4LHUD

Crystal structure of 9c2 tcr bound to cd1d
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
202
structure length
202
Chain Sequence
QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGDPGGLNTDKLIFGKGTRVTVEPRSQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CD1d-lipid antigen recognition by the gamma delta TCR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d
total genus 33
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lhuD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lhuD02
1YEDB 1J0IA 4MA7L 2XG5A 5DJ2B 4ALAL 4K3DL 1RVFH 3MRQA 4NYLB 3OAYH 1F90L 5L2KA 1KCSH 1S5HB 4JR9H 4KQ4L 5ISZB 1DE4A 3VRIB 1I85A 2L0DA 2VLJE 4K94H 3T4YB 1Q1JL 3QEQD 2GJ6D 4PRHE 3QUZD 2RB8A 3RKDC 3ILQC 1NEUA 4HJJH 5DK2A 2PTTA 4B41A 4JFFB 2CK0H 3ZKXB 1T22B 3S35X 5HYFA 4JFYA 4NUGH 1K6QL 3SE3A 3D2UB 2R8SL 4PGZA 3AM8A 5HDLA 5I1DA 1N6QH 3BZFA 3L3IB 4I0KA 3O41B 4MB3A 2W0PA 3IXAB 5FGRA 3CVIH 3HUJF 4EVNA 3BW9A 1U9KA 1LQSR 4GS7B 1I7RA 1Y0LB 1I9JL 2PXYA 1JN6B 4M6NH 4MAYC 5F1KC 3OKLB 2FR4B 3FONA 1GGYA 4HPYH 2DDQL 4BZ2H 3BVNA 5GGRB 1T7XA 3FRPG 2J8UB 5C09E 25C8H 5I8EB 2X4QA 1I8LC 2H9GB 1MUJB 1SY6H 3CVHB 3OBAA 5FAAA 1NCDH 5JHDA 3EO1A 5DGRA 4HQQL 1Y0LA 1AQDB 2B1AH 3AREC 4YUEH 2BSED 3MJGX 2B20A 2PXYC 5MENA 4IRJD 3T77B 4PBVC 1A4KB 1R3LB 1KF9B 1VA9A 4LHUB 4YBHA 4Z7NE 5GSRA 1J86A 5DFWH 4PP2A 3FO0L 4R90H 4OF5A 2BVPA 2DI7A 3EO9H 3UC0L 3DVNA 3FB8B 3LKQB 2YZ1A 3S96B 3HZMA 2OSLA 2NNAB 2QJDA 4HHAB 2X09A 4LLDB 5T3XD 1I7UA 2NX5E 4X4YA 2W65A 5FYKD 4LEOA 1L7TH 3EOTL 4WFHD 3BESR 4GOSA 4LSUH 4P5TD 4BFEA 1T04B 1C16B 5ADOH 4RA3A 5L2KB 4P2RE 3KHOA 1FVCB 2Y7QB 5GISH 4MGXA 5AAMA 4WWKD 1RZ8A 3L5HA 1YPZB 2BRQA 2GTZA 4AYFA 2EXWD 1F3RB 4MA1B 3ZT7A 3L3KB 2MHAA 2R0LH 3KHQA 1GAFH 2Q8AH 5HSFA 4AQOA 3FN0L 4XNUH 5JPMB 4JO3L 1HKFA 5ECJE 3FQWB 2Y36H 4M93B 1NANH 2PYFA 4CMHB 3BPNB 5IIEB 1MHHB 4QHUB 2COQA 3MRGB 4WY7H 1FC2D 5A2KH 3O6LH 1T7VA 5C8JA 1BZ9A 1N4XH 4PJFE 9CGTA 4ZAKD 3ARFC 3BWAB 1MFEL 1PAMA 3HUJA 4JZOA 2R0KH 3EO0A 1MCPH 4FQQA 4DN3H 2XZQL 3BPCB 3MUGA 3IFOB 3OF6D 4PGJA 1IL1B 4JN2A 4LSRH 3LY6A 1FL6B 1BX2B 4HS3B 3QNYA 4HIJA 4JO4H 1JF5A 2UWEE 4OUOA 2IBZX 4L3ED 1WCBB 4HS8L 4OZ4A 2OMNA 4X6EB 1OTSD 1HHKA 3P0VL 3V8CA 3WLWD 2DLGA 4I1NB 4M5ZL 5F6IB 5EOCJ 1WWCA 2R2CA 3MLYL 1K5NA 3TJHD 3D25B 1GC1L 3C6LA 1KG0B 3STLB 4O2CB 3H6JA 4JKWA 2VOTA 4NBYB 5IVXE 2NLJA 3EYQC 1U91B 5C0RL 4KROD 3TO2B 2WNGA 4F58H 4QXTA 3MRRA 3CSBA 4Y4FA 5HXMA 1XCTB 1EUUA 2XQYG 3MLTA 2BSRA 3D69B 3RY4A 4OGXH 3T3PE 1J05A 4AEHH 2EDEA 3WMSA 1EHLL 4RNRB 3HC3H 2C1PB 5GRWA 4PJCF 2XACC 1Y6MR 3QUYD 4P5MB 3TCLB 1CIUA 4E9LA 2AJYL 3W11D 1V7ML 1FFOA 4L8SC 2XPGB 1M7IA 1MREH 2XKSA 2AQ3A 5FOBB 4EI5D 2OP4H 4CVZB 5I18L 5JR1H 5KVFH 3MUHL 2X7LA 3FTGA 3LB6C 4XP1L 2DMBA 1I7ZA 4U2YA 2FX8H 3QEUA 5TQ0L 3L5IA 4TVPL 4IS6A 4IIQC 3VXSA 1UZ6E 4HK0A 4OV5B 3DX9A 5DR5L 5E2UH 3F12B 5M7QA 5C2BH 1WFOA 4UT9L 5DUPL 3D48R 4FQQB 1T89A 1U8HA 4UT7L 2XWTA 5D4QA 1B2WL 2D0GA 4P9HL 2AI0L 1VKXA 5IJVA 1U3ZA 5C2UB 2ZKHH 4Y5YC 1YEDA 4M62H 4YXLL 5CUSH 3E3QC 4PR5B 5EN2A 3MGOB 2EE2A 4W4NA 3EDKA 1S7RA 1IAII 4HWBL 3OZ9H 4HAGA 5D7LB 2RFXA 5DEFB 1MCDA 3ULUL 2HRLA 4OI9A 1IGJA 3J8F7 3LS4L 1AGFB 3VG0H 3LH2H 5EO0A 1R5VA 4QT5B 1UJ3B 2E6PA 3D39A 1M05A 4QRTB 3S35H 5IEHA 4RQQA 1DLFL 1ZHKB 4KKLC 2HTLC 4PJGE 4BKLA 3MROB 1B0WA 4MS8C 1EPFA 3BHBB 1A7BA 2QQLL 3RGVC 5FHAL 3U2SB 2IPTL 1T2QH 1QBAA 1VFUA 4Y4HB 1MY7A 5EZIL 3RL2A 3S98A 4MB4A 4D9LH 4QHKI 3WLBA 4PTTA 4XMLH 3H7LA 5B3JF 5MP6L 3Q5OA 4NOBA 2AK4D 1B4JL 5CFHA 3OKMB 4L1HA 3G5ZB 4FFWD 3TVMD 3VXUD 3IRZA 1B9ZA 4JFQB 1BJ1J 1UWEL 2EXWC 5IV2B 2A9NH 4ORGB 2B0SL 4FNLL 5I1GH 1J8HB 1QFWH 1UB5B 3GEWB 4K3GA 4HD9A 1VGEL 2DQEH 4OCRL 5D1ZC 3DIFA 4DFIA 4B53A 3FQNB 2I27N 3OHXA 1GVIA 3GSXB 1G0YR 2AXFB 2VL5A 5CEXB 4Q0XL 2X9WA 2X4QB 4PJHE 3RVUD 3B2UD 5JW4M 4IS6B 2DQTL 2E6QA 1NLDL 2AJ3A 3WFDL 4XCYB 4XCEB 4GKZA 1OCWH 1NAML 4RAUB 3QXDA 4KMLB 5D1ZA 1XGUA 2NY5H 1FIGL 5I1GL 1P4LA 5K59F 3MRLB 2H32B 2HJFA 1U92A 2GQHA 2CJUL 4NSKB 2CLVB 3UAJC 3WHE1 3LRHA 4NQED 2PCPA 1BIHA 5HYIA 2ATKA 3C5SB 2VN4A 2V7NA 5B3NA 4XCFH 4MA3B 3IAQA 3R1GH 3C08L 4ELMF 5FECA 1QG3A 3SDAC 4R3SB 4WUUD 3H9SD 1F4YH 3DMMC 5ETUB 1EHLH 4NM4H 3HNTH 2BFVL 4HUMB 5ESQB 4EBQH 1LE5A 4KUCF 3UTZA 3KLDA 3V5KB 3O2VL 4HLZG 4WUKH 1CDHA 4NQCA 3MRKA 5C0RH 5DJ6B 4Q7DA 3BI9X 4HKZB 1WC7B 1BBDH 5F7EH 1W72A 2X4SA 4IDJL 4JREB 4WHTA 1DLFH 5BQ7A 1JPGB 5JXEA 2IPUK 1A3LH 3MJ8A 3GBNL 5AEAA 4LMQI 4RFEA 4OLZL 2NR6C 3UTOA 1JV5A 2ZNWA 1FFRA 2GKIA 3F6IA 4XVSH 4GMSL 3LEXB 2EICA 1PJ9A 4OLYH 2QSQA 1I1AB 3RTQA 1G9EA 4OLVH 5CKGA 4P2YA 2C3VB 4JVPA 2XWJA 3L3GA 2R1YA 1REIA 4WWKB 2H1PL 1EA9C 3F58L 3DV4B 4NZTL 3KXFE 5FK9B 1XGYH 2Y5TB 4KDWA 5JMRA 4L3AA 2ILLA 3KS0H 3PGCB 1RZJC 3QWRA 4KTEL 5DHVA 1FCGA 1NDGA 5F97E 4IRSA 5I76A 3CC5A 3ARDA 3MV7E 4KRNA 4PV8A 6FABL 3N1GC 1IQWH 4L5FL 4ODXB 5F3HA 5C08A 3WS3A 1NMBL 1HKLH 1AE6L 4GRWF 4F57H 3IJYA 5KAQF 4BQ9A 2Y5TA 2X42A 2FJHA 3LD8B 5GS3A 1LO0L 4LVHB 3AC0A 1WTLA 5HYEA 2ZUVA 1P6FA 3PV6B 5HVWA 5I18H 5JR1L 3BH9B 5BJTA 5DJ0B 1DBJL 2SEBB 4HGWA 4PB9L 3GJEA 3I2CH 2EE6A 1JGLH 3BUTA 2P42B 4H5SA 