4LI0A

Crystal structure of gdp-bound rab8:grab
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
171
structure length
171
Chain Sequence
b'DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-8A
molecule tags Protein transport
source organism Homo sapiens
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
total genus 54
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4li0A00
1GSIA 1UBCA 4RZXA 2IUUA 3VU9B 2C8VA 3UMFA 1E9SA 3LAWA 4TTPA 5GVSA 1NL3A 5JBQA 4JS0A 2OFWA 1R8SA 4CW7A 2R62A 2OBLA 3ZVRA 2QTFA 1UM8A 3AQ4A 5EP3A 1G4UR 1F5NA 1ZCBA 5IDVA 4WXPA 2FGKA 1E1QA 1S1CA 2ZS7A 1JB1A 3NXSA 4US2R 3FOZA 2GHIA 5DYGA 4LOAA 3Q72A 5C2JB 2FH5B 3RDPA 4TYQA 2KBEA 1YZGA 4KLZA 3WRXC 1F2TB 4EPVA 1NMYA 2IYQA 1T91A 3NH9A 3N2EA 4RFSA 2QZ4A 3W6PA 3RS2A 3KX2A 4M1TA 5HKKD 1E3MA 4US0R 3VR5A 5HE8A 1OXUA 2P3SA 3X1XA 3WHKA 4NYMQ 2GXQA 1US8B 1WE2A 3B9QA 5EE0A 1XJQA 1YR9A 3FMIA 2FNAA 1E9CA 4PPNA 5ANRB 1LV7A 1BMFA 2ZRIA 3EW9A 2ZREA 4X8HA 1ESMA 1S4QA 3KQKA 5TB5A 3RRYA 1Z0IA 4BUJA 4X8MA 1KJYA 1NG1A 2I1VB 3OIUA 1KI4A 3GLFE 4MYCA 3VHXA 3OEHD 4FCVA 1P4SA 4IDHA 2QBYB 1FTSA 4ZDWA 1AQUA 3CRVA 2XZLA 4EPTA 4Q02A 1N6PA 3OAAA 1GL9B 4FMCF 2ZYUX 5FOTA 1UPTA 3MG9A 2D06A 2HV8A 4MGZR 3JVVA 1JALA 1IN8A 1MO5A 3ASYA 1JR3A 4U5XA 2RGEA 4D2IA 4GT1A 2AR7A 2VYFA 1A1VA 1PLKA 5BQ5A 3GFTA 2WJGA 3BAFA 1MRSA 2WBLC 3RWMB 3UXMA 5FOSA 4LJ6A 2NG1A 1E2FA 1SVIA 3CR8A 3L2OB 2O8DA 2QT0A 2QBYA 2GEVA 3P1JA 2CCJA 1XEXB 3BH0A 1XEWX 2HLDA 4JLBA 4P4TA 2ZRFA 4GOJA 1C9KA 1UDXA 2HCJB 2V1XA 4EJSC 4JLPA 4RKEA 3BXZA 4PPQA 1U9IA 2H18A 3MD0A 3C14C 1LVGA 1YVDA 3CH4B 1OXTA 3AGQA 1DAEA 1GG2A 1GVNB 1UKVY 4X8OA 5FOUA 3G5UA 2W83A 1E79A 1UADA 2OILA 1NBME 4A6PA 3MWJA 4AK9A 3CF0A 1KSGA 3DPUA 4OK5A 2XSZA 3F0TA 4CGZA 4OJKA 1Z47A 1IQPA 4PAOA 4Q4AA 5FBVB 4L15A 1X8KA 2D62A 3L0SA 3LRPA 5DI3B 4QBIA 1B0UA 5IK2A 4Z54A 3U3OA 1G41A 4LSGA 2RGNA 2CLSA 1VTKA 2CE7A 2ZQ5A 3EZ9A 4PPFA 2IS1A 4ZIRB 1U0LA 2PT7A 2C96A 4UXIA 4HDOB 1XPRA 2WAXA 2AXNA 1XXHE 2ZI3A 3PUVA 3RRZA 1XTRA 2OLKA 3A1WA 3B6EA 2D2FA 5SZHB 1T9HA 4NBSA 2ANCA 3L82B 2QG6A 3SYLA 1XX6A 1SVMA 2AKYA 3BERA 3GFOA 4QHYA 1M6NA 4C2TA 4JBXA 4ON9A 3NEJA 4AWXA 4LC0A 2QM8A 2J7KA 4QG7A 3L43A 5GADl 1RRCA 4N1AA 2R6DA 2A7QA 4TZ0A 2J9RA 4KAXA 1VPLA 3H1TA 5EP2A 3TKLA 2IF0A 2GBLA 3QBVA 4I81A 1KI8A 3SBEA 3JZAA 1MT0A 3TW4A 1ZAKA 2XITA 3PENA 2F55A 4LV5B 4FI3C 4YLGA 5KDLA 3KFXA 1HA3A 2VP9A 1VCNA 1XMSA 4OL0A 4C7OB 1CU1A 1RPZA 4WZ6A 3GLIA 2ZS9A 2OESA 4XJXA 1Z0JA 2WAYA 2ZJAA 4ZIRA 4ILEA 3IDQA 3DM9B 3QF7A 5DGXA 5FPYA 3U3RA 1ZNYA 3TQCA 4JLDA 1G8FA 5FPKA 3FMPB 2RGBA 4QJ3A 4UNNA 3VR1A 4QJ4A 3ZZUA 5IK2D 3KUDA 3QBTA 3K9GA 2OV2A 2WPDA 1HE1C 4XWOA 3CR7A 1KDOA 2P67A 4Q4AB 1G20E 4XVRA 4WA7A 3HU2A 1IBRA 4NL4H 1UBGA 1SULA 3AVYA 3GJ5A 2ORIA 1WBDA 5EXPA 1W5TA 4GOXA 2HXYA 2GXAA 4XTCS 3JVUA 3C41J 4GOKA 3IILA 2EFHB 2ZRMA 3WMEA 4A1FA 2V6JA 2JASA 4HAUA 2FSFA 2VHJA 1QHYA 1ZUIA 1OH5A 1VMAA 3AP3A 3ADBA 2BBWA 3B5JA 1NMXA 3BORA 2HYIC 5DO9A 1GNPA 3AVUA 1KZ7B 2O8DB 3GJ7A 2DPXA 2OSBA 2XJ4A 3LQRA 4MGIR 3LO5A 1N5LA 2IEYA 4CZ2A 3RANA 2GCPA 1CF4A 4DCSA 1U8ZA 1R4AA 3P4XA 5FUWA 2GNOA 4L9WA 4P0TA 3DL0A 4KFSA 2XJ9A 4I4LA 2J0VA 2OUKA 3O8BA 1CXZA 4IVQA 4NMMA 3MWYW 4RSGA 4PQYA 3OAAD 4NE2A 1T0JB 4PAMA 1YJ5A 4DLSA 3AKYA 3B1XA 2GETA 4NYJR 4URVR 1Z0FA 4D4MA 2NO6A 4BQSA 2DB3A 1AM4D 2GKSA 2LKCA 3WRYC 4TL6A 2VH5R 4AG6A 2AWOA 2BBSA 1ONBA 2C95A 1JR3D 2IYSA 3EA0A 3NC1C 3PUWA 4NONA 3I61A 2PJZA 2J0UB 1T6NA 2QRZA 1E99A 5CIQA 4KU4A 1X8LA 3K0SA 1KKLA 2FV8A 2ZRNA 4BRWA 1KDPA 2XZPA 2FG5A 4HLUC 1IN7A 2Q3HA 2V6IA 4LK2A 4ZDJA 3T61A 4DKXA 1UAAA 1ZIPA 2BBTA 1RIFA 4V0LA 3OEHA 4ZCIA 2RGGA 1KDRA 2PLRA 2B6HA 4P32A 5AK0A 5FPSA 3VNVA 2E9SA 3IIMA 1P61B 2BMJA 2IS4A 2VTKA 2GAAA 1SKQA 5G3ZA 5FBQB 5A4JA 4LYJA 1Z6YA 4NYJQ 4W9MC 3MWLA 1BMFD 4B76A 3CKLA 4DSNA 3LD9A 1XD2A 3KDSE 3CLVA 2IL1A 4Y0VA 5HR5A 2VP5A 1P6XA 3HYTA 4PPGA 1GTVA 1JQLB 1XEWY 8OHMA 1IOZA 1NI3A 3WHLA 2D7CA 1W1WA 1E1QD 3AF4A 1GM5A 1P7CA 4F7WA 4D6PA 1H8ED 3CWZA 4F93B 4RCZA 3EC1A 3QPWA 1LFDB 3I8XA 1KO8A 1KTVA 1UKZA 1YU9A 2RKOA 4LC1A 4MDEA 2ZRAA 4Q7LA 3TSZA 2YJTD 1XPOA 4OHVA 1ZVQA 1SKYE 3W9YA 3ZZTA 2CHGA 3LWNA 3EWAA 2J7PD 3UWOA 4R98A 3PXGA 1FMLA 1VCIA 1ZD8A 4KSCA 4ZDKA 4B6EA 4BWYA 2OFXA 1R10A 1GRNA 4C3ZA 1RRPA 2CDNA 5CM9C 3VNUA 3W8NA 2VP2A 1OYWA 1JEEA 1JR3E 1KK2A 1PUIA 2W58A 4HZIA 1KI3A 5CDFA 4BGDA 1N3BA 1T0HB 2PCJA 4Q4HA 1T3HA 3GJ8A 5EE9A 2BC9A 4PSAA 2O8CB 5EUQB 1E0AA 1CR1A 1QHXA 5FOVA 4PHFA 1GRRA 1L7VC 4BFZA 4QHTA 1E9EA 4G01B 3VHLB 4BE7B 1FFHA 1JI0A 2ZSAA 1TQDA 4FWIB 1G7SA 3A1UA 2C03A 4HEJA 4Q7JB 1IHUA 5FPTA 4QKQA 5B58C 3IQWA 2ZJBA 4JLKA 4ZV4A 1CULC 2HXSA 3THWB 2G0TA 3U2QA 3ZD6A 3NG1A 3IBYA 2BCJQ 1UEJA 1T3SA 2ODNA 2QPTA 4YONB 3SFZA 3EZ6A 4QBGB 3KKMA 2WIAA 3LY5A 3Q5EA 1A5TA 3BRWD 4YMSA 1UBEA 4KV9A 2ZITA 4GBMA 3PITA 4Q1CA 2O8FB 1HT1E 4TLBA 3OEED 3GLHB 3WBJA 2XOKA 5GJCA 2QTHA 3L0IB 1ZC4A 2Q0HA 2VHCA 1P3JA 3K9HA 521PA 5HCNA 1E2LA 1HQYE 4PHGA 3IPXA 3P26A 1HY3A 4KCGA 4BFSA 3EPHA 2PMKA 2YWEA 1VYUA 1Z22A 1KI6B 3ND8A 4KBGA 3S1AA 3FGNA 5CLQA 1XP8A 1KK3A 1R7RA 2VLIA 4ASUA 2FMXA 3A58B 3VMFA 