4LIIA

Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (aifm1) from homo sapiens at 1.88 a resolution
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
Knots found
sequence length
487
structure length
474
Chain Sequence
QDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (AIFM1) from Homo sapiens at 1.88 A resolution
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase, apoptosis
molecule keywords Apoptosis-inducing factor 1, mitochondrial
total genus 147
structure length 474
sequence length 487
other databases KnotProt 2.0: S -31
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4liiA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4liiA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4liiA01
4Y4LA 3F8PA 3KLJA 5KOWA 1K0IA 4YSYA 3CGCA 2OALA 1JOAA 3NLCA 4ZCCA 2GR2A 4NEWA 2H89A 1GT8A 4GF7A 1E1KA 4OPIA 2E5VA 1JNRA 3G5QA 2YLRA 4ADWA 2QCUA 5KWFA 3H4KA 3NH3X 3AYJA 3GYJA 3AE6A 4H4RA 3QVPA 2R9ZA 3AE2A 1NEKA 3LZWA 2YG5A 1GRAA 4J34A 1E1NA 3AE7A 4K5SA 3BI2A 2QA1A 2ZZ0A 3HZLA 2I0ZA 2BC0A 1ZMDA 2Q6UA 5TR3A 4EIQA 2BK4A 1GTHA 1EL9A 2GR0A 3AD7B 2X99A 1D7YA 2J3NA 2XLSA 5FS7A 2NPXA 3CN8A 3RP6A 1OJDA 2VOUA 3B6DA 1NENA 1VG0A 3CGEA 2WDRA 4OPGA 4Z26A 2IVEA 4ZCDA 3RP7A 2XLRA 2BS2A 2NVKX 2WOVA 2FJAA 1JU2A 1QO8A 4EQXA 1IUUA 1YKJA 3AD9B 1L0VA 2WBAA 4Z43A 4CNJA 1ONFA 1PBFA 1NHQA 3CNPA 1ZMCA 2AR8A 2GAHB 1F6MA 2A8XA 3AE4A 3CNSA 1PBBA 4B68A 3QSSA 4FDCB 1Q1RA 4A79A 4J33A 5JCKA 4UDQA 3AWIA 4AT2A 1BWCA 1V59A 1TYTA 2EQ8A 3CGDA 4H4PA 2WS3A 3AB1A 1VDCA 3AEEA 1FL2A 4Z2UA 2YM2A 1PBDA 3V3NA 3URHA 5FS9A 3GYIA 4U8IA 3NKSA 2PHHA 4JY3A 1NDAA 2XVJA 3DMEA 3KD9A 2X8HA 1P2EA 1Z6LA 1E1MA 4N9XA 3S61A 3O0HA 5KVHA 2BCPA 2XFPA 1E6EA 3JSKA 3K7QX 3ATQA 3QJ4A 2RABA 1PHHA 4D04A 4H4WA 4KPRA 3FBSA 5BUKA 2V61A 2BC1A 3CNJA 2YLZA 3NRNA 1GNDA 5U25A 1F8WA 3C96A 3AYIA 4I59A 3NYCA 4H2QA 4H4TA 2YM1A 4ICYA 1H7WA 4IVMB 2C65A 4H7UA 1CBOA 4O5QA 3UKQA 2VVLA 4OVIA 1GPEA 1YY5A 4CCRA 4JQ9A 2C70A 4O5UA 4H50A 1DOCA 1GREA 2VVMA 1LQTA 2R45A 3IWAA 3E1TA 1VQWA 4H4ZA 2WPFA 2BACA 2TPRA 1XANA 1B37A 2A89A 5EB4A 1RP0A 3D8XA 3T37A 1NG3A 3QSMA 5EB5A 2GV8A 2C72A 1S3BA 1SEZA 1YQZA 2YQUA 2OLNA 3ALJA 3M12A 3P9UA 3D1CA 1CC6A 3AD8B 4A6NB 2WPEA 1GRBA 1GRTA 1KFYA 3AE5A 3H8IA 4K8DA 2C3CA 2YG3A 2WDQA 3AE8A 4M52A 4A65A 1ZDLA 4Z2RA 4X9NA 1F8SA 4I58A 4C74A 1B5QA 3ICRA 1ZOYA 2H88A 4TM1A 1IUVA 3NK0X 2DKHA 4JDRA 1B4VA 4H4UA 3UKPA 3ICSA 3ABVA 2B9XA 1IUSA 2C67A 2WU5A 1M64A 1TDEA 2WESA 3DJGX 2EQ9A 2ACZA 2IIDA 3M13A 4APNA 4U8OA 3GRTA 1GRFA 1CF3A 2E1MA 1KNRA 3VQRA 1E39A 1LVLA 3NYEA 1GOSA 3CGBA 2WETA 5FS6A 4H4XA 2VQBA 4ECHA 4U8LA 4K5RA 1JRZA 4Y4NA 2Y6QA 4XXGA 2PYXA 2YLTA 5U1OA 1COYA 1VG9A 3NTAA 1Y56B 2WP5A 2BYBA 5U63A 1S3EA 4FK1A 4H2RA 3Q9TA 1FEBA 1N4WA 1REOA 4YWOA 1VRQB 2JB2A 2CFYA 4GDEA 4IVOB 1JEHA 3Q6JA 2B7RA 4NTCA 3ATRA 3UKFA 2BS4A 2V3AA 4YSXA 4J56A 5FS8A 1Q1WA 1CHUA 1O95A 1TDKA 2ARDA 3ADAB 3P4RA 4XWRA 1TDOA 3P4SA 4OPDA 1D4CA 2XVIA 1PXCA 1CJ2A 2YG4A 3AYLA 3EPTA 4H4SA 3EF6A 2WOIA 1KSUA 1B8SA 4LIIA 1GTEA 3FMWA 3KA7A 2XFQA 4OPUA 1BGNA 4RG4A 3NNEA 4YTPA 2YR5A 4IA5A 3R9UA 4BK1A 1NAAA 3AEAA 1D7LA 4U2LA 1L9DA 5ER0A 3L8KA 4BV6A 3F8DA 3GDPA 4LU6A 2C73A 3GD3A 2FJDA 3GSIA 1S2YA 4BJZA 2YG7A 4AOSA 3II4A 2Z5XA 1EBDA 2HQMA 1GXFA 2V6OA 3P4QA 2GR1A 5JCIA 1PN0A 2C64A 2XFUA 4UP3A 5FMHA 4YTNA 5C3JA 3GDNA 3GRSA 1YQ4A 3DK9A 1ZP0A 4RSLA 3BI4A 4UDRA 2YVGA 1ZY8A 5JCNA 3IHGA 3DH9A 3UKLA 3SM8A 2GF3A 2XCGA 2JKCA 4CBQA 4B67A 3UKAA 3NN0X 3M0OA 5J60A 3SFEA 3UOZA 3VR8A 4UDPA 4GRTA 1F3PA 1H6VA 2XLUA 4H2NA 1XDIA 3GWDA 4EIPA 2YVFA 1CJ3A 5BRTA 4J57A 5M0ZA 2X50A 4Z25A 2R4JA 2VVLG 2E4GA 3NK2X 2EQ6A 4HB9A 4YTMA 4EMJA 2VQ7A 1TDNA 5KVIA 4DGKA 4YT0A 2C76A 1P2HA 4E0VA 4A6NA 3QFBA 3AE3A 4H2PA 3GWFA 3UTHA 1LTXR 2FBWA 4YSHA 5J7XA 1BGJA 5GSNA 2GR3A 2WEUA 3B3RA 1W4XA 2GQFA 1QLBA 4EM3A 2GMJA 1N4VA 4GDPA 3AEBA 5HYMA 3CPHG 4A7AA 4PAAA 1ZOVA 2YR6A 1M6IA 3C4AA 1D5TA 3LADA 4AT0A 4B64A 3DA1A 2GEWA 1NG4A 3OZ2A 2XFNA 1NHPA 