4LIIA

Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (aifm1) from homo sapiens at 1.88 a resolution
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
Knots found
sequence length
487
structure length
474
Chain Sequence
b'QDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (AIFM1) from Homo sapiens at 1.88 A resolution
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase, apoptosis
total genus 147
structure length 474
sequence length 487
other databases KnotProt 2.0: S -31
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4liiA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4liiA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4liiA01
1PDHA 4WCTA 3IHMA 3P4QA 4A65A 3C4AA 1GRHA 3ALJA 4A5LA 1DOCA 5U1OA 1GPEA 3M0OA 1DODA 1E1KA 3ISHA 3GWDA 1IUTA 4DNAA 2BACA 2YG4A 2YR4A 4UP3A 2I0ZA 3ATQA 4CBQA 2C76A 3S61A 2J3NA 2IIDA 1F6MA 1JRZA 3NIXA 3BI2A 3UKHA 4HA6A 1VDCA 1ZDLA 3DK9A 4H4PA 4J56A 3AD7B 3S5WA 3UTEA 4C3XA 1JEHA 5IQ4A 1DJNA 1GRFA 1W4XA 2YWLA 1K0IA 4BURA 1D4DA 2B7RA 4ADWA 4GDEA 4NEVA 2V3AA 5HYMA 4ECHA 1H7XA 4IA5A 3KVEA 4EQWA 1NPXA 3L1RA 4TM4A 1EL5A 1RYIA 2QA2A 3REDA 3AEBA 4AT2A 2YM2A 3GRTA 3LADA 1GTHA 2C73A 2WESA 1DOBA 2BCPA 3ICTA 3RP7A 4K8DA 3NH3X 2YR6A 1GRTA 3K7TA 2DKHA 2XDOA 4FK1C 4XWZA 5KVIA 1TDKA 2APGA 3LXDA 5CQFA 4U8NA 2BS2A 3D8XA 4EQSA 2AAQA 4K2XA 3K30A 3CGEA 2C75A 1ZX9A 3EAOA 2A87A 2GR2A 2E4GA 3K7QX 2A89A 3UKFA 3BI5A 4Z44A 4CRTA 4Y4MA 1JRXA 2WU5A 1YY5A 1Q1RA 3NYCA 4B66A 4B63A 1NHRA 2V6OA 1CJCA 5BULA 4AT0A 3QJ4A 3CGDA 2VRMA 5IQ1A 2OALA 5C3JA 2WHDA 1YQ3A 1XANA 4GR1A 1H84A 4IA6A 5U25A 3QSMA 5KRQA 2YG5A 3ICRA 1E6EA 1VRQB 2VZ2A 1QJDA 3URHA 2WQYA 1UKVG 4OPLA 3NKSA 1OJTA 1EL9A 3I3LA 3P4RA 4CY6A 2RGHA 4O5UA 1S2QA 4USQA 1F3PA 4YSXA 3UTHA 4BK1A 5BVAA 4I58A 1NHSA 3GD3A 4B69A 2BC1A 1CBOA 1DXLA 4YT0A 2WPFA 1E7PA 2IVEA 4Z26A 2JAEA 4YXDA 2NPXA 2YLSA 3VRAA 2R9ZA 3AEDA 2B9WA 1RP0A 1PS9A 2JKCA 3UCLA 4YTNA 2TPRA 1GTEA 1K0LA 2AQJA 4OPGA 1LJ1A 2YM1A 2HQMA 4EIPA 3DJEA 4H2QA 3KLJA 1PXBA 2GRTA 1DOEA 2JB3A 1NHQA 4WX1A 4Y4LA 2ZZCA 1COYA 3AEFA 5CKUA 3ABVA 4Z25A 1E1LA 3M12A 4H4UA 4XWRA 4O5QA 3T37A 1F8WA 5EOWA 2O9ZA 4H2NA 1D7LA 3K7MX 3BHFA 2C7GA 3AE1A 2XLSA 4BV6A 1Y56A 3M13A 1NG3A 1VG9A 4E0VA 5JCLA 4J2WA 1CJ3A 5M0ZA 4H4VA 2R46A 1TDOA 5FMHA 3AYLA 3AYIA 1BKWA 2RGJA 3CNJA 5C2TA 4H4SA 1L9CA 2PHHA 3UOXA 4LIIA 3DJJA 1CL0A 3IWAA 1OJDA 1ONFA 4MJWA 1ZKQA 4J57A 5EB4A 3F8PA 3QSSA 1L0VA 1BF3A 2QAEA 1PBBA 4TM1A 3VR8A 1GRGA 4YSYA 2GEWA 3DA1A 4OPIA 3AECA 4JN9A 2EQ9A 5KVHA 2WOIA 1N4VA 1GESA 1IJHA 2FJEA 2ACZA 1IUWA 4IVOB 4KPRA 3UKLA 4ZN0A 4AOXA 1PXCA 5L46A 2C70A 2YG3A 2XFNA 1FCDA 2XLUA 1PJ6A 3RHAA 1FECA 1B5QA 1O5WA 4B65A 3GSIA 1YQ4A 2W0HA 2GAGB 2XVHA 2WP9A 2JK6A 3F8DA 3GDPA 2VVLA 3CPIG 2YVGA 3EPTA 2GMJA 3RP8A 2R4JA 1GOSA 4B1BA 2FJAA 4H4RA 3G5RA 1ELIA 3KPFA 3H4KA 3CNDA 5KXJA 1GSNA 1FEAA 1GT8A 5KWFA 3LZXA 1VG0A 4USRA 1XHCA 2RABA 1ZP0A 4YKFA 5KOWA 2WS3A 5HHFA 2WP5A 4CCQA 1H83A 3BI4A 4H4XA 1N1PA 2X8CA 3KU9A 3NN6X 5J7XA 3CN8A 5BUKA 1BWCA 4Z2TA 3H8IA 3NG7X 3ALMA 2R0GA 2B76A 3Q9TA 2B9YA 1IUSA 3B6DA 3UKPA 3JSKA 2WP6A 2Z5XA 2UZZA 2GMHA 3P4PA 1KDGA 3GWFA 3AEGA 1NEKA 4AP3A 1FOHA 5DBJA 2FBWA 1N4WA 2VVLG 2AR8A 3AEAA 1P2EA 1QO8A 1REOA 3BNMA 3V3NA 4U8IA 2X8HA 1DJQA 1VQWA 4OPCA 4XXGA 3UKAA 1ZK7A 1FEBA 2GF3A 2WBAA 4K5SA 2GB0A 3R9UA 3GD4A 2WOWA 2YVJA 2C64A 3NK0X 3BNUA 1O94A 2GAHB 1CC6A 2YG6A 2FJBA 2GR0A 3CTYA 4ZCCA 2CFYA 3SFEA 5EBKA 2X3NA 2GR3A 3UTGA 3PVCA 4H4WA 4P9SA 1Q1WA 1M6IA 3BHKA 3DH9A 3DGHA 1K0JA 1PBEA 3NHOX 3NYFA 4Z43A 1TRBA 2GQFA 4A79A 3V76A 4U8MA 3PS9A 3SFDA 4JNQA 4TLZA 3UTFA 1JRYA 4H4TA 4C77A 1IUUA 4YTMA 4H2PA 5BRTA 1GV4A 1L9EA 4HB9A 2BK5A 2XYOA 4LA1A 2XVIA 5HXIA 2B9XA 2Y6QA 4A6NB 2FJDA 4A6NA 4Z2UA 1E1NA 2H88A 2WU2A 2BC0A 1CHUA 3DMEA 5IPYA 3RP6A 3QFBA 1H7WA 3ZDNA 1X31B 1CC2A 1JNRA 2DKIA 1B8SA 3FG2P 1GREA 2C72A 3ICSA 3GMCA 4I59A 3GMBA 3CPHG 1IUVA 2F5ZA 3NTDA 4JQ9A 3AE2A 1GALA 3CIRA 4C3YA 3O0HA 2Q7VA 2XLTA 3GYIA 1PBFA 3NK2X 4JY3A 3RNMA 4TM3A 2VVMA 3VR9A 1CJ4A 2JBVA 3AEEA 2H89A 3ITJA 4EMJA 4UDPA 2XFPA 1EL7A 3AE7A 4UDRA 2IVDA 3VRDB 4JY2A 1XPQA 4D03A 3AE3A 4BJZA 1GRAA 4J34A 4CNKA 3COXA 3CNTA 4B64A 4IVMB 2WEUA 4OVIA 4H4ZA 4H2RA 3DJGX 3AWIA 1Q9IA 4NTEA 3C96A 4FX9A 1K4QA 4H4YA 1ZOVA 4U8KA 4Y4NA 2XLPA 1NG4A 4RSLA 3GYJA 1H6VA 4CY8A 3AYJA 4EQRA 4K5RA 1B37A 5FS8A 3UOZA 5GRTA 3NT6A 3FIMB 3KD9A 4BJYA 4Z24A 3CPJG 1XDIA 3SM8A 3IF9A 4IV9A 1D4CA 5FS6A 4J33A 5JCMA 2BYBA 2OLNA 1GNDA 1S3BA 3IHGA 4NTCA 1YKJA 3G5QA 5FS9A 3DJDA 3DK8A 4OCGA 5KOXA 1Z6LA 2C67A 4LU6A 3E1TA 2X99A 3V3OA 1YQZA 2PYXA 4GF7A 3CNPA 1KSSA 2V60A 4BK2A 1LVLA 3KKJA 1LPFA 1LQUA 1KNRA 3NRNA 1MOKA 3B3RA 4GUVA 2BABA 4RG3A 3D1CA 4A9WA 4YTPA 2WOVA 2XVEA 1V59A 2Y6RA 2WPCA 2YLTA 2XVJA 3EANA 1S3EA 4EQXA 2E5VA 5JCNA 2BA9A 1KSUA 5M10A 4NTDA 2Q6UA 4EMWA 4NZHA 5EB5A 1OJCA 3UP4A 3I6DA 3ZYXA 2ZZBA 3EF6A 4APNA 2YLXA 4GDPA 4B68A 2C3CA 4C74A 4GRTA 1H82A 3NNEA 4U2SA 3AD9B 1BGNA 2C3DA 1CF3A 1F8SA 1EBDA 5JCIA 2WETA 1CC4A 3DGZA 4JNAA 1E1MA 2YAUA 3F8RA 1JNZA 5J60A 4CCRA 3LB8A 1N4UA 1NAAA 3OZ2A 5ER0A 2OLOA 1AOGA 2GVCA 4OPUA 2BS4A 4YWOA 2ZBWA 1PJ7A 1HYUA 3QVPA 1LV0A 1FL2A 4C5OA 4YKGA 3QVRA 2YVFA 2V3BA 4PABA 1H81A 4N9XA 3AE9A 3ALLA 1KNPA 4AP1A 4FDCB 4H4QA 2QA1A 2VQ7A 1NDAA 2RGOA 4EM4A 1PXAA 1ZMDA 2XVFA 4B67A 1F8RA 2GR1A 3GDNA 3P4SA 3AE5A 4PAAA 4EMIA 1NHPA 1EL8A 1CJ2A 4H50A 1PBDA 2BK3A 2TMDA 3FPZA 1D5TA 4DGKA 3AE8A 2XLRA 2VOUA 3DK4A 2R0PA 3VRBA 3H8LA 2WDRA 3P9UA 4AOSA 3CGCA 2VQBA 1JOAA 2EQ8A 1PJ5A 1TDFA 3AD8B 5HY5A 2X8GA 2ZZ0A 1GEUA 1L9DA 3NGCX 1SEZA 3WE0A 3P1WA 1JU2A 3LOVA 2CDUA 1ZMCA 4A7AA 4Z2RA 1NENA 3L8KA 1QLBA 2XFUA 1TYPA 3IC9A 1MO9A 2X50A 1O95A 4OPTA 2BK4A 4UDQA 2CULA 1H86A 4H7UA 2GV8A 2R4EA 1PBCA 1P2HA 5LV9A 4X9NA 3G5SA 2YQUA 2JB1A 2B7SA 4DSHA 4JDRA 4U8PA 1KFYA 4U8LA 1OJ9A 4J36A 4K7ZA 3AB1A 4J31A 5GSNA 3QFAA 4U8JA 1GETA 1GERA 4TLXA 5TR3A 3SQPA 1E39A 1PHHA 5JCKA 1S2YA 2XCGA 4X9MA 2XFOA 1GXFA 2A8XA 3ATRA 2WDQA 1IUXA 2YLWA 3ADAB 2BCGG 3UKQA 1DNCA 2CVJA 4YSZA 1OJAA 3SGLA 4YSHA 3FBSA 3LZWA 1D7YA 1BZLA 1TYTA 2C66A 3AE4A 3HZLA 4M52A 4GCMA 1TDEA 2VRLA 3AXBA 1LQTA 4ICYA 4TM0A 4REKA 4ZCDA 4KX6A 4X4JA 2YR5A 4FK1A 4EM3A 3PO7A 1ZY8A 4BK3A 3Q6JA 4U2LA 2EQ6A 2Q0KA 1BGJA 3NTAA 2Z5YA 2GH5A 2BS3A 4U8OA 4D04A 2GQWA 2E1MA 2OA1A 3UKKA 2EQ7A 1D4EA 3UOVA 1TDNA 1Y56B 1KF6A 3FMWA 3LJPA 4CNJA 2BXRA 4A99A 5U63A 3KA7A 3UP5A 1GRBA 2WDVA 3NK1X 3CNSA 2R45A 2YLRA 1B4VA 1PN0A 2XFQA 2NVKX 1Y0PA 3CGBA 2JB2A 2QCUA 4RG4A 2ARDA 4EIQA 2V61A 2WPEA 2YLZA 3NYEA 3AE6A 1RSGA 4NEWA 3OC4A 1M64A 3GRSA 5FS7A 3QSEA 2Q0LA 3UOYA 3NLCA 2YG7A 4OPDA 2R0CA 3C4NA 1MXTA 2V5ZA 1LTXR 2BXSA 3II4A 3NN0X 4K22A 2OAMA 3VQRA 4U2TA 4DSGA 1ZOYA 2C65A
chains in the Genus database with same CATH superfamily