4JYCA 4XVUA 1ZD1A 4QNMA 5JHHB 4IEEA 4PZYA 4V0KA 2J3EA 3GJXC 4B47A 4RD2A 4M8NE 1P2VA 1S96A 3EWSA 3HDTA 3TRFA 4ZI2A 3PEUA 1II0A 4C0AC 1E9FA 1K5GA 2LKDA 1PZNA 2P6UA 3ASZA 1LS6A 1M7HA 1U90A 1TEVA 2ANBA 2DWOA 1UFQA 3EARA 1NJGA 3EA5A 2C2HA 5BYKA 1ZIOA 5IRCD 4U7DA 4HB0A 1YQTA 2EFGA 3IPYA 3KJEA 3R8FA 3QXXA 1YE8A 4TZ6A 3RS4A 2OAQ1 4LJ7A 2BOVA 3ND9A 1W0KA 4RD1A 1G1MA 1YRBA 2ZR0A 4TMKA 4I1UA 1QBKC 4I1VA 3TW8B 4C0SA 4D80A 4E5UA 1AKYA 5FL7D 1Z2CA 4S2EA 2R65A 3GPLA 3SJCA 2MSCB 3H84A 3A1VA 4Q1EA 2QMUA 5L3RA 2ZI6A 1IONA 4GPTA 1IY0A 1JXMA 5KPDA 2KWIA 4OI1A 4DSTA 1JECA 2D74A 4Q1BA 1SVWA 4BZXA 2ZRHA 3FFAA 1U2RA 4G3XA 1XZPA 1I4LD 1N6HA 4JJZA 3ZZ0A 2ZM5A 3Q5DA 5BXQC 1AK2A 1D6JA 2AXPA 5C46F 4Q47A 2JLUA 3EZ2A 3FHOA 2GEUA 4Q9HA 1NSTA 4IRUB 4IOLA 1TMKA 2X1VA 2ZI7A 1ANKA 1E9BA 2A2ZA 3OF5A 4FW9A 3U7EB 1KO1A 4Q19A 4RFSB 3TE6A 3LW8A 3U44B 2P5SA 1GL7A 2O8EB 2BHRA 2AK3A 1BO6A 1JEDA 3TQFA 4Q1DA 3I5XA 2VP0A 1W48A 4B3XA 1DG3A 1OH7A 5C18A 4PHHA 3T34A 3ZJYA 4FCWA 3FTQA 1E4YA 4ARZA 4JLMA 3RRNA 3TIFA 1OB5A 4TT3D 4PFSA 2GVDC 2PH1A 3IEUA 3HPRA 5EQTA 5F2EA 1E94E 4Z8XA 2GEDA 2WHXA 3HJNA 3NVAA 4PQRA 4Y0AA 5KSYA 1Z8FA 2FA9A 1DVRA 4UJ3A 4NYMR 3AVQA 3PV0A 3U7FB 3TAUA 3AUYA 2J1LA 4DLYA 2VIIA 1P60A 2JA1A 3CNLA 3VTKA 3LVRE 1B23P 2FX3A 4H1VA 4AYWA 3CWQA 2KBFA 4R2HA 1OF1A 4YC7A 2W2XA 1LB1B 4OHYA 5GJWC 2F3RA 4TMVA 5B30A 2FU5C 3KUCA 4Q48A 4RD6A 4Q5IA 1IY1A 2JJ2A 3B9PA 4LBYA 4LV6A 1G5TA 2WOOA 4LJ8A 3MCAA 2OBMA 1F3OA 3FYHA 4AKIA 3RS5A 2PZGA 4GP6A 2ZSBA 3V9PA 2UZ3A 2VP6A 2QAGA 3EPJA 3NKVA 4URWR 1PLJA 3Q3JB 2ZRBA 2A5YB 2AK2A 2ZE8A 3LLMA 1KKMA 4MRSA 3GLHA 5JI2E 1FQKA 3QENA 2ZI4A 2ATXA 1XXHA 4LBZA 121PA 1D9XA 4D26A 3PVSA 4DLRA 3UG6A 2QGZA 3IKJA 5TARA 1NG9A 1Z0DA 4HAYA 2B21A 2F7SA 2QQ0A 2Z5FA 4FD2A 3TBKA 3SI7A 3Q85A 2F9MA 1MV5A 1HUQA 2ZAOA 2NO1A 2YKGA 2JJ2D 2GVZC 1D8TA 1S1MA 1MO3A 5KSPA 1N6LA 1FX0B 1ZUHA 2QMHA 3KKOA 3NIBA 2CL6X 1E2IA 1OSNA 5FUYA 4ESVA 1TL7C 1EGAA 1W4BA 3ZLJA 1T8UA 2R6GA 3I5YA 4IXNA 3OIWA 4D4JA 4DEYA 5FI1B 3VFDA 1UKEA 2X2FA 2ZUDA 4B75A 2GCOA 4CIDA 2IS2A 2O8CA 2REBA 1R5BA 1J8YF 1P9NA 3NWJA 4GMXA 4DCTA 5KO2A 2CVHA 2W6IA 4U00A 3QSYA 2OAP1 1E2GA 1NVXQ 4P4UA 4RFVA 3CRMA 4YDHB 1NP6A 3QKSA 4II7A 4ZCMA 1Q1QA 1E2HA 2FOLA 5FUXA 5TY0A 3VR3A 3D7MA 1G291 1FMJA 2CHVA 1NKSA 2FFQA 4B74A 5H8WA 3MUFA 2Z43A 2YHSA 1AS2A 4EIWA 3SR0A 2G77B 3ONWA 1CEEA 3OE7A 5HZHA 1Z6XA 5BW8A 2HEIA 4IEIA 4TQ9A 4EKDA 1Q0UA 4POAA 5JECA 2C9CA 3Q7QA 1KI9A 3U6KA 2NZ8A 1WP9A 4YMWA 3J81k 1BIFA 3RSLA 2ATVA 1FP6A 4C0LA 1FOEB 3KFVA 2QORA 1OHHD 4RVCA 2AN9A 1YHNA 4PXAA 3PEVA 4DVGA 2CJWA 2EWVA 1G3IA 3SEAA 2QUZA 4EJSB 2A5FA 1KMQA 3EAQA 3UMRA 1S3GA 1X1RA 1FPMA 4XD7A 4KITB 3E5HA 5FL7A 5KYKA 3EX7C 1XF9A 1M1YE 1R5NA 4OKSA 3UATA 1P62B 1XB2A 4KSBA 4YMTA 5TDHA 3PUYA 4N0EA 2F6RA 3AF1A 1E2MA 3GLFA 1G6OA 4MH0R 3V00A 3R9WA 2BWJA 1FW6A 3LDAA 4G5GA 4PC7A 2ECKA 4GFDA 2GTPA 5HZKA 3NDBB 3PR1A 3AV0B 3CONA 3BH6A 2VEDA 2P6NA 2GK6A 5FBLB 4YXWD 4O3MA 4RY2A 4LX0A 3MFYA 3QF4A 2IHBA 4IOMA 4DB2A 4LGMA 4C0BA 1X3SA 4AG5A 4JKYA 1KJZA 4RZ2A 2BCGY 2EW1A 2IYLD 2QGNA 3FWYA 3QPUA 1E9DA 4DDUA 4BPBA 3ZYCA 5CDFE 1U81A 2GZHA 2NO7A 2TMKA 1VIYA 1OIWA 1XZQA 1BKDR 3DHWC 4M0LA 1BYUA 5TVKA 5JWRA 4UNQA 1ZNZA 2W00A 4L8GA 3SJAA 3HR8A 1AS0A 3I72A 3K0AA 5H1YA 1LNZA 2JDIA 2XAUA 4PC1A 3QEOA 1ZU4A 4DDVA 1J8MF 2HT6A 5AWFC 1DAGA 4LJYA 2RB4A 5EUMA 2DR3A 2WM9B 3IUYA 1EFHA 1VYVA 4R7ZA 3OZXA 1G17A 1OH8A 1E98A 3CNOA 4KFRA 2OFOA 4JMPA 3CRW1 2A30A 1FTNA 4CT5A 2YC4C 1ZP6A 4Q9KA 2BMFA 5JS8A 3H4MA 4DLXA 1VG1A 4HAWA 3A4NA 3IEVA 5E7IA 2W6JA 1RW4A 4B2IA 1CRQA 1GITA 3NBYC 4FCTA 4GRAA 4MRVA 2IYTA 1G19A 2QMOA 2XB2A 4HATA 3FHCB 1XTSA 4BEBA 1G8GA 1VECA 4IFBA 1YZUA 5UKDA 5TV2A 4RD3A 1E1RD 2DHRA 4QGFA 4B2PA 3NBZC 1W0JA 1DG1G 1ELOA 3FDIA 1NN3A 4H9GA 3ZQ6A 1TU3A 1W2HA 2JCSA 3FKSD 1YZTA 5DI9A 3A4LA 1X1SA 5J47A 3O8DA 5FFMA 2BKEA 1II8B 1X86B 4EQ6A 2ZU0C 2Q3FA 2ZYTX 4PX9A 2WWYA 2JAQA 2OO7A 1COWD 4FMCB 5FOXA 3OFNA 4N3NA 2H17A 2REOA 2WKPA 2CL7X 1SXJD 1PJRA 3B82A 3PFIA 5E7JA 3GEIA 2YWHA 1S8FA 4DT1B 2MSEB 4GMDA 3IHLA 3NTUA 3RS7A 1SVKA 4FMBB 2Z83A 1I2MA 1X8JA 3RC3A 3VQTA 1IM2A 2D7DA 2XXAA 1DAKA 2ERYA 3AKDA 1DPFA 1KAOA 3GJ0A 1M7GA 3UKDA 4B71A 3CW2A 3SQWA 1Z08A 3LLUA 2W2TA 1XTIA 2QSYA 3K0EA 4KLNA 2EVWX 4Q00A 4EDHA 1XCMA 1VIAA 3KXKA 3D3QA 2R9VA 1HQCA 5ELXA 2Q6TA 2O0KA 5EXXA 3T12A 1CTQA 3A4MA 2UVQA 4J0QA 2IYVA 2WMNB 3JZMA 3WNDA 2PJRA 4B44A 3P20A 3LX5A 1Q57A 5JJLA 3VKHA 3TJZA 3X1WA 2VRWA 2J0SA 3KQUA 3D6TB 2FFBA 5EJEA 4TMZA 4DUGD 1YZLA 4PHTA 2P6RA 2F3TA 1N0UA 4RKFA 5KDOA 1S0UA 4M4SA 4WXRA 1TUIA 1G16A 1E2DA 3IHWA 1CLUA 3AGPA 4WZBE 4QBFA 5J4LA 3LX8A 3SNHA 2PX0A 4QJ5A 2CEAA 3DZ8A 1JJVA 3RSOA 5KDDA 4TMTA 2C9OA 2JLVA 5DLQC 2ZYVX 1SXJA 5HPYB 2QAGC 3WP0A 1L4UA 5CJPA 2O52A 3OFND 4AIIA 3A1TA 3SQXA 1G6HA 2P2LA 4UQOA 4KYIB 3BGWA 4RD4A 2JJ8A 2OCYC 1U94A 4QM7A 2XEXA 4Q9IA 1SVSA 1R8QA 2YC2C 2X8AA 3AVWA 1CJTC 3E70C 1OV4A 4F4IA 1EX6A 1O87A 1MO4A 2DCUA 4QXAA 4HUQA 1HV8A 1XFAA 2H8KA 4UXHA 4TWZA 1AA9A 4TMXA 4TN1A 4MKFA 4ZCLA 1OJLA 1D9ZA 4M1WA 1XTJA 5AJYA 3FMFA 3QKRB 1XWIA 5LDDC 2BDTA 4NP6A 1H8HA 4IOJA 1TPZA 1F60A 