3BE1L 4OF7A 5I2IA 4MD5A 4C59B 4GG8A 2R4SL 4FMFA 1JWMB 3OB8A 4K9EC 4R96B 1JPGA 4YBLB 3CFCH 1VGKB 5T1LB 2HT4D 5FDWA 3KPSA 3G9AB 3OXSA 4P57B 4KJPD 1AKJA 3EFFA 4QOKD 3VXTB 5J12B 2X4NA 1BFVH 1U58A 1V3MA 1RUPL 1NCAL 4ZD3H 4ZODA 3FT2B 5A3ID 3BRGC 4YHKH 5AYUL 4EN3A 1B0GA 1IC4H 1KCVH 2V9TA 1FN4B 2BVUA 4R4BB 4G8FB 4R7DA 3MRFA 1IRAY 4M02A 5DMYA 5ICZA 1EZVX 2BY2A 4GKZB 5HTSA 3SDAB 2IFGA 2J8OA 3V0VB 5IW3A 3FFCE 4OFPA 4WNQB 3FB5B 2WIMA 3BWUC 2AV1A 3QNYB 4X8JA 4FQCH 4YK4C 5CJOL 3D18B 5EFIA 5GS0H 3V4UL 2YD5A 4PD4K 4S2SA 3KAAA 2HT3D 4XP9L 5DHVB 5I76B 3RJDA 1L4IA 3IU3B 5GPRA 2YUZA 5HVHB 1LD9A 1RD6A 1LP9B 2BY0A 4F7PA 5KSAC 3CMOL 2G5BB 3V4UH 5I1IH 4BM7A 2F53A 1ZHNA 4PJ9A 4ZTOH 1WV7T 5F8RC 3VXQB 3AXLA 1YNTA 4JCLA 5DGQA 1QA9A 1C8PA 1OGTA 1GH7A 2VQ1B 2HJKA 4HZLA 1BBJB 4JFZL 1MFDH 1NCBL 3QH3B 2DKSA 4KHTL 5DRWA 4E42B 3RY6A 1N64L 3LPGA 1KCVL 1IC4L 3MRFB 2GSGB 1ED3B 5IW1A 1ZWIB 1DLHB 3TYFB 1T1XB 4OZGF 4LSDA 1M7DB 2ZCHH 2BNUA 2YPKB 1E6JL 5KG9A 1H15A 3OR7B 4YAQA 4WW1A 3OKEA 3MBXH 5F7KC 2VXVH 5MHSD 1EO7A 2VZSA 2AABL 1ODAA 1QTYT 5I75C 2XI9A 3JUZA 2A77H 3MRKB 4D3CH 2GK2A 2LAAA 4JZJB 3U0PB 3QUMA 1ZHBA 1G1YA 3H7BA 4JR9L 4X98A 1RZ7L 3O9WB 3CH1B 2NZ9D 2V17L 2R4SH 4PRBB 4P3WA 4MNQD 4F37K 4EIZC 3IDYC 3ME0A 4WFFD 3QFJA 3QDJE 1Q9KA 2CRIA 1N2RB 2GJ6B 4PRPA 3GB7A 3K1KC 3MREB 1NLBL 2DQHH 5GGQH 3IU4H 3EO9L 2P8LB 4I0PC 3CDYA 1XH3B 4PYHA 2ESVB 4E0RB 3FO0H 5C09B 4PR5A 1HINH 4N8CH 1RZIA 3GRWA 3MOAL 5IBTL 2ED8A 2A74A 4QEGA 4QGYA 1ZS8A 4Z7QE 3HC4H 1VFMA 1VKXB 1KJVA 3UTTE 5EPMA 1BLNB 1IGJB 1EEYA 1U8PA 5T3ZH 4ISVB 4HQQH 3CD4A 4G6JL 2YRPA 4O2EB 1WBXA 1W72L 4TOYL 3HMXL 5HVFB 1JF1B 5GGSY 4W6WB 3TO4B 4MAYD 1QEWB 3RDTB 2I5YH 3DGGA 3Q6FA 5LXGL 4L4TA 2F9BT 2PETA 3KPLB 5C0BB 2Y1VA 2ZCLH 5ACZB 1TVHA 2DDQH 3G5YB 3O11B 4BZ2L 1ES0A 1MCWW 3CUPA 4JHBA 2YD9A 3HE7C 3ILPB 5MEND 1EEZB 5BRZB 3EW3B 35C8L 4IIQA 3MLVL 4OUUB 1BGXH 3ZKMC 5C0AD 2ED9A 3VXSB 3FT2A 3UPRA 1A7OH 3MMEA 1E0OB 5IEKB 4ZFFA 3PJSA 5FO7A 1EZVY 4LCCB 5BW7A 4QXUL 1MAKA 1MIMH 5CAYB 2CUMA 2J88L 2CDFB 1ZOXA 2AV7B 1DVFD 5ITFB 4ZO8A 5JXAH 4K94L 4X7TB 2FRGP 4NYLA 1FO0L 2FZ3B 4P46D 3OTTA 3LKPA 4Q2ZB 3PNWA 2BNQE 4NQEB 5A16A 4NQXA 5E1AB 1RFDH 4LP4A 3TN0D 2F54B 3V7AE 3KPPA 4J3VA 1U8LA 2Q3AA 1LO3H 2APTA 4U1JA 1G7MA 2BNRD 4F7CB 5IW6B 1CWVA 3TBYA 1Z0NA 4XNXL 1CDCA 2VDLL 4LBEA 1HNFA 4RMQA 4L8SB 4XHQA 5ENWA 2CIKB 2W9EL 1MNUL 2VDRH 4Z7UA 1KPVB 1FE8H 1NCNA 2IPUG 1KB5B 2IFFH 4LNRB 3SQOH 4HC1L 4ZFZA 5EOCL 4I48A 2VR9A 2VKWA 1WTGT 4JPIA 4IDLA 3HNVH 1OAXH 3SKJL 1JL8A 3I6GA 3V52L 5GRUH 2BRRH 4GBXB 4UILL 2CUIA 1ES0B 4XC1L 1S7WB 1F4AA 1CU4H 1QFWI 3PGCA 5JOPD 5C07A 4OZ4B 4HGMA 2VLKD 2D3VA 2HFGH 4H25B 4XMPL 5GZNC 2D31A 5LWYH 4KRPB 2A6DB 2MPAH 2XA3A 3ZL4L 1QSZA 4KI5C 4PV8B 1CL7L 3GKWL 3O2DL 4AENA 1XGPB 2YC1A 2DYPD 2VZUA 2PYFB 3U4BL 5L6YL 1ZVSB 3TBWA 3O3AB 2B2XH 4G80A 4TSAH 4PRAB 3ZE0F 4LLYB 1G9NH 1KNOB 4CJ1A 4WW2A 5K59E 3S36L 2NY0C 2EH7H 3RUGA 3L3GB 4XP4H 1JRHL 4DN4H 2P8LA 4OKVB 4E5XA 2GY7B 2OTPA 4NO3A 5IUSA 2DI9A 4ZTPH 3ULSA 1DBML 3KLAB 2E3VA 3DYOA 5I17B 4R4FH 1T7WA 4LF3B 5E6YA 2FX9L 5HPMB 1XF3A 4JFOB 3QIUB 4X9FA 5EBWA 5BS0E 2IC2A 1GZPB 3QFDA 3EDEA 4JO2H 4Q2ZA 1KCLA 5TGBA 4XPGH 5J11C 2G9HA 3H9HA 1J8HD 4MXQD 4JHZA 1F58L 1JZ8A 5EU6E 1BD2D 3ARDD 4JFPA 1AP2A 1GOFA 1IBGH 1GGTA 1ZTXH 4DEPC 5GGSA 3SDDC 5T1MB 1K3IA 4ZS6D 3ULUH 5J1AA 4OF0A 4D0BB 4UDTA 5E4IA 4UB0H 1U93A 2VLLB 3IDJA 1QA9B 2D4DA 1A3QA 4Y1AA 4BFBD 3HE7A 1DSFL 4XZUA 5IF0B 2MQ3A 2ADIA 1Z2KA 5DHVH 4F8TA 2E7LC 1UCBL 4M6OH 2AJZB 3ESUF 3FAXA 4K9EH 1MQKH 1AIFB 1FH5H 4JM2C 3BIKB 2DAVA 4U33A 1FGVL 1YYML 4QRUB 2MKLC 5JW3H 4LSPL 4JM2B 2AJXH 3QB7C 2QQKH 3BH8B 4GRLD 2EECA 5E99H 3WS6A 5DD5H 3T65A 4FZEH 5DQ9A 4HCRA 4TVPH 3QHFL 3VFTA 2XTJC 5GJSL 3M07A 1OPGH 1TETL 4S1SH 4MYWB 4Z76B 5EOQL 4GRLA 3B5HA 2FSEB 4WI6A 1UA6H 1EO5A 2HT2D 3O6FA 4BFIB 3O0RL 4DK3A 2VR4A 3VW3L 4KFZC 1U8IA 3L3HB 1V7MH 4U1GC 4BH7B 3VFRB 3TZVC 3KPOB 3VGGA 3LMJL 4BYHA 3O3EB 4M1CC 4I3GA 2ATPA 1WT5A 1R3IH 2CQVA 4YHPA 5T1KB 3OKMA 4KPHH 5JDSA 4G5ZH 4OF6A 1AGDA 4ONHB 3FQRB 3WXVL 3LKNA 5C08E 3WEXB 4ZDHA 5EBWB 3KG5A 4CADB 4KKLD 3GMQA 3GSUA 4QXTB 1I85C 4JFEB 3LB6D 4KPHL 2DLIA 2FO4B 1OSPL 1P6AB 2Z8VC 3BPLC 3LMJH 3EZJB 4D2NA 5KVGL 4P9MH 5DMIH 5EO1B 4Q9BA 1MRCH 3GSRB 3HI6L 4P2OD 5TF0A 1HQRA 5JZ7D 1Q72H 4KQ3L 2J7LA 5FGBC 1A4KA 2V5MA 5TDOB 4I18C 3DO7A 1QOKA 1T1WA 2FIRT 4HK3N 4IM8A 4UAOB 3T3MF 1ERNA 4QHLA 5CGYC 3AU1A 1AGCA 3I84A 4JO4L 1Q0XL 4S0SD 5FYKE 4LSRL 3ARFB 3Q5TA 5JW3L 5EN2B 2I60L 32C2A 5J6GB 3H3PH 2BVEA 4NQUA 4NN6B 5BVPH 2UZIL 1V7NH 4X6DB 1YNKH 2VRAA 3L5XH 1JGEA 1BFOB 2PNDA 3ROOA 1FP5A 1T3FA 4GBXA 3UPCA 3R0MA 4U7SA 1DBBH 4P4RB 4NHUA 1CR9H 3OF6A 3IAGC 3L3HA 1A1MA 4KVCL 1CLOL 3GDBA 3T0XA 5FOJA 2ZCKL 1ADQA 3VI4F 1LO5B 4K71C 4P5TB 4F8QA 2XY1A 3ESVF 3HR5A 4H0GA 4I3SL 4NN5B 5HD8C 3DVIA 1F3JB 1VEMA 4DKAA 4P5MA 4M8QA 1NEZB 2GEEA 3STZA 4Y1AE 1X7QB 2NY7H 1JGUH 4RFEB 3FN0H 4G8GE 1OAYL 4XTRD 1HN1A 5EBMB 1G7MB 3KJ4C 3FTGB 2DWDA 3KPSB 5C86A 1S7TB 4XPGL 3MCLH 1EXUB 1A6ZB 2N4IA 3I75A 1OP3H 3TC9A 4MJ5B 5GISL 3IDXH 5CEYB 4UUJA 3EOYG 5JPNB 3MNVB 4PV9B 3T0DA 2DI8A 1C1EL 