7ENLA 1GRHA 1DOCA 1GPEA 3M0OA 2YG4A 2IIDA 3NIXA 3S47A 3UCDA 4G9KA 4DHGA 1ZDLA 4J56A 1FFUC 2P3ZA 5IQ4A 1GRFA 2OZ3A 3P3BA 4ADWA 2V3AA 5HYMA 3UJFA 4IA5A 3KVEA 1R6WA 2GGEA 1EL5A 1RYIA 4AT2A 2PTWA 2XDOA 5KVIA 1TDKA 3RGTA 4GGBA 2E4GA 2GR2A 2E5AA 2A89A 3BI5A 4Z44A 3DESA 4B63A 1CJCA 3FVDA 3FYYA 1YQ3A 2P8CA 1E6EA 1SJCA 3NZGA 1F3PA 1P43A 2OQHA 4G73A 4B69A 5KMSA 2WPFA 2IVEA 4KPLA 4FI4A 2YLSA 3VRAA 2B9WA 2AL2A 3ZLHA 2TPRA 1DOEA 4XWRA 3NS1B 3T37A 4H2NA 1D7LA 1NG3A 1VG9A 3R0KA 4J2WA 4H4VA 3AYIA 3IJQA 3CNJA 1L9CA 3IWAA 3KPKA 4E4UA 1FFVC 2ZC8A 2QAEA 3HW2A 3VDGA 4G74A 4YSYA 3DA1A 3SR6B 4K1WA 1IJHA 1IUWA 4IVOB 4GMEA 4KPRA 2AKZA 1PJ6A 1O5WA 4B65A 3DEQA 3H7VA 2WP9A 2VVLA 3TCSA 3CPIG 4JN7A 3RP8A 2R4JA 2OLAA 2PODA 4B1BA 2FJAA 4GIRA 1ELSA 2AKMA 3S5SA 3LZXA 2XH0A 1ZP0A 4Z17A 4YKFA 5KOWA 2GGHA 2WP5A 1H83A 3BI4A 4H4XA 5J7XA 3CN8A 5BUKA 5IDZA 3HRDC 3Q9TA 2Z5XA 4GGHA 3GWFA 1FOHA 1QO8A 1VQWA 1ZK7A 2GF3A 2PP0A 1O94A 2YG6A 3CTYA 2GR0A 1KKRA 2CFYA 2X3NA 3GYXA 1Q1WA 3BHKA 3DH9A 5FJOA 4Z43A 1TRBA 2GQFA 2XSXA 2RDXA 1JRYA 1N5XA 5FJRA 4K2SA 5BRTA 4LA1A 3IK4A 2B9XA 2FJDA 1CHUA 3QFBA 3ZDNA 1CC2A 3FG2P 1GREA 2C72A 3ICSA 3AE2A 1GALA 4C3YA 3O0HA 3GYIA 4JY3A 4TM3A 2VVMA 3VR9A 4EMJA 1JRPA 4UDRA 3VRDB 4JY2A 2PA6A 1BKHA 3NXLA 3COXA 1W6TA 3CNTA 2WEUA 3NRZB 4H2RA 3T4WA 1Q9IA 4NTEA 4FX9A 1ZOVA 3GYJA 5GRTA 3FIMB 4Z24A 3CPJG 5ENLA 1XDIA 3SM8A 3IF9A 3SXIA 2HZGA 2BYBA 2OLNA 4NTCA 3AN1A 1NELA 5FS9A 4LU6A 3E1TA 3ZLFA 1KSSA 2XVEA 3ZVHB 2YLTA 2XVJA 1S3EA 2E5VA 2BA9A 2GGJA 1OJCA 3I6DA 3DFYA 3MWCA 4APNA 4C74A 2C3CA 2PSNA 4IZGA 4U2SA 1JPMA 3T6CA 2I5QA 3AD9B 1F8SA 5JCIA 2WETA 3DGZA 1WYGA 1VDVA 5J60A 1N4UA 4YWOA 4C5OA 4YKGA 3SN0A 4PABA 5BOEA 3OZMA 4AP1A 2QA1A 2VQ7A 4M6UA 4EM4A 2XVFA 4B67A 3AE5A 4EMIA 2PU0A 3T0KA 2R0PA 2WDRA 2X8GA 2ZZ0A 1GEUA 1L9DA 3P1WA 4Z2RA 2XH4A 1MO9A 1MDLA 2X50A 2CULA 5J04A 5LV9A 3G5SA 3U4FA 4JDRA 4U8LA 4J36A 4E6MA 4X2PA 4TLXA 5FJTA 1E39A 5JCKA 3QKEA 2WDQA 1IUXA 3ADAB 3UKQA 4Z1YA 3SGLA 1TYTA 1BZLA 4M52A 3UJRA 4II2A 4HYRA 4GISA 3SY4A 3U9IA 3PO7A 4BK3A 1N61C 3Q6JA 3QTPA 1BGJA 3NTAA 2GH5A 4D04A 1JCTA 3UKKA 2EQ7A 4H2HA 1EBHA 3UOVA 1TDNA 1Y56B 2BXRA 4A99A 1GRBA 2WDVA 2YLRA 1Y0PA 2QCUA 4RG4A 2YLZA 3NYEA 3AE6A 1RSGA 3TOYA 3NLCA 1MXTA 2P0IA 2BXSA 3II4A 3VQRA 2QGYA 1MRAA 4WCTA 3P4QA 3C4AA 4A5LA 2QDDA 2OO6A 5U1OA 1DODA 3ISHA 4UP3A 3GWDA 1IUTA 3PWIA 3ATQA 3BI2A 4HA6A 2QJNA 3AD7B 3S5WA 4C3XA 1K0IA 2BRYA 4NEVA 3T8QA 4ECHA 4EQWA 3L1RA 3PK7A 4HN8A 3LADA 2WESA 1DOBA 2BCPA 3ICTA 1H2IA 4MGGA 3NH3X 3K7TA 2DKHA 2PTZA 4XWZA 1IYXA 2AAQA 3K30A 2C75A 3EAOA 2MUCA 1JRXA 1YY5A 4B66A 1XPYA 5BULA 1FHUA 3QJ4A 5IQ1A 5C3JA 2WHDA 1XANA 5FJUA 3UJ2A 3QSMA 3DG3A 5FJPA 3CT2A 3I6TA 3THUA 2RGHA 3AMZA 3MY9A 3UTHA 1SB3B 4YT0A 1DXLA 4Z26A 2JAEA 3NO1A 4YXDA 1PS9A 3UCLA 2AQJA 4HNCA 4OPGA 2HQMA 4EIPA 3NVYB 3DJEA 3I6EA 1PXBA 4Y4LA 1NHQA 4WX1A 2ZZCA 1COYA 3ABVA 3M12A 1EC9A 3ZLGA 3K7MX 2C7GA 2PS2A 1SJBA 2XLSA 4BV6A 3M13A 1OEPA 5FMHA 1BKWA 1VQZA 5C2TA 4H4SA 2PHHA 3UOXA 1OJDA 1ZKQA 2OKTA 3F8PA 1L0VA 2PP3A 3A7AA 4E5TA 4TM1A 2OFJA 1GRGA 1X2GA 4OPIA 4IHCA 1N4VA 2FJEA 3UKLA 1PXCA 2C70A 2XFNA 4ZOHB 1YQ4A 2GAGB 2XVHA 3TJIA 3NFUA 5JRBA 1GOSA 4H4RA 1ELIA 3H4KA 3CNDA 3VFCA 3VCNA 4HCHA 5KWFA 1VG0A 4USRA 1XHCA 3ZVIA 2RABA 4EWJA 4G6GA 2WS3A 4CCQA 3P93A 2X8CA 3KU9A 3NN6X 3NG7X 3ALMA 4MKSA 2B9YA 3UKPA 3KUMA 3JSKA 2FKPA 3P4PA 2OZ8A 1KDGA 3AEGA 5DBJA 2VVLG 3AEAA 3V3NA 3EUB3 1REOA 4OPCA 3VC5A 4G8TA 2GB0A 3R9UA 3NK0X 3A7UA 2GAHB 4ZCCA 2FJBA 4GFIA 3SFEA 3UTGA 3PVCA 3SSZA 4DN1A 3BJSA 3PS9A 4JNQA 4H4TA 4C77A 1IUUA 4YTMA 4H2PA 1GV4A 1L9EA 4HB9A 2BK5A 2XYOA 1EC8A 2XVIA 3UJEA 1E9IA 2WU2A 3DMEA 1H7WA 1PDZA 3GMCA 2F5ZA 3CIRA 1CJ4A 2JBVA 3ITJA 2XFPA 1EL7A 3DIPA 5BOFA 3AE3A 1GRAA 1WUEA 3PG6A 4IVMB 3DJGX 4ZA0A 3C96A 1K4QA 4H4YA 2XLPA 3TW9A 1H6VA 3KD9A 5JCMA 3NVZB 1S3BA 4OCGA 5KOXA 4IT1A 1RVKA 2X99A 3V3OA 3KKJA 3RCYA 2BABA 4RG3A 3ZVHA 3PWGA 5JCNA 4KT2A 3NVVB 4GDPA 4GRTA 1H82A 3Q45A 2C3DA 3BOXA 1EBDA 1MDRA 1KN0A 3F8RA 3DG7A 1NAAA 4OPUA 1AOGA 1PJ7A 1HYUA 1FL2A 3QVRA 3UXKA 3TQPA 3AE9A 3ALLA 4GYPC 3MQTA 1KNPA 2RGOA 1ZMDA 5KMPA 1F8RA 2GR1A 2OPJA 3VC6A 1NHPA 1EL8A 3FPZA 4H50A 3UCCA 3AE8A 3VRBA 3P9UA 2VQBA 2EQ8A 5HY5A 4DX3A 3WE0A 2CDUA 2W3SA 3DERA 1ECQA 3L8KA 2XFUA 1TYPA 3CXBA 4DWDA 4OPTA 2BK4A 4UDQA 4H7UA 1MNSA 1P2HA 2YQUA 4K7ZA 1STZA 3R1ZA 3SX6A 5GSNA 4U8JA 3R25A 2AL1A 5TR3A 3SQPA 1S2YA 4X9MA 1JROA 2XFOA 4G6HA 2YLWA 2BCGG 1DNCA 1OJAA 3FBSA 3CXOA 3HZLA 4ICYA 4TM0A 1JPDX 4KX6A 1ZY8A 2EQ6A 4U8OA 1KD0A 4H83A 3MSYA 2PP1A 1KF6A 3FMWA 3LJPA 3UP5A 3NK1X 2R45A 1PN0A 2NVKX 3CGBA 3MUCA 4IL0A 2V61A 4TVYA 3FCPA 3AM9A 3OC4A 3QSEA 2Q0LA 2YG7A 2V5ZA 4K22A 1N63C 4U2TA 4I58A 3QN3A 1PDHA 3IHMA 3ALJA 3T9PA 4K8GA 4CBQA 4DNAA 2YR4A 2I0ZA 2C76A 1JRZA 3UKHA 4GAPA 5KMQA 4H19A 3DK9A 4H4PA 3CK5A 3UTEA 1JEHA 1DJNA 1W4XA 2YWLA 4BURA 1D4DA 2B7RA 4GDEA 1H7XA 4G7FA 2QA2A 3AEBA 2YM2A 3GRTA 1DTNA 1GTHA 4HCLA 3MZNA 3CYJA 3RP7A 4K8DA 1GRTA 4FK1C 5CQFA 4U8NA 2BS2A 3D8XA 4EQSA 3CGEA 1ZX9A 4II3A 4CRTA 2NQLA 4Y4MA 2WU5A 1Q1RA 4J1OA 3CGDA 2VRMA 1H84A 5KRQA 6ENLA 1VRQB 2VZ2A 3I4KA 3URHA 2WQYA 1UKVG 4OPLA 3NKSA 4A35A 3P4RA 4KEMA 4O5UA 4USQA 4YSXA 4BK1A 3N6HA 3SZCA 1CBOA 1E7PA 3VA8A 4TVWA 2R9ZA 3AEDA 3TWBA 2JKCA 4YTNA 1GTEA 3JVAA 3STPA 5CKUA 1E1LA 1WUFA 4H4UA 3N4EA 1XS2A 5EOWA 1TKKA 2O9ZA 1F9CA 3H70A 2E3TA 3AE1A 4E0VA 4GYPA 1CJ3A 5M0ZA 2RGJA 4LIIA 4MJWA 5EB4A 3QSSA 2PTYA 3D9XA 1BF3A 3VR8A 1P48A 2XGZA 4JN9A 2WOIA 1GESA 4IP4A 2ACZA 3R10A 4NWZA 4AOXA 5L46A 1FCDA 2XLUA 3RHAA 1FECA 1B5QA 3GSIA 3H12A 2W0HA 2YVGA 3EPTA 3G5RA 3VCCA 3QPEA 5KXJA 3RO6A 1GT8A 3IJIA 4MMWA 4HCDA 5HHFA 3R0UA 1BWCA 2R0GA 2B76A 1IUSA 3B6DA 3R11A 2UZZA 2ZADA 2QVHA 2POZA 1NEKA 1NU5A 4AP3A 2AR8A 3CB3A 4U8IA 2X8HA 1FEBA 4K5SA 2WOWA 2YVJA 3BNUA 3UXLA 2GGGA 5EBKA 1ONEA 2GR3A 4H4WA 4P9SA 1M6IA 1KKOA 3DGHA 1PBEA 3NYFA 3IJLA 3B9JB 3V76A 4U8MA 5KNLA 4A6NB 1YEYA 1E1NA 2DKIA 1B8SA 4I59A 3GMBA 2BRAA 2Q7VA 2XLTA 3V3WA 1TE6A 4ENLA 3N6JA 2H89A 2IVDA 3ES8A 4BJZA 4J34A 4B64A 4HPNA 4OVIA 4H4ZA 3N4FA 4U8KA 4Y4NA 4F4RA 5G5GB 1NG4A 4RSLA 3TTEA 3T2ZA 4K5RA 2PGWA 5FS8A 3T2YA 3NT6A 4BJYA 2CHRA 1D4CA 5FS6A 3IHGA 4FP1A 3G5QA 3DJDA 3DK8A 1Z6LA 2C67A 3FXGA 1LPFA 4GAVA 3NRNA 1MOKA 3B3RA 4GUVA 4A9WA 3SZ0A 4YTPA 1V59A 2Y6RA 2WPCA 3EANA 3NVWB 3T31A 1KSUA 5M10A 3DFHA 4NTDA 4NZHA 4EMWA 2HNEA 2W3RA 2ZZBA 2YLXA 3CMMA 1BGNA 4H1ZA 1CC4A 4JNAA 2YAUA 1JNZA 3LB8A 3OZ2A 2PMQA 2OLOA 2BS4A 2ZBWA 1LV0A 2YVFA 1FO4A 1H81A 4FDCB 4H4QA 2MNRA 3HYXA 3GDNA 4PAAA 1N5WC 2TMDA 1PBDA 1D5TA 2VOUA 3DK4A 4AOSA 2ONEA 1JOAA 1PJ5A 1TDFA 1EC7A 3NGCX 1SEZA 1JU2A 3BSMA 1V97A 1ZMCA 5G5HB 1NENA 3RRAA 3IC9A 4ROPA 3RITA 1O95A 2DW7A 3SYIA 1H86A 1PBCA 4X9NA 2JB1A 4DSHA 4YWSA 3SN4A 2PGEA 2O56A 1GXFA 3ATRA 2CVJA 4A3RA 3SJNA 3AE4A 2C66A 1TDEA 4REKA 4X4JA 