2IXFA 3BS4A 1ZD9A 2NMVA 4ABYA 2WWFA 3W5IA 3U3MA 2EFDB 2Z6VA 4DLVA 1NVUQ 621PA 1JBKA 2Q3MA 3W3AA 1WXQA 5KUTA 2VF7A 5H68A 4BFTA 3QPVA 4D4KA 1KNXA 1ZU5A 3AKCA 2QT1A 4OQXA 1E0JA 2QE7D 3QIAA 4DSUA 3BD9A 1VHTA 1E2KA 2HJVA 4LHXA 4OK6A 5TXGA 1E2PA 4C0JA 3VX4A 2N1BA 2R44A 2O8BB 3RRMA 1G3RA 221PA 4PC6A 4L5BA 1QG4A 3FVQA 1SQ5A 1CJUC 4AYXA 2QMEA 3T5GA 2AWNA 2L0XA 3BFXA 3LBHA 3GP8A 3KZ1E 4LYFA 1NLFA 1EFUA 1M8PA 1S3SA 4PZZA 4R2IA 3Q9LA 1R0WA 2GF9A 1ZNWA 5L3QB 1XMVA 4M9XA 2ZU6A 1OIXA 2QEQA 5A0FA 1CBUA 1VCMA 3MAAC 4XH9B 5TMPA 2XNDD 4A4DA 1NIPA 3BB1A 3QOFA 2FFAA 4XWKA 1BS1A 3AP1A 1KI7A 2YOFA 5C4GB 1OT3A 4JVLA 4MUBA 1QHNA 3ZGXA 3K8YA 1ZUNB 4YMUA 3WY9A 2J87A 4Q18A 3KJIA 3M0EA 2AX4A 1Z28A 2QP9X 2Z0MA 4V02A 1OYYA 1NVVQ 3BB3A 3BFVA 1GL6A 4NYIQ 2ZEJA 2CNWD 4BFYA 4IOKA 3UANA 3U61B 4FWTA 1IN4A 1N6RA 3KTAB 1OW3B 1R6BX 2RAPA 1G9XA 4IVPA 1GAJA 2QRNA 2PZFA 4NKRA 3BBPA 2BM1A 4W5WA 3MWKA 3U4QA 1CJKC 5LB2A 1OB2A 2A3RA 2OEPA 3SZRA 4Q4LA 5F98A 4ZKEA 1AN0A 4KBFA 2GWHA 3PCRB 1ZBDA 4TL9A 3C7KA 4M9QA 1VG9B 3E2IA 1NVWQ 3OE7D 5DH9A 1KY2A 2Z4RA 3LXXA 3SBDA 5EXSA 5AJWA 2IYZA 1CJMA 1NN5A 1E9RA 1MKYA 2C77A 1QHGA 1ZINA 2YOHA 1N0WA 3T35A 1A2KC 3TMKA 1KNQA 1TF5A 2ORWA 1ZW6A 1P75A 1ODFA 2IC5A 1UF9A 3O8RA 3TK1A 2XSZD 1W4AA 4JT4A 3CBQA 2YZ2A 4OHXA 2QROA 2WWXA 4GL2A 2J45A 4QC2A 1TNDA 2BMEA 2AL7A 2B8WA 3GLHE 4E03A 1LF0A 1PUJA 3M6AA 4C0KA 4EQ6B 2DYKA 1Q3TA 2ZYWX 1DADA 3C16C 3U60B 4V0ME 4FINA 1OXVA 2H7VA 2N42A 4OBEA 1JR6A 3CZQA 1KJWA 1F2UB 2V8OA 3X2SA 3K0CA 3OIYA 2HLDD 3CNNA 1XXHB 5DI3A 1TQ6A 5G40A 4G0NA 5SZIA 4KVAA 3G82C 3GMTA 1GIAA 2E1RA 3LFUA 1BOFA 1KK0A 2KB0A 3ZIAD 1NIJA 4KFTA 2QAGB 3VKGA 3SYKA 3W8RA 2IUTA 4BLSA 3FHTA 4DDTA 3R9IA 1Z06A 2IYYA 3BFKA 5JJIA 2IBMA 4A92A 2MMGA 4LJ9A 3BC1A 1FL9A 3GJ4A 2UKDA 3KKQA 4M1SA 4C0HA 1Z6AA 2CMKA 4P31A 4CVNA 4B35A 2I1QA 2G3YA 3PG5A 5KNBA 1W2GA 3QVVA 1YR8A 4IDPA 5CJ2A 1NMZA 1XDBA 1E2JA 4OI0A 1P72A 1PV4A 1JJ7A 4PZLA 3TVTA 1N5IA 3SFVA 4QGAA 3K0AB 2WWHA 3NC0C 2ZJ5A 3KXIA 2R6AA 3O8CA 3CIOA 1KHTA 1GFIA 2RCNA 4I99A 4RJLA 2J41A 3KXLA 1DBSA 1MR3F 1UDWA 3THXA 2X2EA 2WWGA 2G83A 3AB3A 2NO0A 1XRJA 3K1JA 3CUEF 2GAOA 4L9SA 1XCPA 4WBSA 2F1JA 4IDNA 5HKKA 2B92A 2CXXA 2QP3A 3NBXX 3G0HA 3HP1A 5P21A 3ZVMA 4LZZA 3K0FB 3PEWA 4RD0A 2ZSDA 1CP2A 4URZR 4UNPA 1MH1A 4B3FX 1R2QA 4TT3A 3B7GA 3GLFB 1SVLA 4AD8A 5DSZA 1KO5A 1U98A 2ZRLA 1GOTA 3SS8A 1YZQA 1ZMXA 5H70A 1YZKA 2DFNA 2XTZA 1P5ZB 3A37A 3CF2A 3REGA 5DYIA 2J5XA 5L3SB 1U0HC 5KSOA 1L2TA 1XEFA 1Q21A 4S35A 5G3YA 1TEXA 1IXSB 1E96A 1WQ1R 2IYUA 5FR2A 4DLTA 4CEHA 4QM6A 3T5DA 1IY2A 2REXB 3WBKA 2QNRA 3QQ5A 5FUVA 2ZRJA 1A2BA 2NZJA 1QHHA 2ZPTX 3QJYA 4Q7MB 2HYDA 5FI0B 4N0DA 4D4LA 5JSZB 1WA5A 3RYTC 2WJHA 3D31A 4B73A 1F48A 1SGWA 1XCGB 4OQMA 2FSGA 4D82A 1FP7A 1W4RA 5BN3A 5JMTA 1WMSA 3EIEA 2VSXA 3GEEA 3N2IA 4B43A 4DB4A 1E32A 3TUZC 1II9A 3RLFA 3I62A 1MRNA 4Z8YA 2H92A 1KOFA 1OE0A 1EWRA 2CK3A 4L16A 1TQ2A 2FF7A 5HE9A 1N5KA 1GWNA 1Q3HA 2ASEA 3QE0A 3LW7A 3V4RA 4A15A 4Q01A 1QVRA 3CX8A 3A6PC 2BV3A 3EPKA 1XNJA 1XTQA 3ZD7A 1EFTA 3TNFA 4ERNA 4W5HA 4A6XA 2W0MA 1VG0B 2ZROA 2FPLA 1DEKA 3ETLA 4BFVA 2H5EA 2FZLA 2OLJA 1TF2A 1SKYB 3W34A 4TLEA 4FIDA 3BWDD 4DIEA 1J99A 721PA 4HZUA 1D2EA 4DCNA 5CIWA 2CE2X 5DN6A 2ZIAA 2A5JA 3NHBA 4JLAA 3V4FA 3I92A 2CL0X 2O8FA 5DE3A 5KOYA 1ZM2A 3C8UA 2GJ8A 2FDCA 1AJEA 1ETUA 3H2YA 3VR6A 4NCJA 5DN6D 2GJSA 1CR0A 4LJ5A 4MQBA 4JLJA 4HUTA 5EE1A 1NRJB 1P73A 1CRPA 1YZNA 2OG2A 3PJRA 5E4FA 4B48A 1KAGA 4EPXA 3GJ3A 4HI0E 2XOKD 2PX3A 4KVGA 1N0VC 2CLDX 2WSMA 1KIMA 1GKUB 4MUAA 1NLZA 4CDGA 1XJCA 1G7TA 2RHMA 3GLGE 2QSZA 4NYIR 4EPWA 2BJWA 1ZYUA 3MMPA 3KJHA 2CVFA 4GZMA 3EZ7A 4V03A 4P33A 2BMDA 4QBHA 2VBCA 2BKUA 4DLWA 2ZSEA 3I3SR 4JVNA 2IYXA 5GVRA 4DCUA 5JSZA 1FNNA 3ZH9B 1QHHB 1Z29A 3DKPA 2J46A 2NPIA 2WTUA 1G7CA 3QKUA 5EP4A 3LNCA 1HTWA 3TR0A 1W36D 1DAIA 2AHOA 3K9NA 1U8AA 4LDJA 1DARA 2DFKB 1RJ9B 1RYHA 1V43A 2BEKA 3MLEA 3LH5A 4QFMA 5G41A 3VX3A 3KKPA 1SVOA 2FZ4A 2WOJA 4AYTA 5L3SA 2ONKA 2CLCX 2GXUA 2DWPA 2O0HA 2Q9AA 1KO4A 3ADKA 4R9UC 5CK4A 3DZDA 2AFIE 5FH9A 3RVBA 4XVQA 4AY2A 1E0SA 1TADA 4F91B 1CJVC 3R7WA 3IIJA 2IX3A 2O5VA 2H1LA 2FSHA 4TLDA 4ARZB 2ZVPX 1IN6A 2XX3A 2DFTA 3FMOB 1KYIA 4NU0A 3QXSA 3HYRA 1A82A 3B1ZA 4JL8A 3BJIC 5D3QA 4CEHB 4Q03A 5C1BA 4M1MA 1NF3A 2EFEB 4LV8B 5AJVB 5BWMA 4G5RA 4UKDA 2G9NA 2R6FA 3T06B 5L3QA 1XD8A 2LCFA 2ZJ8A 1FZQA 2OT3B 3W90A 2RGCA 1G8HA 2FFHA 4JLNA 4OHWA 1H8EA 2OCPA 3L8YA 3UPUA 1GP2A 5KTYA 4RZUA 5DHFA 5EZ6B 2QP4A 3AKEA 3R7WB 3RNLA 3W5JA 1EWQA 4TL8A 2OBNA 1S9DA 4TTQA 3X1YA 4B6FA 4C30A 3AVVA 3SJZA 3EASA 1JPNA 5D3MB 3A8TA 2PEYA 4GP7A 4M2LA 4O2LA 5JWHA 4TLCA 2C04A 5HTKA 2AD5A 4C2UA 2FSIA 4NCNA 2C78A 2J0QA 1YR6A 2WZQA 3ZVLA 1XJ0A 1UKYA 1CKEA 3TR5A 1K6MA 1NSFA 5AUNB 3KQNA 3DM5A 1LF5A 1W4CA 4WIAA 4NDZA 3RC8A 4I1OA 1CR2A 2PBRA 1G3MA 1P2SA 4KI0A 3T1QA 5JWOA 4AKEA 1Q44A 3NEYA 1G3QA 2GRJA 3AVXA 3NH6A 4HAXA 4U02A 2Q9CA 2MSDB 4HLUA 5J4VA 4XSGA 1OFHA 4NHOA 3A36A 1W47A 4LCBA 2ZRCA 2JIZA 4LI0A 2V9PA 2QA5A 4GZLA 4K46A 1QG2A 1SXJE 4MYHA 3W3ZB 3R8CA 4XTRA 2Q9BA 4KFUA 3A1SA 4CYMA 2XTNA 3REFA 5FTJA 3LQQA 4TTRA 1Z07A 5LB4A 4QHSA 