3UTQB 5IF0A 4FFZL 3LRSA 4DJMA 2VDML 5JMOC 5FXCH 3R8BB 2GSIB 1AXIB 4S0TD 4HIHA 2NLJB 4Y89A 5FV2A 4PJDA 5J9PB 1QBML 4ZO6A 4HGWB 2CLVA 1PY4A 1Y18B 1KTKE 1AO7B 4AM0B 3DUUA 5EUOF 5I66A 4UV7L 2ADJB 3TA3D 1A1OA 2B1AL 4LIQL 5E2VH 1QVOB 5KSUB 2ZUSA 3VFNB 4FN0A 5IM7A 3MO1B 5DVOA 3L3JB 1F45A 1SY6L 5EU4A 4UNVA 4H26B 2QHRL 1FH5L 1KGCE 1ZGLA 4TNVF 4NQEE 3BO8B 5A40E 3RHWK 1NCTA 1QFHA 4W6YB 5JPNA 3C60C 5JOFA 2E6JA 5ESVA 2VXTL 3ZYIA 3ZT5A 3V52H 1MCSA 2AK4E 4ZUVA 3E1F1 1A7NH 2DD8L 1LO4H 5T1KD 1T7YA 5DQDL 4HIIA 5TE6L 4LU5L 4YNYA 1CS6A 1W0VA 4EVNB 3BPOB 3CXDH 1KCKA 3HUJB 1YEJL 2KKQA 4G9FB 3ZDXE 8FABB 2W1NA 5DVLA 4MJIA 3OSKA 4YHOL 5AG9A 1IBGL 3U9PH 4P2QE 2HAZA 4UTAL 4CU7A 4KKBC 3VFUA 2F58H 4PGEA 2EDRA 3QDGA 4HJJL 1CFNB 4KZDH 1GXEA 2UZXB 4KXZI 5F72S 1OTTD 4CKVX 4X4MA 4FFWC 5IOPB 2HT2C 5IROA 3S34H 1N5YL 5ESQA 4EUPB 4Y4HC 4C55A 1EDQA 3UEZA 4K7PH 3B5TA 4ZUUA 1NC2B 3QPQD 3SKNA 5DJ6A 4PBWD 4XT1C 1CGVA 1FC1A 5GS0D 2EDDA 4J8RB 3GGWA 3RIFK 2EDNA 1RUKH 5GGTL 2I9LB 4AM0A 4PRNA 4C56B 4HX1A 3INUL 5A43C 4XP4L 1T1YA 5DYOB 1DEEB 5F7MC 3LN5B 3X13B 1FNAA 5ANMA 3W39A 5IJKC 3RZCD 2W60B 2VQ1A 4FQIL 2GHWB 2VLRB 4UDUB 1J11A 1MUJA 1RZJH 3AVEA 1QSVA 3DRTB 1V5JA 3H42L 3S4SA 3E6FA 4NZRL 1FVEB 1HILB 3QEGH 4CDGC 4IMLA 4DVBA 1T5WB 1MVFA 5JZ7C 4GAJH 3W5NA 3WFBH 5H2BB 4TRPL 4JANA 5HGHA 5IT2L 2BNQA 4RMTA 3SJVB 4LPVA 5AZEL 5KZCB 3DSFH 2ED7A 4KMQA 2O5YH 2VAAB 5GJTL 5C0CA 1I8KB 3HPLB 3K80A 4U1NB 4TOYH 4X0KA 5MI0C 4HJ0C 2FWOB 1A9BB 4XX1G 1VFBA 1JNLH 3QIUD 1U8MB 5E6IA 4LCUB 5DWUH 5E0QA 5JDSB 1RZJL 4HV8A 3PXJA 4OFDA 1MEXH 3QZWB 4YE4L 4R26H 2P5EE 4WNQA 1E4KA 3W82A 3NPSB 4MXVE 5J1AB 2P5ED 3OAYK 3VDBA 3WL9B 1TMCB 4P5KB 3DURA 5F9OH 3KYKH 2A9MH 1TXKA 1B88A 1RI8A 1ZT1B 2ICWJ 3MLXH 4O02H 1PZ5B 4MZ3A 1UWGL 2VABA 3IDIB 5FIEA 3PIQB 4WU5A 3K4AA 5E2JA 5DEZA 2EYRA 5GSVB 2VXSH 4PJHA 4KROB 1IKNA 5F7LB 1NGWB 1B0RA 4PRIA 2PO6A 4OZIB 1A2YB 2DQGL 5CP7A 1ZA3B 5FO8B 1BQSA 4O4YH 2NXZB 1G7IB 1U95B 4WFEE 5T1LA 5MEOA 5I15L 4FQHB 4GRWE 2AK4A 4D3CL 4WGWB 5I1HL 1YMMA 2FH6A 4WV1A 3RGVA 3VI3E 3ZMRA 5FYJU 3C8KA 1U8NA 4WDIA 1A1NA 3RWGB 4LEXH 1AIFA 2NY1B 3U0TB 2XKNB 4PJGF 1FG9C 4A6YH 2A1WL 4EI5B 1W0YT 3VWJB 1DANU 3L7EA 1NBZA 3VDCA 1AR1C 5J6HA 2D7TH 4KJYA 4EIGB 4OCSL 5C6PB 1QO3A 1KT2A 3ZHLA 1NCUA 2D7OA 1VDGA 3QDGE 5GGRY 4NNPH 1CDGA 4MJ6B 2F5AL 2ENSA 4C4KT 1HZHL 1TZHA 3EDFA 2APVA 4ETQB 5I1LA 3K1DA 1LNUB 4HS3A 2UYLB 1N3NA 4EDWL 2FLRT 4PRBA 4ZTOL 4O58H 5CZKA 3MGOA 2W9DL 2EIEA 3WN5B 4JKPH 2ZOLA 3MV9B 4K7FB 1X5LA 2QHRH 3ZTJG 5D2NB 5E9DB 1JP5A 5EIQA 3QP3A 3KYOB 4J2XA 1RY7B 4P2RA 3BKMH 1KJMB 1UXSA 3B6SB 5CHNB 4KK6C 1E27A 5SWQA 4K2UL 5FGCE 1F11A 2DQJL 1PFCA 1DQML 5I71C 3CAFA 2JELH 4EXPX 3B2VL 2G75B 4QWWC 2CKBB 3D85D 4OCWL 1A6VL 4MCYB 4CN1A 3CU1A 1L6ZA 1PKQB 4PJ8C 5JOFB 4D9QE 3I50L 4JDVA 4XPBH 5DRNB 4D9QD 1JI2A 2B5IC 1ZKAA 4Z7OE 5K9KB 3MRBA 1BFVL 3EIFA 1KNOA 1P7HL 1KN2H 2YD6A 4DZBA 3BZ4B 4JGJA 4GAGL 4PTUA 3W0WE 1C1EH 4EI6B 2NQCA 4HPOL 8CGTA 2ICEB 1UB6B 3PWPD 4S1DD 2VSDA 4YPGB 3GSNB 3MZTA 3QRGH 2CDFA 3BD4A 2J2ZA 3QA3B 4PJ7B 1I7UB 3TYGL 2F53E 5TF1L 5KS9B 4NOFA 3O6FC 5EU7C 4F9LA 3LN5A 3NIDE 3IGAB 1KXQE 3N0PB 4I3SH 1RUAL 2VN7A 3QDME 5ERWB 1VFOA 2Z9TA 4LHUA 3V6ZB 4XAKD 2VKXA 3IDUA 3WS6C 1ACYH 3ZDZF 4JGMA 5JHLL 3GBML 2NY2B 4BQ6A 3ULUC 1PW3A 2WIIB 4Y2DC 3NFPA 2VJXA 1YECL 4HXBH 5IVOA 3SKNB 2IAMA 1MLCA 1S9WB 3CH8A 3N1PC 3QUXC 4M7LT 1TQBC 1JWUB 1OP5K 1P1ZB 3SOBH 3HAEB 3SKMA 4JPKL 1HXYB 4LRIA 4XVTL 5E94A 3UROR 3MXVL 4YHZL 3NIFF 1MRDL 3BPOC 2Q6WA 3QEQE 3TBTB 2V2XB 2EYTA 1NCWH 1S7UA 4HIXL 2JCCB 4PJAE 3RGVD 4FMKA 3L3DB 1OAUL 2EH8H 2JB6B 1IM9B 3JV5A 8FABA 5D7SH 2VXQH 4OLZH 1Q9OB 1QR1A 4MDJB 2OR7A 4OQTL 4MNHA 3MR9A 4MNQB 5IIEA 2GFBB 4S1RH 3RX8A 1RU9H 4K8RL 3TN0C 4G6KL 2CDGA 3QQ9C 3WLBB 4XGZB 1CXHA 3MRMB 1HWHB 5EU5A 3S3SA 5IGXH 2OXGA 3O8XD 1L7IH 4U1KB 1S9WA 1DQLL 1ITCA 1RZ8B 4FQXC 1I8MB 3NCJL 1G6RL 3TN0A 4BKLB 5JW5B 2HMID 2DQDH 2ZOLB 2F54E 3VXRE 2IG2L 1PKOA 5D1QA 4L4TE 3VXRD 1ZT7A 1ZANH 4OM1H 2VZOA 1WITA 2WP3O 5HHXH 5DQJB 1DLHA 2GUOB 4MXVF 4LLMA 4MMZC 1FSKB 1GC1C 4JM4L 2B5IB 2LQRA 3KPNA 3C8KB 1F3DJ 2UWEF 4WDIB 3BAEH 1JBJA 4HZAA 4GXVH 1U8KB 3DVGA 4KUCD 4PLKD 4YDJB 4M7ZB 1PZUB 3JV4B 4OM0H 3WSQL 5C0IA 3C5ZD 3MZGB 2YD1A 2YK1H 4HWNA 4N1CA 1BP3B 1IGIL 5ID0A 1N7MH 4H8WL 5FYJD 2LU3A 3G04A 1OQOA 1IT9H 3NA4A 5D93B 1A4JB 1KIPB 3VWJD 5FA4B 4NQVB 1LP9A 1MQKL 3QUML 5T3XE 5C0FB 1BVLB 1I8LA 1BMGA 2NY0D 5ITFA 2ENYA 3KPQB 5DRZA 1NL0H 2EDFA 2CGRH 2HWZH 1DSFH 1S8DB 2BVQB 5F96L 5AUMA 1SY6A 3O9WA 3X3GL 1WBZB 4MNGE 2X4RA 4NC1E 1WFUA 1SYSA 3WIIL 4PJBF 5GS2H 3ZT6A 5JLZA 4MAYA 2BHUA 3SDCC 4ZPVB 4R97B 2A9NL 1JUFA 1UWEH 1UH4A 5HHPB 5BS0D 3U36B 1IM9A 4FTVB 4RMRA 1CK0H 2Q8BL 3VCLB 2Y25A 3SDDB 3QT2A 3NCCB 1KXVC 4NHUB 5EC2A 1A3LL 4ZUTA 2EIDA 5E9DD 3OMZA 3RKDD 3T8XA 4JRYD 1QLFA 3MRHB 5CJXA 4JQIH 2YPLE 3AXLB 4NBXB 1CG9A 1U6AH 1LDSA 2X4PA 1KJ3H 1KJ3L 5FHAH 15C8L 1QHPA 5JW4R 1J1PH 1UZ6F 4Y8DC 5T3XL 3AS0A 4ONGL 2B7DT 1JWSB 4WI2A 4X7DC 3CFKA 2F74A 1DUZA 1YA5A 4APQB 4LLWA 3IDGB 3C6LB 5CMAA 3DUUB 5DQJA 5DD1H 4X8JB 4Y1AB 1I9IL 2XZAH 3ZHDA 5DSCB 4N0UE 4UIKL 1L9MA 4XCNA 1QO3B 5K9QI 