3GD6A 1X2HA 2Z5YA 3FJ4A 2OA1A 1D4EA 5KMRA 3V4BA 3CNSA 3T14A 1B4VA 1N60C 2ARDA 3B97A 2WPEA 3UJSA 3GRSA 5FS7A 3UOYA 2GDQA 4ZCWA 2R0CA 3C4NA 4HNLA 2W55A 2PTXA 3TWAA 4A65A 3OPSA 3HYWA 1E1KA 2BACA 3S61A 2J3NA 1F6MA 1VDCA 3SZWA 4JN8A 3RR1A 3UGVA 1NPXA 1FIQB 2OG9A 4TM4A 3REDA 1MUCA 2C73A 4A6GA 4DXKA 2YR6A 2APGA 3LXDA 2OX4A 3T2KA 4K2XA 1S7MA 2A87A 3K7QX 3UKFA 3NYCA 1NHRA 2V6OA 3D46A 4AT0A 3PFRA 2OALA 4GR1A 4IA6A 1KCZA 5U25A 2YG5A 2PCEA 2FYMA 3ICRA 1L8PA 1QJDA 1OJTA 2PPGA 1EL9A 3JZUA 3I3LA 4CY6A 1S2QA 3GO2A 5BVAA 3DG6A 1NHSA 3GD3A 2BC1A 2NPXA 2AL2B 1RP0A 4M0XA 2GGIA 1K0LA 1N62C 1LJ1A 2YM1A 4H2QA 3KLJA 2GRTA 2JB3A 3AEFA 4Z25A 4O5QA 1F8WA 3HYVA 3BHFA 1Y56A 3DDMA 5JCLA 5EU9A 2R46A 2W54A 1TDOA 3AYLA 3OZYA 3DJJA 1CL0A 1ONFA 4IL2A 4J57A 3OTRA 3EEZA 3P0WA 1PBBA 2GEWA 2QJJA 3AECA 2EQ9A 5KVHA 4ZN0A 2YG3A 2QJMA 4DYEA 3F8DA 1BQGA 2JK6A 3GDPA 2GMJA 2QDEA 3ES7A 3KPFA 3QLDA 1GSNA 1FEAA 2GL5A 2OVLA 1N1PA 4Z2TA 1SJAA 3H8IA 3SBFA 1FHVA 2WP6A 2GMHA 2QQ6A 2FBWA 1N4WA 1P2EA 3BNMA 1DJQA 4XXGA 3UKAA 2WBAA 2HXUA 3GD4A 3H8AA 2C64A 4NNJA 1CC6A 3DGBA 1K0JA 3NHOX 4A79A 3OW1A 3SFDA 3UTFA 4TLZA 3D47A 5HXIA 3ENLA 2Y6QA 4Z2UA 4A6NA 4JHMA 2H88A 2BC0A 5IPYA 3RP6A 1X31B 4KWSA 1JNRA 3FV9A 3CPHG 1IUVA 3NTDA 4J3ZA 4JQ9A 3NK2X 1PBFA 3ETRB 3GC2A 3RNMA 3AEEA 4UDPA 3TJ4A 1RM6B 3AE7A 1XPQA 4D03A 4CNKA 3AWIA 1ZXIC 4E8GA 4CY8A 3AYJA 4EQRA 1B37A 3UOZA 4IV9A 4J33A 1GNDA 1YKJA 3OP2A 1YQZA 2PYXA 4GF7A 3CNPA 2V60A 4BK2A 1LVLA 1LQUA 1KNRA 3D1CA 1JDFA 2WOVA 2GSHA 2C4CA 2OQYA 4EQXA 2Q6UA 5EB5A 3UP4A 3ZYXA 3EF6A 1TZZA 3A7RA 3MKCA 4B68A 3NNEA 1CF3A 1E1MA 4CCRA 5ER0A 2GVCA 3QVPA 1SJDA 2V3BA 4N9XA 2XH7A 1NDAA 1PXAA 3P4SA 3SZFA 1CJ2A 2BK3A 4DGKA 3SQSA 2XLRA 3H8LA 3CGCA 1R0MA 3Q4DA 3AD8B 1PDYA 2P8BA 3LOVA 4A7AA 1QLBA 3JW7A 2XH2A 2OZTA 2GV8A 2R4EA 1T3QC 2B7SA 3V5CA 4U8PA 1KFYA 1OJ9A 3AB1A 4J31A 3QFAA 1GETA 1GERA 1PHHA 2XCGA 3K1GA 2A8XA 4YSZA 4YSHA 3LZWA 1D7YA 4GCMA 2VRLA 3AXBA 1LQTA 4ZCDA 2YR5A 4FK1A 2DW6A 4EM3A 4U2LA 3SN1A 2Q0KA 2BS3A 2GQWA 2E1MA 3CAWA 4CNJA 4E4FA 3KA7A 5U63A 2XFQA 2HXTA 2JB2A 1EBGA 2PU1A 3HPFA 4EIQA 2P88A 3V5FA 3L5OA 4NEWA 1M64A 3R07C 3GY1A 4OPDA 4IP5A 1LTXR 3EKGA 3NN0X 2OAMA 4DSGA 1ZOYA 2C65A
chains in the Genus database with same CATH topology
1PDHA 4WCTA 3IHMA 3P4QA 4A65A 3C4AA 1GRHA 3ALJA 4A5LA 1DOCA 5U1OA 1GPEA 3M0OA 1DODA 1E1KA 3HYWA 3GWDA 1IUTA 4DNAA 2BACA 2YG4A 2YR4A 3ISHA 2I0ZA 3ATQA 4CBQA 2C76A 3S61A 2J3NA 2IIDA 1F6MA 1JRZA 3NIXA 3BI2A 4GAPA 4HA6A 5KMQA 3UKHA 4G9KA 1VDCA 1ZDLA 3DK9A 4H4PA 4J56A 3AD7B 3S5WA 3UTEA 4C3XA 3SZWA 1JEHA 5IQ4A 1DJNA 1GRFA 1W4XA 2YWLA 1K0IA 2BRYA 4BURA 1D4DA 2B7RA 4ADWA 4GDEA 4NEVA 2V3AA 5HYMA 4ECHA 1H7XA 4IA5A 3KVEA 4EQWA 1NPXA 3L1RA 4TM4A 1EL5A 1RYIA 2QA2A 3REDA 3AEBA 4AT2A 2YM2A 3GRTA 3LADA 1GTHA 2C73A 2WESA 1DOBA 2BCPA 3ICTA 1H2IA 3RP7A 4K8DA 3NH3X 2YR6A 1GRTA 3K7TA 2DKHA 2XDOA 4FK1C 4XWZA 5KVIA 1TDKA 2APGA 3LXDA 5CQFA 4U8NA 2BS2A 3T2KA 3D8XA 4EQSA 2AAQA 4K2XA 3K30A 3CGEA 2C75A 1S7MA 1ZX9A 3EAOA 2A87A 2GR2A 2E4GA 3K7QX 2A89A 4II3A 3UKFA 3BI5A 4Z44A 4CRTA 4Y4MA 1JRXA 2WU5A 1YY5A 1Q1RA 3NYCA 4B66A 4B63A 1NHRA 2V6OA 1CJCA 5BULA 4AT0A 3QJ4A 3CGDA 2VRMA 5IQ1A 2OALA 5C3JA 2WHDA 1YQ3A 1XANA 4GR1A 1H84A 4IA6A 5U25A 3QSMA 5KRQA 2YG5A 3ICRA 1E6EA 1VRQB 2VZ2A 1QJDA 3URHA 2WQYA 1UKVG 4OPLA 3NKSA 1OJTA 1EL9A 3I3LA 3P4RA 4CY6A 2RGHA 4O5UA 1S2QA 4USQA 1F3PA 4YSXA 3UTHA 4BK1A 5BVAA 4I58A 4G73A 1NHSA 3GD3A 3SZCA 4B69A 2BC1A 5KMSA 1CBOA 1DXLA 4YT0A 2WPFA 1E7PA 2IVEA 4Z26A 2JAEA 4YXDA 2NPXA 2YLSA 3VRAA 2R9ZA 3AEDA 2B9WA 1RP0A 1PS9A 2JKCA 3UCLA 4YTNA 2TPRA 1GTEA 1K0LA 2AQJA 4OPGA 1LJ1A 2YM1A 2HQMA 4EIPA 3DJEA 4H2QA 3KLJA 1PXBA 2GRTA 1DOEA 2JB3A 1NHQA 4WX1A 4Y4LA 2ZZCA 1COYA 3AEFA 5CKUA 3ABVA 4Z25A 1E1LA 3M12A 4H4UA 4XWRA 4O5QA 3T37A 1F8WA 5EOWA 2O9ZA 3HYVA 4H2NA 1D7LA 3K7MX 3BHFA 2C7GA 3AE1A 2XLSA 4BV6A 1Y56A 3M13A 1NG3A 1VG9A 4E0VA 5JCLA 4J2WA 1CJ3A 5M0ZA 4H4VA 2R46A 1TDOA 5FMHA 3AYLA 3AYIA 1BKWA 2RGJA 3CNJA 5C2TA 4H4SA 1L9CA 2PHHA 3UOXA 4LIIA 3DJJA 1CL0A 3IWAA 1OJDA 1ONFA 3KPKA 4MJWA 1ZKQA 4J57A 5EB4A 3F8PA 3QSSA 1L0VA 3D9XA 1BF3A 2QAEA 1PBBA 4TM1A 3VR8A 1GRGA 4G74A 4YSYA 2GEWA 3DA1A 4OPIA 3AECA 4JN9A 2EQ9A 5KVHA 2WOIA 1N4VA 1GESA 1IJHA 2FJEA 2ACZA 1IUWA 4IVOB 4KPRA 4NWZA 3UKLA 4ZN0A 4AOXA 1PXCA 5L46A 2C70A 2YG3A 2XFNA 1FCDA 2XLUA 1PJ6A 3RHAA 1FECA 1B5QA 1O5WA 4B65A 3GSIA 1YQ4A 2W0HA 2GAGB 2XVHA 2WP9A 2JK6A 3F8DA 3GDPA 2VVLA 3CPIG 2YVGA 3EPTA 2GMJA 3RP8A 2R4JA 5JRBA 1GOSA 4B1BA 2FJAA 4H4RA 3G5RA 1ELIA 3KPFA 3H4KA 3CNDA 5KXJA 1GSNA 1FEAA 1GT8A 5KWFA 3LZXA 1VG0A 4USRA 1XHCA 4G6GA 2RABA 1ZP0A 4YKFA 5KOWA 2WS3A 5HHFA 2WP5A 4CCQA 1H83A 3BI4A 4H4XA 1N1PA 2X8CA 3KU9A 3NN6X 5J7XA 3CN8A 5BUKA 1BWCA 4Z2TA 3H8IA 3NG7X 3ALMA 2R0GA 2B76A 3Q9TA 2B9YA 1IUSA 3B6DA 3UKPA 3JSKA 2WP6A 2Z5XA 2UZZA 2GMHA 3P4PA 1KDGA 3GWFA 3AEGA 1NEKA 4AP3A 1FOHA 5DBJA 2FBWA 1N4WA 2VVLG 2AR8A 3AEAA 1P2EA 1QO8A 1REOA 3BNMA 3V3NA 4U8IA 2X8HA 1DJQA 1VQWA 4OPCA 4XXGA 3UKAA 1ZK7A 1FEBA 2GF3A 2WBAA 4K5SA 2GB0A 3R9UA 3GD4A 2WOWA 2YVJA 2C64A 3NK0X 3BNUA 1O94A 4NNJA 2GAHB 1CC6A 2YG6A 2FJBA 2GR0A 3CTYA 4ZCCA 2CFYA 3SFEA 5EBKA 2X3NA 2GR3A 3UTGA 3PVCA 3GYXA 4H4WA 4P9SA 1Q1WA 1M6IA 3BHKA 3DH9A 3DGHA 1K0JA 1PBEA 3NHOX 3NYFA 4Z43A 1TRBA 2GQFA 4A79A 3V76A 4U8MA 3PS9A 3SFDA 4JNQA 4TLZA 3UTFA 1JRYA 4H4TA 4C77A 1IUUA 4YTMA 4H2PA 5BRTA 1GV4A 1L9EA 4HB9A 2BK5A 2XYOA 4LA1A 5KNLA 2XVIA 5HXIA 2B9XA 2Y6QA 4A6NB 2FJDA 4A6NA 4Z2UA 1E1NA 2H88A 2WU2A 2BC0A 1CHUA 3DMEA 5IPYA 3RP6A 3QFBA 1H7WA 3ZDNA 1X31B 1CC2A 1JNRA 2DKIA 1B8SA 3FG2P 1GREA 2C72A 3ICSA 3GMCA 4I59A 3GMBA 3CPHG 1IUVA 2F5ZA 3NTDA 4JQ9A 3AE2A 1GALA 3CIRA 4C3YA 2BRAA 3O0HA 2Q7VA 2XLTA 3GYIA 1PBFA 3NK2X 4JY3A 3RNMA 4TM3A 2VVMA 3VR9A 1CJ4A 2JBVA 3AEEA 2H89A 3ITJA 4EMJA 4UDPA 2XFPA 1EL7A 3AE7A 4UDRA 2IVDA 3VRDB 4JY2A 1XPQA 4D03A 3AE3A 4BJZA 1GRAA 4J34A 4CNKA 3COXA 3CNTA 4B64A 3PG6A 4IVMB 2WEUA 4OVIA 4H4ZA 4H2RA 3DJGX 3AWIA 1Q9IA 4NTEA 3C96A 4FX9A 1K4QA 4H4YA 1ZOVA 4U8KA 4Y4NA 2XLPA 1NG4A 4RSLA 3GYJA 1H6VA 4CY8A 3AYJA 3T2ZA 4EQRA 4K5RA 1B37A 5FS8A 3UOZA 5GRTA 3T2YA 3NT6A 3FIMB 3KD9A 4BJYA 4Z24A 3CPJG 1XDIA 3SM8A 3IF9A 4IV9A 1D4CA 5FS6A 4J33A 3SXIA 5JCMA 2BYBA 2OLNA 1GNDA 1S3BA 3IHGA 4NTCA 1YKJA 3G5QA 5FS9A 3DJDA 3DK8A 4OCGA 5KOXA 1Z6LA 2C67A 4LU6A 3E1TA 2X99A 3V3OA 1YQZA 2PYXA 4GF7A 3CNPA 1KSSA 2V60A 4BK2A 1LVLA 3KKJA 1LPFA 1LQUA 1KNRA 4GAVA 3NRNA 1MOKA 3B3RA 4GUVA 2BABA 4RG3A 3D1CA 4A9WA 3SZ0A 4YTPA 2WOVA 2XVEA 1V59A 2Y6RA 2WPCA 2YLTA 2XVJA 3EANA 1S3EA 2C4CA 4EQXA 2E5VA 5JCNA 3T31A 2BA9A 1KSUA 5M10A 4NTDA 2Q6UA 4EMWA 4NZHA 5EB5A 1OJCA 3UP4A 3I6DA 3ZYXA 2ZZBA 3EF6A 4APNA 2YLXA 4GDPA 4B68A 2C3CA 3CMMA 4GRTA 1H82A 3NNEA 4C74A 4U2SA 3AD9B 1BGNA 2C3DA 1CF3A 1F8SA 1EBDA 5JCIA 2WETA 1CC4A 3DGZA 4JNAA 1KN0A 