3U3JA 3GD7A 4BLPA 2DFLA 3CZPA 5F9FA 3PUZA 4P3YA 4Q1AA 2RMKA 3I73A 2UZIR 3B85A 4URXR 5E7MA 2GESA 3ZIAA 2ZUCA 1RC8A 1GNRA 2QENA 2ZE6A 5JEDA 4MKIA 5FPHA 5JI3E 1N6NA 1SXJB 2CBZA 4MGKR 2NTYC 1UEIA 4LHYA 2IS6A 1XD9A 3T1VA 1M74A 2VF8A 4OYHA 2YWGA 1F2UA 4PANA 1AZSC 1OXXK 4YMVA 1G5PA 4HZUB 5CB6A 5DIFA 2R6CA 1JNYA 4UXJA 4L4UA 1JAIA 4LHWA 2JLXA 2ZANA 3F8TA 1Z5ZA 4A82A 4ACBA 1ZCAA 4W5JA 5FL3A 4PTLA 2VQSA 3EIHA 1KZGB 1Q20A 5B2ZA 3THWA 1R0ZA 4G1UC 3QVUA 2GZAA 3LXRA 3ICEA 3RHFA 3F5FA 5K8UA 1OLOA 2WPDD 3QKTA 3WMGA 1KI2A 3U4QB 1WB9A 4KJZA 3AF3A 3WYFA 2IF2A 3X1DA 4JL6A 1EK0A 1P2UA 4JJKA 2ZR9A 4EFLA 3DKVA 1KSFX 3GLGA 3ADDA 1U0JA 2QPAA 1H65A 1KGDA 2VHQA 3KTAA 3RS3A 5SZKB 3B78A 4GSYA 3AVOA 2PT5A 5FBWB 2XXAB 2CNWA 2JLRA 2MMCA 1WDTA 4IDOA 4PO1A 3K09A 4IW3B 4CEJB 1ZC3A 2GJKA 1L4YA 2IYWA 1KO7A 1UBFA 3AM1A 4D0GA 4PR0A 1W44A 1EXMA 4H1UA 3E1SA 1EFRA 4IHQA 3K70D 3P4YA 4LHZA 4DCVA 2XNDA 3CM0A 4EFNA 2V7QD 2FN4A 2XNSA 4JYBA 4FMDF 1QVAA 3CO5A 2D4HA 1XMIA 2OHFA 2QQEA 2NOAA 1J2JA 1LS1A 1GRQA 2ZETA 2JLZA 2VO1A 3ADCA 2RH5A 1HEIA 4B32A 4D0LB 3VR4A 2QAJA 3I1FA 2BIFA 3U6BA 1GKYA 3K70B 2CCKA 1AGRA 2VHTA 4TMWA 2ODWA 3K9LA 3P27A 2WJIA 3NBFA 1U9IC 2EYQA 3LBIA 4ITRC 4K81B 4Q4JA 1YR7A 3KJGA 4V0NA 1DTSA 2IHYA 1G5RA 2W2VA 1NKTA 4GI7A 4AKGA 3FPAA 3HPQA 1G64A 3DO6A 4IVRA 4KXFB 2FEOA 2PMDA 4NZYA 3CX6A 1XEXA 4HAZA 3WMFA 4DHEA 4PAQA 3AF2A 2RGAA 421PA 5DNYB 4CEIA 4GDFA 3THXB 2F9LA 2GK7A 1PVOA 2OM2A 1OFIA 3RWOA 1E79D 1K5DA 1NBMA 3K09C 4B3DA 1Z6TA 2V4ZA 2O8BA 3PEYA 3H86A 3QKRA 1H8HD 2Z4SA 2ZJOA 2QE7A 5JLJA 1WRBA 1T4GA 4M22A 3BH7A 2HT1A 821PA 2VA8A 2XTMA 2QTVB 1HT2E 4IJMA 3U5ZB 4CEIB 3Q7PA 3GCGA 5FOWA 1VDZA 2BVNA 4BLQA 4M9SA 5FTLA 5FTNA 2B7BA 2ZRPA 3K0CC 2JLSA 4AI6A 1JPJA 2OZEA 1MABB 4V0MA 3IO5A 4Z51A 4M1YA 2IEZA 4E07A 1L8QA 2HDNB 4PC3A 1JQJC 4HB2A 3DMDA 1Z63A 3TLXA 1Y63A 1T5LA 3N70A 2LWIA 1X6VA 1U8YA 3QXCA 4TSFA 2RGXA 5FTKA 5KPJA 5LD2C 4O0MA 1VKJA 2ZJ2A 2CHQA 4EAQA 1DO0A 4HLCA 4QNRA 3P32A 1ESNA 4AURA 2ZJYA 2ZRDA 3ZQJA 1TU4A 2VL7A 1E0KA 3SJBA 1SHKA 2A5DA 3U7GA 4OJQA 4JBWA 2A5GA 2F1HA 2BBOA 2X77A 4A0GA 4Q7KA 4BECA 3O47A 1NLYA 3K53A 4B2LA 2CJWB 3KL4A 2EQBA 2I3BA 2C9YA 4NPHA 2FGJA 5BYJA 4DUGA 5CB8A 2H16A 2ONJA 3I8SA 3TH5A 4MDFA 3ICQB 2JGNA 1EFCA 3MJHA 4PSKA 3MJRA 4LJ4A 4HDCA 5JCPA 2PEZA 2DBYA 2QU8A 1E9AA 1G8PA 2OXCA 2FE4A 3SC3A 4BFXA 4XOIA 2WMOB 1NJFA 4V0OA 5IT5A 4IKEA 4HLQB 3VU9A 2K5UA 1V5WA 1N5JA 3FB4A 3WYGA 2IWHA 3T1TA 4IFEA 2D3WA 3B2EA 1D5CA 4RZ3A 1BH2A 2EYUA 3SYNA 3MRSA 3GLIB 3AVTA 4C7OA 2ERXA 3QKSB 1AQYA 5EE3A 2HF8A 2YVUA 1AS3A 2G6BA 5JEEA 3IQXA 3LA6A 1AGPA 1RZ3A 1DS6A 5AJXA 4ESHA 5K8IA 1EX7A 3B60A 4MITA 2IK8A 1CR4A 2G0NA 2GCOB 5J4KA 1COWA 2A78A 3FFBA 2R2AA 4ZPXA 3CF6R 2R8RA 1XMJA 1GILA 3N5CA 5BN4A 4OHZA 1VHLA 1Z2AA 3CH5A 1Q1BA 3AEZA 4OQNA 3TSOA 4A0HA 1Q22A 3GLIE 3WNBA 1XTKA 2WKQA 4ZO4A 4K8OA 1W0JD 4DT1A 5J40A 4UNRA 1LTQA 4HSEA 1AKEA 1R5OA 4JVMA 4PSVA 4TSFD 2G1KA 3TSWA 1KSHA 4M21A 2VP4A 2WJYA 1U99A 1W36C 1YRAA 1DAHA 2QM7A 3CX7A 5HCIA 4NH0A 1II8A 1KK1A 5JS7A 1I2DA 1W7AA 3HR7A 4DEXA 5J4YA 3D8BA 4HDQB 4LPKA 3FKSA 4DBLC 4LPSA 1YKSA 4B3GA 1IJEA 1TX4B 3W6OA 5J5CA 2NO9A 3B1VA 4BLTA 5JFGA 1E1RA 1VYTA 2GA8A 5JJKA 4KYUA 4LUCA 4DJTA 1N25A 4QL3A 2AKAB 1MOZA 3QG1A 4HLDA 4QOSA 5CM8B 4BFWA 3AP2A 1RRFA 2JDID 2VPPA 3LV8A 2JLYA 2WVJA 4DZZA 2W6JD 4D0NA 1MABA 4BZQA 1G4AE 4E22A 4OK3A 1NBMD 1SXJC 2PL3A 1GNQA 1Z3IX 1ZM3A 4F38A 3CPHA 5AUPB 3AVPA 1JAHA 2ZR7A 3GJ6A 5K8LA 4LYAA 3KB2A 2YINC 4MKGA 3WXMA 3QY0A 3Q8XB 5FTMA 2HJGA 2ZAMA 4HB4A 2BJVA 1NN0A 3QF4B 1R0YA 1M34E 2F1IA 3C5CA 4BFUA 4WW0A 1J90A 1MO6A 4NCHA 1IXRC 1CIPA 2C98A 5D3MA 2IW3A 4YDSA 4DIDA 2P65A 4HUQB 5L8VA 4A9AA 4JT2A 4TYYA 2I4IA 5E95A 4QRHA 1ZRHA 4JBYA 1LW7A 4A0RA 1TQ4A 4JL5A 1ZM7A 3OHMA 3RAPR 4TYWA 3KQLA 4AKHA 3CB4A 3H0KA 1D2MA 2BM0A 4G5QA 5LPNA 2NPFA 2ODBA 2ZJZA 4YXWA 1QZXA 2WKRA 3K70C 1IN5A 1QHIA 4A0FA 3TGPA 2JLQA 3B13B 3U44A 1RFLA 1DELA 2JJ1D 2V7QA 3HWSA 4Q4JB 4QGGA 5G53C 1ZM4A 3NDPA 4KODA 1KMHB 5CITA 1XPUA 2QN6A 4JZKA 1EFRD 3AF0A 4MRNA 1OHHA 4DLZA 2DWQA 1WCV1 4A8JC 2ZVQX 1US8A 3GQBA 4DWJA 1KSJA 2C99A 2EU8A 4XD7D 4UNSA 3BOSA 4LYHA 4MGYR 3QUSA 3UMSA 3TUIC 5JRJA 2V1UA 1S9HA 3CPJB 1OKKA 2FEMA 4EJSA 1NY6A 4OI2A 1F2TA 2VHUA 5DISB 2WJJA 2P5TB 1UJ2A 1QF9A 3IIKA 2WSSD 5E3HA 3BK7A 1EESA 3WNCA 2KJQA 1Y3AA 2ZI5A 4OI4A 4XSHA 5KNCA 1N6OA 1Z83A 2P0EA 4CEJA 4LY6A 4EPRA 4M1OA 4ZKDA 2FJUA 2IA5A 4PQFA 3RS0A 2NQ2C 3SHFA 4F92B 1FUKA 2J59A 4Q9LA 1W49A 2WV9A 5CK5A 2ZRKA 4JVSB 3R20A 3U3KA 4F4CA 2YOGA 2YYZA 3PQCA 4PO9A 1OFUX 5AR1A 3GLGB 3WYAA 5EP1A 3L8ZA 1T5IA 5CLLA 4BEJA 4OQLA 4BZPA 1KI1A 1CS4C 5JRZA 1F6BA 2RHDA 3ZS9A 2ZRGA 4JIMA 5LD2B 4M9ZA 2KE5A 2W6ID 2ZTSA 1Q1ZA 2KI5A 2VSFA 3UG7A 4MRRA 4TLAA 3EXAA 2X19A 3EG5A 3QEJA 2G1JA 1XU4A 2ZXUA 1RE0A 5GJVC 1EG7A 3DDCA 4D81A 1FUUA 4FN5A 4LHVA 5F9HA 4CF7A 1HURA 1QRAA 3QNUA 5JCZA 4O25A 5AUQA 5JZVA 1AIPA 2QY9A 5EZ5A 3MGCA 3SDZA 5K8TA 4JSYA 1T8TA 1ZNXA 1E2NA 2EWWA 3LBNA 4UJ5A 4Z1MD 2FWRA 3TAHA 4JLOA 3B1YA 5GJBA 4R71A 3THYA 2WWIA 4G5SA 2YWFA 3THYB 3VAAA 3DMNA 3IO3A 3ZVNA 3AH8A 4TQUS 4DSOA 1E2EA 2OCAA 1T3LA 4URUR 