5HGAA 2VDNL 3EGSB 5EIVA 2XZZA 3DUSB 4XPHH 4X6FA 4ERSH 1T66D 5EIIA 2YSSB 2DQIL 1NAMH 1A7QL 4RDQG 5I9QB 5HYJE 3WFDH 3ARED 1J7VR 1YNLL 3S88H 4Z8FL 3QO1B 4HMEA 4JM2F 3NFSL 7FABH 3T0EC 3BHBA 4X9GA 1AFVL 1V3LA 5EULV 5I0ZA 1NGWA 1JNJA 5BXFA 1P4BL 3B8YA 3SPVB 4PJXB 4RMSA 3WFEL 2LTQC 4QLRA 1QSFD 1J87A 4GKSA 3QIUA 4Q58C 1OB1B 3QULA 3MGAA 1AI1L 2YKLH 4GLRI 4XPFL 4JPWH 5TQ0H 3PWLA 1NGYA 3LKOA 4IHOB 5C0CD 4FNLH 1KFAH 1HH6A 3BAEL 2VIRA 2P5WA 4LLVA 4XP1H 2GCYB 5TE4H 3TESA 4OIIL 4MNQA 5KVFL 2BOBA 5ESVB 4NJAL 3VFPB 4CMHC 5L2KD 3D9AL 1RK0B 3P4OB 1MI5A 43CAB 3I3BA 3D39D 2BK8A 2KQNA 1KC5L 1H5BC 4JLRB 5DMJB 5F1NB 3NCJH 4U1NA 4U1MA 1ZHNB 4ODTH 2G5BA 4I13B 1SVCP 4QY8B 5E00B 1KEGH 1MRFH 1BOGA 2IPTH 3O4OC 2JF1A 3KXFD 3ISWA 3QSKB 2QQLH 5C08B 4KKAC 4BELD 2Z8RA 4ZAKB 3OKOA 3TV3H 3VFGH 2J12B 5L9DL 3OG4B 1Y18A 2H2SC 5I1EH 4YWGL 3WBDA 3H9ZA 1T20A 4ZAKC 1KLGA 4K8RH 1GGCL 1KIRB 2VDKL 4NP4L 4GBXD 3P0YH 1QSED 4XVJH 5ICYB 5MERA 3D3VA 2L4OA 3L9RB 1HYSC 1JFQH 4ODSH 3VG0L 2VDOH 3ZZ1A 4AMKH 1PD6A 5LCVL 3VWKA 3V9FA 4Q97A 2Z8WC 1U92B 4WO4D 1BGXL 4JRYA 4JDTH 1SMOA 1PEWA 1YYLL 3SGEH 4G9DA 3WCYA 1WAAA 4HXAL 1X6LA 5IMLB 1QFWM 2F19L 3HC0A 3WV0A 4XRCB 4GXUN 5IMKA 1UGNA 4G3YH 5SV4A 5BS0A 1OSZA 4GAYB 4HUVB 1CDYA 4DK6A 5KW9H 1RIHH 1LHZA 1MCWM 5LGHH 4ZUUB 5J1TC 4WGVB 3R8QA 4JLRA 5I6XC 4JPVH 2WZPD 5DJCA 3RA7H 1D5XB 5C2BL 4AK1A 3PP3H 3QXWA 2NY1C 4Z78B 1HIML 5E2UL 5T1KA 3I6LE 1ZAGA 4I2XB 1IEAB 4OZFG 2NW2A 3KPSE 4M8VA 5A2IH 5F9JB 4ODVH 1R5IA 4IRJA 4MD4B 1F2QA 2H2PD 5FYLH 3UZVB 1CBVL 4HS6B 2KUTA 3MRCA 4WTZA 1HH6B 1Z3GL 3NTCH 1MJUL 4H20L 5ETUA 4N8CL 2VLJD 3DXAA 3AS2A 4P4KC 4G43B 1PQZA 4DW2H 3ULVF 4JO3H 4OLWL 2RQ8A 4WTWA 4P4KB 1RSFA 3PL6D 5E5MA 5IEKA 2AXJA 3LSOA 5B8CC 3MNWB 4KI5F 5JLZB 4N8VA 4LGRB 3WS3B 1IAKA 3SCMD 1E4JA 2HJFB 3EZ8A 4XMKL 3W11C 4P2OC 3UTSA 1P4IH 4IJ3B 3D85A 5DF0A 1G6RA 1MY5A 1DBKL 3A6OA 4RAUA 5B39G 4Y4HA 5C0CB 5CHNA 4FQXA 3TPUB 3ZTNL 1OAKL 1MFCH 1MFCL 5I8KH 4F58L 4MNGB 2CR6A 3IDYB 5IROC 2E9WA 4UQ2A 3S5LG 2R23A 2OX5A 2YUXA 1BOYA 1DBKH 2D03L 3QJFA 5J1SC 2JK5A 1WZLA 2VXVL 4XAWH 3CSGA 3FO9B 3T1FB 4W68A 1E6JH 1Q9WB 3LV3A 1VFAA 2OTUB 4JHWH 4PRPD 2PR4L 1OLZA 2XWBB 4LOUD 1DQDH 1NMCC 4PJDB 5J9PA 3D1MC 4LLQB 4FXGA 4JFZH 4ZXBA 3RWGA 3JVGC 1MJUH 3B9KC 4H20H 2XOTA 1IGYA 2AKRA 1T80A 2VR5A 5JW4Q 2EXYD 2DQJH 3NACH 4G6AC 1OY3B 2I9LA 2CIIA 3L3KA 2BXYA 3OAUH 1R24B 4WJ5A 3T1FA 1ONQB 3VXSD 4GRWH 2YRLA 1YPZA 2X41A 3GSNH 3LKPB 4ZUSB 1CE6A 1SEQL 4PRHA 5E8PA 1I8IB 1QLRA 5FDYA 1RJCA 5LQBH 4NGHL 1H15B 2DJSA 2X70B 5GS0L 1RIHL 1DN2A 2FJFA 3TYFA 3VJ6B 4G3YL 2R15A 3FOLB 1ZHBB 2PW1A 1RIVH 3NACL 2Z31C 1P5UA 1CCZA 1SMAA 3L5WA 3V0AC 4ZPVA 4JDTL 4GG6A 4HJ0D 2ATKB 1Q38A 4U6TA 3UPRB 1DQDL 5T1DH 5C9JB 3REVB 3X14A 4Y4FD 1MAMH 2CO7B 1XF4A 4JO1H 3U1SH 4JHWL 1PSKL 1UJ3A 4KK9C 1DEDA 5E24E 5JOPE 4NQCD 4OLEA 4YNYB 4LSTL 4LLWB 4PJ8B 2A1WH 2GYSA 2UZYB 1RUPH 1BM3H 4I0PD 4LEXL 5L9DH 4FP8H 1OGTB 1S78D 4RISH 1A0QH 1FZMA 5DQ9B 5FUOL 4YDLB 5IVXB 1XF5A 2OTWB 5C0IB 1D6EA 2ZPKL 1IZJA 3HMWL 3BGMA 3LQAC 4H26A 3MO1A 4HSQA 4MA7H 3ZDYE 1U8HB 3SDAA 3V4VH 1XFPA 4NKOA 1JGLL 2VLKB 3ULVH 2BVYA 4I48B 1OD7A 2BNQD 4OLWH 1MCHA 5F9DC 3IXAA 3KYKL 4LDLB 3H0TB 3BP5A 5IR1B 1XR8A 2JCCF 4TNVK 2FBJL 4ENEC 3QYCA 1LO0H 4U1GB 4JZNB 2WBJA 4P59L 3V0VA 2VLMD 4XX1E 4Z7OF 4U0RB 4F7CA 5E1HB 5IW6A 1CBVH 3GSVB 5IG7A 4Q9CA 5C71A 1GGUA 4NO0A 4ODVL 3C9NA 1FN4A 2EC9T 1DQQA 4LQFL 1M7IB 2P1YA 4JFDD 3BKCL 5J0BA 4PJIA 2QADD 4LHJB 2OR9H 1UB6A 4MCZA 4HUWB 1OF2B 4I5BA 4Y5YB 2DMKA 1WZ1L 1AO7D 1CFTB 2VXUL 1D6VL 1B90A 2AQ2A 5FDWB 4JZOB 4HFWA 3H42H 1TIUA 4HXAH 5ALCH 3KPRA 4LNVA 2I26N 4I18A 2A83B 3WDJA 1JCKA 4OLYL 4QXWA 2VDNH 4DGIH 1DN0B 3CX5K 4QHUA 3UTSD 4E42A 5K9QG 3MRJB 4Y4KB 4JFEE 4HG4J 2Y07H 4NKMB 3PG2A 1SBSH 3P9MA 2CH8A 3MACH 4E5XB 1EAJA 4L29A 4TUKL 4NDMA 4R4NC 5FF6B 1RJYB 2ICWI 3CNKA 5H8DA 4YFDB 3MRIA 3ILPA 5DI8B 4X9BA 1FQ9C 4HJGA 4NIKB 3LKSA 5F44A 2C4FU 1T03L 2EDJA 5BVJA 4A6YB 3GMRB 1CFVL 4WUKL 1IL1A 2VC2L 5JUEH 2OJEB 1Z9MA 2EC8A 5F21B 3ARVA 3QO1A 4ZFZB 1SM3H 1W0WB 5CBEB 3V6ZA 4Q6YA 1VADB 4NJ9L 3TZVA 2OM5A 4H25A 4KKNA 3WKMH 4MJIE 4Z7WF 1TQCB 3CFEA 5SWZD 4HWEH 3EJYD 5J7CC 3BN9D 4P3CL 4G6FB 3BRDA 1NUGA 1JMXA 5TE4L 1JPST 2FIKB 5E9DE 4RGOL 4WFGD 1YEJH 1AO7A 3MLUH 1DDHB 3PNWB 4KRMB 4TNWF 3OX8B 4Y5YA 3UTPD 1K3ZA 5JQHC 3QXAB 2WBKA 1NLDH 4U31A 5C0ND 2R1WA 1MHEA 1GZPA 4DKDC 4HC1A 4HIHB 2Z4QA 3EDDA 4WO4A 4R0LB 5B38G 1INEH 3GSVA 5IG7B 4PJIF 1I75A 5C6TH 4CVWA 4ZFOL 1B0RB 4PRIB 4MA3A 4M1DH 3ULSB 1EBAA 3U7WH 5D7JB 1D9KC 5D1ZD 4TQEL 3GI8H 2BVOB 1BAFH 5T5FH 3VFRA 1EVTC 3WFCL 3SDDA 2B0SH 1S7TA 2YPVL 4PRHD 4CAGA 4U7MA 4Q6IB 1OGAA 5GRZA 1YEIH 3G08A 4QRPE 5IVNA 5F93C 4X9IA 3VXSE 1FLTX 4PLJD 2H41A 4DEPB 1P5VA 4M8QB 5HHVH 3WNKA 3IVKA 2DIJA 4ZG1A 4HV8B 2XA8H 1DL7L 3AAZA 5MP6H 2PO6D 3FB6A 3L6FB 3GSNA 3KYMA 1YC7A 2NY2C 3GRWL 4Y4FC 1VEPA 4X6DF 4PJ9B 5ESAB 2XQBL 3BN3B 4S1QL 5DDHB 1ETZB 4XNZB 3CZFA 2GT9A 3MOBL 4PJ7F 3TT1H 2ICES 3EO0B 4YHNB 4I8DA 4LVNB 2Q20A 2CLZB 1TQBB 2JKXA 4FTVD 2P5EA 3NFNB 1X5ZA 1TJGL 3P9LA 5CS7A 3CK0L 1QKZL 3T0AA 4ONFH 4S1RL 5CJ8A 1XH3A 4M93C 2BJML 3PWPA 1FNSL 