1E1MA 2YAUA 3F8RA 1JNZA 5J60A 4CCRA 3LB8A 1N4UA 1NAAA 3OZ2A 5ER0A 2OLOA 1AOGA 2GVCA 4OPUA 2BS4A 4YWOA 2ZBWA 1PJ7A 1HYUA 3QVPA 1LV0A 1FL2A 4C5OA 4YKGA 3QVRA 2YVFA 2V3BA 4PABA 1H81A 4N9XA 3AE9A 3ALLA 1KNPA 4AP1A 4FDCB 4H4QA 2QA1A 2VQ7A 1NDAA 2RGOA 4EM4A 1PXAA 3HYXA 1ZMDA 2XVFA 4B67A 1F8RA 5KMPA 2GR1A 3GDNA 3P4SA 3AE5A 4PAAA 4EMIA 3SZFA 1NHPA 1EL8A 1CJ2A 4H50A 1PBDA 2BK3A 2TMDA 3FPZA 1D5TA 4DGKA 3AE8A 2XLRA 2VOUA 3DK4A 2R0PA 3T0KA 3H8LA 3VRBA 2WDRA 3P9UA 4AOSA 3CGCA 2VQBA 1JOAA 2EQ8A 1PJ5A 1TDFA 3AD8B 5HY5A 2X8GA 2ZZ0A 1GEUA 1L9DA 3NGCX 1SEZA 3WE0A 3P1WA 1JU2A 3LOVA 2CDUA 1ZMCA 4A7AA 4Z2RA 1NENA 3L8KA 1QLBA 2XFUA 1TYPA 3IC9A 1MO9A 2X50A 1O95A 4OPTA 2BK4A 4UDQA 2CULA 3SYIA 1H86A 4H7UA 2GV8A 2R4EA 1PBCA 1P2HA 5LV9A 4X9NA 3G5SA 2YQUA 2JB1A 2B7SA 4DSHA 4JDRA 4U8PA 1KFYA 4U8LA 1OJ9A 4J36A 4K7ZA 3AB1A 4J31A 3SX6A 4UP3A 5GSNA 3QFAA 4U8JA 1GETA 1GERA 4TLXA 5TR3A 3SQPA 1E39A 1PHHA 5JCKA 1S2YA 2XCGA 4X9MA 2XFOA 1GXFA 2A8XA 3ATRA 2WDQA 1IUXA 4G6HA 2YLWA 3ADAB 2BCGG 3UKQA 1DNCA 2CVJA 4YSZA 1OJAA 3SGLA 4YSHA 3FBSA 3LZWA 1D7YA 1BZLA 1TYTA 2C66A 3AE4A 3HZLA 4M52A 4GCMA 1TDEA 2VRLA 3AXBA 1LQTA 4ICYA 4II2A 4TM0A 4REKA 4ZCDA 4KX6A 4X4JA 3SY4A 2YR5A 4FK1A 4EM3A 3PO7A 1ZY8A 4BK3A 3Q6JA 4U2LA 2EQ6A 2Q0KA 1BGJA 3NTAA 2Z5YA 2GH5A 2BS3A 4U8OA 4D04A 2GQWA 2E1MA 2OA1A 3UKKA 2EQ7A 1D4EA 3UOVA 1TDNA 1Y56B 1KF6A 3FMWA 3LJPA 5KMRA 4CNJA 2BXRA 4A99A 5U63A 3KA7A 3UP5A 1GRBA 2WDVA 3NK1X 3CNSA 2R45A 2YLRA 1B4VA 1PN0A 3T14A 2XFQA 2NVKX 1Y0PA 3CGBA 2JB2A 2QCUA 4RG4A 2ARDA 4EIQA 2V61A 2WPEA 2YLZA 3L5OA 3NYEA 3AE6A 1RSGA 4NEWA 3OC4A 1M64A 3GRSA 5FS7A 3QSEA 2Q0LA 3UOYA 3NLCA 2YG7A 4OPDA 2R0CA 3C4NA 1MXTA 2V5ZA 1LTXR 2BXSA 3II4A 3NN0X 4K22A 2OAMA 3VQRA 4U2TA 4DSGA 1ZOYA 2C65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PDH A;  4WCT A;  3IHM A;  3P4Q A;  4A65 A;  3C4A A;  1GRH A;  3ALJ A;  4A5L A;  1DOC A;  5U1O A;  1GPE A;  3M0O A;  1DOD A;  1E1K A;  3ISH A;  3GWD A;  1IUT A;  4DNA A;  2BAC A;  2YG4 A;  2YR4 A;  4UP3 A;  2I0Z A;  3ATQ A;  4CBQ A;  2C76 A;  3S61 A;  2J3N A;  2IID A;  1F6M A;  1JRZ A;  3NIX A;  3BI2 A;  3UKH A;  4HA6 A;  1VDC A;  1ZDL A;  3DK9 A;  4H4P A;  4J56 A;  3AD7 B;  3S5W A;  3UTE A;  4C3X A;  1JEH A;  5IQ4 A;  1DJN A;  1GRF A;  1W4X A;  2YWL A;  1K0I A;  4BUR A;  1D4D A;  2B7R A;  4ADW A;  4GDE A;  4NEV A;  2V3A A;  5HYM A;  4ECH A;  1H7X A;  4IA5 A;  3KVE A;  4EQW A;  1NPX A;  3L1R A;  4TM4 A;  1EL5 A;  1RYI A;  2QA2 A;  3RED A;  3AEB A;  4AT2 A;  2YM2 A;  3GRT A;  3LAD A;  1GTH A;  2C73 A;  2WES A;  1DOB A;  2BCP A;  3ICT A;  3RP7 A;  4K8D A;  3NH3 X;  2YR6 A;  1GRT A;  3K7T A;  2DKH A;  2XDO A;  4FK1 C;  4XWZ A;  5KVI A;  1TDK A;  2APG A;  3LXD A;  5CQF A;  4U8N A;  2BS2 A;  3D8X A;  4EQS A;  2AAQ A;  4K2X A;  3K30 A;  3CGE A;  2C75 A;  1ZX9 A;  3EAO A;  2A87 A;  2GR2 A;  2E4G A;  3K7Q X;  2A89 A;  3UKF A;  3BI5 A;  4Z44 A;  4CRT A;  4Y4M A;  1JRX A;  2WU5 A;  1YY5 A;  1Q1R A;  3NYC A;  4B66 A;  4B63 A;  1NHR A;  2V6O A;  1CJC A;  5BUL A;  4AT0 A;  3QJ4 A;  3CGD A;  2VRM A;  5IQ1 A;  2OAL A;  5C3J A;  2WHD A;  1YQ3 A;  1XAN A;  4GR1 A;  1H84 A;  4IA6 A;  5U25 A;  3QSM A;  5KRQ A;  2YG5 A;  3ICR A;  1E6E A;  1VRQ B;  2VZ2 A;  1QJD A;  3URH A;  2WQY A;  1UKV G;  4OPL A;  3NKS A;  1OJT A;  1EL9 A;  3I3L A;  3P4R A;  4CY6 A;  2RGH A;  4O5U A;  1S2Q A;  4USQ A;  1F3P A;  4YSX A;  3UTH A;  4BK1 A;  5BVA A;  4I58 A;  1NHS A;  3GD3 A;  4B69 A;  2BC1 A;  1CBO A;  1DXL A;  4YT0 A;  2WPF A;  1E7P A;  2IVE A;  4Z26 A;  2JAE A;  4YXD A;  2NPX A;  2YLS A;  3VRA A;  2R9Z A;  3AED A;  2B9W A;  1RP0 A;  1PS9 A;  2JKC A;  3UCL A;  4YTN A;  2TPR A;  1GTE A;  1K0L A;  2AQJ A;  4OPG A;  1LJ1 A;  2YM1 A;  2HQM A;  4EIP A;  3DJE A;  4H2Q A;  3KLJ A;  1PXB A;  2GRT A;  1DOE A;  2JB3 A;  1NHQ A;  4WX1 A;  4Y4L A;  2ZZC A;  1COY A;  3AEF A;  5CKU A;  3ABV A;  4Z25 A;  1E1L A;  3M12 A;  4H4U A;  4XWR A;  4O5Q A;  3T37 A;  1F8W A;  5EOW A;  2O9Z A;  4H2N A;  1D7L A;  3K7M X;  3BHF A;  2C7G A;  3AE1 A;  2XLS A;  4BV6 A;  1Y56 A;  3M13 A;  1NG3 A;  1VG9 A;  4E0V A;  5JCL A;  4J2W A;  1CJ3 A;  5M0Z A;  4H4V A;  2R46 A;  1TDO A;  5FMH A;  3AYL A;  3AYI A;  1BKW A;  2RGJ A;  3CNJ A;  5C2T A;  4H4S A;  1L9C A;  2PHH A;  3UOX A;  4LII A;  3DJJ A;  1CL0 A;  3IWA A;  1OJD A;  1ONF A;  4MJW A;  1ZKQ A;  4J57 A;  5EB4 A;  3F8P A;  3QSS A;  1L0V A;  1BF3 A;  2QAE A;  1PBB A;  4TM1 A;  3VR8 A;  1GRG A;  4YSY A;  2GEW A;  3DA1 A;  4OPI A;  3AEC A;  4JN9 A;  2EQ9 A;  5KVH A;  2WOI A;  1N4V A;  1GES A;  1IJH A;  2FJE A;  2ACZ A;  1IUW A;  4IVO B;  4KPR A;  3UKL A;  4ZN0 A;  4AOX A;  1PXC A;  5L46 A;  2C70 A;  2YG3 A;  2XFN A;  1FCD A;  2XLU A;  1PJ6 A;  3RHA A;  1FEC A;  1B5Q A;  1O5W A;  4B65 A;  3GSI A;  1YQ4 A;  2W0H A;  2GAG B;  2XVH A;  2WP9 A;  2JK6 A;  3F8D A;  3GDP A;  2VVL A;  3CPI G;  2YVG A;  3EPT A;  2GMJ A;  3RP8 A;  2R4J A;  1GOS A;  4B1B A;  2FJA A;  4H4R A;  3G5R A;  1ELI A;  3KPF A;  3H4K A;  3CND A;  5KXJ A;  1GSN A;  1FEA A;  1GT8 A;  5KWF A;  3LZX A;  1VG0 A;  4USR A;  1XHC A;  2RAB A;  1ZP0 A;  4YKF A;  5KOW A;  2WS3 A;  5HHF A;  2WP5 A;  4CCQ A;  1H83 A;  3BI4 A;  4H4X A;  1N1P A;  2X8C A;  3KU9 A;  3NN6 X;  5J7X A;  3CN8 A;  5BUK A;  1BWC A;  4Z2T A;  3H8I A;  3NG7 X;  3ALM A;  2R0G A;  2B76 A;  3Q9T A;  2B9Y A;  1IUS A;  3B6D A;  3UKP A;  3JSK A;  2WP6 A;  2Z5X A;  2UZZ A;  2GMH A;  3P4P A;  1KDG A;  3GWF A;  3AEG A;  1NEK A;  4AP3 A;  1FOH A;  5DBJ A;  2FBW A;  1N4W A;  2VVL G;  2AR8 A;  3AEA A;  1P2E A;  1QO8 A;  1REO A;  3BNM A;  3V3N A;  4U8I A;  2X8H A;  1DJQ A;  1VQW A;  4OPC A;  4XXG A;  3UKA A;  1ZK7 A;  1FEB A;  2GF3 A;  2WBA A;  4K5S A;  2GB0 A;  3R9U A;  3GD4 A;  2WOW A;  2YVJ A;  2C64 A;  3NK0 X;  3BNU A;  1O94 A;  2GAH B;  1CC6 A;  2YG6 A;  2FJB A;  2GR0 A;  3CTY A;  4ZCC A;  2CFY A;  3SFE A;  5EBK A;  2X3N A;  2GR3 A;  3UTG A;  3PVC A;  4H4W A;  4P9S A;  1Q1W A;  1M6I A;  3BHK A;  3DH9 A;  3DGH A;  1K0J A;  1PBE A;  3NHO X;  3NYF A;  4Z43 A;  1TRB A;  2GQF A;  4A79 A;  3V76 A;  4U8M A;  3PS9 A;  3SFD A;  4JNQ A;  4TLZ A;  3UTF A;  1JRY A;  4H4T A;  4C77 A;  1IUU A;  4YTM A;  4H2P A;  5BRT A;  1GV4 A;  1L9E A;  4HB9 A;  2BK5 A;  2XYO A;  4LA1 A;  2XVI A;  5HXI A;  2B9X A;  2Y6Q A;  4A6N B;  2FJD A;  4A6N A;  4Z2U A;  1E1N A;  2H88 A;  2WU2 A;  2BC0 A;  1CHU A;  3DME A;  5IPY A;  3RP6 A;  3QFB A;  1H7W A;  3ZDN A;  1X31 B;  1CC2 A;  1JNR A;  2DKI A;  1B8S A;  3FG2 P;  1GRE A;  2C72 A;  3ICS A;  3GMC A;  4I59 A;  3GMB A;  3CPH G;  1IUV A;  2F5Z A;  3NTD A;  4JQ9 A;  3AE2 A;  1GAL A;  3CIR A;  4C3Y A;  3O0H A;  2Q7V A;  2XLT A;  3GYI A;  1PBF A;  3NK2 X;  4JY3 A;  3RNM A;  4TM3 A;  