5KOXA 2OAMA 4EM4A 4NTDA 2ZZCA 1AOGA 2UZZA 2AAQA 5DBJA 3COXA 2BS3A 3CIRA 3NIXA 4D03A 2V5ZA 3QVRA 4OPLA 1EL7A 1Q9IA 1Y0PA 4U8NA 5HY5A 1CJ4A 2O9ZA 2Q0LA 3LOVA 2GQWA 2BK3A 2TMDA 3BNUA 2Q7VA 3DK8A 2VZ2A 2EQ7A 4TM3A 3F8RA 2JB3A 3NHOX 5BULA 1DJQA 1KSSA 1RSGA 2JB1A 1PBEA 2R0GA 3AE1A 5IQ4A 1XPQA 2X8CA 3REDA 2GRTA 4AP3A 5BVAA 5IPYA 2W0HA 3P4PA 4YKFA 2C3DA 3SQPA 2R0PA 1K0JA 5HXIA 1EL8A 1KNPA 2YLSA 3BHFA 4B1BA 1ZK7A 1CL0A 2C7GA 2FJEA 3UKKA 3UP5A 3UP4A 4Z24A 3K7TA 4GCMA 1GRHA 1H84A 4USRA 2BCGG 1FCDA 4J31A 5HHFA 1QJDA 1NHRA 1Y56A 3DJDA 5KXJA 1PJ7A 2YR4A 1F8RA 1FOHA 2OA1A 3KPFA 1TRBA 1NHSA 3CNTA 5LV9A 1GV4A 1CC2A 2GB0A 3CPIG 3UTEA 3ISHA 3IC9A 4C77A 4U8PA 3DJEA 2GAGB 3ALMA 5CQFA 4YXDA 1DNCA 2APGA 5CKUA 4B69A 2XFOA 1FEAA 4EQWA 2XYOA 2CVJA 2Q0KA 2RGJA 4WX1A 4HA6A 2QAEA 1PJ5A 1LV0A 1LJ1A 1BF3A 4KX6A 4OPTA 4Z2TA 4BK3A 3BI5A 1BZLA 3RNMA 3UTFA 1MO9A 2DKIA 3PVCA 3DGHA 3PS9A 3KVEA 2XVFA 4YKGA 2VRMA 1MOKA 4JNQA 3QSEA 1IUXA 3WE0A 4Y4MA 2RGOA 4U2TA 2YLXA 2R0CA 2WHDA 3DJJA 3AE9A 3ITJA 4OPCA 5KRQA 1N1PA 1H7XA 2WOWA 2FJBA 1L9EA 1H81A 4TM4A 1K0LA 4TLZA 1S2QA 3EANA 3BHKA 3ICTA 1H86A 4XWZA 2CDUA 3UCLA 2WDVA 4B65A 2JK6A 3ZYXA 4AP1A 2Z5YA 2JAEA 2YVJA 3K7MX 4NTEA 2XVHA 2AQJA 5EBKA 3AEFA 3VR9A 2B9WA 1CJCA 1LQUA 3UOYA 2CULA 1IJHA 3DK4A 2QA2A 2B76A 2XLPA 2A87A 4K7ZA 1N4UA 2XVEA 4CRTA 4DSHA 1PDHA 3RHAA 1DXLA 1DOEA 1BKWA 2BA9A 4J36A 5M10A 3PO7A 1JRYA 3I3LA 4JNAA 3EAOA 3AXBA 3KKJA 1GEUA 3UOVA 1PBCA 1GSNA 1PJ6A 1UKVG 2WP9A 3UKHA 1OJ9A 3CPJG 4A5LA 4H4YA 2YG6A 1YQ3A 1NPXA 4H4VA 2V3BA 3LZXA 1OJTA 1GALA 3K30A 3LXDA 3CTYA 5EOWA 3ZDNA 1DJNA 1OJAA 1CC4A 1H83A 1PS9A 2XDOA 2WP6A 1TDFA 4EMIA 3NN6X 2R46A 1ELIA 4MJWA 2BXSA 1OJCA 4BK2A 2BK5A 1MXTA 4RG3A 1GERA 5JCLA 2JBVA 1DODA 1JNZA 4DSGA 4C3YA 3NG7X 4LA1A 2IVDA 1O5WA 2BABA 1GRGA 3P1WA 4BURA 1EL5A 4A99A 4JY2A 2C66A 4U8JA 1E7PA 1JRXA 2RGHA 4CY6A 3DGZA 3VRDB 4YSZA 4EQRA 1H82A 4BJYA 3GD4A 2C75A 1ZKQA 1TYPA 2ZZBA 4FX9A 3H8LA 2B9YA 2R4EA 3V76A 3LB8A 3L1RA 3AECA 2YAUA 3FIMB 3GMCA 4J2WA 5JCMA 2WQYA 3I6DA 1LPFA 4Z44A 4B63A 3LJPA 4H4QA 3G5SA 2GMHA 2YLWA 4REKA 1PXBA 2Y6RA 3G5RA 4OCGA 2X3NA 4GUVA 4U8MA 3SGLA 1D4EA 2VRLA 4NEVA 1FECA 2X8GA 1DOBA 3IF9A 2F5ZA 3ALLA 4USQA 1GETA 3VRBA 3KU9A 3NGCX 4U8KA 1PXAA 1KF6A 3S5WA 4CY8A 5L46A 4TM0A 3FG2P 3RP8A 5C2TA 1HYUA 1O94A 1D4DA 2WU2A 4EMWA 3BNMA 3IHMA 4C3XA 1XHCA 3VRAA 3CNDA 1K4QA 4U2SA 4X4JA 3AEDA 4B66A 2XLTA 4TLXA 5GRTA 4DNAA 4CCQA 4FK1C 3NK1X 3UTGA 4IV9A 4JN9A 4A9WA 4EQSA 1ZX9A 4X9MA 3NTDA 4AOXA 2BXRA 2ZBWA 3QFAA 4PABA 4P9SA 2WPCA 1KDGA 4CNKA 4WCTA 4C5OA 3V3OA 4K2XA 3NT6A 3OC4A 1L9CA 1X31B 4IA6A 3C4NA 2V60A 4K22A 3FPZA 3SFDA 2GH5A 4NZHA 3GMBA 5IQ1A 1IUWA 1RYIA 2OLOA 4ZN0A 4GR1A 2B7SA 3UOXA 1GESA 3AEGA 2GVCA 3NYFA 1IUTA 1E1LA 2YWLA
chains in the Genus database with same CATH superfamily
3SZCA 1K0IA 2OALA 2GR2A 2H89A 3H4KA 3GYJA 3AE6A 2PSNA 3TJIA 2YG5A 1E1NA 4M6UA 4DHGA 3CK5A 4EIQA 3CXOA 2C4CA 3CN8A 2J3NA 2XLSA 2NPXA 3PG6A 5FJTA 3IJQA 2IVEA 3PWIA 2NVKX 1N5XA 3BSMA 1IUUA 1PBFA 1NHQA 3CNPA 2GAHB 3AE4A 3CNSA 3B9JB 3SY4A 1Q1RA 4A79A 3UGVA 4GYPA 4J33A 5JCKA 3AN1A 1V59A 3CGDA 4Z2UA 3DMEA 3KD9A 1Z6LA 5KVHA 3MKCA 4A3RA 3T9PA 1FIQB 2BC1A 3SZ0A 2YLZA 1GNDA 1F8WA 3NYCA 4H2QA 4H4TA 4ICYA 1CBOA 4O5QA 1N62C 3HPFA 1GPEA 1YY5A 1KKRA 2C70A 4O5UA 4MMWA 1LQTA 3RO6A 3IWAA 3E1TA 2BACA 4H4ZA 3ENLA 1S3BA 3M12A 3FVDA 2YQUA 2O56A 3BOXA 2WPEA 1GRBA 2C3CA 4A65A 2WDQA 4FP1A 4I58A 4C74A 2H88A 4TM1A 2MNRA 2ZADA 1M64A 1TDEA 3UJ2A 2ACZA 3M13A 3VCCA 4G74A 3NRZB 3SBFA 4IZGA 1KNRA 3R11A 4H4XA 4ECHA 4K5RA 2P88A 2PCEA 3Q4DA 5U63A 1N4WA 1VRQB 2JB2A 1ONEA 4IVOB 1ZXIC 3T0KA 4NTCA 3UKFA 2OVLA 2V3AA 4J56A 5FS8A 3ADAB 2ARDA 4XWRA 2WOIA 4LIIA 3FMWA 2DW6A 3F8DA 4LU6A 3GSIA 4BJZA 2Z5XA 3P4QA 2GR1A 4GYPC 2XCGA 4CBQA 3NN0X 3UOZA 4UDPA 3S5SA 3ES8A 4J57A 5BRTA 5M0ZA 2E4GA 5KMPA 2EQ6A 4YTMA 5FJUA 1OEPA 2NQLA 4YT0A 3QFBA 3SQSA 3AE3A 1LTXR 5J7XA 5GSNA 2WEUA 3B3RA 1W4XA 3TJ4A 3SZWA 4G9KA 4GDPA 5HYMA 3CPHG 3T2KA 3NS1B 1M6IA 