5KNDA 4G5OA 2OCBA 6Q21A 4PC2A 3SOPA 1E69A 3QI2A 2GZDA 2JIZD 5FBRB 3QG5A 4MA4A 4JLVA 1IJFA 2XB4A 3OESA 3KKNA 1Q12A 1OH6A 3X1ZA 4C9BA 3L0PA 4MKHA 1N6IA 3PUXA 4MRPA 5LBIA 4DLUA 4ZDIA 1P9WA 2F43A 1Z0KA 1C1YA 3GEHA 1G7RA 4LBWA 4RCYA 3TVDA 4EPYA 2HF9A 1WBBA 3C4JA 2A9KA 1SHZA 4B33A 1C4OA 2OE2A 3NHAA 2GDJA 5FR1A 3CRQA 1GZSA 1KY3A 4Z1MA 1NNEA 3M1IA 1J70A 2Q21A 4W7SA 1W36B 1OIVA 1NVVR 2VSOA 5J4HA 1E2QA 1Q1EA 2B7CA 2DY1A 2E87A 3EZFA 4KHZA 4DRZA 1VCOA 2NIPA 2QI9C 4B3CA 4PO8A 3SE0A 1D2NA 1Z0AA 5JHGB 2SHKA 1NY5A 2ZUBA 4HAVA 3DVLA 3QXHA 1XBTA 4F4JA 3VR2A 1PLLA 3B1WA 2GCNA 2HUPA 1BYIA 2YNMA 4OQFA 4D25A 2D2EA 3CPEA 2OXRA 2Y8EA 1E4VA 3KB1A 4M1KA 2IYRA 1SZPA 3FKQA 4O2RA 2O8EA 2AD1A 1FQJA 1G3UA 1R0XA 4EUNA 1NN1A 1HH4A 1TUEA 4FMDB 1HYQA 2PCLA 2G88A 1I4DD 2QPOA 2HCBA 3HU3A 4TL7A 5IF9A 4P4SA 2IT1A 4ACAA 3W6NA 4A8JA 1TTTA 2GF0A 1QHSA 5F3WB 3QXJA 3BIFA 5EXTA 2RGDA 2GXSA 4US1R 1OFTA 1DAFA 1KMHA 2WSSA 1LY1A 3CRRA 3EPLA 3MSXA 4C0QC 1XD2B 3VKWA 3EC2A 3K0FA 1I4TD 4LRWA 3EIQA 2XZOA 1OKKD 1A4RA 4A36A 2EFCB 5KHOC 4NCIA 3SU8A 3B8HA 4LWZA 5SZJA 2V3CC 4M53A 1E6CA 3T1OA 2N46A 1GUAA 3I32A 4I1SA 2NGRA 1OPXA 4JKIA 3SN6A 3WP1B 1DE0A 2GILA 2O0JA 4MYTA 3UK6A 4A8JB 1FNMA 5C4MA 2W0SA 4P4SB 1OXSC 2AFHE 1S2MA 3C15C 3TUJC 4TYNA 4Q9JA 1GKIA 1RVDA 2WICA 5M04A 3FE2A 1RKBA 1KDTA 2JJ1A 2J0UA 4BLOA 2KSQA 1G21E 4DC9A 5AUOB 1IAQA 1RJ9A 5B64A 3THOA 3UWKA 5KU1A 1DAMA 2WIBA 3AUXA 2ODEA 2QL6A 3IGFA 4FXPA 1J7KA 1Z6GA 2GBLC 1O3YA 1DO2A 1W0KD 4XIGS 1QDEA 4E09A 4NTZA 2ORVA 2GJAA 5BN5A 1G8YA 4WAUA 4TYPA 4HB3A 3T15A 4NCKA 5CYPA 5L3VA 2B8TA 4QGHA 1G18A 5DHAA 5IHPA 3R9XA 3DOEA 4X8LA 3GFPA 1KI6A 4ASUD 1W46A 5A5GA 3BE4A 4IXMA 1JXOA 4Q21A 3DEFA 3OIVA 3BB4A 4LJAA 3L0OA 2JLWA 1FX0A 4BASA 2IXGA 2JATA 4MYUA 1N2CE 2V54A 2YV5A 4IDQA 1GDDA 5AJZA 4DXAA 4EFMA 4A2PA 2F43B 3I4LA 4LBVA 4BLRA 1ZJ6A 1W5SA 1HE8B 3ZS8A 1IXZA 2H57A 1P9RA 1VG8A 2RGNC 3RABA 4WZAE 4Q1FA 3S1AB 4YQFA 2ZE7A 3F3YA 4ZI3A 4GNKA 4URYR 1ZM9A 2C5LA 4A2WA 4CT4B 2CCGA 2WWWA 2IUSA 2BEJA 3LVQE 5EE5B 5CYOA 4BRUA 1N6KA 4B34A 3OEEA 2ZE5A 3ZDQA 2IXEA 3DOFA 4JSTA 2JEOA 2XGJA 4KO8A 3PIRA 1DOAA 2FPKA 4C4PA 1TF7A 4WOPA 4HYYA 3HU1A 4WVFA 1AZTA 3M4YA 4TQAA 1A7JA 2CK3D 4XWAA 1M2OB 3SHWA 1WF3A 3IBGA 2PZEA 4DDWA 1K8RA 1RYFA 1M7BA 4Q4HB 1P2TA 3C5HA 2ZSFA 1RRGA 2IWRA 2V55B 2F1RA 2WJVA 4CRWB 5B57C 4Q66C 3ECCA 3UIEA 4AC9A 4A2QA 5KSZA 2FPMA 1TAGA 4B3BA 2PLFA 3U7HB 3KQHA 2ZI9A 2ZS8A 2GJ9A 2J7PA
chains in the Genus database with same CATH superfamily
1GSIA 1RKXA 5GVSA 1E9SA 2XB9A 1U2GA 3MBKA 2OBLA 3HSSA 1UM8A 4JODA 4MHSA 3GYGA 4OHRA 1ZCBA 5DK4A 2OXFA 2PKYX 2JFNA 2RFLA 2FGKA 1S1CA 1XHFA 3FOZA 3NXSA 3PI7A 5IKXA 3OO1A 1KZ9A 1C0LA 1FTWA 2HJRA 3CUTA 1LI5A 5C2JB 2FH5B 2KBEA 1KPGA 3WA7A 3FI0A 2FE1A 4G67A 3WRXC 1F2TB 3OU6A 4EPVA 1NMYA 3N2ZB 3OM9A 4EI9A 3IUQA 4QECA 2F00A 3N2EA 2Z5LA 3W6PA 2NVOA 1S7CA 2QD4A 1JQ5A 2RK6A 4JYMA 5SICE 1Y8QA 4R68A 1W1IA 4M1TA 5HKKD 1Z4PX 2IXBA 3LUAA 5ALOA 3UAOA 3VR5A 5HE8A 1OXUA 3X1XA 1K6IA 3GQBB 2J9ZB 1US8B 2XRFA 2B1QA 1TYCA 2IGTA 1X7YB 3ILVA 4PLHA 4B2YA 5A5DA 1LRKA 1NUUA 2FNAA 3RJTA 1Q7BA 3BHNA 4OHOA 4Z4EA 1E9CA 3WLLA 4EL0A 1ULTA 5A3RA 1R0SA 4LC9A 4NOMA 3WKDA 3ZOKA 2DM6A 3PFCA 4N54A 3CSUA 4FHDA 1XR3A 3JVEA 4DWWA 2DBQA 3DT9A 3SIWA 2GN4A 3RRYA 1ZGJA 4Z2YA 5CHYA 3WFJA 1T4DA 4MYCA 5DP2A 3PDWA 2PPLA 3L5KA 3O31A 4HEHA 1AB6A 2GGSA 3BCSA 4FCVA 4ND6A 3RU9A 2JFWA 2J9YB 2X1HA 1I4EB 1KFJB 3EXIA 3O84A 4G1MB 4M1EA 4JOBA 4NSNA 5BOSA 2WJPA 1UR5A 1Z8DA 3Q9NA 5IYZB 3AEKB 2XQJA 2Q4DA 5H0IA 1BDHA 1N6PA 5U4QA 3Q40A 3U39A 2PO7A 3QTBA 1DZ3A 3K71B 2J33A 3KR2A 3MG9A 2FUG1 4AMGA 1IN8A 3WGQA 1ZN7A 1EDBA 3QX7A 4D2IA 4GT1A 2VUUA 2ZW9A 5BR8B 1PLKA 4CFSA 3O4FA 2WJGA 2F3PA 2WBLC 1HLFA 1G59A 2LDXA 3FNIA 1PKEA 4LJ6A 1NW7A 4FFNA 4XVCA 1O94C 3CR8A 1WY5A 3GLKA 1C7IA 4FZRA 1S7GA 4A16A 4ZYXA 3OKCA 5CG2A 3BH0A 4YAIA 1VL2A 4JLBA 3Q6NA 3N7AA 2R6JA 2FWBA 2OCGA 5IDQA 1BRTA 1C9KA 2HCJB 3T5CA 3RVMA 4JLPA 5ALIA 1Z36A 2XPCA 3RTBA 3ZD8A 4O2BB 5FORA 1UDCA 2QTTA 1BE8A 2CLHB 5CURA 1WZIA 4FGUA 4XFDA 2Q6VA 3LUHA 1OXTA 3AGQA 3COYA 4BB6A 1GG2A 4TM7A 1PNRA 1I32A 4X8OA 2FOIA 3G5UA 1QFJA 4E15A 4DV6B 3T3NA 1WQ4A 1XL0A 4A6PA 2VHVA 4AK9A 2BEWB 1KSGA 1C7ZA 4MARA 1F1JA 4RHYA 3N0WA 3VJKA 1Z47A 2O2XA 5KOJA 1NYLA 5FBVB 3BCHA 1YACA 2PWZA 2X58A 5F4BA 2YXLA 4QBIA 4IQ0A 4G8DA 4M76B 2REQA 3F5QA 4ERXA 4NULA 3I52A 3ID6C 5ALHA 4ND4A 3MRTA 4IHJF 3PFFA 3A3KA 4ZIRB 1U0LA 2XYHA 1XPRA 2I9KA 2CVQA 4F86A 3VR4D 2B8NA 1XXHE 4KQXA 3ZDRA 1I3OA 4UUPA 4GX1A 3IAHA 2CFTA 2I4TA 3B6EA 2OLKA 2PGIA 4GZ5A 2X0IA 3UV6A 5SZHB 1QIDA 4EFLA 3QYAA 9LDTA 2ANCA 1PJ4A 1JV2B 4KJXA 2HAEA 5JQGB 2OORC 1KEKA 1B8UA 4FFBA 1T9BA 1SBIA 1U7XA 5ITWA 4R40A 3QLUA 5D51S 2BKVA 4RTSA 2QX4A 2FUCA 3B51X 3BERA 2ENWA 3LCCA 4C2TA 2NU7B 2C5SA 4JBXA 1L8LA 3ESQA 4LC0A 5F1OA 4AWXA 2NP7A 3H9UA 1XMXA 3HA3A 4WKCA 3Q3HA 5GADl 1DFHA 1UC8A 3C85A 3ORQA 4HH4A 3K0HA 1Y5RA 1LKZA 2P77A 3D0KA 3GJQA 1KI8A 4I81A 2X0JA 5EZSA 3V1TC 1N2SA 3NBKA 3QFRA 3TW4A 3MMSA 4CMEC 3PENA 1ESEA 4OBXA 4HH0A 3UMGA 1TTHA 4UFNA 1XMSA 2GM4A 1CU1A 1JQEA 1RPZA 4TTJA 4FYXA 2OESA 3E81A 4PVCA 