2VVM A;  3VR9 A;  1CJ4 A;  2JBV A;  3AEE A;  2H89 A;  3ITJ A;  4EMJ A;  4UDP A;  2XFP A;  1EL7 A;  3AE7 A;  4UDR A;  2IVD A;  3VRD B;  4JY2 A;  1XPQ A;  4D03 A;  3AE3 A;  4BJZ A;  1GRA A;  4J34 A;  4CNK A;  3COX A;  3CNT A;  4B64 A;  4IVM B;  2WEU A;  4OVI A;  4H4Z A;  4H2R A;  3DJG X;  3AWI A;  1Q9I A;  4NTE A;  3C96 A;  4FX9 A;  1K4Q A;  4H4Y A;  1ZOV A;  4U8K A;  4Y4N A;  2XLP A;  1NG4 A;  4RSL A;  3GYJ A;  1H6V A;  4CY8 A;  3AYJ A;  4EQR A;  4K5R A;  1B37 A;  5FS8 A;  3UOZ A;  5GRT A;  3NT6 A;  3FIM B;  3KD9 A;  4BJY A;  4Z24 A;  3CPJ G;  1XDI A;  3SM8 A;  3IF9 A;  4IV9 A;  1D4C A;  5FS6 A;  4J33 A;  5JCM A;  2BYB A;  2OLN A;  1GND A;  1S3B A;  3IHG A;  4NTC A;  1YKJ A;  3G5Q A;  5FS9 A;  3DJD A;  3DK8 A;  4OCG A;  5KOX A;  1Z6L A;  2C67 A;  4LU6 A;  3E1T A;  2X99 A;  3V3O A;  1YQZ A;  2PYX A;  4GF7 A;  3CNP A;  1KSS A;  2V60 A;  4BK2 A;  1LVL A;  3KKJ A;  1LPF A;  1LQU A;  1KNR A;  3NRN A;  1MOK A;  3B3R A;  4GUV A;  2BAB A;  4RG3 A;  3D1C A;  4A9W A;  4YTP A;  2WOV A;  2XVE A;  1V59 A;  2Y6R A;  2WPC A;  2YLT A;  2XVJ A;  3EAN A;  1S3E A;  4EQX A;  2E5V A;  5JCN A;  2BA9 A;  1KSU A;  5M10 A;  4NTD A;  2Q6U A;  4EMW A;  4NZH A;  5EB5 A;  1OJC A;  3UP4 A;  3I6D A;  3ZYX A;  2ZZB A;  3EF6 A;  4APN A;  2YLX A;  4GDP A;  4B68 A;  2C3C A;  4C74 A;  4GRT A;  1H82 A;  3NNE A;  4U2S A;  3AD9 B;  1BGN A;  2C3D A;  1CF3 A;  1F8S A;  1EBD A;  5JCI A;  2WET A;  1CC4 A;  3DGZ A;  4JNA A;  1E1M A;  2YAU A;  3F8R A;  1JNZ A;  5J60 A;  4CCR A;  3LB8 A;  1N4U A;  1NAA A;  3OZ2 A;  5ER0 A;  2OLO A;  1AOG A;  2GVC A;  4OPU A;  2BS4 A;  4YWO A;  2ZBW A;  1PJ7 A;  1HYU A;  3QVP A;  1LV0 A;  1FL2 A;  4C5O A;  4YKG A;  3QVR A;  2YVF A;  2V3B A;  4PAB A;  1H81 A;  4N9X A;  3AE9 A;  3ALL A;  1KNP A;  4AP1 A;  4FDC B;  4H4Q A;  2QA1 A;  2VQ7 A;  1NDA A;  2RGO A;  4EM4 A;  1PXA A;  1ZMD A;  2XVF A;  4B67 A;  1F8R A;  2GR1 A;  3GDN A;  3P4S A;  3AE5 A;  4PAA A;  4EMI A;  1NHP A;  1EL8 A;  1CJ2 A;  4H50 A;  1PBD A;  2BK3 A;  2TMD A;  3FPZ A;  1D5T A;  4DGK A;  3AE8 A;  2XLR A;  2VOU A;  3DK4 A;  2R0P A;  3VRB A;  3H8L A;  2WDR A;  3P9U A;  4AOS A;  3CGC A;  2VQB A;  1JOA A;  2EQ8 A;  1PJ5 A;  1TDF A;  3AD8 B;  5HY5 A;  2X8G A;  2ZZ0 A;  1GEU A;  1L9D A;  3NGC X;  1SEZ A;  3WE0 A;  3P1W A;  1JU2 A;  3LOV A;  2CDU A;  1ZMC A;  4A7A A;  4Z2R A;  1NEN A;  3L8K A;  1QLB A;  2XFU A;  1TYP A;  3IC9 A;  1MO9 A;  2X50 A;  1O95 A;  4OPT A;  2BK4 A;  4UDQ A;  2CUL A;  1H86 A;  4H7U A;  2GV8 A;  2R4E A;  1PBC A;  1P2H A;  5LV9 A;  4X9N A;  3G5S A;  2YQU A;  2JB1 A;  2B7S A;  4DSH A;  4JDR A;  4U8P A;  1KFY A;  4U8L A;  1OJ9 A;  4J36 A;  4K7Z A;  3AB1 A;  4J31 A;  5GSN A;  3QFA A;  4U8J A;  1GET A;  1GER A;  4TLX A;  5TR3 A;  3SQP A;  1E39 A;  1PHH A;  5JCK A;  1S2Y A;  2XCG A;  4X9M A;  2XFO A;  1GXF A;  2A8X A;  3ATR A;  2WDQ A;  1IUX A;  2YLW A;  3ADA B;  2BCG G;  3UKQ A;  1DNC A;  2CVJ A;  4YSZ A;  1OJA A;  3SGL A;  4YSH A;  3FBS A;  3LZW A;  1D7Y A;  1BZL A;  1TYT A;  2C66 A;  3AE4 A;  3HZL A;  4M52 A;  4GCM A;  1TDE A;  2VRL A;  3AXB A;  1LQT A;  4ICY A;  4TM0 A;  4REK A;  4ZCD A;  4KX6 A;  4X4J A;  2YR5 A;  4FK1 A;  4EM3 A;  3PO7 A;  1ZY8 A;  4BK3 A;  3Q6J A;  4U2L A;  2EQ6 A;  2Q0K A;  1BGJ A;  3NTA A;  2Z5Y A;  2GH5 A;  2BS3 A;  4U8O A;  4D04 A;  2GQW A;  2E1M A;  2OA1 A;  3UKK A;  2EQ7 A;  1D4E A;  3UOV A;  1TDN A;  1Y56 B;  1KF6 A;  3FMW A;  3LJP A;  4CNJ A;  2BXR A;  4A99 A;  5U63 A;  3KA7 A;  3UP5 A;  1GRB A;  2WDV A;  3NK1 X;  3CNS A;  2R45 A;  2YLR A;  1B4V A;  1PN0 A;  2XFQ A;  2NVK X;  1Y0P A;  3CGB A;  2JB2 A;  2QCU A;  4RG4 A;  2ARD A;  4EIQ A;  2V61 A;  2WPE A;  2YLZ A;  3NYE A;  3AE6 A;  1RSG A;  4NEW A;  3OC4 A;  1M64 A;  3GRS A;  5FS7 A;  3QSE A;  2Q0L A;  3UOY A;  3NLC A;  2YG7 A;  4OPD A;  2R0C A;  3C4N A;  1MXT A;  2V5Z A;  1LTX R;  2BXS A;  3II4 A;  3NN0 X;  4K22 A;  2OAM A;  3VQR A;  4U2T A;  4DSG A;  1ZOY A;  2C65 A; 
#chains in the Genus database with same CATH topology
 7ENL A;  1GRH A;  1DOC A;  1GPE A;  3M0O A;  2YG4 A;  2IID A;  3NIX A;  3S47 A;  3UCD A;  4G9K A;  4DHG A;  1ZDL A;  4J56 A;  1FFU C;  2P3Z A;  5IQ4 A;  1GRF A;  2OZ3 A;  3P3B A;  4ADW A;  2V3A A;  5HYM A;  3UJF A;  4IA5 A;  3KVE A;  1R6W A;  2GGE A;  1EL5 A;  1RYI A;  4AT2 A;  2PTW A;  2XDO A;  5KVI A;  1TDK A;  3RGT A;  4GGB A;  2E4G A;  2GR2 A;  2E5A A;  2A89 A;  3BI5 A;  4Z44 A;  3DES A;  4B63 A;  1CJC A;  3FVD A;  3FYY A;  1YQ3 A;  2P8C A;  1E6E A;  1SJC A;  3NZG A;  1F3P A;  1P43 A;  2OQH A;  4G73 A;  4B69 A;  5KMS A;  2WPF A;  2IVE A;  4KPL A;  4FI4 A;  2YLS A;  3VRA A;  2B9W A;  2AL2 A;  3ZLH A;  2TPR A;  1DOE A;  4XWR A;  3NS1 B;  3T37 A;  4H2N A;  1D7L A;  1NG3 A;  1VG9 A;  3R0K A;  4J2W A;  4H4V A;  3AYI A;  3IJQ A;  3CNJ A;  1L9C A;  3IWA A;  3KPK A;  4E4U A;  1FFV C;  2ZC8 A;  2QAE A;  3HW2 A;  3VDG A;  4G74 A;  4YSY A;  3DA1 A;  3SR6 B;  4K1W A;  1IJH A;  1IUW A;  4IVO B;  4GME A;  4KPR A;  2AKZ A;  1PJ6 A;  1O5W A;  4B65 A;  3DEQ A;  3H7V A;  2WP9 A;  2VVL A;  3TCS A;  3CPI G;  4JN7 A;  3RP8 A;  2R4J A;  2OLA A;  2POD A;  4B1B A;  2FJA A;  4GIR A;  1ELS A;  2AKM A;  3S5S A;  3LZX A;  2XH0 A;  1ZP0 A;  4Z17 A;  4YKF A;  5KOW A;  2GGH A;  2WP5 A;  1H83 A;  3BI4 A;  4H4X A;  5J7X A;  3CN8 A;  5BUK A;  5IDZ A;  3HRD C;  3Q9T A;  2Z5X A;  4GGH A;  3GWF A;  1FOH A;  1QO8 A;  1VQW A;  1ZK7 A;  2GF3 A;  2PP0 A;  1O94 A;  2YG6 A;  3CTY A;  2GR0 A;  1KKR A;  2CFY A;  2X3N A;  3GYX A;  1Q1W A;  3BHK A;  3DH9 A;  5FJO A;  4Z43 A;  1TRB A;  2GQF A;  2XSX A;  2RDX A;  1JRY A;  1N5X A;  5FJR A;  4K2S A;  5BRT A;  4LA1 A;  3IK4 A;  2B9X A;  2FJD A;  1CHU A;  3QFB A;  3ZDN A;  1CC2 A;  3FG2 P;  1GRE A;  2C72 A;  3ICS A;  3AE2 A;  1GAL A;  4C3Y A;  3O0H A;  3GYI A;  4JY3 A;  4TM3 A;  2VVM A;  3VR9 A;  4EMJ A;  1JRP A;  4UDR A;  3VRD B;  4JY2 A;  2PA6 A;  1BKH A;  3NXL A;  3COX A;  1W6T A;  3CNT A;  2WEU A;  3NRZ B;  4H2R A;  3T4W A;  1Q9I A;  4NTE A;  4FX9 A;  1ZOV A;  3GYJ A;  5GRT A;  3FIM B;  4Z24 A;  3CPJ G;  5ENL A;  1XDI A;  3SM8 A;  3IF9 A;  3SXI A;  2HZG A;  2BYB A;  2OLN A;  4NTC A;  3AN1 A;  1NEL A;  5FS9 A;  4LU6 A;  3E1T A;  3ZLF A;  1KSS A;  2XVE A;  3ZVH B;  2YLT A;  2XVJ A;  1S3E A;  2E5V A;  2BA9 A;  2GGJ A;  1OJC A;  3I6D A;  3DFY A;  3MWC A;  4APN A;  4C74 A;  2C3C A;  2PSN A;  4IZG A;  4U2S A;  1JPM A;  3T6C A;  2I5Q A;  3AD9 B;  1F8S A;  5JCI A;  2WET A;  3DGZ A;  1WYG A;  1VDV A;  5J60 A;  1N4U A;  4YWO A;  4C5O A;  4YKG A;  3SN0 A;  4PAB A;  5BOE A;  3OZM A;  4AP1 A;  2QA1 A;  2VQ7 A;  4M6U A;  4EM4 A;  2XVF A;  4B67 A;  3AE5 A;  4EMI A;  2PU0 A;  3T0K A;  2R0P A;  2WDR A;  2X8G A;  