4AT0A 2QJNA 2XFNA 3GC2A 5BOFA 4NTDA 3NVWB 5DBJA 3CIRA 4D03A 2V5ZA 4OPLA 3BNUA 2RDXA 4TM3A 2JB3A 3NHOX 1KCZA 2XSXA 3N6JA 2AKMA 3P4PA 2C3DA 4ZOHB 2QGYA 1ZK7A 2FJEA 3UKKA 1GRHA 5KMSA 1QJDA 1NHRA 5G5HB 1DTNA 3A7UA 3CNTA 3RR1A 1GV4A 1CC2A 2GB0A 3ISHA 5CQFA 4WX1A 1BF3A 4OPTA 2GGEA 3UXKA 3SX6A 2OPJA 3UTFA 3TCSA 2XH0A 2XVFA 3DG7A 1IUXA 3WE0A 4K1WA 3DJJA 3DFHA 2WOWA 3H8AA 4B66A 3T31A 1K0LA 1P48A 2WDVA 4DYEA 2Z5YA 1PDYA 4JHMA 2JAEA 3K7MX 2AQJA 3AEFA 3VR9A 2XLPA 4DSHA 3RHAA 1DOEA 1VQZA 1BKWA 2BA9A 5J04A 5M10A 3UOVA 1PBCA 1UKVG 3CPJG 3DERA 1YQ3A 1NPXA 2V3BA 4H4VA 1OJTA 3LXDA 3CTYA 3ZDNA 1OJAA 3MZNA 1PS9A 2XDOA 1TDFA 3NN6X 2R46A 4MJWA 1OJCA 4GGBA 4C3YA 3NG7X 4LA1A 4JY2A 1E7PA 3P3BA 4YSZA 2FKPA 4EQRA 3NVVB 4H2HA 4BJYA 1JDFA 3RGTA 3LB8A 3L1RA 3IK4A 6ENLA 4J2WA 1IYXA 4B63A 3NVYB 3LJPA 4H4QA 4G8TA 3QTPA 4GUVA 4NEVA 1FECA 2X8GA 1DOBA 3KU9A 1PXAA 3HW2A 1D4DA 2WU2A 1VDVA 1XHCA 2XH7A 4X4JA 3AEDA 2XLTA 4A9WA 3UTGA 4JN9A 4EQSA 4X9MA 3VC6A 3H70A 4C5OA 3UXLA 4NZHA 2PP3A 3OPSA 1RYIA 2B7SA 3UOXA 3NYFA 1IUTA 2MUCA 4Y4LA 5KOWA 3CGCA 1JOAA 3NLCA 1GT8A 2E5VA 1JNRA 5KWFA 3AYJA 4KEMA 4H4RA 3QVPA 1NEKA 1KN0A 2BC0A 3ZLHA 1EL9A 2PA6A 2X99A 2VOUA 4Z17A 2WDRA 4ZCDA 2XLRA 1JPMA 2FJAA 1JU2A 3V4BA 1QO8A 1YKJA 2WBAA 4Z43A 1SJAA 1N63C 4CNJA 3ES7A 2AR8A 3IJIA 2A8XA 1PBBA 4B68A 3QSSA 3AWIA 1BKHA 3JZUA 3AEEA 2WS3A 1FL2A 3ETRB 1PBDA 3CXBA 3GYIA 2PHHA 2XVJA 4N9XA 3S61A 3AM9A 3O0HA 2BCPA 2XFPA 4H19A 1E6EA 3JSKA 5EU9A 3ATQA 3NVZB 3QJ4A 2RABA 4D04A 2OX4A 4H4WA 4KPRA 5BUKA 4IT1A 4FI4A 5U25A 3C96A 2OO6A 1H7WA 3TQPA 3UKQA 2VVLA 4JQ9A 2VVMA 1N60C 1B37A 1XANA 2A89A 3SSZA 4DN1A 5EB4A 3T37A 2HXTA 2GGGA 1KD0A 3D1CA 3T6CA 1E9IA 4TVWA 1GRTA 3AE5A 4M52A 1F8SA 1ZOYA 5KMQA 3PFRA 3SZFA 1IUVA 3NK0X 2DKHA 4JDRA 3ZLFA 3I4KA 3UKPA 1IUSA 4F4RA 2WESA 4DWDA 3DJGX 2FYMA 3GRTA 1GRFA 1CF3A 1E39A 1LVLA 1GOSA 3CGBA 4U8LA 1EC9A 2P8CA 1JRZA 2Y6QA 2W54A 2PYXA 5U1OA 4K2SA 1VG9A 4ZCWA 4FK1A 5G5GB 1FEBA 2W3RA 2CFYA 4GDEA 3SN0A 4DX3A 3BJSA 1CHUA 3P4RA 1PXCA 3AYLA 3EF6A 1KSUA 3UJRA 2XFQA 4GMEA 3NNEA 1MDLA 3AEAA 1D7LA 1WYGA 1FHVA 4BV6A 3N4EA 4AOSA 3II4A 4HYRA 2HQMA 2C64A 5JCIA 5FMHA 3OW1A 4E5TA 3GDNA 1YQ4A 3JW7A 2YVGA 3DH9A 3SM8A 4KT2A 4B67A 5J60A 1F3PA 1H6VA 4GRTA 2BRAA 4H2NA 4EIPA 2YVFA 1CJ3A 4MKSA 2X50A 3NK2X 2P3ZA 2AL2B 3UTHA 3CMMA 1BGJA 3VCNA 1QLBA 2AL1A 4JN7A 2OKTA 1ZOVA 2YR6A 1D5TA 3LADA 3DA1A 4A35A 3OZ2A 5KOXA 3NO1A 3COXA 2BS3A 1EL7A 1Q9IA 5HY5A 2Q0LA 2BK3A 2TMDA 3NZGA 3DK8A 2CHRA 2EQ7A 2VZ2A 1RSGA 1PBEA 5IQ4A 4HCDA 3SQPA 1K0JA 2XH4A 3BHFA 2YLSA 1CL0A 3UP4A 2GGIA 1H84A 3Q45A 2OQYA 5KXJA 1TRBA 3UTEA 4J3ZA 3U9IA 2ZC8A 1DNCA 2XYOA 1MO9A 2XGZA 3DGHA 1EC8A 3PS9A 3KVEA 4YKGA 3QSEA 1S7MA 1YEYA 1SJBA 4OPCA 1H7XA 2FJBA 4TLZA 3EANA 4XWZA 3FJ4A 2CDUA 3OP2A 2JK6A 3ZYXA 4AP1A 1SJDA 1CJCA 1LQUA 3VDGA 3UOYA 3DK4A 2A87A 1N4UA 1PDHA 1RM6B 3SN4A 1STZA 1JRYA 3I3LA 3EAOA 1GSNA 2WP9A 1ECQA 2GSHA 2YG6A 1GALA 4G7FA 4BK2A 4RG3A 1ELSA 4EWJA 3MSYA 1GRGA 4BURA 2C66A 4U8JA 2BRYA 3DFYA 1JRXA 3GD4A 1TYPA 3H8LA 2R4EA 2QDDA 4DXKA 3FIMB 2WQYA 4Z44A 3G5RA 3DDMA 3IF9A 2F5ZA 3FYYA 3NGCX 3VRAA 4U2SA 4DNAA 4CCQA 3NK1X 2PPGA 2ZBWA 3QFAA 3DIPA 2WPCA 1KDGA 4K2XA 3OC4A 1L9CA 1X31B 3C4NA 4K22A 3FPZA 3GMBA 3SJNA 2XH2A 1IUWA 4GR1A 2GVCA 3N4FA 1E1LA 1RVKA 2PTZA 3JVAA 3F8PA 5KMRA 1SJCA 4YSYA 4ZCCA 4NEWA 4OPIA 4GF7A 3R0KA 2YLRA 4ADWA 2POZA 3NH3X 4KPLA 2R9ZA 3NXLA 1NU5A 3SR6B 3LZWA 4J34A 4K5SA 4HCLA 2QA1A 2ZZ0A 3HZLA 2I0ZA 1ZMDA 2Q6UA 1GTHA 1R6WA 3AD7B 1D7YA 3RP6A 2P8BA 3CGEA 3IJLA 2BS2A 2ONEA 2OZ3A 1L0VA 1TE6A 1ONFA 2QDEA 2AKZA 4ENLA 3SYIA 3CYJA 3ZVHA 4AT2A 2EQ8A 3AB1A 3UJSA 2YM2A 3V3NA 3URHA 3NKSA 1NDAA 4KWSA 2X8HA 1P2EA 3THUA 3K7QX 1PHHA 3R0UA 3FBSA 3GY1A 2V61A 3CNJA 2QVHA 1FFUC 4I59A 5JRBA 4IVMB 1SB3B 2PMQA 3GO2A 4OVIA 3T4WA 4CCRA 4H50A 1JCTA 1RP0A 3D8XA 3QSMA 2GV8A 2C72A 3FV9A 1SEZA 1CC6A 4A6NB 4JN8A 2E3TA 4K8DA 1JRPA 1B5QA 3T2YA 1B4VA 1P43A 4H4UA 3ABVA 2C67A 2EQ9A 3HYWA 3VQRA 3NYEA 2PTXA 4XXGA 2YLTA 1Y56B 2WP5A 