4ES6A 4F84A 2ZJAA 2FPRA 3ESXA 3D5TA 2Q8QA 2WIFA 3U3RA 4MWDA 3KFLA 4I1PA 2B6NA 4AWAA 1LRLA 1ZMTA 5D3ZA 3IS3A 2GNAA 2C88A 5IK2D 1U7HA 3OY2A 3PIIA 4I8XA 3QBTA 4UD2A 2OV2A 1HE1C 4XWOA 1AQIA 5AW5A 1LSUA 2P67A 2HA6A 1GGKA 2I9PA 2GZRA 2VNAA 3C4VA 4JEHA 4O8CA 4Q4AB 4YRFA 3L7NA 3ZE6A 1UBGA 2UVDA 1P29A 2IJGX 1H1TA 3I6YA 3PR3A 4FC7A 1EFDN 4AJEA 3GJ5A 2ORIA 4BFLA 1JAXA 4X6UA 3L1JA 3K2IA 4I7EA 3UWDA 1W5TA 3WYEA 5K8VA 1PBNA 2HXYA 2GXAA 1VIDA 1GZDA 4DANA 3OT4A 2NV2B 1I3MA 4O2BA 3G1WA 4O4IA 3C41J 4GOKA 4BFCA 4PIMA 4A1FA 2V6JA 4EY7A 3TKYA 2IEBA 1VMAA 5AW7A 1T9KA 2Q3BA 4UAVA 2CMGA 4NBNA 5JSQA 3BORA 3U0VA 4BUZA 2HYIC 1I2ZA 1GNPA 3F3KA 3QU7A 2ID9A 1VB5A 4XKJA 2DPXA 1OZ0A 2O8DB 1DU4A 2GO1A 3ZV3A 3LO5A 2IEYA 2OD7A 4WMLA 3IRVA 3ZE2B 4LEIA 1DQSA 2A7XA 4CV2A 3W2GA 3DD5A 3ER9A 3L1UA 2FRXA 3QOYA 3S70A 4BLVA 2PRJA 2Z3ZA 3KSZO 4I4LA 4KFSA 2X0DA 1WCXA 5AUPB 1K6XA 2J0VA 1LX7A 1U5AA 3JAMA 2ZUEA 4RWZA 5AK5A 2AG5A 3SXUA 3L5OA 4PQYA 2YJ3A 4NE2A 4IIXA 4I4TB 1KH2A 3FNHA 5JQWA 1BW9A 4EATA 3L05A 4Z0PA 2VLBA 4UW9A 3VZQA 3UXHA 2FFJA 3UT5B 4URVR 4D4MA 1SHTX 3TOZA 5KTNA 4ZI7F 2JK1A 2NO6A 4K6HA 1E3LA 2P3LA 4Y9TA 1JMVA 1L8AA 4BQSA 3C48A 4DAOA 3KQTA 2LKCA 3WRYC 2RGUA 4JD5A 5J59A 3FNEA 1O54A 2VH5R 5GGXA 1ISFA 2IYSA 2C94A 3OOSA 1JR3D 4X7RA 4MUFA 4UQLA 2PJZA 2Q4EA 3DONA 5CIQA 5IG2A 1TJNA 3GZ4A 3GRRA 2JFXA 1D6NA 4EWLA 5EMJA 3HL0A 4OATA 1Q0TA 1J09A 4G1VA 2XZPA 5EWLA 1M2GA 1A2OA 3F7OA 1U3CA 1XU9A 1GPYA 2JFFA 4CF6A 2ILTA 4EQZA 2BBTA 4QARA 1J2UA 3L6OO 1PHRA 2O7RA 3M6UA 2QN7A 4OMDA 5FPSA 3VNVA 5AHWA 3O92A 4HDAA 4G0MA 1Q1AA 1L4MA 4HFNA 2VTKA 5EXEA 4DR7B 2GAAA 2GZMA 4B9AA 2CNOA 2DH6A 1QIHA 5D1NA 2BF7A 3KLMX 5EEGA 1L6IA 2GZ3A 3MWLA 1BMFD 2RBEA 3EW7A 2B5OA 4IX9A 1YD7A 4M8LA 4A7PA 4B76A 2WF9A 3CKLA 1XD2A 1XYVA 4BKMA 8MHTA 1J42A 5DEOA 2AOXA 2NQTA 3HYTA 1FSPA 5IMSA 1GTVA 1JQLB 3TLBA 1IOZA 1NI3A 3D59A 8OHMA 5JC8A 1W1WA 1E1QD 4ZARA 5THKA 4UBNA 5GIPE 5EI5A 5C7YA 3HN7A 3EC1A 3QPWA 4IIEA 1G2PA 4S1OA 1RLOA 1UKZA 1YBAA 1C1XB 2RKOA 1U02A 2X42A 2ZRAA 3NHYA 1P2GA 4LC1A 2IOQA 4Q6WA 1EVZA 3ISJA 4CR8A 3AUJB 4OHVA 3AF5A 2Z1MA 5AW3A 4P7BA 5EMKA 2CHGA 3EFBA 3CVXA 3EWAA 4YP0A 1XZMA 2ZJ4A 3SR4A 2VWGA 5FD8A 2QLFA 4GOMD 4Z9BA 1FMLA 5J2UF 3D5EA 3IOEA 3HDHA 3WKAA 3O83A 4BWYA 1WNFA 4J2OA 4U2BA 3I1IA 5M34A 1N3LA 1RRPA 3VNUA 4HDRB 3A3PA 5HK8A 4OGLA 1C0EA 1OYWA 4RVSA 4IDGA 1KK2A 1J06A 2DTEA 3DVRX 3HKBA 3IEIA 4H7IA 4QEDA 3S1LA 4RDXA 4BGDA 4GIBA 2PCJA 5LKRA 3KEOA 4Q4HA 1SNYA 3WQSB 1JTEA 2H4HA 2JJMA 4ZV7A 3GJ8A 2Q4BA 3VZBA 3NI2A 2O8CB 5FV4A 5EUQB 1Y9ZA 1ZJ4A 1E0AA 1CR1A 1C30A 1QHXA 2OBXA 2OHVA 3KU1A 4JJAA 1B7GO 2PS0A 2CDBA 1GRRA 2DHEA 2GPBA 2ZYDA 3FVTA 4PHFA 5FOVA 1E9EA 3AFIA 5DBHX 3D0RA 3H1PA 5HIMA 4FEEA 3VJMA 3AM4A 1J8QA 3C6KA 4WOBA 1G7SA 3HA5A 2C03A 4Q7JB 3VR4H 4K8RB 4YK7A 3QYFA 1JFRA 3C4QA 4MVJM 3DQQA 1XKQA 3AXSA 4JLKA 9ABPA 4AXBA 1O7JA 2Q50A 1DQYA 3P9IA 3PUIA 3ZD6A 3HCOA 4OOFA 3UAVA 1ZN9A 4ZOBA 2C92A 4BTVA 2F62A 1RHJA 3VOTA 2HO5A 3JWGA 3HYLA 4UHCA 2Z3WA 3KDPA 3EZ6A 4YAWA 3KKMA 5DBEX 1EJ2A 4JQOA 9MHTA 3BRWD 2QRKA 4JYPA 3QFCA 1R4MA 3IR5A 4KV9A 3DS8A 4GBMA 3E22B 1BXKA 5I9MA 3PITA 2X4LA 3CBGA 3K94A 4Q1CA 4ENVA 1DSSG 3OPQA 4TLBA 3GLHB 3QMWA 2QRMA 3L0IB 3STXA 1ZC4A 3P2OA 1VA5A 2HZ7A 3GT3A 3TRHA 1P3DA 521PA 5HCNA 1E2LA 1HQYE 1BU5A 1NI4B 2F48A 2WSLA 3ACBA 4HGZA 4YUYA 3P26A 5IXSA 2XGMA 1KP3A 4KCGA 4MCHA 4FYIA 3ND8A 3NGMA 5KQLA 4I9HA 3FGNA 1XP8A 2VLIA 1R7RA 3HR4A 2FPIB 4CF5A 2FMXA 2ZWMA 3LYUA 5FFFA 4G5XA 5CA0F 1Y4SA 5LBUA 4D6XA 4KVFA 4ESOA 2FEKA 3PQ3A 1TK2A 1W9MA 4R2LA 4DR2B 4QNMA 1RHMA 5E6UB 2YMMA 3F73A 1A5SB 4IEEA 5L3ZA 2B78A 5D5QA 3GJXC 4R51A 3H04A 1TO1E 3BHMA 1K88A 1P2VA 1S96A 3OJFA 3TRFA 3N8DA 4KQWA 3D8TA 1EVJA 2P6UA 1LS6A 5IPFA 1GQFA 3R2JA 2H2AA 2DWOA 3G0GA 1NJGA 2C0CA 2W2KB 2WNSA 5EIBC 3ZY6A 2OP1A 5C1OA 3PGA1 4U7DA 3IPYA 3R8FA 4WOJA 4D41A 4ZOLF 3CVWA 4TZ6A 1NW8A 4LJ7A 3ND9A 1W0KA 2WYHA 3ZY2A 1H2AS 1QH1A 1Z35A 1YRBA 3SY8A 4I1UA 1K2VN 1QBKC 1RBMA 5KWSA 2N0SA 4GXNA 4OHPA 1MEOA 4S2EA 2PRYA 4BXOB 1BOOA 4HFMA 1DJLA 1P0QA 4PG5A 2MSCB 3H84A 3A1VA 3Q41A 5DHQA 3WSWA 4COOA 2QMUA 3M6FA 1IONA 1O9GA 3MRXA 2Y1DA 3LCJA 1KC1A 1LTKA 5LQUA 3F3SA 4DSTA 4L8VA 5M5BA 5DN9A 2DT8A 4B5LA 3FFAA 3PT5A 2VXYA 3UUGA 1XZPA 1LDYA 4UMFA 5LOVF 4LVOA 5BXQC 2YY7A 3M81A 1ODJA 1YDWA 2I8LA 3OQJA 2P91A 3MNFA 2AXPA 3R7NA 3FHOA 2GEUA 4UU0A 1NSTA 4EKYA 2ZM6B 3BRSA 3QMMA 1N4DA 2PR2A 4YJ2B 2OWDA 4BO7A 3OF5A 3LFTA 4YV7A 2O50A 4FW9A 2IPOA 3VU1A 3ENKA 1VE6A 2BR3A 4Q19A 4I6EA 5D00A 3HDVA 4R2MA 4OG2A 3U44B 2VNJA 1FRFS 2ZSUA 3FUUA 2YDXA 4OXKA 3R7AA 1W48A 1XTUA 2FFRA 2P30A 1OH7A 2Q6IA 4PHHA 3T34A 2XUPA 1A5BB 1TCCA 1UMDB 4AIRA 4ARZA 1RTTA 2B20A 1OB5A 4V0SA 4B3MB 4TT3D 3BT7A 3H19A 4C29A 4J7UA 4J3JA 3IEUA 1HE5A 3FCEA 3H2ZA 2R25B 4NCAA 5EQTA 2JH9A 1I1OA 4M7RA 5KYUA 1WM1A 2HSEA 4KPUA 3TTXA 3VHQA 4W5QA 4PQRA 3HZHA 3NM6B 4O2AF 4Y0AA 1Z8FA 2FA9A 1GZ7A 2QR5A 4JJFA 1K4YA 2GCEA 3JY6A 4M8IA 4RTQA 5C32A 1ZONA 1F8UA 1U3FA 1ATIA 3AVQA 4N8DA 2R8OA 3W4KA 2VIIA 4B4OA 8GPBA 1UZMA 3NUQA 3COWA 4J49A 4UTNA 3CNLA 3VTKA 5JOQA 1IWPB 4JB3A 3U09A 3O90A 3CWQA 1N9KA 3RREA 3E9RA 