4MLIA 4PREA 4X99A 3AGVA 3C6SA 4F7MB 2I07B 5EWIL 4U0QB 2ID5A 2A6KA 4PS4H 1DCLA 1DEEA 3FT4B 2IBGA 4PJXF 4PTTB 2G75A 2O5ZL 4K8RD 1T1WB 4PPTA 4FQ2H 4JKMA 5J13B 1CR9L 2VLKE 2BDNL 4HUXB 4YHZH 3SDXA 3MUZ1 4K23H 3LHPL 4O5LH 4OV6F 3W9DA 4YXLH 2OQJA 5A2LH 4HKZA 2VLJA 3DXAD 2HWZL 3JTSB 3QDJB 1B4RA 3KYAA 4JPKH 3TGXA 4ENED 5DO2D 2AJSL 3O6ML 3OKNB 4PJHB 4OD1H 1V8HA 4POUB 1X6NA 5DJ8A 2XT1B 5JNYA 4Z0XA 3KPOA 1A8JH 2XRAH 1E6OH 1EO8L 1M71A 5ID1A 2I9TB 2FD6H 4JY5H 1XIWB 3IDMB 1YECH 1CXFA 4HXBL 4O9HL 3SDDD 4CBPA 1LEIA 4ETQA 4XBPA 1G7HB 3FQRA 2QR0B 4BSWB 4YDVB 4D8PB 1Z5LA 3JVGA 2GFBA 3EYSL 3M8OH 2ATPB 3QFJE 3QDJA 3ES6B 3EOAB 3HZKA 1CD8A 5EUOE 3RBGA 1HSBB 5HYSB 2HFEA 3C8HA 3CDGA 1J1OH 3O3DA 3DRQB 2GITB 2NY4B 2D2OA 1NAMB 3RNKA 4FQXD 1JZ7A 2ZUUA 4KVNL 4L9LB 1AQDA 3ARXA 2IH1A 3S8WA 5FYJL 2XN9A 4F33A 4NRXA 2DQDL 4S2SB 3HC3L 1MH5B 1YEKL 1LEKA 3TVMB 3VXUB 1WZKA 3SCMA 3UYPA 1EEQA 3PWNB 2ZOKA 4HK0B 4LKCA 3BP4B 4Z77A 3DI3B 4GJTB 3AS3A 4YIQA 1KENL 1TJIL 4Y7MA 4DTGL 4WI8A 3ABZA 4LLAA 4YBLC 3WO4C 2IAMB 3MRNA 2R69L 2X4UA 3QG6B 1QD0A 3GNML 4K3JL 4I9WE 4R2GB 2H26B 1IAIM 4YXHH 3DXAE 1PZ5A 5D1XB 1NKRA 4D0CB 2H32H 3F7YA 3RWHB 2OZ4H 4Z7UB 5K9JL 2FX7H 1T0MA 4K7PY 4E0RA 2RR3A 4PRID 1XZ0A 5D7LE 3L5WB 4PJAA 4OGYL 4Y5XB 3DETD 5GJSH 3TH4T 4I3RH 4KROC 2VMFA 4IRZH 1A9BA 2EEBA 1AP2B 4L8DB 2NXYB 4M43H 1SJEA 4P99A 5GIRA 3P30H 2NY6C 3PXHA 5EH1A 4LHQB 2QEJA 4MXWH 1U58B 4H1LG 1WEJH 3MNZB 2Z91B 1QSFA 3D0LA 2V5YA 1A6WH 1R0AL 1JPFA 5BO1H 4E41D 3TO2A 2BNUB 2YPKA 4WFGE 3DYPA 3QDMA 3VWKC 1UVQB 3VU2A 1W0VB 2FB4L 5FB8A 3ZKNC 1I1AC 4D0DA 5D2LF 4DQOL 5HY9A 4ZNEA 3B83A 5IB3B 1KIRA 4GRWB 3L3OB 2Q86A 5T3ZE 2D7TL 3PWPB 4K3EH 2Y9RT 1S7RB 3KXFA 5GGUA 1M6OB 5BZDB 3UTTD 1O7SA 3IKCA 3VFWB 4BQCA 3MYZA 1GAFL 3RIAF 3MFGB 1NGZA 3BPCA 2FL5B 5B4MD 3V6OC 3QJFB 1H8NA 3OV6A 4BFGA 1TJHL 4YHNA 1BWMA 1FJ1B 1T0NA 5I8OL 2IQAB 3KDMB 3MOBH 5JHDE 3TT1L 3I3EA 4HIJB 2E7HA 4HPOH 4YIQB 1KJ2L 2HJLA 3G9VA 5H94A 3KXFB 4JN1L 3FZUD 4XXDA 3L6FA 3FB6B 3RTQB 1MH5A 4UNTA 1FZKB 1JK8B 3MPCA 1QHOA 1DN0A 5AD0A 1AR2A 2BSSA 3MLXL 1CT8B 4RZCA 1A6VH 3C60D 1CTNA 3THML 3EOAA 4NRZA 4R26L 1KPVA 1NJ9A 4YHIB 4E41E 2BOBB 4K3HA 3ZKSD 5FUZH 5GS1C 2PYED 4Y4KA 5B38A 2PTVA 4QRSB 4PJEB 3G6JA 1D3CA 1S7SB 1MCKA 3LEYL 3U82B 1NC4D 5ID1B 3HAEG 4R0LA 1I3RA 4KKBD 4XMPH 2H6PA 4HIEA 2F54A 1IJ9A 1MJJA 4PG2A 2Z91A 5CINH 1N8ZB 4J3SA 5D7JC 3RWFA 3HC0B 3VDAA 3QEGL 3DNKA 2OQJB 1NEZA 1A1OB 5IBUG 4UINH 5C08D 1AGBA 1IKFH 2FEDD 5EOCH 1HZHH 2VABB 3IDIA 4X5WA 3HG1A 1T1XA 4LEOB 3PV6A 2QQNH 4KHXL 3NN8A 4E41B 5BV7L 2VO5A 3HS0B 1T3FB 4XNXH 4OI8A 1BHGA 2DLEA 4OF3A 4ELME 4O2FB 4I77L 5DSCA 1D6EB 3RJQB 3TNMB 2GTWB 2Q76B 4JN2B 4LKCB 3KJ4B 4TSBH 3EYUL 2DBLH 4APQD 1OQXA 1P7KA 5C0AA 5IJVB 5I1HH 4U1IB 1T6VN 5D6CA 3BISA 3FHQA 2GT9B 2KL6A 5D1QD 4YHYB 4I4WB 4Y2OA 4JANB 2H9GA 5DK0B 2HTKC 5F1SA 2AEPH 4HEME 1XGTB 3TNMA 2BNRE 1FZMB 1FRGH 1RPQA 4NQSA 3FMGH 1S7VB 4QXUH 4P48A 1ZHLB 4YHOH 1OARL 4MDIB 3Q2CA 1MVUB 4L9LA 2PTTB 4YGVB 1UM6H 4XBPB 1N2RA 2GJ6A 2VZVA 3MLVH 2AGJH 3CLEL 5SWSE 4M7LL 3NPZB 4WFFE 4POZD 3HRPA 4U6XA 1MWAA 2E9JA 5DTFB 1XR9A 1IFHH 1MOEA 5I1DB 1JNLL 3HZKB 3PWUB 4Y1AD 1IEBA 2X1XR 3PHOB 5D1XD 3RIFF 4J3XA 3MJ9H 3OKEB 3OJ2C 1CI5A 1U8OB 2O5XH 1VERA 3BKCH 2G2RB 4MS8D 5JO5A 4GAJL 3LDBB 3T08A 2NY6D 3KWWA 3WHXA 1G9NC 1AGFA 3HE6A 5BRZE 1GRWA 5MEQB 1AD9A 2Z93B 5DJ2A 5DEFA 1YDPB 4Z76A 2QTEA 5TDOA 3DO7B 5EG6C 4ZS7H 4P59H 3JV6B 3AROA 4NRYA 3V79C 1CXEA 3S4SG 2D7PA 2J4WH 4Y5VA 1M7DA 1F97A 3OGCB 3INUH 3EYFB 5DD3H 3RAJL 4AY0A 4XCEA 2XWTB 3U0TA 2OXHA 5DRXA 4BSVA 3IU3A 5F9WC 3SGDH 5FM5M 3QWQB 1IM3B 4GH7B 4HZLB 5DFVC 2VDMH 5IMMB 2F15A 3C6LD 5BV7C 1AHWC 4MZ2A 1DJSA 1KJ2H 3LKNB 2BCKA 4MQXC 4HH9A 3BIAX 3TT3L 5I8OH 3WN5C 1A0QL 4Q9QH 5I0DA 1YMHA 4F7PB 4TSBL 3SDCB 1FVDA 3PIQA 4PJ9D 3U0WL 4U1IA 5E2TH 3Q1SH 4LHUG 4G8GB 2B39A 2ZG3A 3VD9A 4BFIA 3ROLB 4P2QB 2BSTA 3QCTH 4ZFGL 1D5MB 4OLUH 2ADFL 2HRPH 1SYVB 4IMKC 3O81A 3RWEA 2D0FA 1BEYL 4LU5H 3ZE2F 4MHHI 1KUMA 5JPMA 5KANG 5HPOA 3NH7L 2HFFB 3Q5YA 5DK2B 3BH8A 4Y4FB 2EDOA 4NQDE 1I4FB 3H8NA 4DGYL 2F8OA 1JE6A 3QUXA 4QCIA 3WE6A 4N9GB 4LAQH 3VH8G 2C1PA 4XP9H 1KV3A 5CCKL 1GL4B 1F8TL 1X5HA 1AXSB 2XTJB 4X4YB 3NIGF 1HCVA 4XXCA 3VGEA 4F7EB 3K4DA 4OGYH 4OAWA 3BMWA 3QXUA 4G9FE 4HBCH 4JRXD 3OKDA 3ARZA 5KBNC 5SWSA 1K4DB 1F3JA 3FKUS 1U3HD 4F9LC 1OWWA 2ITDB 3H0TA 1CLYH 2OTUA 1R5WA 4DZ8A 1WIOA 4XAWL 3IS0X 3HCVB 1FORH 2AJ3B 2VSCA 3NGBC 4M00A 3BQUB 5EO9A 4I2XE 2W0FA 3KYNA 1F6FB 1ITBB 1R3IL 3KVQA 3TA3B 3QQ4A 5C8JB 5DRNA 3QFJD 5D70L 4UOW0 1UEMA 1X9QA 2IMMA 4ODUA 4HKJA 3TA3C 5BZWA 3RWCB 3AU1B 4FQJH 5T1LD 2ZWLT 3K8KA 4QRPA 5EA0H 2WWKT 3FHAA 4LVHC 4OQ1A 4DZBB 2QSCL 3RNKB 4PGDA 3VW3H 3BZEA 3CLFL 3VWJC 3MLRH 4NUJA 2X7LB 3RPKA 1TPXC 2QADC 5BZDA 5HYQB 3KPPB 5DHXB 4G80B 2XPGA 1J5OL 4GW4B 1QFUL 2P45B 4LRNH 3QHFH 1AE6H 3FO2B 4AENB 5J13C 2K3TA 3O4OB 1T21B 3IF1B 5C1MB 1XIWA 3EHBC 3RL2B 1H9VA 2FD6L 3VFMA 1MJ7H 4NKIH 2Y6SD 4NPYA 1J0JA 1WIUA 3F7QA 4NO0B 1U3HA 3WJLC 2YD4A 2NW3A 4AT6B 3X12B 5E8OA 5FKAB 5INCB 2J5LC 1G7JB 3MOQA 3QQ9D 3RHWF 2V7NB 2DB8A 2F19H 1KG0A 5HGBB 3O3BA 4XCNB 1KJ2B 3MGTA 