1EC7A 1REOA 4NWZA 4YWOA 1JEHA 3N6HA 3DG6A 3ATRA 4IL2A 1O95A 3S47A 3RRAA 1D4CA 3TW9A 1CJ2A 2YG4A 3EPTA 2PGWA 1GTEA 4II2A 4OPUA 1BGNA 4YTPA 4IA5A 3R9UA 4U2LA 3TOYA 5ER0A 3L8KA 3DESA 3GDPA 3GD3A 3VA8A 1S2YA 4YTNA 3GRSA 3BI4A 5JCNA 1WUEA 3UKLA 1MDRA 2JKCA 3T14A 3UKAA 3M0OA 1NELA 3VR8A 2OLAA 3PK7A 3GWDA 2VVLG 4HB9A 4EMJA 3TWAA 2VQ7A 5KVIA 4DGKA 2C76A 4E0VA 4A6NA 3V5CA 4YSHA 3H12A 4EM3A 2GMJA 1N4VA 3CT2A 2OZ8A 4A7AA 4PAAA 3C4AA 3FXGA 3EKGA 3NFUA 4B64A 2GEWA 1NHPA 4HCHA 4EM4A 1AOGA 2UZZA 5FJPA 3QVRA 4GGHA 4K8GA 1Y0PA 1CJ4A 4G6HA 2GQWA 2Q7VA 5BULA 3F8RA 3STPA 1DJQA 1KSSA 2JB1A 1XPQA 2OFJA 4G6GA 2I5QA 2R0PA 4X2PA 4B1BA 2C7GA 4Z24A 3K7TA 2PODA 4USRA 4II3A 3DJDA 1PJ7A 1FOHA 3KPFA 5ENLA 3CPIG 3ZVIA 3UJEA 4U8PA 3DJEA 2GAGB 3ALMA 3TWBA 2XFOA 4EQWA 2CVJA 2Q0KA 4GAVA 1PJ5A 1LJ1A 4Z2TA 4BK3A 3BI5A 3RNMA 2DKIA 3VC5A 3PVCA 3P93A 2VRMA 4JNQA 1W6TA 2GDQA 4Y4MA 4U2TA 4IL0A 5KRQA 1KKOA 1T3QC 3I6TA 4HNLA 4B65A 4NTEA 2XVHA 5EBKA 1H2IA 3QLDA 1BQGA 4GAPA 2CULA 1IJHA 2B76A 2XVEA 5BOEA 4J36A 3PO7A 4JNAA 3AXBA 2E5AA 1OJ9A 4A5LA 5EOWA 3MY9A 1H83A 3MQTA 1ELIA 4E4FA 2P0IA 1MXTA 1GERA 4H83A 5JCLA 3T8QA 1JNZA 2JBVA 4DSGA 3MWCA 2IVDA 3P1WA 1WUFA 4GFIA 1EL5A 2QJJA 3MUCA 2RGHA 3QPEA 2C75A 1ZKQA 2ZZBA 4FX9A 2B9YA 1N61C 3UJFA 1FO4A 3I6DA 3G5SA 2GMHA 4REKA 4OCGA 2X3NA 4U8MA 2VRLA 3ALLA 1GETA 4U8KA 3S5WA 5L46A 4NNJA 3RP8A 1O94A 3BNMA 4C3XA 3CNDA 1K4QA 4FK1C 3R1ZA 3R10A 4AOXA 2BXRA 4P9SA 4H1ZA 4WCTA 3V3OA 3NT6A 2V60A 3SFDA 2GH5A 1X2GA 5IQ1A 4ZN0A 1GESA 3AEGA 4GIRA 1EBDA 3RP7A 2YWLA 3KLJA 3CB3A 3GD6A 2AL2A 3T2ZA 1E1KA 1R0MA 3G5QA 2QCUA 2PGEA 3AE2A 3RCYA 1GRAA 3AE7A 3BI2A 3V3WA 1JPDX 5TR3A 2BK4A 2DW7A 2GR0A 1V97A 5FS7A 1OJDA 3B6DA 1NENA 1VG0A 4OPGA 4Z26A 2WOVA 4EQXA 3AD9B 7ENLA 4ROPA 1ZMCA 1F6MA 4FDCB 4UDQA 3P0WA 3UCDA 1BWCA 1TYTA 4H4PA 1VDCA 4U8IA 5FS9A 4JY3A 1E1MA 3GYXA 2QJMA 3B97A 3EEZA 3D9XA 2OG9A 2W3SA 3HYXA 3A7RA 3NRNA 3AYIA 3A7AA 2YM1A 4HN8A 2PTYA 3D47A 2C65A 4H7UA 2HNEA 1DOCA 1GREA 2R45A 1VQWA 2WPFA 2TPRA 3ZLGA 1NG3A 5EB5A 4M0XA 1YQZA 2OLNA 3ALJA 3FCPA 3P9UA 3AD8B 4G73A 4A6GA 3CAWA 1KFYA 3H8IA 2YG3A 3AE8A 1ZDLA 3AMZA 4X9NA 4Z2RA 3ICRA 1FHUA 3ICSA 2B9XA 2WU5A 2IIDA 4APNA 4U8OA 1EBGA 2E1MA 2WETA 5FS6A 3HRDC 3OZMA 2VQBA 4Y4NA 1COYA 3NTAA 2BYBA 1S3EA 4H2RA 3Q9TA 3EUB3 1XPYA 4HNCA 3Q6JA 2B7RA 2BS4A 4YSXA 1Q1WA 1TDKA 1TDOA 5IDZA 3P4SA 4OPDA 2XVIA 4H4SA 1B8SA 3KA7A 4RG4A 2YR5A 4BK1A 1NAAA 1L9DA 4J1OA 2C73A 2FJDA 1JROA 2YG7A 1GXFA 2V6OA 3PWGA 4UP3A 5C3JA 1PN0A 2XFUA 1FFVC 3DK9A 1ZP0A 4RSLA 1PDZA 4UDRA 1ZY8A 3IHGA 2GF3A 3D46A 3SFEA 2XLUA 1XDIA 4Z25A 3R07C 2R4JA 1TDNA 1P2HA 4H2PA 3GWFA 2FBWA 2GR3A 1TZZA 2GQFA 2GL5A 3AEBA 1F9CA 1NG4A 3SXIA 2OAMA 2ZZCA 2PU1A 2AAQA 2GGJA 3NIXA 3UCCA 5FJRA 4U8NA 2O9ZA 3TTEA 3LOVA 3VFCA 4E8GA 2R0GA 3AE1A 4IHCA 2X8CA 1MRAA 2GRTA 3REDA 4E6MA 4AP3A 5BVAA 5IPYA 2PU0A 2W0HA 4YKFA 5HXIA 1EL8A 1KNPA 2HZGA 1MUCA 3V5FA 3UP5A 4GCMA 2PP1A 1FCDA 2BCGG 4J31A 5HHFA 1Y56A 2YR4A 1F8RA 2GGHA 2OA1A 1MNSA 1NHSA 5LV9A 4MGGA 4YWSA 3IC9A 4C77A 4YXDA 4ZA0A 2APGA 5CKUA 4B69A 1FEAA 2RGJA 4HA6A 2QAEA 1LV0A 3HYVA 4KX6A 3U4FA 1N5WC 1BZLA 1MOKA 1X2HA 3K1GA 2RGOA 2W55A 3R25A 2R0CA 2YLXA 1TKKA 2WHDA 4GISA 3AE9A 3KUMA 3ITJA 3SN1A 1N1PA 3QN3A 1EBHA 4USQA 1L9EA 1H81A 4TM4A 1S2QA 3BHKA 3ICTA 1H86A 3UCLA 2YVJA 3H7VA 4HPNA 2B9WA 4TVYA 2QA2A 5FJOA 4CRTA 4K7ZA 3I6EA 1DXLA 2PTWA 3KKJA 1GEUA 4IP5A 1PJ6A 3UKHA 3OZYA 2PS2A 4H4YA 5KNLA 3LZXA 3K30A 1DJNA 1CC4A 2WP6A 2OZTA 4EMIA 3DEQA 2BXSA 3DGBA 2BK5A 1DODA 3DG3A 1O5WA 2BABA 4A99A 3QKEA 4CY6A 3DGZA 3VRDB 1H82A 4Z1YA 3V76A 3AECA 2YAUA 3GMCA 5JCMA 1LPFA 3OTRA 2YLWA 2OQHA 2PP0A 1PXBA 2Y6RA 3ZVHB 3SGLA 1D4EA 3VRBA 3L5OA 1KF6A 4CY8A 4TM0A 3FG2P 5C2TA 1HYUA 4EMWA 3IHMA 3RITA 4TLXA 5GRTA 4IV9A 1XS2A 1ZX9A 3NTDA 4PABA 4E4UA 4IP4A 4CNKA 1L8PA 4IA6A 2QQ6A 2OLOA 3KPKA 2HXUA
chains in the Genus database with same CATH topology
