 4P2RE 5FO9B 1XCTB 1HXMB 3NPSB 3ULVE 4PJ9C 4LVNB 4GRWE 4TQEL 5FGBA 4P9ML 1LO5B 4M02A 1TTGA 4LQ1A 2LAAA 5JZ7C 2P46B 3S36H 5HY9A 3HR5A 1KIQB 3MO1A 2C1PB 3ZLQC 5E95B 4MJIE 5F6HJ 4G43B 3P9WB 4I9WE 3RVVD 3VD9A 1D5ZA 2JK5A 5MERB 2ZUXA 1NFDA 5EN2A 4ZNCD 1CYGA 4LDOB 3ARGC 5EC1B 4MCZB 5EIIA 4QY8A 4GH7B 3H9SE 2OI9C 5B3JF 3MV9A 2J8UA 4HKJB 3ZO0A 2WMPA 3CVHH 1IGCH 2XXMB 5SWZE 1VFUA 3GSQA 4YC2B 2DRUA 1IEBB 3B43A 3MREB 3Q6GH 1YJDL 3HI5L 5J8OA 3C5ZA 3M45A 4YGAB 5I1AB 3QEQB 4LSPH 3NCJH 4PGEA 3TH2T 2FYYB 5DI8B 2XKSA 2NX5A 3VJ6A 3C60A 4NC1E 2E7LE 2HFGL 3SGJA 4ELKA 4Q6IB 1D5MA 4HGWA 1ZXQA 2AEPL 2X1WL 1A7NL 3ZKMD 1DN0B 2FD6H 4Q2ZB 5GS1A 1OW0A 1C1EL 4ZS6C 4LCCC 5HPMB 1HYSD 4OT1L 3UTZB 3QG6A 1AI1H 2ERJB 4DZ8B 5LWYL 3W11C 1XGPB 2NYYD 5J11B 3MOAH 4GBXB 5JPNA 3QNYB 2V17L 5DJDB 3ROLB 4U6HB 3UCRA 3QI9B 1J1XH 5GGSB 4JDZA 4KMQA 1FLRL 2WBJD 1NCNA 2C3WA 4BK4A 4FG6D 4JO3L 5CD5D 1EO8L 3S37H 4MAUL 4OJFH 6CGTA 5CCKH 4EUPG 4JLRA 3GBLA 2H2PD 5IQ9B 2HT4C 1TNMA 2ZUWA 3BWAB 3TCLA 1EPFA 3OPZH 1J1OL 4ZUSB 3HAEH 1KCGC 5IFJA 4KJPD 1B88A 5C07B 1UEYA 4WU5B 4N0UE 3WD5H 1EJOL 3GHEH 4FFVC 3RTQB 1A0QL 3H0TA 1F8TL 5EU3B 4CJ1A 2YS4A 1FO0A 3ARTA 2YWZA 4LU5H 3O8XC 1ONQB 3MRLB 3HG1B 2ZUVA 3PGDB 1A1MA 2VOTA 3CSYA 3G04B 3QJHA 4HS3A 4BJLA 2HFGH 4XPGL 4MMZC 1LP9E 2CKBH 1LEKA 2XZAH 2GFBA 3HMWH 4XRCA 1CBVH 4YXKH 3GIZL 4B41A 1ZT4B 3V8CA 1PEZA 3IDGB 1SYVA 3GNML 4Z0XB 1MLBA 1TQCB 5C0ND 2QHRL 3I50H 4FNLH 4H20H 2A9MH 3QB7C 4ZFGH 3TVMA 3MZTA 5J1SC 1S3KH 3HZVB 1MQKL 3MOQA 5HHQB 4H88L 3E1F1 2OTUA 4FQQA 3GSOA 2HN7A 4RBPH 3JWOL 3VXQA 1OCWH 2DQDL 4G8GE 3K4DA 5IB2B 2E9JA 4P23A 4G42B 1KOAA 2FHBA 4X9IA 1X5JA 1PY9A 4UDTB 1Z9LA 3DNKA 3IFNL 3CJJA 5BS0A 4JO3H 1FORH 3UPRB 4EI6B 1ORQB 3O0RH 3DIFB 1MHPH 2QSTA 4JDVB 5T5FH 4NNPL 3U4AA 4JFYB 3TH3T 4HK3J 1JFMA 4R8WL 4WWKD 1UADC 1HCFX 3S36X 4X0KB 1I8KA 4HWEL 3K81A 5DRNB 4TTDD 4J8RB 3PHOA 9CGTA 2DDQH 2P8PA 2IFGA 1EEZA 3MZGB 1D9KC 4G9FE 5DJYA 4FQ2L 4PY7B 3RIAF 3MRPA 1SMOA 4HF5H 1MCDA 2NW2B