3QIWB 4X6BA 3IFNH 3QCVL 4XNMA 2CLRB 2CRYA 1AJ7H 3EFDL 1R3HB 4XPAH 1INDH 1BWWA 2VLKA 5KSBE 3VFOA 4AMKL 2FX7L 1I3GH 4XP6H 4DUWA 5A3IC 3QUXD 3SO3C 2K1MA 2V5RA 2VQTA 4M4PA 4ONFL 1GOHA 3TNNA 1YNTB 3BEWB 3BP5B 5IR1A 5I1EL 4YDLC 3MCG1 3MFFA 1YEEH 4PLJC 3I9GL 3ZSTA 4WU7B 5I73B 4WTXA 5GQBA 1C5BH 1IAOB 1NGXA 4JEGB 5CWSB 1QSFE 3BGAA 2N1KA 1KENH 1TJIH 2FR4A 2PO6C 1CICD 4ISVA 3CXHK 4RMVA 3T8XB 4G5ZL 2NY2D 2GJJA 5D93C 5EZOL 2X1WL 4LASL 4PJBE 3F12A 1B6UA 1LP9E 1BD2A 4FA8A 2WINA 2DWDB 5GXBB 3GK8H 3LSOB 5EC1A 2NXYD 1JI1A 4NNYA 3H3KA 4NJAH 4HFUH 3TP4A 2YD8A 4OD2A 3B3IA 5E2WH 5I16B 1AY1H 4ODHL 5EC2B 1INQA 1WUNT 5DMKB 2YPVH 2WMPA 1KFAL 3NIFE 3BKYH 1WLHA 2P5WE 4RMUA 5T5FL 3GI8L 3WFCH 3QWOB 3IKKA 3PWJA 3MJ7A 1UG9A 3D0VA 4P2OB 5I75B 3NCYS 3H7BB 2QQKL 3S37H 3T0BA 2IBBA 1CE6B 5E8PB 5C6TL 1UM5L 4YX2L 2X4TA 2E5EA 2YA1A 3PGDA 5LWYL 1IEHA 4QRPD 3E8UL 1F5WA 2HFGL 2DTSA 3WFHB 2AJSH 3HPLA 3SGJC 1IM3A 4ZXBB 4OTXH 3C5JA 1OAXL 3HNVL 5GGTA 3SKJH 1JYWA 1YMME 2EDTA 2NZ9C 1OT1A 3MA9H 5D72L 1TITA 1QFWL 5ID0B 4Y4KC 3SKOA 1FSKC 2DKMA 4JRYB 1ONQA 4QRQB 4XI5C 4LMQE 3KLHC 1CXLA 2P48B 4UDUA 4ODWA 3RWDA 1I9IH 1MCIA 3DI2B 2YEZB 4Z7VA 1BQHG 4HWZA 4OFYD 3CFEB 4PRAA 2IAMD 3TFKC 2MCPH 5D2LB 1QKZH 3MTRA 4JAMB 1I7TA 4RFOL 5EZIH 4PRNB 5EU5B 5D96C 4O51A 1T2QL 3KYNB 1JGVH 3RNQB 5FO8A 1AXTH 1FV1B 5J11B 5L2JA 3GHBL 1YZZA 3MRPB 1IEBB 3T2PA 5BCAA 5C07B 1CDJA 1MLBB 4KI1A 2CSPA 3N85L 2FL5A 1T5XA 2J3SA 2J88H 3B9AA 5CZVH 5DDHA 1DL7H 1DBMH 1Q0YH 5DJXA 4A2MA 1M1SA 3JSSA 3CFBB 3VRLE 4L29B 5IHUH 1CK0L 3LH2L 2DYPB 3IFLH 4P49A 3B3IB 3OR6B 3HB3C 3RVVD 1SVZA 4N0FB 1JZ6A 3LEVH 4LGSB 3OZ9L 3QUZB 1XF1A 5D72H 43C9B 4F7EA 3U4BH 3GIZL 1OGAB 3UCRA 3QULB 3U7WL 3DJ9A 2C4FT 1FZOB 3O2DH 4YZFE 3ZL4H 2UVFA 1H5BB 5JQ6L 4L3CB 1MPAL 4CUCA 4XC1H 4LQFH 2KZ1B 3WIFB 1H3VA 5D9SB 2BRRL 5GRUL 5KSVB 2BX5A 3QXVA 2MWCA 1TVDA 4H8WC 2HKHL 1RUML 4JFDE 2GJ6E 4PJAB 1IAIH 3O45B 2ZSVB 2EKSB 4JFHE 1IAMA 4ODHH 2EO9A 4G8FA 3DO3A 1T0MB 1MREL 5C7XH 2CUHA 1WICA 3G6JE 2WM0A 2Z8SA 5GGQL 1OTSC 3UTQA 2KZWA 4JJHA 2AJYH 1URLA 1SJVA 3UBXG 2YA0A 3PE9A 2HLFC 1SM3L 4TYUA 2WK2A 3BZ4A 3B5GA 1RV6X 2VC2H 4HIEB 1WISA 1RZ7H 4J12A 3MA7B 1BX2A 1AXSA 1U8JB 2WQRA 5B4MC 4RISL 1C7SA 2J8UA 1NDMB 2C3VA 1RZFH 3CFDB 4YHYC 4NKMA 4N0FA 4N5EC 2CXKA 4QOKA 5D5MF 1JN6A 2EE3A 1FO0B 5HYSG 4BUHA 3GUTB 1AKJD 3I75B 5HDQL 3MODL 2DQFB 4OQTH 5CD5C 5HI5C 4KK8D 4DUXA 1PSKH 2ICWA 3KPSD 3QI9C 4LPYA 2VXQL 4R9HA 1QP1A 2Y07L 5D7KE 1MCLA 4M5ZH 5ICXA 4UAOC 3BYYA 3WUZA 1T5XB 3PP3K 2K9UA 4UT6L 4AEEA 1B3JA 3BYTA 1MRDH 4PD4J 2J6EL 2IALA 4KGLA 1LK3H 5JO5B 3SOBL 3DROA 1ROWA 4X7FC 2I5YL 1I7TB 4NGHH 1IE5A 1FJ1A 1T0NB 1LWRA 3QUMB 2CDEB 4RDQF 3ALPA 5CSZB 2H45A 1C12A 1H3XA 4X7SL 3DVNB 3FB8A 3H9SE 3LKQA 4RMWA 4I5BB 5JTWA 3C5SA 4WWKA 3MBED 1BF8A 3U9UB 1XR8B 1ZLVH 1C08B 1J5OH 4HCRH 4X83A 3F5WB 5D7JD 4F37F 4XWOC 1KOAA 5DMGC 5I71B 4APQA 4GW5B 4OI7A 2XIDA 2L7JA 3O8XC 1AC0A 1T1ZB 4PLOB 3D5OF 4PGCA 3MV8D 3BJ91 1CVSC 1DFBH 5IFHH 3MV8E 5AYUH 5TE7H 3ULVL 1ZT7B 3HR6A 3B9KB 1GPOL 1NCAH 2VISB 4ZD3L 1G7IA 3JV6A 3UYRH 4M7JL 2QLVB 1CG9B 1CDBA 4F3FA 4JDZA 5FKPA 1Q9LA 2JJTC 1A02N 1R3JB 3A6BH 3OHXB 3WO4B 1A9EA 1OAKH 4QGTA 5ADOL 5FUOH 2HVKB 3MJ7B 4YFEA 1EXUA 2JTDA 5D2LE 3RBSA 2GW5A 3QEHA 4HDIA 4XMKH 2P49B 4L8BB 3TO4D 5CJ5A 1X5YA 5KS9E 4LARL 4KDVA 3DTXB 1EGJL 2J8UF 1A2YA 4ZSOA 4F80A 1MIEL 4JDVB 4LCCA 2OLDA 3PWUA 1S7XB 3P4NB 2UWEA 2XG4A 4DW2L 1WSST 4N8VG 4R90L 5HHOB 5ICXB 4YR6A 2R1XB 3RI5K 5ILTL 1CLCA 2EC9U 4ZYKB 5HHNA 3C87A 4P5KA 5HHMB 4AQ1B 1NMBH 1NBYA 1S7QB 1JUFB 4TULL 2BNQB 2FEDC 4PG2C 4I2XA 2Z35B 4LFHD 1W2KT 5ELIA 5F7UA 4XBGA 3RA7L 4PP1C 4PJ5E 4WWID 5DJCB 2FWOA 4KTEH 3PWNA 4MJID 4QHKJ 4MA1C 1SEQH 4LSVL 4LL9A 4O2EA 4U6YB 3QO0A 5CBAB 4EDXA 5BS0B 1S5HA 3DLQR 2J6EH 2FECI 4U1LA 1BIIA 4EXKA 2F5AH 5D6DC 5B21A 4ZOCA 1XF2B 2QADB 3F5WA 5D7LA 1DDHA 3AREB 1TCRB 4P23C 5SX4H 4M6AA 3SN6N 4HKBB 5LCVH 1YEGL 2ADFH 2IAND 2RHEA 5SX5K 4YDJA 2VLLA 3IDJB 4IRSD 4J6RL 2DTMH 3GMOA 3P0YL 4XVJL 5J06A 4NUGL 1F6LL 4FXGB 5HDQH 4IOSD 2LABA 2CK0L 2R23B 3SQBA 1CFSB 4MAUH 1VADA 3TZVB 3VFGL 4POYA 2FO4A 2QQQA 4UU9A 2D03H 3A6CH 2YMXH 3WFHA 2FATL 4M5YL 5I1AA 5HI3D 4LF3A 3WEXA 3QDMD 4FFYL 3EUUA 3QDGB 3G5VB 2GJZB 1MRFL 3MYJB 3MNWA 3V6OA 5IMOA 3LQAL 2NY3D 4Q9RL 4ZFOB 2EYRB 3SJVE 4YAQB 3WIHL 1CGWA 3PWJB 3TIEA 1UQSA 2VB5A 2CKBH 2O26U 1I1AA 5F9OL 3MLWL 4KDTC 5DC4B 4MDIA 2MQ0A 3QISA 4I0PB 4QRRD 3FO1A 4XB8A 4ZS7L 4N0CD 4OFIA 4LSQH 4NQSB 2W92A 1J05B 3BPNC 1MEXL 3PWLB 1PQZB 1EUTA 2HVJA 4JFED 3HZVA 4H0HB 1WWAX 5FUCE 2W0LA 2B8OT 2ICWB 1KJMA 1UXSB 4YLQT 4QTHA 5E8EB 5FYJE 2NYYC 5IK3A 4XTRC 3OKKB 1AFVH 3MRPA 3SHSA 3DSFL 1L0XA 5HHMD 2Z92A 1Q9LB 4OZIE 4HWBA 4LCYA 1FDLL 4ZSOE 1WBYA 3VXPB 4M7KH 2NY5C 4EN3D 3PWVB 1X5KA 2X1OA 3WIHA 2DQIH 3L3JA 5EU4B 1NBVL 3C5ZC 4UDTB 5L7XH 4XPHL 4X80H 2XFXB 2Z31B 2X6MA 4OSUH 3S5LB 2BVPB 3RL1A 5KOVC 4WEUD 3QXTA 1J10A 4N5UA 4UIKH 5DD0L 1OARH 1B0GB 4HX1B 3N1MC 5DD1L 4N1HB 1WBYB 5A16B 3SJVD 1FRGL 1DQTA 1TTGA 3GIVA 4HF5L 2H2SD 2VDKH 3QUZC 3RFZC 4Z7UE 4D9RD 4YWGH 2ARJA 3N85H 2H26A 1IM9D 2NPLX 5T3XH 1QNZH 2APWA 4PY7A 1F4WH 3BGFB 3DX8A 