4Y4LA 3SZCA 3F8PA 3KLJA 5KOWA 5KMRA 3T2ZA 1K0IA 4YSYA 3CGCA 2OALA 1JOAA 3NLCA 4ZCCA 2GR2A 4NEWA 2H89A 1GT8A 4GF7A 1E1KA 4OPIA 2E5VA 1JNRA 3G5QA 2YLRA 4ADWA 2QCUA 5KWFA 3H4KA 3NH3X 3AYJA 3GYJA 3AE6A 4H4RA 3QVPA 2R9ZA 3AE2A 1NEKA 3LZWA 2YG5A 1GRAA 4J34A 1E1NA 3AE7A 4K5SA 3BI2A 2QA1A 2ZZ0A 3HZLA 2I0ZA 1KN0A 1ZMDA 2BC0A 2Q6UA 5TR3A 4EIQA 2BK4A 1GTHA 1EL9A 2GR0A 3AD7B 2X99A 1D7YA 2J3NA 2C4CA 5FS7A 2NPXA 3PG6A 2XLSA 3CN8A 3RP6A 1OJDA 2VOUA 3B6DA 1NENA 1VG0A 3CGEA 2WDRA 4OPGA 4Z26A 2IVEA 4ZCDA 3RP7A 2XLRA 2BS2A 2NVKX 2WOVA 2FJAA 1JU2A 1QO8A 4EQXA 1IUUA 1YKJA 3AD9B 1L0VA 2WBAA 4Z43A 4CNJA 1ONFA 1PBFA 1NHQA 3CNPA 1ZMCA 2AR8A 2GAHB 1F6MA 2A8XA 3AE4A 3CNSA 1PBBA 4B68A 3QSSA 3SY4A 4FDCB 3SYIA 1Q1RA 4A79A 4J33A 5JCKA 4UDQA 3AWIA 4AT2A 1BWCA 1V59A 1TYTA 2EQ8A 3CGDA 4H4PA 2WS3A 3AB1A 1VDCA 3AEEA 1FL2A 4Z2UA 2YM2A 1PBDA 3V3NA 3URHA 5FS9A 3GYIA 4U8IA 3NKSA 2PHHA 4JY3A 1NDAA 2XVJA 3DMEA 3KD9A 2X8HA 1P2EA 1Z6LA 1E1MA 4N9XA 3GYXA 3S61A 3O0HA 5KVHA 2BCPA 2XFPA 1E6EA 3JSKA 3K7QX 3ATQA 3D9XA 3QJ4A 2RABA 1PHHA 4D04A 4H4WA 4KPRA 3FBSA 5BUKA 2V61A 3HYXA 2BC1A 3CNJA 3SZ0A 2YLZA 3NRNA 1GNDA 5U25A 1F8WA 3C96A 3AYIA 4I59A 5JRBA 3NYCA 4H4TA 2YM1A 4H2QA 1H7WA 4ICYA 2C65A 4H7UA 1CBOA 4IVMB 4O5QA 3UKQA 2VVLA 4OVIA 1GPEA 1YY5A 4CCRA 4JQ9A 2C70A 4O5UA 4H50A 1DOCA 1GREA 2VVMA 1LQTA 2R45A 3IWAA 3E1TA 1VQWA 4H4ZA 2WPFA 2BACA 2TPRA 1XANA 1B37A 2A89A 5EB4A 1RP0A 3D8XA 3T37A 1NG3A 3QSMA 5EB5A 2GV8A 2C72A 1S3BA 1SEZA 1YQZA 2YQUA 2OLNA 3ALJA 3M12A 3P9UA 3D1CA 1CC6A 3AD8B 4A6NB 2WPEA 4G73A 1GRBA 1GRTA 1KFYA 3AE5A 3H8IA 4K8DA 2C3CA 2YG3A 2WDQA 3AE8A 4M52A 4A65A 1ZDLA 4Z2RA 4X9NA 1F8SA 4I58A 4C74A 1B5QA 3ICRA 1ZOYA 5KMQA 2H88A 4TM1A 3SZFA 1IUVA 3NK0X 2DKHA 4JDRA 3T2YA 1B4VA 4H4UA 3UKPA 3ICSA 3ABVA 2B9XA 1IUSA 2C67A 2WU5A 1M64A 1TDEA 2WESA 3DJGX 2EQ9A 2ACZA 2IIDA 3M13A 4APNA 4G74A 4U8OA 3GRTA 1GRFA 1CF3A 2E1MA 1KNRA 3HYWA 3VQRA 1E39A 1LVLA 3NYEA 1GOSA 3CGBA 2WETA 5FS6A 4H4XA 2VQBA 4ECHA 4U8LA 4K5RA 1JRZA 4Y4NA 2Y6QA 4XXGA 2PYXA 2YLTA 5U1OA 1COYA 1VG9A 3NTAA 1Y56B 2WP5A 2BYBA 5U63A 1S3EA 4FK1A 4H2RA 3Q9TA 1FEBA 1N4WA 1REOA 4YWOA 1VRQB 2JB2A 4NWZA 2CFYA 4GDEA 4IVOB 1JEHA 3T0KA 3Q6JA 2B7RA 4NTCA 3ATRA 3UKFA 2BS4A 2V3AA 4YSXA 4J56A 5FS8A 1Q1WA 1CHUA 1O95A 1TDKA 2ARDA 3ADAB 3P4RA 4XWRA 1TDOA 3P4SA 4OPDA 1D4CA 2XVIA 1PXCA 1CJ2A 2YG4A 3AYLA 3EPTA 4H4SA 3EF6A 2WOIA 1KSUA 1B8SA 4LIIA 1GTEA 3FMWA 4II2A 3KA7A 2XFQA 4OPUA 1BGNA 4RG4A 3NNEA 4YTPA 2YR5A 4IA5A 3R9UA 4BK1A 1NAAA 3AEAA 1D7LA 4U2LA 1L9DA 5ER0A 3L8KA 4BV6A 3F8DA 3GDPA 4LU6A 2C73A 3GD3A 2FJDA 3GSIA 1S2YA 4BJZA 2YG7A 4AOSA 3II4A 2Z5XA 1EBDA 2HQMA 1GXFA 2V6OA 3P4QA 2GR1A 5JCIA 1PN0A 2C64A 2XFUA 4UP3A 5FMHA 4YTNA 5C3JA 3GDNA 3GRSA 1YQ4A 3DK9A 1ZP0A 4RSLA 3BI4A 4UDRA 2YVGA 1ZY8A 5JCNA 3IHGA 3DH9A 3UKLA 3SM8A 2GF3A 2XCGA 2JKCA 4CBQA 4B67A 3T14A 3UKAA 3NN0X 3M0OA 5J60A 3SFEA 3UOZA 3VR8A 4UDPA 4GRTA 1F3PA 1H6VA 2BRAA 2XLUA 1XDIA 4H2NA 3GWDA 4EIPA 2YVFA 1CJ3A 5BRTA 4J57A 5M0ZA 2X50A 4Z25A 2R4JA 2VVLG 2E4GA 5KMPA 3NK2X 2EQ6A 4HB9A 4YTMA 4EMJA 2VQ7A 1TDNA 5KVIA 4DGKA 4YT0A 2C76A 1P2HA 4E0VA 4A6NA 3QFBA 3AE3A 4H2PA 3GWFA 3UTHA 1LTXR 2FBWA 4YSHA 5J7XA 3CMMA 1BGJA 5GSNA 2GR3A 2WEUA 3B3RA 1W4XA 2GQFA 1QLBA 4EM3A 3SZWA 2GMJA 4G9KA 1N4VA 4GDPA 3AEBA 5HYMA 3CPHG 3T2KA 4A7AA 4PAAA 1ZOVA 2YR6A 1M6IA 3C4AA 1D5TA 3LADA 4AT0A 4B64A 3DA1A 2GEWA 1NG4A 3OZ2A 2XFNA 1NHPA 3SXIA 5KOXA 2OAMA 4EM4A 4NTDA 2ZZCA 1AOGA 2UZZA 2AAQA 5DBJA 3COXA 2BS3A 3CIRA 3NIXA 4D03A 2V5ZA 3QVRA 4OPLA 1EL7A 1Q9IA 1Y0PA 4U8NA 5HY5A 1CJ4A 2O9ZA 2Q0LA 3LOVA 4G6HA 2GQWA 2BK3A 2TMDA 3BNUA 2Q7VA 3DK8A 2VZ2A 2EQ7A 4TM3A 3F8RA 2JB3A 3NHOX 5BULA 1DJQA 1KSSA 1RSGA 2JB1A 1PBEA 2R0GA 3AE1A 5IQ4A 1XPQA 2X8CA 3REDA 2GRTA 4AP3A 5BVAA 5IPYA 2W0HA 3P4PA 4G6GA 4YKFA 2C3DA 3SQPA 2R0PA 1K0JA 5HXIA 1EL8A 1KNPA 2YLSA 3BHFA 4B1BA 1ZK7A 1CL0A 2C7GA 2FJEA 3UKKA 3UP5A 3UP4A 4Z24A 3K7TA 4GCMA 1GRHA 1H84A 4USRA 2BCGG 1FCDA 4II3A 4J31A 5HHFA 1QJDA 5KMSA 1NHRA 1Y56A 3DJDA 5KXJA 1PJ7A 2YR4A 1F8RA 1FOHA 2OA1A 3KPFA 1TRBA 1NHSA 3CNTA 5LV9A 1GV4A 1CC2A 2GB0A 3CPIG 3UTEA 