2ZZ0 A;  1GEU A;  1L9D A;  3P1W A;  4Z2R A;  2XH4 A;  1MO9 A;  1MDL A;  2X50 A;  2CUL A;  5J04 A;  5LV9 A;  3G5S A;  3U4F A;  4JDR A;  4U8L A;  4J36 A;  4E6M A;  4X2P A;  4TLX A;  5FJT A;  1E39 A;  5JCK A;  3QKE A;  2WDQ A;  1IUX A;  3ADA B;  3UKQ A;  4Z1Y A;  3SGL A;  1TYT A;  1BZL A;  4M52 A;  3UJR A;  4II2 A;  4HYR A;  4GIS A;  3SY4 A;  3U9I A;  3PO7 A;  4BK3 A;  1N61 C;  3Q6J A;  3QTP A;  1BGJ A;  3NTA A;  2GH5 A;  4D04 A;  1JCT A;  3UKK A;  2EQ7 A;  4H2H A;  1EBH A;  3UOV A;  1TDN A;  1Y56 B;  2BXR A;  4A99 A;  1GRB A;  2WDV A;  2YLR A;  1Y0P A;  2QCU A;  4RG4 A;  2YLZ A;  3NYE A;  3AE6 A;  1RSG A;  3TOY A;  3NLC A;  1MXT A;  2P0I A;  2BXS A;  3II4 A;  3VQR A;  2QGY A;  1MRA A;  4WCT A;  3P4Q A;  3C4A A;  4A5L A;  2QDD A;  2OO6 A;  5U1O A;  1DOD A;  3ISH A;  4UP3 A;  3GWD A;  1IUT A;  3PWI A;  3ATQ A;  3BI2 A;  4HA6 A;  2QJN A;  3AD7 B;  3S5W A;  4C3X A;  1K0I A;  2BRY A;  4NEV A;  3T8Q A;  4ECH A;  4EQW A;  3L1R A;  3PK7 A;  4HN8 A;  3LAD A;  2WES A;  1DOB A;  2BCP A;  3ICT A;  1H2I A;  4MGG A;  3NH3 X;  3K7T A;  2DKH A;  2PTZ A;  4XWZ A;  1IYX A;  2AAQ A;  3K30 A;  2C75 A;  3EAO A;  2MUC A;  1JRX A;  1YY5 A;  4B66 A;  1XPY A;  5BUL A;  1FHU A;  3QJ4 A;  5IQ1 A;  5C3J A;  2WHD A;  1XAN A;  5FJU A;  3UJ2 A;  3QSM A;  3DG3 A;  5FJP A;  3CT2 A;  3I6T A;  3THU A;  2RGH A;  3AMZ A;  3MY9 A;  3UTH A;  1SB3 B;  4YT0 A;  1DXL A;  4Z26 A;  2JAE A;  3NO1 A;  4YXD A;  1PS9 A;  3UCL A;  2AQJ A;  4HNC A;  4OPG A;  2HQM A;  4EIP A;  3NVY B;  3DJE A;  3I6E A;  1PXB A;  4Y4L A;  1NHQ A;  4WX1 A;  2ZZC A;  1COY A;  3ABV A;  3M12 A;  1EC9 A;  3ZLG A;  3K7M X;  2C7G A;  2PS2 A;  1SJB A;  2XLS A;  4BV6 A;  3M13 A;  1OEP A;  5FMH A;  1BKW A;  1VQZ A;  5C2T A;  4H4S A;  2PHH A;  3UOX A;  1OJD A;  1ZKQ A;  2OKT A;  3F8P A;  1L0V A;  2PP3 A;  3A7A A;  4E5T A;  4TM1 A;  2OFJ A;  1GRG A;  1X2G A;  4OPI A;  4IHC A;  1N4V A;  2FJE A;  3UKL A;  1PXC A;  2C70 A;  2XFN A;  4ZOH B;  1YQ4 A;  2GAG B;  2XVH A;  3TJI A;  3NFU A;  5JRB A;  1GOS A;  4H4R A;  1ELI A;  3H4K A;  3CND A;  3VFC A;  3VCN A;  4HCH A;  5KWF A;  1VG0 A;  4USR A;  1XHC A;  3ZVI A;  2RAB A;  4EWJ A;  4G6G A;  2WS3 A;  4CCQ A;  3P93 A;  2X8C A;  3KU9 A;  3NN6 X;  3NG7 X;  3ALM A;  4MKS A;  2B9Y A;  3UKP A;  3KUM A;  3JSK A;  2FKP A;  3P4P A;  2OZ8 A;  1KDG A;  3AEG A;  5DBJ A;  2VVL G;  3AEA A;  3V3N A;  3EUB 3;  1REO A;  4OPC A;  3VC5 A;  4G8T A;  2GB0 A;  3R9U A;  3NK0 X;  3A7U A;  2GAH B;  4ZCC A;  2FJB A;  4GFI A;  3SFE A;  3UTG A;  3PVC A;  3SSZ A;  4DN1 A;  3BJS A;  3PS9 A;  4JNQ A;  4H4T A;  4C77 A;  1IUU A;  4YTM A;  4H2P A;  1GV4 A;  1L9E A;  4HB9 A;  2BK5 A;  2XYO A;  1EC8 A;  2XVI A;  3UJE A;  1E9I A;  2WU2 A;  3DME A;  1H7W A;  1PDZ A;  3GMC A;  2F5Z A;  3CIR A;  1CJ4 A;  2JBV A;  3ITJ A;  2XFP A;  1EL7 A;  3DIP A;  5BOF A;  3AE3 A;  1GRA A;  1WUE A;  3PG6 A;  4IVM B;  3DJG X;  4ZA0 A;  3C96 A;  1K4Q A;  4H4Y A;  2XLP A;  3TW9 A;  1H6V A;  3KD9 A;  5JCM A;  3NVZ B;  1S3B A;  4OCG A;  5KOX A;  4IT1 A;  1RVK A;  2X99 A;  3V3O A;  3KKJ A;  3RCY A;  2BAB A;  4RG3 A;  3ZVH A;  3PWG A;  5JCN A;  4KT2 A;  3NVV B;  4GDP A;  4GRT A;  1H82 A;  3Q45 A;  2C3D A;  3BOX A;  1EBD A;  1MDR A;  1KN0 A;  3F8R A;  3DG7 A;  1NAA A;  4OPU A;  1AOG A;  1PJ7 A;  1HYU A;  1FL2 A;  3QVR A;  3UXK A;  3TQP A;  3AE9 A;  3ALL A;  4GYP C;  3MQT A;  1KNP A;  2RGO A;  1ZMD A;  5KMP A;  1F8R A;  2GR1 A;  2OPJ A;  3VC6 A;  1NHP A;  1EL8 A;  3FPZ A;  4H50 A;  3UCC A;  3AE8 A;  3VRB A;  3P9U A;  2VQB A;  2EQ8 A;  5HY5 A;  4DX3 A;  3WE0 A;  2CDU A;  2W3S A;  3DER A;  1ECQ A;  3L8K A;  2XFU A;  1TYP A;  3CXB A;  4DWD A;  4OPT A;  2BK4 A;  4UDQ A;  4H7U A;  1MNS A;  1P2H A;  2YQU A;  4K7Z A;  1STZ A;  3R1Z A;  3SX6 A;  5GSN A;  4U8J A;  3R25 A;  2AL1 A;  5TR3 A;  3SQP A;  1S2Y A;  4X9M A;  1JRO A;  2XFO A;  4G6H A;  2YLW A;  2BCG G;  1DNC A;  1OJA A;  3FBS A;  3CXO A;  3HZL A;  4ICY A;  4TM0 A;  1JPD X;  4KX6 A;  1ZY8 A;  2EQ6 A;  4U8O A;  1KD0 A;  4H83 A;  3MSY A;  2PP1 A;  1KF6 A;  3FMW A;  3LJP A;  3UP5 A;  3NK1 X;  2R45 A;  1PN0 A;  2NVK X;  3CGB A;  3MUC A;  4IL0 A;  2V61 A;  4TVY A;  3FCP A;  3AM9 A;  3OC4 A;  3QSE A;  2Q0L A;  2YG7 A;  2V5Z A;  4K22 A;  1N63 C;  4U2T A;  4I58 A;  3QN3 A;  1PDH A;  3IHM A;  3ALJ A;  3T9P A;  4K8G A;  4CBQ A;  4DNA A;  2YR4 A;  2I0Z A;  2C76 A;  1JRZ A;  3UKH A;  4GAP A;  5KMQ A;  4H19 A;  3DK9 A;  4H4P A;  3CK5 A;  3UTE A;  1JEH A;  1DJN A;  1W4X A;  2YWL A;  4BUR A;  1D4D A;  2B7R A;  4GDE A;  1H7X A;  4G7F A;  2QA2 A;  3AEB A;  2YM2 A;  3GRT A;  1DTN A;  1GTH A;  4HCL A;  3MZN A;  3CYJ A;  3RP7 A;  4K8D A;  1GRT A;  4FK1 C;  5CQF A;  4U8N A;  2BS2 A;  3D8X A;  4EQS A;  3CGE A;  1ZX9 A;  4II3 A;  4CRT A;  2NQL A;  4Y4M A;  2WU5 A;  1Q1R A;  4J1O A;  3CGD A;  2VRM A;  1H84 A;  5KRQ A;  6ENL A;  1VRQ B;  2VZ2 A;  3I4K A;  3URH A;  2WQY A;  1UKV G;  4OPL A;  3NKS A;  4A35 A;  3P4R A;  4KEM A;  4O5U A;  4USQ A;  4YSX A;  4BK1 A;  3N6H A;  3SZC A;  1CBO A;  1E7P A;  3VA8 A;  4TVW A;  2R9Z A;  3AED A;  3TWB A;  2JKC A;  4YTN A;  1GTE A;  3JVA A;  3STP A;  5CKU A;  1E1L A;  1WUF A;  4H4U A;  3N4E A;  1XS2 A;  5EOW A;  1TKK A;  2O9Z A;  1F9C A;  3H70 A;  2E3T A;  3AE1 A;  4E0V A;  4GYP A;  1CJ3 A;  5M0Z A;  2RGJ A;  4LII A;  4MJW A;  5EB4 A;  3QSS A;  2PTY A;  3D9X A;  1BF3 A;  3VR8 A;  1P48 A;  2XGZ A;  4JN9 A;  2WOI A;  1GES A;  4IP4 A;  2ACZ A;  3R10 A;  4NWZ A;  4AOX A;  5L46 A;  1FCD A;  2XLU A;  3RHA A;  1FEC A;  1B5Q A;  3GSI A;  3H12 A;  2W0H A;  2YVG A;  3EPT A;  3G5R A;  3VCC A;  3QPE A;  5KXJ A;  3RO6 A;  1GT8 A;  3IJI A;  4MMW A;  4HCD A;  5HHF A;  3R0U A;  1BWC A;  2R0G A;  2B76 A;  1IUS A;  3B6D A;  3R11 A;  2UZZ A;  2ZAD A;  2QVH A;  2POZ A;  1NEK A;  1NU5 A;  4AP3 A;  2AR8 A;  3CB3 A;  4U8I A;  2X8H A;  1FEB A;  4K5S A;  2WOW A;  2YVJ A;  3BNU A;  3UXL A;  2GGG A;  5EBK A;  1ONE A;  2GR3 A;  4H4W A;  4P9S A;  1M6I A;  1KKO A;  3DGH A;  1PBE A;  3NYF A;  3IJL A;  3B9J B;  3V76 A;  4U8M A;  5KNL A;  4A6N B;  1YEY A;  1E1N A;  2DKI A;  1B8S A;  4I59 A;  3GMB A;  2BRA A;  2Q7V A;  2XLT A;  3V3W A;  1TE6 A;  4ENL A;  3N6J A;  2H89 A;  2IVD A;  3ES8 A;  4BJZ A;  4J34 A;  4B64 A;  4HPN A;  4OVI A;  4H4Z A;  3N4F A;  4U8K A;  4Y4N A;  4F4R A;  5G5G B;  1NG4 A;  4RSL A;  3TTE A;  3T2Z A;  4K5R A;  2PGW A;  5FS8 A;  3T2Y A;  3NT6 A;  4BJY A;  2CHR A;  1D4C A;  5FS6 A;  3IHG A;  4FP1 A;  3G5Q A;  3DJD A;  3DK8 A;  1Z6L A;  2C67 A;  3FXG A;  1LPF A;  4GAV A;  3NRN A;  1MOK A;  3B3R A;  4GUV A;  4A9W A;  3SZ0 A;  4YTP A;  1V59 A;  2Y6R A;  2WPC A;  3EAN A;  3NVW B;  3T31 A;  1KSU A;  5M10 A;  3DFH A;  4NTD A;  4NZH A;  4EMW A;  2HNE A;  2W3R A;  2ZZB A;  2YLX A;  3CMM A;  1BGN A;  4H1Z A;  1CC4 A;  4JNA A;  2YAU A;  1JNZ A;  3LB8 A;  3OZ2 A;  2PMQ A;  2OLO A;  2BS4 A;  2ZBW A;  1LV0 A;  2YVF A;  1FO4 A;  1H81 A;  4FDC B;  4H4Q A;  2MNR A;  3HYX A;  3GDN A;  4PAA A;  1N5W C;  2TMD A;  1PBD A;  1D5T A;  2VOU A;  3DK4 A;  4AOS A;  2ONE A;  1JOA A;  1PJ5 A;  1TDF A;  1EC7 A;  3NGC X;  1SEZ A;  1JU2 A;  3BSM A;  1V97 A;  1ZMC A;  5G5H B;  1NEN A;  3RRA A;  3IC9 A;  4ROP A;  3RIT A;  1O95 A;  2DW7 A;  3SYI A;  1H86 A;  1PBC A;  4X9N A;  2JB1 A;  4DSH A;  4YWS A;  3SN4 A;  2PGE A;  2O56 A;  1GXF A;  3ATR A;  2CVJ A;  4A3R A;  3SJN A;  3AE4 A;  2C66 A;  1TDE A;  4REK A;  4X4J A;  3GD6 A;  1X2H A;  2Z5Y A;  3FJ4 A;  2OA1 A;  1D4E A;  5KMR A;  3V4B A;  3CNS A;  3T14 A;  1B4V A;  1N60 C;  2ARD A;  3B97 A;  2WPE A;  3UJS A;  3GRS A;  5FS7 A;  3UOY A;  2GDQ A;  4ZCW A;  2R0C A;  3C4N A;  4HNL A;  2W55 A;  2PTX A;  3TWA A;  4A65 A;  3OPS A;  3HYW A;  1E1K A;  2BAC A;  3S61 A;  2J3N A;  1F6M A;  1VDC A;  3SZW A;  4JN8 A;  3RR1 A;  3UGV A;  1NPX A;  1FIQ B;  2OG9 A;  4TM4 A;  3RED A;  1MUC A;  2C73 A;  4A6G A;  4DXK A;  2YR6 A;  2APG A;  3LXD A;  2OX4 A;  3T2K A;  4K2X A;  1S7M A;  2A87 A;  3K7Q X;  3UKF A;  3NYC A;  1NHR A;  2V6O A;  3D46 A;  4AT0 A;  3PFR A;  2OAL A;  4GR1 A;  4IA6 A;  1KCZ A;  5U25 A;  2YG5 A;  2PCE A;  2FYM A;  3ICR A;  1L8P A;  1QJD A;  1OJT A;  2PPG A;  1EL9 A;  3JZU A;  3I3L A;  4CY6 A;  1S2Q A;  3GO2 A;  5BVA A;  3DG6 A;  1NHS A;  3GD3 A;  2BC1 A;  2NPX A;  2AL2 B;  1RP0 A;  4M0X A;  2GGI A;  1K0L A;  1N62 C;  1LJ1 A;  2YM1 A;  4H2Q A;  3KLJ A;  2GRT A;  2JB3 A;  3AEF A;  4Z25 A;  4O5Q A;  1F8W A;  3HYV A;  3BHF A;  1Y56 A;  3DDM A;  5JCL A;  5EU9 A;  2R46 A;  2W54 A;  1TDO A;  3AYL A;  3OZY A;  3DJJ A;  1CL0 A;  1ONF A;  4IL2 A;  4J57 A;  3OTR A;  3EEZ A;  3P0W A;  1PBB A;  2GEW A;  2QJJ A;  3AEC A;  2EQ9 A;  5KVH A;  4ZN0 A;  2YG3 A;  2QJM A;  4DYE A;  3F8D A;  1BQG A;  2JK6 A;  3GDP A;  2GMJ A;  2QDE A;  3ES7 A;  3KPF A;  3QLD A;  1GSN A;  1FEA A;  2GL5 A;  2OVL A;  1N1P A;  4Z2T A;  1SJA A;  3H8I A;  3SBF A;  1FHV A;  2WP6 A;  2GMH A;  2QQ6 A;  2FBW A;  1N4W A;  1P2E A;  3BNM A;  1DJQ A;  4XXG A;  3UKA A;  2WBA A;  2HXU A;  3GD4 A;  3H8A A;  2C64 A;  4NNJ A;  1CC6 A;  3DGB A;  1K0J A;  3NHO X;  4A79 A;  3OW1 A;  3SFD A;  3UTF A;  4TLZ A;  3D47 A;  5HXI A;  3ENL A;  2Y6Q A;  4Z2U A;  4A6N A;  4JHM A;  2H88 A;  2BC0 A;  5IPY A;  3RP6 A;  1X31 B;  4KWS A;  1JNR A;  3FV9 A;  3CPH G;  1IUV A;  3NTD A;  4J3Z A;  4JQ9 A;  3NK2 X;  1PBF A;  3ETR B;  3GC2 A;  3RNM A;  3AEE A;  4UDP A;  3TJ4 A;  1RM6 B;  3AE7 A;  1XPQ A;  4D03 A;  4CNK A;  3AWI A;  1ZXI C;  4E8G A;  4CY8 A;  3AYJ A;  4EQR A;  1B37 A;  3UOZ A;  4IV9 A;  4J33 A;  1GND A;  1YKJ A;  3OP2 A;  1YQZ A;  2PYX A;  4GF7 A;  3CNP A;  2V60 A;  4BK2 A;  1LVL A;  1LQU A;  1KNR A;  3D1C A;  1JDF A;  2WOV A;  2GSH A;  2C4C A;  2OQY A;  4EQX A;  2Q6U A;  5EB5 A;  3UP4 A;  3ZYX A;  3EF6 A;  1TZZ A;  3A7R A;  3MKC A;  4B68 A;  3NNE A;  1CF3 A;  1E1M A;  4CCR A;  5ER0 A;  2GVC A;  3QVP A;  1SJD A;  2V3B A;  4N9X A;  2XH7 A;  1NDA A;  1PXA A;  3P4S A;  3SZF A;  1CJ2 A;  2BK3 A;  4DGK A;  3SQS A;  2XLR A;  3H8L A;  3CGC A;  1R0M A;  3Q4D A;  3AD8 B;  1PDY A;  2P8B A;  3LOV A;  4A7A A;  1QLB A;  3JW7 A;  2XH2 A;  2OZT A;  2GV8 A;  2R4E A;  1T3Q C;  2B7S A;  3V5C A;  4U8P A;  1KFY A;  1OJ9 A;  3AB1 A;  4J31 A;  3QFA A;  1GET A;  1GER A;  1PHH A;  2XCG A;  3K1G A;  2A8X A;  4YSZ A;  4YSH A;  3LZW A;  1D7Y A;  4GCM A;  2VRL A;  3AXB A;  1LQT A;  4ZCD A;  2YR5 A;  4FK1 A;  2DW6 A;  4EM3 A;  4U2L A;  3SN1 A;  2Q0K A;  2BS3 A;  2GQW A;  2E1M A;  3CAW A;  4CNJ A;  4E4F A;  3KA7 A;  5U63 A;  2XFQ A;  2HXT A;  2JB2 A;  1EBG A;  2PU1 A;  3HPF A;  4EIQ A;  2P88 A;  3V5F A;  3L5O A;  4NEW A;  1M64 A;  3R07 C;  3GY1 A;  4OPD A;  4IP5 A;  1LTX R;  3EKG A;  3NN0 X;  2OAM A;  4DSG A;  1ZOY A;  2C65 A; 
#chains in the Genus database with same CATH homology
 1PDH A;  4WCT A;  3IHM A;  3P4Q A;  4A65 A;  3C4A A;  1GRH A;  3ALJ A;  4A5L A;  1DOC A;  5U1O A;  1GPE A;  3M0O A;  1DOD A;  1E1K A;  3HYW A;  3GWD A;  1IUT A;  4DNA A;  2BAC A;  2YG4 A;  2YR4 A;  3ISH A;  2I0Z A;  3ATQ A;  4CBQ A;  2C76 A;  3S61 A;  2J3N A;  2IID A;  1F6M A;  1JRZ A;  3NIX A;  3BI2 A;  4GAP A;  4HA6 A;  5KMQ A;  3UKH A;  4G9K A;  1VDC A;  1ZDL A;  3DK9 A;  4H4P A;  4J56 A;  3AD7 B;  3S5W A;  3UTE A;  4C3X A;  3SZW A;  1JEH A;  5IQ4 A;  1DJN A;  1GRF A;  1W4X A;  2YWL A;  1K0I A;  2BRY A;  4BUR A;  1D4D A;  2B7R A;  4ADW A;  4GDE A;  4NEV A;  2V3A A;  5HYM A;  4ECH A;  1H7X A;  4IA5 A;  3KVE A;  4EQW A;  1NPX A;  3L1R A;  4TM4 A;  1EL5 A;  1RYI A;  2QA2 A;  3RED A;  3AEB A;  4AT2 A;  2YM2 A;  3GRT A;  3LAD A;  1GTH A;  2C73 A;  2WES A;  1DOB A;  2BCP A;  3ICT A;  1H2I A;  3RP7 A;  4K8D A;  3NH3 X;  2YR6 A;  1GRT A;  3K7T A;  2DKH A;  2XDO A;  4FK1 C;  4XWZ A;  5KVI A;  1TDK A;  2APG A;  3LXD A;  5CQF A;  4U8N A;  2BS2 A;  3T2K A;  3D8X A;  4EQS A;  2AAQ A;  4K2X A;  3K30 A;  3CGE A;  2C75 A;  1S7M A;  1ZX9 A;  3EAO A;  2A87 A;  2GR2 A;  2E4G A;  3K7Q X;  2A89 A;  4II3 A;  3UKF A;  3BI5 A;  4Z44 A;  4CRT A;  4Y4M A;  1JRX A;  2WU5 A;  1YY5 A;  1Q1R A;  3NYC A;  4B66 A;  4B63 A;  1NHR A;  2V6O A;  1CJC A;  5BUL A;  4AT0 A;  3QJ4 A;  3CGD A;  2VRM A;  5IQ1 A;  2OAL A;  5C3J A;  2WHD A;  1YQ3 A;  1XAN A;  4GR1 A;  1H84 A;  4IA6 A;  5U25 A;  3QSM A;  5KRQ A;  2YG5 A;  3ICR A;  1E6E A;  1VRQ B;  2VZ2 A;  1QJD A;  3URH A;  2WQY A;  1UKV G;  4OPL A;  3NKS A;  1OJT A;  1EL9 A;  3I3L A;  3P4R A;  4CY6 A;  2RGH A;  4O5U A;  1S2Q A;  4USQ A;  1F3P A;  4YSX A;  3UTH A;  4BK1 A;  5BVA A;  4I58 A;  4G73 A;  1NHS A;  3GD3 A;  3SZC A;  4B69 A;  2BC1 A;  5KMS A;  1CBO A;  1DXL A;  4YT0 A;  2WPF A;  1E7P A;  2IVE A;  4Z26 A;  2JAE A;  4YXD A;  2NPX A;  2YLS A;  3VRA A;  2R9Z A;  3AED A;  2B9W A;  1RP0 A;  1PS9 A;  2JKC A;  3UCL A;  4YTN A;  2TPR A;  1GTE A;  1K0L A;  2AQJ A;  4OPG A;  1LJ1 A;  2YM1 A;  2HQM A;  4EIP A;  3DJE A;  4H2Q A;  3KLJ A;  1PXB A;  2GRT A;  1DOE A;  2JB3 A;  1NHQ A;  4WX1 A;  4Y4L A;  2ZZC A;  1COY A;  3AEF A;  5CKU A;  3ABV A;  4Z25 A;  1E1L A;  3M12 A;  4H4U A;  4XWR A;  4O5Q A;  3T37 A;  1F8W A;  5EOW A;  2O9Z A;  3HYV A;  4H2N A;  1D7L A;  3K7M X;  3BHF A;  2C7G A;  3AE1 A;  2XLS A;  4BV6 A;  1Y56 A;  3M13 A;  1NG3 A;  1VG9 A;  4E0V A;  5JCL A;  4J2W A;  1CJ3 A;  5M0Z A;  4H4V A;  2R46 A;  1TDO A;  5FMH A;  3AYL A;  3AYI A;  1BKW A;  2RGJ A;  3CNJ A;  5C2T A;  4H4S A;  1L9C A;  2PHH A;  3UOX A;  4LII A;  3DJJ A;  1CL0 A;  3IWA A;  1OJD A;  1ONF A;  3KPK A;  4MJW