3O2VH 1JGVL 1NFDA 1U6AL 2G60H 1YY8B 3PV7A 3VE0B 3NAAH 4TN9A 3IAPA 5CJXC 4ZPTA 3QUZA 3TJHC 5F71A 2D9CA 1OHQA 3STZB 4YDIL 3S35L 3MRHA 1G6VK 3D9AH 1U3JA 4LLVB 2MCPL 3VA2C 4PJ8A 4J4PA 5C7XL 1FZOA 4XCFL 3BH9A 1SJEB 5GIRB 3O6KH 3V0WL 1EEZA 5BRZA 5JHDD 2HH0H 4LK4A 5IBLD 3JWOL 5E6ZA 2PW2B 4K94C 3K4ZA 4Z95L 5DQDH 5BXFB 3TLRA 4JPWL 5BZWB 4ZSOB 2YC1B 3V5DB 4ZO7A 5CUSL 3QUYC 4JY4B 4M6MH 5DS8A 3WFEH 3GMNB 4OZIF 4W4OC 1BVKA 1BQHB 3UDWC 3OGOE 3V6FA 5I9QC 2WP3T 3BD3A 3CX5J 3WO3B 3RTQD 1NDGB 1UC6A 3QUMH 4ETYA 3PQYD 2MSPA 4KU1A 5JNYB 1NGQL 1YJDH 4P4KD 3VXRA 2IPKA 2NNAA 2C4XA 4Z8FH 3KPLA 3U4EA 3ARGA 3E2HC 5FK9A 2RCSL 2VLJB 5F88A 4Y19E 3T2QA 2KH2B 2P8MB 1FVEA 1HILA 4DVBB 5AZ2L 1VGEH 2DQEL 3ULVC 2O93L 4GQ9H 1HQRB 4UV7H 5FF6A 1T0PB 1KCUL 1M05B 4GXVL 1X5GA 2FX8L 3ET9F 1QSEE 4Z95H 3ZYZA 2DM7A 2ZJSL 5MENB 4MQXD 3THMH 2X2YA 4PIRF 5E2WL 1SQ2N 5SWSB 1QBMH 2P46B 4MA8H 1FNFA 1OWRM 2GITA 1FCCA 2DM2A 5JA8B 5AG8A 3MV9D 4PGBA 4OZGA 1A14H 1KT2B 4WHTB 4U6VH 4L4JA 4NQEA 3U0PA 4GRMA 3MNZA 2BNRB 4OGXL 4YHPB 4FFZH 1MHPH 5EO1A 5D7IF 5JIKA 1E4XH 15C8H 1NC2A 4UNUA 4MNGA 4EDXB 1UM4L 3T0EE 3QFJB 1LEIB 3NIGE 5IVZB 4CMMA 3VGBA 4HWUA 1L0QA 3U46B 3I9GH 3DX7A 3VFVB 3P77B 3T3ME 4G6KH 3IETB 3OQ3B 1FL3A 1HQ4A 1CICC 3AAZB 3RWIB 5DRWB 1GC1H 1P53A 3FFDB 4PGEB 2ZZUT 3JTSA 1BPVA 4K3EL 4RBPH 3HLAA 4XP6L 5D7SL 5DD0H 5EZJB 4P5TA 2KBGA 5FM8A 4OUUA 3ALWA 5EUOA 1CZ8H 5B3JE 4Y2DB 3M17B 3GJFK 4OZHB 5GZOC 2FSEA 2E8YA 4RGMC 1BBJA 5F9JA 1JGEB 5TJWK 3ROOB 3D87B 1MWAL 1NL0L 3SY0A 4S10A 5EFIB 3Q6FB 3TVMC 1HYSD 4QHNB 4PJGB 5DUPH 5SX5H 1JF1A 1HDMB 2VZTA 2XYCA 3I6LD 1A47A 3DHMA 3V2AR 3TVMA 3VXUA 2B4CH 5F70A 4M43L 2PXYB 4WI5A 5ANMB 4K55A 3W39B 4OZHA 3VXMB 3GJFB 1FG2A 4MQSB 1I9EA 2MQCA 2EDLA 5IJKA 2UY6A 5HHOE 4XZUB 2D7MA 4WY7L 3EJJX 2V5SA 2AQ1A 3ARBA 3PDOA 4JM4H 4V1DE 3SBWC 3WNMA 3OAZK 3JV4A 4LCWA 3ULUD 2V2TA 3B2UC 4OCYH 5F88B 4Q6IC 5DEGB 5DC0A 5C07D 3OXRA 5T1MA 3V6BR 3CCHB 4BSWA 5ICZB 2IG2H 5INDA 4Y5XC 2R2HB 5K33A 5IKCA 3EAKA 4U49A 1YC8A 4Q9RH 2AERT 5C0CE 4LASH 2X70A 2NXYC 2OJEA 4PJEF 4NCC2 2YWYA 3EJZD 3NABH 3VI3F 1UYWH 2ZUTA 3BQUC 3QUXB 4QCIB 2DOCA 5D7IA 3RZCB 1WIPA 1UKQA 1ZHKA 4G7YL 4QTHB 5E8EA 5F1NA 4KJWD 4NPYB 3OJMB 4RAVA 4QNPE 4MJIB 3PABA 2YD7A 4JREC 4MNQE 2QSVA 3BP7B 3VMOA 1OP3K 2Y6SC 2RIKA 5I17A 3T0VA 4J6RH 3KPRE 7CGTA 2Q6WB 2OZ4A 3ZE2E 3EFDH 4PY8J 4C4KO 2APXA 4NRZB 5EC1B 3DV6A 2JELL 3EYSH 1NC2D 3M8OL 3WUWG 4ZNEE 2IANB 3IDNA 3OPZL 4K2UH 5E99L 1SJXA 2YUWA 1CFQA 3BKML 3MV7D 2IQAA 3KDMA 5T5NG 4JJ5A 4NNXB 1JPTH 3BOVA 3PGFL 5CGTA 1MCNA 4QXGL 2C5DC 1MLBA 3VXRB 3MJ9A 3I6KB 4XHJD 3T3PF 1PLGL 2AEIT 3MV9A 1JZ3A 2XZQH 4JKPL 4MCZB 1MJ7L 4MD0A 1OD9A 4X6CA 4OV5A 3EOBA 3GSQA 2A6DA 3MA7A 5DHYA 5EOTB 4WEBH 4K23L 4O5LL 2BHYA 4HKXB 2WWMC 4ACPA 3QUYA 3RTQC 1RJZB 4QF1B 2GAZB 3CVIL 5GGVL 1T4KB 2C3XA 4C57C 2Q7YB 4FTVE 3NZHH 2KDGA 1K4CB 4L4TD 4WW2F 4PJCB 3SO3B 3BUYA 2F54D 5I30L 1EIBA 1FFPB 1FNSH 5KSBF 3SKOB 4AIXA 3Q6GH 3NA9H 1JHTB 3QUKB 3TYGH 3RVXD 1YEHH 2A6IA 3PQYE 1JTOA 1K8IB 3W9EB 1QSEB 4NKOB 3QRGL 4UV4L 3UTZB 3L5JA 4PTUB 4Q9QL 5CP3H 2PYEE 3AMLA 3VXUE 1OLLA 3RRQA 3H9SA 4MX7B 4ZDHB 4MMXC 3VWKD 2X4PB 5HPMA 5HGDA 1M4KA 1ZA3A 3HB3D 3SDCD 2CRMA 4LSUL 3DUHA 4PJEA 2FX9H 4RWYH 1L7TL 5H37H 1H3UA 2VXSL 1CE1L 2OJZL 1GPOH 1E4WL 3IJSA 5MI0B 3I3DA 4R2GC 1U3YA 1T6WA 2VITA 4MLSA 4RX4D 4BH7A 2XZCL 3P11L 2R4RL 3FN9A 4CN4A 3RWHA 1S78C 4AG4L 5D1XC 4PJFF 4G8GA 2WW8A 1HXMB 5C3LD 2EZ0C 1G9NL 4HBCL 2FJHB 4GRLB 1PG7H 3N9GH 2GY5A 1BQLL 5C0BA 1QBBA 3W0WA 1FZKA 3G5VA 1S3KL 1IGTB 4IOIB 4IIQB 4EUPH 1KLUA 4ELMA 4ZS6C 1F11B 2IQ9L 2VL5B 1INEL 1FPTL 4DAGH 2CXGA 2HVKA 1D5ZB 1JHLH 4JAMA 3SJVA 4X4ME 4LAQL 25C8L 1MHCA 5ABDE 1ZK9A 5IT2H 1ZA6A 2NMSA 4M61B 4O58L 1VPOH 1LGVA 1P7KB 3H9YA 4K7FA 2DL2A 2IMNA 3MLZH 3U6RB 3WNPA 3RNQA 2GTWA 1ORQA 2P8PA 3B9KA 4FQIH 1WBXB 5K9OB 1BEYH 5E8NB 2E27L 1IMHC 3FQTB 5DJDB 2EDBA 1MNUH 2X40A 5EU6B 2PYEB 1OAZH 2P5WB 2EEAA 4P3CH 2E8ZA 3KWWB 4C58B 3P9WB 1NGYB 3LKOB 1K6QH 3MODH 4OBRA 2A2QT 5E2TL 4NHCL 4JFQA 1EAPB 4FQLH 4RCAA 2AEPL 2AAVA 4LPXA 5FGCB 3MUJA 4OZIA 4RBPK 4EI5A 1RK1A 3HPJB 5EBLA 3S97C 5CJBA 1FO0H 4LKXB 4MVBD 2Y23A 1WT5C 1XR9B 2DQGH 1RVFL 3ULUF 4Y16A 4WV1B 3KPMA 3EYUH 3FCTA 5JORB 3GMQB 3GSUB 2IGFH 4Z7WE 5CP7B 3SO5A 5FEBA 3OKNA 1NUFA 5KTEL 2F58L 4O02L 4P4KA 4Z7VE 4L1DA 4RQQB 3NZ8B 3F65A 3UBXB 3G6DL 4LCUA 1R3LA 2E27H 4G9FA 4L8BA 1DZBA 4D9RE 3MXWL 1XGUB 3V4PH 5DZOA 5A1AA 5AD0B 4JQVC 1MHCB 5DWUL 1IKFL 3ZE0E 3UJIH 1A9EB 1U0QA 1UACL 5CBAA 1D9KA 1NGPH 5JHDB 4F9PC 3TCXA 5ISZE 2JJVA 1KTDA 3V6OE 3CZJA 4JFFD 1O0VA 2OL3H 4YFLF 4F3FB 2O5YL 1NEZG 3OAZH 1VEOA 2V2WB 4KMTL 2P4AB 3MJ9L 2X5PA 4KMTH 1LO2H 4MQ7A 4MQTB 5TDPB 3T09A 4U6HA 1S9XA 2OL3L 2AV1B 4M61A 4QRUA 4KK5D 2FHBA 4XPTH 1NSNL 1UACH 1ETZA 4PP1D 3ORJA 1KPUB 3I6GB 5IB4A 4F9PA 1VACB 3R06A 4DZ8B 5HGHB 2ADJA 2B4CC 5H2BA 1P69B 2AGJL 2R1XA 3CLEH 2DKUA 2XNAA 1PG7L 5C0NC 3T4AB 3DPBA 3LEVL 1RZIB 2Q76A 3L3OA 3MGTB 3QIWA 2Q86B 4JFDB 4JFXA 1G7PB 2HP4A 1A3RL 3P4NA 1YQVL 4RRPG 5IHUL 1V3KA 3JWDH 1MI5D 1Z0MA 4HUUA 4J1UB 5CEZH 1SEBA 5MERB 3MLTB 1JHKH 1HXMA 5CKAA 3WHXB 4ZQKB 4IJ3C 4HG4K 3BRFA 