2Q41A 1IK4A 1OF1A 1I13A 4FQ5A 1O89A 1WU7A 1JJFA 3H2BA 4WK4B 3PRHA 3J7TA 2XMBA 4OHYA 5K01A 1GL3A 1QO9A 4EENA 4F5YA 1U7UA 4Y1RA 2BEUB 2BY4A 1LDMA 4TN5A 2PKWA 3AHCA 4WLFA 3O26A 1GG9A 1IFXA 2PGJA 3Q3EA 4AKIA 3ICWA 4RORA 1Q0PA 4GP6A 4KXQA 3RS5A 3WAKA 3V9PA 5FWXB 1L5NA 1D07A 3DE4X 3SG0A 3EPJA 3DR5A 2RONA 4URWR 4MWBA 3P2YA 4X64B 2ZRBA 2ZYAA 5JI2E 2QYSA 2NUTA 2B4RO 3FPEA 1N2HA 1N2EA 3GL9A 3LP5A 3QENA 4MWZA 4OO3A 4Q39A 2ATXA 2L42A 4Z6KA 121PA 3DAHA 4G0QA 1FY2A 1TJ3A 1J8FA 1FDOA 1W5FA 3IBTA 1C7RA 5FLEX 4D26A 5TARA 4MCJA 1F0YA 2B21A 4KXVA 1ABBA 1O77A 2JGJA 2Z5FA 4QREA 2BTEA 3ICOA 2Q3EA 2HO4A 2M32A 2HHJA 4LSMA 2ZAOA 4D9IA 1CUXA 3JVIA 3DGEC 2YKGA 2JJ2D 1Y6GA 1AVTA 4FJ1A 2NWQA 5LP6C 1UFOA 1MO3A 1Z73A 1DMRA 1WCIA 1ZUHA 5BV2P 3JWJA 2AW3A 1E2IA 3RRFA 5FULA 1P5HA 1EGAA 1UAYA 1W4BA 1VL8A 3N39C 3WYNA 2C9MA 1KU0A 3B3AA 3HFSA 5FWXA 4DEYA 5ALFA 1DNPA 1T2NA 2NTJA 1A76A 3AR3A 5KTOA 2XUJA 4WERA 2GCOA 4A6EA 4B75A 1AHPA 2IS2A 5C8ZA 3KTOA 3KSBC 3E9CA 3Q12A 1T2FA 1FC0A 2FVYA 2IU4A 4PYLA 3O1HB 1WP4A 2OAP1 3IBSA 4P4UA 2FPOA 1EMDA 3CRMA 1IUKA 4D02A 4YDHB 2JHGA 4P22A 4MKXA 3OOHA 4IIFA 5FUXA 2VT2A 1HTBA 1TM2A 2JAXA 3P2EA 4RKYA 2O7NA 4RIIA 4CMBA 3KALA 5I7RA 3I9V1 6GPBA 1AA6A 2UU9B 1FVHA 2DPMA 3G2PA 4I2VA 1HG0A 4S1PA 3F47A 3R77A 4MX8A 3MGKA 4B79A 2W70A 3DF7A 4BE4A 3K96A 1DBIA 4LDQA 2PZKA 3F4KA 4FBMA 1Y7HA 4I6GA 2WUDA 1I9CA 2HEIA 2Q1UA 1SBQA 4PGAA 2J09A 4IEIA 4TQ9A 4EKDA 1Q0UA 2C3UA 4POAA 5T4FA 3UGKA 5C7IO 5JECA 1RZUA 1XLWA 5KNCD 1QWOA 1U28C 3ROGA 4FLFA 4YMWA 1Y9DA 3LIPA 4ICIA 4KO2S 4ZYWA 3L04A 1OHHD 2I2AA 3EA4A 4RVCA 1G38A 1Z8HA 4OM7A 5DTRA 2JKZA 3O3OB 1YZHA 4PXAA 4RAOA 2VOJA 4FDLA 5AH0A 1IRIA 4G0UA 2A5FA 3BZUA 1OAKA 4FZJA 2HWUA 2Q27A 1K7XB 1UQUA 3UMRA 1S3GA 2FWNA 2P4SA 4L02A 3LMKA 3E5HA 5FL7A 5KYKA 3IAEA 2JPDA 4BNMA 3GK3A 4KSBA 3C97A 4NR0A 4QDZA 2GA9A 2RD2A 1JIXA 2HA7A 2B2CA 1NQXA 3RR2A 2X6QA 2XNKA 4CM3A 1U8XX 1A9TA 1G6OA 3V00A 3VPXA 3EVZA 1JSCA 1Z62A 2HMUA 1EJBA 2V3VA 4LE1A 1YI0A 3FF4A 4UASA 2ZSJA 4G63A 4PC7A 3WGHA 3WL6A 3B6ZA 5K0JA 3F4LA 4B46A 3MHTA 1CYDA 2IIQA 5HZKA 2IYOA 3S7TA 1GAXA 1IY9A 3CONA 3ZX4A 4HNGA 1MXHA 1G2OA 2VEDA 3I0MA 4DQLA 5C8YB 1ADFA 1O9HA 2JKVA 5EHNA 4RY2A 1RYZA 3MFYA 3QF4A 3V6LA 4FEAA 9LDBA 4J4HA 4BCCA 1U7ZA 2BYTA 4LGMA 8ATCA 1E3IA 4C0BA 4KB5A 3BICA 3CLUD 3F5MA 1Q16A 1JDVA 1KJZA 1LZKA 1R37A 1RJFA 3DAPA 4EG0A 2BCGY 1AO3A 1SQ0A 2RJ3A 2IYLD 2W71A 3DT6A 1HORA 3IV6A 3QPUA 3QVOA 4BPBA 4KWCA 2ONCA 2C2BA 4YR9A 3IHTA 4YXFA 5BR4A 2GZHA 4P4GA 1XVLA 2JIBA 2II6A 3BXPA 3I9FA 3PC8A 1SA0B 1WABA 5I8WA 1XZQA 1BKDR 2IUEA 3DHWC 1FNCA 1PQWA 2CV1A 2FKNA 4B85A 1U6KA 3TMAA 2W00A 3L92A 4L8GA 4YAUA 3K5HA 3MT7A 1V1RB 2DR0A 1PX0A 2VJOA 5TQ2B 1E18A 2PKEA 1CUCA 2VA9A 3CLRD 2VPTA 3CCCA 3ESBA 4JEIA 4EW1A 4DDVA 2ZK7A 4CL2A 1JLHA 2C3MA 3LPLA 5H81A 4OXRA 1YVUA 1PJSA 4EHFA 2IP4A 1RI2A 2DR3A 1CDZA 1EFHA 3AHDA 1D2HA 4OJNA 3DVAA 3JWHA 4MGHA 2RG1A 3GCWA 3LUFA 3ROZA 2OFOA 1JFVA 2H1CA 2XE8A 3SMVA 5FEUA 1ZP6A 1N1GA 1Z4KA 4Q9KA 2OZKA 4U9IS 5JS8A 4DR5B 4KGXA 4XPIA 1VG1A 4IG9A 4WE3A 4DZTA 3NBYC 1VE5A 5KJ6A 3R0JA 3T94A 1NQAO 1G19A 1VSQA 1NUAA 2HQSA 4HATA 4UMEA 2XB2A 3GAFA 3NUZA 3PFKA 1DIAA 2DX7A 2IE8A 3FOAA 4U39A 5HHTA 3RGGA 2CXQA 4AF7A 4BEBA 4F4UA 1G8GA 1Z4NA 3G13A 4ZV9A 1LLCA 2IPNA 1FFWA 5K0FA 4LMBA 2PMFA 3DE3X 4BTLA 3C1AA 4QGFA 4WKPA 4YRIA 5MN4A 1W0JA 6ABPA 4IS2A 3FDIA 5LP6A 3ETJA 2XBMA 3L1IA 3L6BA 1TU3A 4LOIA 4X97A 1G8KA 1RXSA 3K1AA 4M7PA 2QTRA 3AL2A 3CYFA 4RA9A 4Q16A 2Z4TA 3KS9A 2RK3A 1IEXA 1A9RA 2OC9A 2ZU0C 1U1GA 1RPNA 3IERA 3MIIA 3NDJA 4KAAA 3S28A 3BWMA 4FR0A 3E27A 2W7TA 3OFNA 3REQA 4N3NA 1OX4B 1OCEA 1YULA 4OAOA 3M6VA 5FI5A 1P44A 3W5SA 3CE9A 3M8KA 2CL7X 3O2NA 2XA9A 2CHEA 1QPBA 1YHYA 1PJRA 2ISSD 1ZG3A 1ZCFA 1S8FA 1QP8A 2YWHA 1G6KA 3L8DA 3GFRA 3KSUA 3LSYA 3NFYA 4DT1B 3KPWA 1LLUA 2I7XA 2HQOA 2QN9A 3NTUA 4RQAA 3ZJVA 2Z83A 1I2MA 4LWQA 2OHGA 2Z2ZA 3G0IA 1NVAA 2IZ5A 5FQNA 2ERYA 3AKDA 4KR0A 4O63O 4RXMA 1KAOA 2POCA 3M9WA 3UKDA 2XZTA 1F2DA 2I03A 3LO8A 1F8GA 4Y6PA 1EBFA 1Z08A 2FZKA 3LLUA 2QSYA 4J29A 3AETB 4EDHA 4DSZA 5JH7F 3EAFA 1MC5A 3VI3B 5BYAA 5JNVA 1C4XA 1VIAA 5TS3A 3RU3A 3KXKA 4ADSG 1HQCA 3RS9A 1ZEMA 2KLBA 2VQ6A 2Q6TA 3DEJA 1LNSA 4LCEA 3DHNA 5EXXA 5TJ9A 1IG3A 1XN4A 2IYVA 4ETWA 2ZQZA 3JZMA 5JXGA 5TIIA 4CHGA 1WW8A 4B44A 3GDHA 4R31A 1X80B 2CYBA 3MW8A 5I45A 1R5JA 5KYYB 4PIVA 2A6PA 4PEVA 1VZ2A 1NWHA 1U1CA 4O4LF 4FJ2A 4RS3A 3RM3A 1B16A 3V4OA 1P0FA 3WJ1A 4IQ8A 4B4UA 4DUGD 2AEMA 3T3GA 1LPSA 3GLRA 2JFPA 3FRIA 2F3TA 1U2SA 3MCVA 2R6R1 4RKFA 3LM8A 4P84A 4ZO6A 3GD5A 1TUIA 1BXGA 1G16A 2O7SA 4EUSA 1XLUA 4PF1A 3WDLA 5J4LA 3UYLA 1K6JA 2EC5A 4A03A 3LX8A 1V9SA 2J6BA 4HAIA 1XQYA 4IDEA 3SNHA 4QJ5A 1N3YA 3UVEA 5MN6A 1Q0HA 3MB8A 1K66A 2YMLA 2YV1A 2IYAA 4PS0A 5FLKA 5BWOA 5HVNA 2PH7A 1Y7PA 1BE6A 2J67A 3HBNA 1GNTA 1L4UA 4G5YA 3SQXA 3HGMA 1DC5A 4UQOA 2RHWA 4OLBA 1THGA 2I80A 2QRPA 3WWEA 4F5ZA 1MHTA 3ACCA 3CCBA 3BE8A 3QIVA 3RW9A 1O4VA 4QUKA 3VYVA 2ATIA 4UD6A 4CIBA 2J85A 5ALSA 5J5VA 2VBIA 1E6WA 1HYGA 2OGZA 1R8QA 2PKCA 2SCUA 3DOCA 3AVWA 1CJTC 1J8VA 2WFLB 4MW0A 2EW8A 3KOXA 1JFTA 1JL3A 4WNCA 3GNQA 3LQYA 