A;  1ZKQ A;  4J57 A;  5EB4 A;  3F8P A;  3QSS A;  1L0V A;  3D9X A;  1BF3 A;  2QAE A;  1PBB A;  4TM1 A;  3VR8 A;  1GRG A;  4G74 A;  4YSY A;  2GEW A;  3DA1 A;  4OPI A;  3AEC A;  4JN9 A;  2EQ9 A;  5KVH A;  2WOI A;  1N4V A;  1GES A;  1IJH A;  2FJE A;  2ACZ A;  1IUW A;  4IVO B;  4KPR A;  4NWZ A;  3UKL A;  4ZN0 A;  4AOX A;  1PXC A;  5L46 A;  2C70 A;  2YG3 A;  2XFN A;  1FCD A;  2XLU A;  1PJ6 A;  3RHA A;  1FEC A;  1B5Q A;  1O5W A;  4B65 A;  3GSI A;  1YQ4 A;  2W0H A;  2GAG B;  2XVH A;  2WP9 A;  2JK6 A;  3F8D A;  3GDP A;  2VVL A;  3CPI G;  2YVG A;  3EPT A;  2GMJ A;  3RP8 A;  2R4J A;  5JRB A;  1GOS A;  4B1B A;  2FJA A;  4H4R A;  3G5R A;  1ELI A;  3KPF A;  3H4K A;  3CND A;  5KXJ A;  1GSN A;  1FEA A;  1GT8 A;  5KWF A;  3LZX A;  1VG0 A;  4USR A;  1XHC A;  4G6G A;  2RAB A;  1ZP0 A;  4YKF A;  5KOW A;  2WS3 A;  5HHF A;  2WP5 A;  4CCQ A;  1H83 A;  3BI4 A;  4H4X A;  1N1P A;  2X8C A;  3KU9 A;  3NN6 X;  5J7X A;  3CN8 A;  5BUK A;  1BWC A;  4Z2T A;  3H8I A;  3NG7 X;  3ALM A;  2R0G A;  2B76 A;  3Q9T A;  2B9Y A;  1IUS A;  3B6D A;  3UKP A;  3JSK A;  2WP6 A;  2Z5X A;  2UZZ A;  2GMH A;  3P4P A;  1KDG A;  3GWF A;  3AEG A;  1NEK A;  4AP3 A;  1FOH A;  5DBJ A;  2FBW A;  1N4W A;  2VVL G;  2AR8 A;  3AEA A;  1P2E A;  1QO8 A;  1REO A;  3BNM A;  3V3N A;  4U8I A;  2X8H A;  1DJQ A;  1VQW A;  4OPC A;  4XXG A;  3UKA A;  1ZK7 A;  1FEB A;  2GF3 A;  2WBA A;  4K5S A;  2GB0 A;  3R9U A;  3GD4 A;  2WOW A;  2YVJ A;  2C64 A;  3NK0 X;  3BNU A;  1O94 A;  4NNJ A;  2GAH B;  1CC6 A;  2YG6 A;  2FJB A;  2GR0 A;  3CTY A;  4ZCC A;  2CFY A;  3SFE A;  5EBK A;  2X3N A;  2GR3 A;  3UTG A;  3PVC A;  3GYX A;  4H4W A;  4P9S A;  1Q1W A;  1M6I A;  3BHK A;  3DH9 A;  3DGH A;  1K0J A;  1PBE A;  3NHO X;  3NYF A;  4Z43 A;  1TRB A;  2GQF A;  4A79 A;  3V76 A;  4U8M A;  3PS9 A;  3SFD A;  4JNQ A;  4TLZ A;  3UTF A;  1JRY A;  4H4T A;  4C77 A;  1IUU A;  4YTM A;  4H2P A;  5BRT A;  1GV4 A;  1L9E A;  4HB9 A;  2BK5 A;  2XYO A;  4LA1 A;  5KNL A;  2XVI A;  5HXI A;  2B9X A;  2Y6Q A;  4A6N B;  2FJD A;  4A6N A;  4Z2U A;  1E1N A;  2H88 A;  2WU2 A;  2BC0 A;  1CHU A;  3DME A;  5IPY A;  3RP6 A;  3QFB A;  1H7W A;  3ZDN A;  1X31 B;  1CC2 A;  1JNR A;  2DKI A;  1B8S A;  3FG2 P;  1GRE A;  2C72 A;  3ICS A;  3GMC A;  4I59 A;  3GMB A;  3CPH G;  1IUV A;  2F5Z A;  3NTD A;  4JQ9 A;  3AE2 A;  1GAL A;  3CIR A;  4C3Y A;  2BRA A;  3O0H A;  2Q7V A;  2XLT A;  3GYI A;  1PBF A;  3NK2 X;  4JY3 A;  3RNM A;  4TM3 A;  2VVM A;  3VR9 A;  1CJ4 A;  2JBV A;  3AEE A;  2H89 A;  3ITJ A;  4EMJ A;  4UDP A;  2XFP A;  1EL7 A;  3AE7 A;  4UDR A;  2IVD A;  3VRD B;  4JY2 A;  1XPQ A;  4D03 A;  3AE3 A;  4BJZ A;  1GRA A;  4J34 A;  4CNK A;  3COX A;  3CNT A;  4B64 A;  3PG6 A;  4IVM B;  2WEU A;  4OVI A;  4H4Z A;  4H2R A;  3DJG X;  3AWI A;  1Q9I A;  4NTE A;  3C96 A;  4FX9 A;  1K4Q A;  4H4Y A;  1ZOV A;  4U8K A;  4Y4N A;  2XLP A;  1NG4 A;  4RSL A;  3GYJ A;  1H6V A;  4CY8 A;  3AYJ A;  3T2Z A;  4EQR A;  4K5R A;  1B37 A;  5FS8 A;  3UOZ A;  5GRT A;  3T2Y A;  3NT6 A;  3FIM B;  3KD9 A;  4BJY A;  4Z24 A;  3CPJ G;  1XDI A;  3SM8 A;  3IF9 A;  4IV9 A;  1D4C A;  5FS6 A;  4J33 A;  3SXI A;  5JCM A;  2BYB A;  2OLN A;  1GND A;  1S3B A;  3IHG A;  4NTC A;  1YKJ A;  3G5Q A;  5FS9 A;  3DJD A;  3DK8 A;  4OCG A;  5KOX A;  1Z6L A;  2C67 A;  4LU6 A;  3E1T A;  2X99 A;  3V3O A;  1YQZ A;  2PYX A;  4GF7 A;  3CNP A;  1KSS A;  2V60 A;  4BK2 A;  1LVL A;  3KKJ A;  1LPF A;  1LQU A;  1KNR A;  4GAV A;  3NRN A;  1MOK A;  3B3R A;  4GUV A;  2BAB A;  4RG3 A;  3D1C A;  4A9W A;  3SZ0 A;  4YTP A;  2WOV A;  2XVE A;  1V59 A;  2Y6R A;  2WPC A;  2YLT A;  2XVJ A;  3EAN A;  1S3E A;  2C4C A;  4EQX A;  2E5V A;  5JCN A;  3T31 A;  2BA9 A;  1KSU A;  5M10 A;  4NTD A;  2Q6U A;  4EMW A;  4NZH A;  5EB5 A;  1OJC A;  3UP4 A;  3I6D A;  3ZYX A;  2ZZB A;  3EF6 A;  4APN A;  2YLX A;  4GDP A;  4B68 A;  2C3C A;  3CMM A;  4GRT A;  1H82 A;  3NNE A;  4C74 A;  4U2S A;  3AD9 B;  1BGN A;  2C3D A;  1CF3 A;  1F8S A;  1EBD A;  5JCI A;  2WET A;  1CC4 A;  3DGZ A;  4JNA A;  1KN0 A;  1E1M A;  2YAU A;  3F8R A;  1JNZ A;  5J60 A;  4CCR A;  3LB8 A;  1N4U A;  1NAA A;  3OZ2 A;  5ER0 A;  2OLO A;  1AOG A;  2GVC A;  4OPU A;  2BS4 A;  4YWO A;  2ZBW A;  1PJ7 A;  1HYU A;  3QVP A;  1LV0 A;  1FL2 A;  4C5O A;  4YKG A;  3QVR A;  2YVF A;  2V3B A;  4PAB A;  1H81 A;  4N9X A;  3AE9 A;  3ALL A;  1KNP A;  4AP1 A;  4FDC B;  4H4Q A;  2QA1 A;  2VQ7 A;  1NDA A;  2RGO A;  4EM4 A;  1PXA A;  3HYX A;  1ZMD A;  2XVF A;  4B67 A;  1F8R A;  5KMP A;  2GR1 A;  3GDN A;  3P4S A;  3AE5 A;  4PAA A;  4EMI A;  3SZF A;  1NHP A;  1EL8 A;  1CJ2 A;  4H50 A;  1PBD A;  2BK3 A;  2TMD A;  3FPZ A;  1D5T A;  4DGK A;  3AE8 A;  2XLR A;  2VOU A;  3DK4 A;  2R0P A;  3T0K A;  3H8L A;  3VRB A;  2WDR A;  3P9U A;  4AOS A;  3CGC A;  2VQB A;  1JOA A;  2EQ8 A;  1PJ5 A;  1TDF A;  3AD8 B;  5HY5 A;  2X8G A;  2ZZ0 A;  1GEU A;  1L9D A;  3NGC X;  1SEZ A;  3WE0 A;  3P1W A;  1JU2 A;  3LOV A;  2CDU A;  1ZMC A;  4A7A A;  4Z2R A;  1NEN A;  3L8K A;  1QLB A;  2XFU A;  1TYP A;  3IC9 A;  1MO9 A;  2X50 A;  1O95 A;  4OPT A;  2BK4 A;  4UDQ A;  2CUL A;  3SYI A;  1H86 A;  4H7U A;  2GV8 A;  2R4E A;  1PBC A;  1P2H A;  5LV9 A;  4X9N A;  3G5S A;  2YQU A;  2JB1 A;  2B7S A;  4DSH A;  4JDR A;  4U8P A;  1KFY A;  4U8L A;  1OJ9 A;  4J36 A;  4K7Z A;  3AB1 A;  4J31 A;  3SX6 A;  4UP3 A;  5GSN A;  3QFA A;  4U8J A;  1GET A;  1GER A;  4TLX A;  5TR3 A;  3SQP A;  1E39 A;  1PHH A;  5JCK A;  1S2Y A;  2XCG A;  4X9M A;  2XFO A;  1GXF A;  2A8X A;  3ATR A;  2WDQ A;  1IUX A;  4G6H A;  2YLW A;  3ADA B;  2BCG G;  3UKQ A;  1DNC A;  2CVJ A;  4YSZ A;  1OJA A;  3SGL A;  4YSH A;  3FBS A;  3LZW A;  1D7Y A;  1BZL A;  1TYT A;  2C66 A;  3AE4 A;  3HZL A;  4M52 A;  4GCM A;  1TDE A;  2VRL A;  3AXB A;  1LQT A;  4ICY A;  4II2 A;  4TM0 A;  4REK A;  4ZCD A;  4KX6 A;  4X4J A;  3SY4 A;  2YR5 A;  4FK1 A;  4EM3 A;  3PO7 A;  1ZY8 A;  4BK3 A;  3Q6J A;  4U2L A;  2EQ6 A;  2Q0K A;  1BGJ A;  3NTA A;  2Z5Y A;  2GH5 A;  2BS3 A;  4U8O A;  4D04 A;  2GQW A;  2E1M A;  2OA1 A;  3UKK A;  2EQ7 A;  1D4E A;  3UOV A;  1TDN A;  1Y56 B;  1KF6 A;  3FMW A;  3LJP A;  5KMR A;  4CNJ A;  2BXR A;  4A99 A;  5U63 A;  3KA7 A;  3UP5 A;  1GRB A;  2WDV A;  3NK1 X;  3CNS A;  2R45 A;  2YLR A;  1B4V A;  1PN0 A;  3T14 A;  2XFQ A;  2NVK X;  1Y0P A;  3CGB A;  2JB2 A;  2QCU A;  4RG4 A;  2ARD A;  4EIQ A;  2V61 A;  2WPE A;  2YLZ A;  3L5O A;  3NYE A;  3AE6 A;  1RSG A;  4NEW A;  3OC4 A;  1M64 A;  3GRS A;  5FS7 A;  3QSE A;  2Q0L A;  3UOY A;  3NLC A;  2YG7 A;  4OPD A;  2R0C A;  3C4N A;  1MXT A;  2V5Z A;  1LTX R;  2BXS A;  3II4 A;  3NN0 X;  4K22 A;  2OAM A;  3VQR A;  4U2T A;  4DSG A;  1ZOY A;  2C65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...