3ISHA 3IC9A 4C77A 4U8PA 3DJEA 2GAGB 3ALMA 5CQFA 4YXDA 1DNCA 2APGA 5CKUA 4B69A 2XFOA 1FEAA 4EQWA 2XYOA 2CVJA 2Q0KA 2RGJA 4GAVA 4HA6A 2QAEA 4WX1A 1PJ5A 1LV0A 1LJ1A 1BF3A 3HYVA 4KX6A 4OPTA 3SX6A 4Z2TA 4BK3A 3BI5A 1BZLA 3RNMA 3UTFA 1MO9A 2DKIA 3PVCA 3DGHA 3PS9A 3KVEA 2XVFA 4YKGA 2VRMA 1MOKA 4JNQA 3QSEA 1IUXA 3WE0A 1S7MA 4Y4MA 2RGOA 4U2TA 2YLXA 2R0CA 2WHDA 3DJJA 3AE9A 3ITJA 4OPCA 5KRQA 1N1PA 1H7XA 2WOWA 2FJBA 1L9EA 1H81A 4TM4A 1K0LA 4TLZA 1S2QA 3EANA 3BHKA 3ICTA 1H86A 4XWZA 3T31A 2CDUA 3UCLA 2WDVA 4B65A 2JK6A 3ZYXA 4AP1A 2Z5YA 2JAEA 2YVJA 3K7MX 4NTEA 2XVHA 2AQJA 5EBKA 3AEFA 1H2IA 3VR9A 2B9WA 4GAPA 1CJCA 1LQUA 3UOYA 2CULA 1IJHA 3DK4A 2QA2A 2B76A 2XLPA 2A87A 4K7ZA 1N4UA 2XVEA 4CRTA 4DSHA 1PDHA 3RHAA 1DXLA 1DOEA 1BKWA 2BA9A 4J36A 5M10A 3PO7A 1JRYA 3I3LA 4JNAA 3EAOA 3AXBA 3KKJA 1GEUA 3UOVA 1PBCA 1GSNA 1PJ6A 1UKVG 2WP9A 3UKHA 1OJ9A 3CPJG 4A5LA 4H4YA 2YG6A 1YQ3A 5KNLA 1NPXA 2V3BA 4H4VA 3LZXA 1OJTA 1GALA 3K30A 3LXDA 3CTYA 5EOWA 3ZDNA 1DJNA 1OJAA 1CC4A 1H83A 1PS9A 2XDOA 2WP6A 1TDFA 4EMIA 3NN6X 2R46A 1ELIA 4MJWA 2BXSA 1OJCA 4BK2A 2BK5A 1MXTA 4RG3A 1GERA 5JCLA 2JBVA 1DODA 1JNZA 4DSGA 4C3YA 3NG7X 4LA1A 2IVDA 1O5WA 2BABA 1GRGA 3P1WA 4BURA 1EL5A 4A99A 4JY2A 2C66A 4U8JA 2BRYA 1E7PA 1JRXA 2RGHA 4CY6A 3DGZA 3VRDB 4YSZA 4EQRA 1H82A 4BJYA 3GD4A 2C75A 1ZKQA 1TYPA 2ZZBA 4FX9A 3H8LA 2B9YA 2R4EA 3V76A 3LB8A 3L1RA 3AECA 2YAUA 3FIMB 3GMCA 4J2WA 5JCMA 2WQYA 3I6DA 1LPFA 4Z44A 4B63A 3LJPA 4H4QA 3G5SA 2GMHA 2YLWA 4REKA 1PXBA 2Y6RA 3G5RA 4OCGA 2X3NA 4GUVA 4U8MA 3SGLA 1D4EA 2VRLA 4NEVA 1FECA 2X8GA 1DOBA 3IF9A 2F5ZA 3L5OA 3ALLA 1GETA 4USQA 3VRBA 3KU9A 3NGCX 4U8KA 1PXAA 1KF6A 3S5WA 4CY8A 5L46A 4TM0A 3FG2P 4NNJA 3RP8A 5C2TA 1HYUA 1O94A 1D4DA 2WU2A 4EMWA 3BNMA 3IHMA 4C3XA 1XHCA 3VRAA 3CNDA 1K4QA 4U2SA 4X4JA 3AEDA 4B66A 2XLTA 4TLXA 5GRTA 4DNAA 4CCQA 4FK1C 3NK1X 3UTGA 4IV9A 4JN9A 4A9WA 4EQSA 1ZX9A 4X9MA 3NTDA 4AOXA 2BXRA 2ZBWA 3QFAA 4PABA 4P9SA 2WPCA 1KDGA 4CNKA 4WCTA 4C5OA 3V3OA 4K2XA 3NT6A 3OC4A 1L9CA 1X31B 4IA6A 3C4NA 2V60A 4K22A 3FPZA 3SFDA 2GH5A 4NZHA 3GMBA 5IQ1A 1IUWA 1RYIA 2OLOA 3KPKA 4ZN0A 4GR1A 2B7SA 3UOXA 1GESA 3AEGA 2GVCA 3NYFA 1IUTA 1E1LA 2YWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y4L A;  3F8P A;  3KLJ A;  5KOW A;  1K0I A;  4YSY A;  3CGC A;  2OAL A;  1JOA A;  3NLC A;  4ZCC A;  2GR2 A;  4NEW A;  2H89 A;  1GT8 A;  4GF7 A;  1E1K A;  4OPI A;  2E5V A;  1JNR A;  3G5Q A;  2YLR A;  4ADW A;  2QCU A;  5KWF A;  3H4K A;  3NH3 X;  3AYJ A;  3GYJ A;  3AE6 A;  4H4R A;  3QVP A;  2R9Z A;  3AE2 A;  1NEK A;  3LZW A;  2YG5 A;  1GRA A;  4J34 A;  1E1N A;  3AE7 A;  4K5S A;  3BI2 A;  2QA1 A;  2ZZ0 A;  3HZL A;  2I0Z A;  2BC0 A;  1ZMD A;  2Q6U A;  5TR3 A;  4EIQ A;  2BK4 A;  1GTH A;  1EL9 A;  2GR0 A;  3AD7 B;  2X99 A;  1D7Y A;  2J3N A;  2XLS A;  5FS7 A;  2NPX A;  3CN8 A;  3RP6 A;  1OJD A;  2VOU A;  3B6D A;  1NEN A;  1VG0 A;  3CGE A;  2WDR A;  4OPG A;  4Z26 A;  2IVE A;  4ZCD A;  3RP7 A;  2XLR A;  2BS2 A;  2NVK X;  2WOV A;  2FJA A;  1JU2 A;  1QO8 A;  4EQX A;  1IUU A;  1YKJ A;  3AD9 B;  1L0V A;  2WBA A;  4Z43 A;  4CNJ A;  1ONF A;  1PBF A;  1NHQ A;  3CNP A;  1ZMC A;  2AR8 A;  2GAH B;  1F6M A;  2A8X A;  3AE4 A;  3CNS A;  1PBB A;  4B68 A;  3QSS A;  4FDC B;  1Q1R A;  4A79 A;  4J33 A;  5JCK A;  4UDQ A;  3AWI A;  4AT2 A;  1BWC A;  1V59 A;  1TYT A;  2EQ8 A;  3CGD A;  4H4P A;  2WS3 A;  3AB1 A;  1VDC A;  3AEE A;  1FL2 A;  4Z2U A;  2YM2 A;  1PBD A;  3V3N A;  3URH A;  5FS9 A;  3GYI A;  4U8I A;  3NKS A;  2PHH A;  4JY3 A;  1NDA A;  2XVJ A;  3DME A;  3KD9 A;  2X8H A;  1P2E A;  1Z6L A;  1E1M A;  4N9X A;  3S61 A;  3O0H A;  5KVH A;  2BCP A;  2XFP A;  1E6E A;  3JSK A;  3K7Q X;  3ATQ A;  3QJ4 A;  2RAB A;  1PHH A;  4D04 A;  4H4W A;  4KPR A;  3FBS A;  5BUK A;  2V61 A;  2BC1 A;  3CNJ A;  2YLZ A;  3NRN A;  1GND A;  5U25 A;  1F8W A;  3C96 A;  3AYI A;  4I59 A;  3NYC A;  4H2Q A;  4H4T A;  2YM1 A;  4ICY A;  1H7W A;  4IVM B;  2C65 A;  4H7U A;  1CBO A;  4O5Q A;  3UKQ A;  2VVL A;  4OVI A;  1GPE A;  1YY5 A;  4CCR A;  4JQ9 A;  2C70 A;  4O5U A;  4H50 A;  1DOC A;  1GRE A;  2VVM A;  1LQT A;  2R45 A;  3IWA A;  3E1T A;  1VQW A;  4H4Z A;  2WPF A;  2BAC A;  2TPR A;  1XAN A;  1B37 A;  2A89 A;  5EB4 A;  1RP0 A;  3D8X A;  3T37 A;  1NG3 A;  3QSM A;  5EB5 A;  2GV8 A;  2C72 A;  1S3B A;  1SEZ A;  1YQZ A;  2YQU A;  2OLN A;  3ALJ A;  3M12 A;  3P9U A;  3D1C A;  1CC6 A;  3AD8 B;  4A6N B;  2WPE A;  1GRB A;  1GRT A;  1KFY A;  3AE5 A;  3H8I A;  4K8D A;  2C3C A;  2YG3 A;  2WDQ A;  3AE8 A;  4M52 A;  4A65 A;  1ZDL A;  4Z2R A;  4X9N A;  1F8S A;  4I58 A;  4C74 A;  1B5Q A;  3ICR A;  1ZOY A;  2H88 A;  4TM1 A;  1IUV A;  3NK0 X;  2DKH A;  4JDR A;  1B4V A;  4H4U A;  3UKP A;  3ICS A;  3ABV A;  2B9X A;  1IUS A;  2C67 A;  2WU5 A;  1M64 A;  1TDE A;  2WES A;  3DJG X;  2EQ9 A;  2ACZ A;  2IID A;  3M13 A;  4APN A;  4U8O A;  3GRT A;  1GRF A;  1CF3 A;  2E1M A;  1KNR A;  3VQR A;  1E39 A;  1LVL A;  3NYE A;  1GOS A;  3CGB A;  2WET A;  5FS6 A;  4H4X A;  2VQB A;  4ECH A;  4U8L A;  4K5R A;  1JRZ A;  4Y4N A;  2Y6Q A;  4XXG A;  2PYX A;  2YLT A;  5U1O A;  1COY A;  1VG9 A;  3NTA A;  1Y56 B;  2WP5 A;  2BYB A;  5U63 A;  1S3E A;  4FK1 A;  4H2R A;  3Q9T A;  1FEB A;  1N4W A;  1REO A;  4YWO A;  1VRQ B;  2JB2 A;  2CFY A;  4GDE A;  4IVO B;  1JEH A;  3Q6J A;  2B7R A;  4NTC A;  3ATR A;  3UKF A;  2BS4 A;  2V3A A;  4YSX A;  4J56 A;  5FS8 A;  1Q1W A;  1CHU A;  1O95 A;  1TDK A;  2ARD A;  3ADA B;  3P4R A;  4XWR A;  1TDO A;  3P4S A;  4OPD A;  1D4C A;  2XVI A;  1PXC A;  1CJ2 A;  2YG4 A;  3AYL A;  3EPT A;  4H4S A;  3EF6 A;  2WOI A;  1KSU A;  1B8S A;  4LII A;  1GTE A;  3FMW A;  3KA7 A;  2XFQ A;  4OPU A;  1BGN A;  4RG4 A;  3NNE A;  4YTP A;  2YR5 A;  4IA5 A;  3R9U A;  4BK1 A;  1NAA A;  3AEA A;  1D7L A;  4U2L A;  1L9D A;  5ER0 A;  3L8K A;  4BV6 A;  3F8D A;  3GDP A;  4LU6 A;  2C73 A;  3GD3 A;  2FJD A;  3GSI A;  1S2Y A;  4BJZ A;  2YG7 A;  4AOS A;  3II4 A;  2Z5X A;  1EBD A;  2HQM A;  1GXF A;  2V6O A;  3P4Q A;  2GR1 A;  5JCI A;  1PN0 A;  2C64 A;  2XFU A;  4UP3 A;  5FMH A;  4YTN A;  5C3J A;  3GDN A;  3GRS A;  1YQ4 A;  3DK9 A;  1ZP0 A;  4RSL A;  3BI4 A;  4UDR A;  2YVG A;  1ZY8 A;  5JCN A;  3IHG A;  3DH9 A;  3UKL A;  3SM8 A;  2GF3 A;  2XCG A;  2JKC A;  4CBQ A;  4B67 A;  3UKA A;  3NN0 X;  3M0O A;  5J60 A;  3SFE A;  3UOZ A;  3VR8 A;  4UDP A;  4GRT A;  1F3P A;  1H6V A;  2XLU A;  4H2N A;  1XDI A;  3GWD A;  4EIP A;  2YVF A;  1CJ3 A;  5BRT A;  4J57 A;  5M0Z A;  2X50 A;  4Z25 A;  2R4J A;  2VVL G;  2E4G A;  3NK2 X;  2EQ6 A;  4HB9 A;  4YTM A;  4EMJ A;  2VQ7 A;  1TDN A;  5KVI A;  4DGK A;  4YT0 A;  2C76 A;  1P2H A;  4E0V A;  4A6N A;  3QFB A;  3AE3 A;  4H2P A;  3GWF A;  3UTH A;  1LTX R;  2FBW A;  4YSH A;  5J7X A;  1BGJ A;  5GSN A;  2GR3 A;  2WEU A;  3B3R A;  1W4X A;  2GQF A;  1QLB A;  4EM3 A;  2GMJ A;  1N4V A;  4GDP A;  3AEB A;  5HYM A;  3CPH G;  4A7A A;  4PAA A;  1ZOV A;  2YR6 A;  1M6I A;  3C4A A;  1D5T A;  3LAD A;  4AT0 A;  4B64 A;  3DA1 A;  2GEW A;  1NG4 A;  3OZ2 A;  2XFN A;  1NHP A;  5KOX A;  2OAM A;  4EM4 A;  4NTD A;  2ZZC A;  1AOG A;  2UZZ A;  2AAQ A;  5DBJ A;  3COX A;  2BS3 A;  3CIR A;  3NIX A;  4D03 A;  2V5Z A;  3QVR A;  4OPL A;  1EL7 A;  1Q9I A;  1Y0P A;  4U8N A;  5HY5 A;  1CJ4 A;  2O9Z A;  2Q0L A;  3LOV A;  2GQW A;  2BK3 A;  2TMD A;  3BNU A;  2Q7V A;  3DK8 A;  2VZ2 A;  2EQ7 A;  4TM3 A;  3F8R A;  2JB3 A;  3NHO X;  5BUL A;  1DJQ A;  1KSS A;  1RSG A;  2JB1 A;  1PBE A;  2R0G A;  3AE1 A;  5IQ4 A;  1XPQ A;  2X8C A;  3RED A;  2GRT A;  4AP3 A;  5BVA A;  5IPY A;  2W0H A;  3P4P A;  4YKF A;  2C3D A;  3SQP A;  2R0P A;  1K0J A;  5HXI A;  1EL8 A;  1KNP A;  2YLS A;  3BHF A;  4B1B A;  1ZK7 A;  1CL0 A;  2C7G A;  2FJE A;  3UKK A;  3UP5 A;  3UP4 A;  4Z24 A;  3K7T A;  4GCM A;  1GRH A;  1H84 A;  4USR A;  2BCG G;  1FCD A;  4J31 A;  5HHF A;  1QJD A;  1NHR A;  1Y56 A;  3DJD A;  5KXJ A;  1PJ7 A;  2YR4 A;  1F8R A;  1FOH A;  2OA1 A;  3KPF A;  1TRB A;  1NHS A;  3CNT