2DWEA 4JN1H 5EZLB 1A64A 5HD8D 5HI4D 1H8SA 1A6UL 1T66C 4OB5H 4JHAH 5KVEH 3HMWH 2V17H 3B4NA 4WRLA 2Z92B 2FGWH 4YK4B 5L0QB 3BP6B 2NY6B 2ICEA 4OCLC 3BPLB 3BSZL 5CEYA 1H5BA 5I6XB 1D7FA 4QRRB 3S34L 1JVKA 1CD1A 5GHWH 1MF2L 3ECBA 4M4RA 2AV7A 1BM3L 1VGKA 5A2JH 2X89A 4I77H 4I0CC 2EDKA 2HVJB 4NWUL 5KJRL 5KSBB 3Q6GL 2W38A 5KOMC 1V05A 3AB0C 4X4XA 3D39E 3FOMA 3QI9B 4ODUB 4EQ3A 3DBXA 4TTDC 2ZCKH 1BQUA 3CFDA 1Q9WA 3LV3B 5TE6H 4KY1L 4AL8H 1LO4L 1JF6A 2MJWA 3RWJA 1E27B 5SWQB 1LDPL 2Q7YA 5DK0A 1TNMA 3ARGB 2PN5A 4C56E 1TVBB 5EU3A 3U48A 4CW1A 2HKFH 3V7MA 3GHEH 4DAGL 1FPTH 3S3PA 1W0WA 4Z0BL 4X6CB 4YX2H 2XWJB 1EVUA 3S3JA 3X11B 3HI5H 4R8WH 5DS8B 1TTFA 3ARFA 3S37L 1A6AA 2UUDH 6CGTA 4MSWB 4I3RL 2PTUA 3O3UN 5D2LA 1X3DA 4YHML 2X05A 12E8H 4NT6A 4ODBD 1ND0A 4X5LA 2BY1A 4CDHA 3EGSA 4ZUWB 3PABB 1Z9SA 3WXWH 3UJTL 2GIYA 4AG4H 4QRQA 2HTLD 3VFPA 5JA9A 4NFBA 1QBLH 1MCCA 3TBTA 3UYOD 2R4RH 4PUBH 1ZLUK 1XF2A 4J3OC 3QI9A 2X4NB 1CGTA 4JB9H 1IILE 4RNRA 2EE9A 4G7YH 4K3JH 3O2WL 3IDMA 5EZOH 4OZFA 5F7DB 1UYWL 2FJGB 2ZG2A 4DTGH 1N0XL 1WFNA 4HFWB 3H9SB 3QQ3A 5AWNH 3SPVA 2EYSA 1WC7A 1MHEB 1GIGH 3C2AL 2Z35A 4QRSA 1FFNA 4H5SB 2Y4SA 3BE1H 4NCDA 2ORBH 4PP2B 1AGEA 3MUY1 3ULUE 4QNPF 2AEWA 3FL7A 2NY7L 1JNNL 3VCLA 4L3EE 4U3CA 4OZGE 4DQOH 3C5ZA 4FXKB 3SDCA 2NX5A 2FB4H 4XXCC 4X6EA 2HJKB 3QWRD 2WBJB 2L7UA 3MRNB 1QQDB 3PJSB 4X6DA 4YEEA 3G6JF 2C9AA 3SEPA 1G7PA 4P2QA 1AD0B 1I1CA 1IGFL 1DUYB 1RUQH 5L0QC 4BSJA 4L5FH 4JM2A 1A1MB 2UZIH 1RZKC 3GSXA 5DZNA 3VXMA 3W5MA 5C0FA 1PLGH 3H3PL 3E6HB 5LGHL 1CFBA 5F7HA 1P2CA 4NFDA 4FABL 2EEDA 3FRPA 4V2BA 4HH9B 3TO4A 1XF5B 2OTWA 4LP5A 3KPRD 1Y6KR 4OLXH 1XEDA 4LCIH 5J3HC 4JQVA 4OLVL 3MBEB 5HI3C 4HK3J 4KDTA 3JWDC 3OKLA 5IHBA 4GMSH 4XVSL 1AGCB 2IH1B 1EHXA 4MCYA 3SE3C 2VDOL 5JIHA 2J1KA 3NN8B 4U05A 1GGBL 5I74C 2W07A 4X4XB 4WFHE 2DQCH 3L7FB 4PJDE 2X10A 3ZE1F 3GBNH 4XNQA 4C56A 3SGKA 5C09A 4LOUC 1F58H 5D1QB 5HGBA 1BZ7B 4BA8A 3C2SA 4NO0D 3PGDB 4JZJC 4Z7UF 4PJHF 4WUUA 1QRNB 1GIGL 5F6HI 3TBVB 1LVEA 4G6AD 3HZYA 4QO1A 1PX3A 3T0WA 3ZKND 3QQ3B 4DVRL 4XP5L 4QRTA 4U6XB 4X4ZA 5BOPA 2NZIA 3KPMB 1DQQB 4Y16B 1FZJA 2JJSC 1QFOA 2NR6D 2R2HA 3U7AA 1KC5H 3K2MC 4UOW1 4GFTB 1CFSA 4F7TB 5F7YC 1KIPA 1F4YL 3PHOA 2BY3A 3F7RA 2YSSA 4YFLI 1E4XI 4Y5XA 2A6KB 4GW4A 1JRHI 3GMOB 2QL1A 1QBLL 1S7VA 3O0RH 2V2TB 4LDOB 1FNEA 4MXQC 1YMMD 3T65B 1UA6L 1BREA 1YN7A 4JY6A 3KNBB 3SE9H 2AKRB 5K93A 1IGCL 1CD9B 3B8SA 5CMAB 3IDGA 4TQEH 1KTLA 4UTBH 3TBWB 4KI5D 4QRPB 1T2XA 4Y4KD 1VENA 2PYEA 5DD5L 2ZNXA 5AZ2H 4ZUVB 3RUGF 3NBNA 4HT1H 5D6CB 3ULVD 2B4CL 1MFBL 2AK4B 1NDMA 4NKQB 4TTDD 5F9WB 1BQHA 4PJEE 2WUBL 4OT1H 4K7PX 5J4MA 3GHEL 5GZOD 2IAMC 4PRIE 3B43A 1CU4L 4DGYH 4LCWD 1KACB 1CN4A 3DMMD 3BN9C 4RAHA 2E7MA 3QEQB 2V5TA 4L3EA 5CSBA 4DCQB 1V3JA 5GGUB 3B9DA 2HFEB 3N1QC 4HLJA 4JRWA 4HS6A 1AGEB 3WL9A 4PJFB 1ZTXL 5DJZA 4K71B 4P5TC 2ARWA 4MDJA 1IARB 2QSTA 4FHBD 3PHQA 1OAQH 1U2CA 4DFHA 5ADPH 5DK3A 1FGNL 2NW3B 5ACMA 4AT6A 3U0WH 3CK0H 2H6PB 3VJ6A 2HYMA 5CD5D 2FJGA 1W72B 3F7VA 1G0XA 4X5WB 1U91A 2CPCA 2AXGB 2VAAA 1KYOK 2E7BA 3VRJA 1P9MC 4ZXBD 5KAQG 4S1QH 2XQBH 1MHPL 3DSNA 3D69A 2IH3A 3QFDB 1A7RH 4LVEA 3OXSB 2BZDA 5E5RB 2DMCA 1JWUA 2C3HA 2XA8L 4LLUB 1IC7L 5BW7C 3P4MB 1U8KA 3DVGB 1C7TA 1XT5A 5CEZL 2P24B 1JRHH 4EKXA 4XRCA 4APQC 3STLA 1LILA 5B38B 4CVUA 2EH7L 1SYVA 2ADGA 1KLGB 4NKDA 2RFXB 4OSUL 4HWBH 3T4AA 2B2XL 4TSAL 2NTFA 1JZ4A 2FH8A 5ERWA 4JG0L 1KEMH 5ALCL 2PF6A 4TUOB 4YZFF 2HTKD 1CLZH 3QDGD 2E9BA 2ZKHL 2VH5H 1T2JA 4XWOD 5ACZA 1TVBA 1DANT 4P9HH 1B2WH 3QUYB 1MI5E 3IJYB 1WZ1H 3GO1H 5LGKA 1NGQH 1YJDL 3DGGB 4OGZA 2YD3A 3VG9B 43CAA 5EBGA 3QDHA 1IT9L 2VZ1A 1FYTB 1ZT4A 3HMXH 4H8WH 2RGSA 4HBQA 4Y2DD 1D5BA 2HLFD 3FO1B 3L95A 3AY4C 3FQNA 4W4OA 3UJIL 4OM0L 4GUPB 1F6AB 2DIBA 2ERJC 3DIFB 4Y19D 5ENWB 3WSQH 4EI6A 5E5MB 3F62A 1KJVB 1EJ6A 4U1MB 4C83B 3WUWA 5HYQA 3CPLB 1MCEA 3GSOB 3P4MA 3E3QE 5C0BE 3DXAB 3IDNB 1HSBA 3RP1A 5HYSA 3V0WH 4NDMB 4NQTA 3GMPB 1ZSDB 4PJXA 2DQFA 5HHXL 1AH1A 3ES6A 2JLLA 1OM3H 2DQHL 1HCFX 4NKDB 5J3HD 3WKML 3QI9D 2EDQA 3CU7A 2XKNA 4NJ9H 4N9GA 1FYHB 4PJIB 5C0EB 4IHOA 4AEHL 2YPLB 4MWFA 5GRVL 1XCTA 2AS5M 3KPRB 4LLUA 2K7PA 2ZPKH 5EO9B 5E7FA 3BQUA 1CFVH 3U2SA 4P2RB 1IC5L 5J12C 2YR3A 5HJ3A 1T03H 3A6CL 5E6ID 4W70A 1UEYA 3NFPB 3KLSA 3G6AA 1QSEA 4PY8I 1GJIA 5FO7B 5CGMA 4NBZB 3QNZA 4J4PD 3REWA 5CGYD 1KB9K 5GSRB 5FGSA 4N0RA 1JYVA 3MLYH 2ITDA 1UWXK 2XXCB 2HT3C 5J56B 2DLTA 3QXDB 1OAZL 1FG2B 3QEQA 3WHE0 4YDKH 3O45A 1MFDL 1NCBH 5TDNA 4HIXH 3P0VH 4J23A 3DMMB 5E8NA 4L4TB 5T33H 5GS0C 4GSDH 2E9IA 3MLZL 1J12A 3GSQB 4PJ9C 1DQJB 4XVTH 3U6RA 1ZLVK 3K2UL 2ICCA 1VPOL 5CINL 5F6HJ 3LN4A 1FDLH 2HN7B 1T83A 4G7VL 2F74B 3CMOH 5I1IL 1PYWA 4GQPH 1EERB 1JHLL 3ARPA 1H3PL 3MQIA 4U6YA 3M17A 4OCXH 3EYOB 5CJOH 3D18A 1A22B 5C0DB 1T5WA 1NCCH 2Y06L 1G7QA 3BP4A 3LIZH 1IAKB 1WGOA 3RVXC 1HE7A 2CMRL 2P47B 3HC4L 3BVNB 3U83A 1ZLWH 4GG6B 1U93B 4NO5A 1MHHA 3FFDA 3X13A 2P44B 4X7EC 1HINL 1EEYB 1U8PB 3RIAK 3VFOB 2PW1B 4UIMB 2NY3C 4NFCA 1XGQA 3IU4L 3QEHB 4J3WA 5LAXA 4CNIB 4YHKL 4WVRA 4B7IA 5IV2A 5D8JL 1EGJH 3T4YA 2MHAB 4OBSA 2WSKA 3JTTB 3VRIA 2R0LL 3V4VL 5FA4A 4WEMB 1OW0<