5KYWA 1M0EA 4YRNA 1AKRA 5H16A 2V5VA 1EX6A 2QJRA 2LNDA 3WLQA 4F3CA 1L7EA 1MO4A 3ANLA 3RBAA 3LZCA 4QXAA 4KXMA 1E20A 4PG6A 2CMFA 1E3QA 1HDRA 3FUCA 3JQRA 4ROTA 4RM2A 4UXHA 1PDWA 4TN1A 4ZCLA 5FF9A 1OJLA 3PQ7A 1Y3IA 5SY4A 1M8JA 3NTLA 5AJYA 1ZPDA 5KNDH 5LDDC 4NP6A 3UXYA 4EG7A 3G2IA 3ZE9A 4XYMA 3PPYA 1H2EA 1V47A 2J32A 4S1TA 3LLSA 4ABYA 2NMVA 2WWFA 4YRJA 3A9SA 1ES9A 4R9VA 4RKQA 4DLVA 1UK9A 3I0NA 5BOSB 4JI8B 4TS1A 3MAJA 4ZCSA 1VHQA 2X2OA 3H2GA 1OTXA 1N9GB 2A0XA 2VF7A 3DGFC 4EZBA 2R8XA 4GQBA 3NHLA 4NK5A 1BFDA 3AKCA 2QT1A 3TD6A 4KDRA 1G5HA 4MPDA 2MINA 1T25A 1RADA 1P8JA 2Q2OA 3NP7A 5EKUA 3FY4A 3F7NA 1ODCA 2ORYA 4MB2A 1JVNA 2PVCA 3FYDA 4C0JA 1JKIA 3CLRC 2UUCB 1CWUA 2XMDA 3G85A 4P1ZA 4R1LA 1V37A 3TD9A 4AN0A 4LFBB 221PA 3TD2A 1E8DA 1K27A 2DKFA 1F5SA 1WV0A 3OZDA 4AYXA 4CJXA 2CT8A 2QUKA 2Y0BA 3TEMA 1WF6A 4MAAA 5F35A 5L40A 2Q0SA 1FE8A 1S3SA 2CMDA 2QB5A 5F2OA 5KC9A 3DKIA 4L22A 2IUYA 1Y5MA 2RHJA 1R0WA 2GF9A 5AM3A 1XZFA 4NMWA 2H1FA 1N5RA 1VXRA 2I54A 4M9XA 4TV8B 5L3QB 1VCMA 4XH9B 3MAAC 4O1IA 4D9HA 1NYTA 4KMMA 4E4RA 2PUHA 3DF9A 5TMPA 2EKZA 3QOFA 3DCIA 2QJWA 3FYUC 5A2GA 3OZGA 1G63A 1KI7A 2QV0A 4JXJA 1OT3A 3S55A 5HQTA 1QAQA 1QHNA 1E4OA 1TYEB 2FZVA 3KJQA 1OBHA 4MCAA 1A27A 4MUBA 3WY9A 2EGUA 4RNCA 3IQZA 3GBPA 3PSHA 3KJIA 3M0EA 5EIHA 1ZVJA 1O6CA 2X8JB 4HNTA 1LWNA 2WR8A 2Z0MA 5CT8A 4V02A 3C87A 3LT5A 1EZ4A 1PVDA 2JA2A 1GL6A 5BN4B 2CNWD 3C1TA 3Q9UA 3DHEA 2H4JA 3UANA 3ZWOA 4BGUA 4YHHB 3U61B 1VI2A 2FMHA 1NDQA 1K0UA 1R6BX 2PKXA 3NS7A 4RPCA 4ZVNA 4QRDA 4WDRA 5MHTA 1GAJA 1ZSNA 2DUMA 4LYGA 1PWXA 2HMYB 3BDIA 5TT1A 1P3Y1 4YCLA 5JZMA 4NKRA 1LFAA 3C3PA 2BM1A 2FSPA 2P9FA 3VPFA 1CJKC 1OB2A 3KAKA 3MVEA 2OEPA 3SZRA 4ER6A 4XM0A 3BX1A 5TR9A 1QE0A 1B8NA 2X6RA 2Q6KA 2GWHA 3LHSA 4KBFA 2H2GA 3PCRB 4TL9A 2WDZA 3BGVA 4O6VA 2VT7A 1NVWQ 3E2IA 3BWXA 4ND2A 4A26A 3SZ3A 4Y1GA 4O2AA 3G23A 1X94A 2UUBB 4C7JA 3SBDA 4WCFA 4O4JA 4EVIA 1YOBA 2CF6A 1CJMA 1FJHA 1WMAA 3NCTA 1T5OA 5JAQA 3SXPA 4CLXA 3MTBA 4IJQA 1ZINA 5HUQA 2IV7A 4DG9A 3HUTA 2YYYA 3T35A 3UT0A 1KNQA 4DNOA 3JQFA 5AVYA 4D9MA 4RJTA 4FE3A 4J2TA 3DUWA 2PWPA 3OEYA 1MBZA 3E61A 1CY7A 1E6MA 3NALA 3WRWA 4RK4A 3ADOA 1OGIA 3TTUA 2QROA 4DZRA 3TG8A 4GL2A 4QC2A 4DR6B 2BMEA 2XDAA 2X6TA 2AL7A 1KEPA 1R4ZA 2D5AA 3SX0A 3VJLA 3RC3A 1PUJA 3M6AA 2AG0A 1U8EA 2P90A 5EJGA 1MB4A 2ZYWX 1XGKA 3IQIX 1YV9A 4WQMA 3C16C 5GONA 2IWRA 3V8VA 1VLQA 1XRPA 4V0ME 3ZLVA 4PXSA 2BEVB 2H7VA 4AJ1A 5LMCA 3A9VA 5U9CA 4BNKA 3TXXA 3TSCA 3QUTA 1U3TA 5ILQA 4ZYTA 1ZRNA 3OIYA 2V9CA 1YAJA 4RTJA 4MVJH 1O94A 4IV0A 1XPJA 4OH7A 1HEUA 4MV4A 2X4GA 3HNPA 4EHKA 2HPZA 3D4OA 3V8PA 2Q8PA 3OZTA 5F3DA 1KBQA 2KB0A 2O0MA 4KRYA 3OZBA 3RS8A 4S04A 4CCAA 1F20A 1A2QA 5C80A 3FHTA 2G72A 5JNTA 3R9IA 5JIBA 3BFKA 5MFZA 3O8LA 5JJIA 2C82A 4C08A 3CSSA 5ICCA 4BRSA 3GMSA 1FL9A 3HMKA 2W2OA 4MQ5A 3GPCA 4YCCA 3ND5A 2AR9A 1DV2A 2GPSA 4V2UA 1OGYA 1XRQA 2CMKA 4M1SA 5FJIA 1E7MA 1XTZA 2I1QA 1BKSB 1W2GA 3IQGX 3QVVA 3QX3A 2JAUA 3NYWA 3QUAA 5TMEA 4B82A 3KUUA 2O6HA 5AJTA 5E0KB 1DX4A 5CJ2A 3C45A 1ULZA 3ZHQA 1DUIA 1XDBA 4RULA 1EP3B 4OI0A 2NT4A 1HE2A 4QFBA 3SMQA 3RD5A 1QCDA 2CFRA 3K3PA 1IUOA 1P9OA 1X7WA 3NB0A 5CVDA 1Z16A 5FWYB 3TVTA 3PNQA 1ZNQO 4QGAA 1L7DA 3K0AB 4BJ5A 2WWHA 2C3YA 1CZOA 3DCJA 2ZJ5A 2DHQA 2HH9A 3KXIA 5F7ZA 3O8CA 1J0DA 3CIOA 1P39A 5BMVA 2RCNA 3PGVA 2R0QC 3BMCA 2IIVA 2CV0A 2PBLA 1DEOA 3HFGA 4BQQA 4DMKA 4F3KA 1O5TA 2GTHA 1UDWA 3THXA 4EHIA 4M7WA 1NOIA 5IN4A 2GTIA 3HVUA 1CUIA 4U6SA 2ZUWA 3QFFA 4ER0A 3AB3A 2NO0A 3DEYX 3K1JA 2GAOA 4IL5A 2NZWA 3L8MA 4IFTA 1EQUA 1G8MA 2GJ4A 3U17A 4WBSA 2F1JA 4IDNA 3HO8A 4O4HA 5DP1A 2P7HA 4PIPA 3S2YA 2AC2A 3NBXX 5DB4A 4E5NA 2ES4A 1G9TA 3L8EA 3H9GA 4Z7JA 5FYQA 1U2DC 5TT0A 3ZVMA 1UEXC 3M9XA 3PEWA 4MQMA 4TRJA 3GLVA 5KTSA 1V16B 2XZDA 3HB0A 5MGNA 3DMYA 4HDKA 4HD8A 4K05A 3WQBA 4QYSA 1TT5B 4DV5B 4BVKA 1NTOA 4B3FX 4FM9A 2IBSA 3B7GA 3JTEA 1SVLA 4CKEA 1QP0A 3LQ4A 3B7WA 3IBCA 4N12A 3LLCA 2I4MA 4OJMX 3ZTTA 3ZWXA 4IAOA 2ZRLA 4EB6B 4EUKA 3LYHA 1T8WA 3MUNA 3SS8A 2WKSA 4N65A 4KXWA 1FP1D 2DFNA 3EDYA 2H59A 3ODPA 1BWPA 1MJHA 1Y8QB 3A37A 3CF2A 3I6QA 1LBHA 1QLWA 5DYIA 3REGA 3TQTA 2EQAA 1GU7A 2B1RA 2Y3IA 1TLLA 1XEFA 3GEMA 3OPNA 1TEXA 1WQ1R 3WWPA 2I0FA 4IJ6A 4DLTA 4IYJA 2CJFA 1I51A 3RUCA 1BA2A 1IY2A 1DIGA 3GA7A 2REXB 5IAKA 2NU8A 3JQAD 3WBKA 1HWYA 1KOGA 1I0IA 1GFSA 1PJBA 1ULAA 1ZOOA 2PS3A 4UUOA 4ZAXA 5FUVA 2EFYA 3JQBC 2NZJA 1W76A 2PS9A 1KJNA 2ZPTX 5J2UA 3HXKA 5FI0B 4BU0A 4KWTA 4D4LA 5JSZB 2JBWA 2DECA 2WJHA 4G37A 1NNI1 4MW9A 1ORWA 3W4IA 2FSGA 5AW8A 1FP7A 2ECPA 2IPAB 4WZAB 3A6JA 4HSGA 3GEEA 2ZZKA 3TI9A 1A0OA 2NYUA 3O73A 3N2IA 2O4UX 4DB4A 3JALA 3LUPA 3I62A 3MTDA 1KOFA 1DDOA 5HE9A 2XA1A 1JIKA 2BGTA 5IF3A 3LW7A 3H9BA 3CX8A 4R1QA 3HCDA 4F11A 2R60A 4HVLA 3FAZA 1XNJA 3I37X 1ZH8A 1XTQA 2EIXA 4L6IA 4CM9A 2X3YA 4JUCA 4N8EA 4Y6RA 3RV4A 4AFNA 3U4DA 5DNUA 5FWNA 4KACA 2ZLBA 3OZEA 3HVHA 2E2WA 4GUDA 3SXJA 4ZZ0A 4R2KA 3BEDA 4JGGA 1Y1TA 3ZGYA 2Y27A 2FPLA 4O4IF 3CO0S 2H5EA 2FZLA 1M2OA 4OP1A 4BFVA 4CN9A 3O1IC 4G2NA 3R75A 3UFXB 3E6AA 4ZI5A 4CKCA 4HZUA 3PNVA 4CQJA 1AE1A 1H93A 1WAMA 5IC6A 4MVJF 5LN1A 3EH1A 2DP4E 1QDUA 2VK2A