A;  5LV9 A;  1GV4 A;  1CC2 A;  2GB0 A;  3CPI G;  3UTE A;  3ISH A;  3IC9 A;  4C77 A;  4U8P A;  3DJE A;  2GAG B;  3ALM A;  5CQF A;  4YXD A;  1DNC A;  2APG A;  5CKU A;  4B69 A;  2XFO A;  1FEA A;  4EQW A;  2XYO A;  2CVJ A;  2Q0K A;  2RGJ A;  4WX1 A;  4HA6 A;  2QAE A;  1PJ5 A;  1LV0 A;  1LJ1 A;  1BF3 A;  4KX6 A;  4OPT A;  4Z2T A;  4BK3 A;  3BI5 A;  1BZL A;  3RNM A;  3UTF A;  1MO9 A;  2DKI A;  3PVC A;  3DGH A;  3PS9 A;  3KVE A;  2XVF A;  4YKG A;  2VRM A;  1MOK A;  4JNQ A;  3QSE A;  1IUX A;  3WE0 A;  4Y4M A;  2RGO A;  4U2T A;  2YLX A;  2R0C A;  2WHD A;  3DJJ A;  3AE9 A;  3ITJ A;  4OPC A;  5KRQ A;  1N1P A;  1H7X A;  2WOW A;  2FJB A;  1L9E A;  1H81 A;  4TM4 A;  1K0L A;  4TLZ A;  1S2Q A;  3EAN A;  3BHK A;  3ICT A;  1H86 A;  4XWZ A;  2CDU A;  3UCL A;  2WDV A;  4B65 A;  2JK6 A;  3ZYX A;  4AP1 A;  2Z5Y A;  2JAE A;  2YVJ A;  3K7M X;  4NTE A;  2XVH A;  2AQJ A;  5EBK A;  3AEF A;  3VR9 A;  2B9W A;  1CJC A;  1LQU A;  3UOY A;  2CUL A;  1IJH A;  3DK4 A;  2QA2 A;  2B76 A;  2XLP A;  2A87 A;  4K7Z A;  1N4U A;  2XVE A;  4CRT A;  4DSH A;  1PDH A;  3RHA A;  1DXL A;  1DOE A;  1BKW A;  2BA9 A;  4J36 A;  5M10 A;  3PO7 A;  1JRY A;  3I3L A;  4JNA A;  3EAO A;  3AXB A;  3KKJ A;  1GEU A;  3UOV A;  1PBC A;  1GSN A;  1PJ6 A;  1UKV G;  2WP9 A;  3UKH A;  1OJ9 A;  3CPJ G;  4A5L A;  4H4Y A;  2YG6 A;  1YQ3 A;  1NPX A;  4H4V A;  2V3B A;  3LZX A;  1OJT A;  1GAL A;  3K30 A;  3LXD A;  3CTY A;  5EOW A;  3ZDN A;  1DJN A;  1OJA A;  1CC4 A;  1H83 A;  1PS9 A;  2XDO A;  2WP6 A;  1TDF A;  4EMI A;  3NN6 X;  2R46 A;  1ELI A;  4MJW A;  2BXS A;  1OJC A;  4BK2 A;  2BK5 A;  1MXT A;  4RG3 A;  1GER A;  5JCL A;  2JBV A;  1DOD A;  1JNZ A;  4DSG A;  4C3Y A;  3NG7 X;  4LA1 A;  2IVD A;  1O5W A;  2BAB A;  1GRG A;  3P1W A;  4BUR A;  1EL5 A;  4A99 A;  4JY2 A;  2C66 A;  4U8J A;  1E7P A;  1JRX A;  2RGH A;  4CY6 A;  3DGZ A;  3VRD B;  4YSZ A;  4EQR A;  1H82 A;  4BJY A;  3GD4 A;  2C75 A;  1ZKQ A;  1TYP A;  2ZZB A;  4FX9 A;  3H8L A;  2B9Y A;  2R4E A;  3V76 A;  3LB8 A;  3L1R A;  3AEC A;  2YAU A;  3FIM B;  3GMC A;  4J2W A;  5JCM A;  2WQY A;  3I6D A;  1LPF A;  4Z44 A;  4B63 A;  3LJP A;  4H4Q A;  3G5S A;  2GMH A;  2YLW A;  4REK A;  1PXB A;  2Y6R A;  3G5R A;  4OCG A;  2X3N A;  4GUV A;  4U8M A;  3SGL A;  1D4E A;  2VRL A;  4NEV A;  1FEC A;  2X8G A;  1DOB A;  3IF9 A;  2F5Z A;  3ALL A;  4USQ A;  1GET A;  3VRB A;  3KU9 A;  3NGC X;  4U8K A;  1PXA A;  1KF6 A;  3S5W A;  4CY8 A;  5L46 A;  4TM0 A;  3FG2 P;  3RP8 A;  5C2T A;  1HYU A;  1O94 A;  1D4D A;  2WU2 A;  4EMW A;  3BNM A;  3IHM A;  4C3X A;  1XHC A;  3VRA A;  3CND A;  1K4Q A;  4U2S A;  4X4J A;  3AED A;  4B66 A;  2XLT A;  4TLX A;  5GRT A;  4DNA A;  4CCQ A;  4FK1 C;  3NK1 X;  3UTG A;  4IV9 A;  4JN9 A;  4A9W A;  4EQS A;  1ZX9 A;  4X9M A;  3NTD A;  4AOX A;  2BXR A;  2ZBW A;  3QFA A;  4PAB A;  4P9S A;  2WPC A;  1KDG A;  4CNK A;  4WCT A;  4C5O A;  3V3O A;  4K2X A;  3NT6 A;  3OC4 A;  1L9C A;  1X31 B;  4IA6 A;  3C4N A;  2V60 A;  4K22 A;  3FPZ A;  3SFD A;  2GH5 A;  4NZH A;  3GMB A;  5IQ1 A;  1IUW A;  1RYI A;  2OLO A;  4ZN0 A;  4GR1 A;  2B7S A;  3UOX A;  1GES A;  3AEG A;  2GVC A;  3NYF A;  1IUT A;  1E1L A;  2YWL A; 
#chains in the Genus database with same CATH topology
 3SZC A;  1K0I A;  2OAL A;  2GR2 A;  2H89 A;  3H4K A;  3GYJ A;  3AE6 A;  2PSN A;  3TJI A;  2YG5 A;  1E1N A;  4M6U A;  4DHG A;  3CK5 A;  4EIQ A;  3CXO A;  2C4C A;  3CN8 A;  2J3N A;  2XLS A;  2NPX A;  3PG6 A;  5FJT A;  3IJQ A;  2IVE A;  3PWI A;  2NVK X;  1N5X A;  3BSM A;  1IUU A;  1PBF A;  1NHQ A;  3CNP A;  2GAH B;  3AE4 A;  3CNS A;  3B9J B;  3SY4 A;  1Q1R A;  4A79 A;  3UGV A;  4GYP A;  4J33 A;  5JCK A;  3AN1 A;  1V59 A;  3CGD A;  4Z2U A;  3DME A;  3KD9 A;  1Z6L A;  5KVH A;  3MKC A;  4A3R A;  3T9P A;  1FIQ B;  2BC1 A;  3SZ0 A;  2YLZ A;  1GND A;  1F8W A;  3NYC A;  4H2Q A;  4H4T A;  4ICY A;  1CBO A;  4O5Q A;  1N62 C;  3HPF A;  1GPE A;  1YY5 A;  1KKR A;  2C70 A;  4O5U A;  4MMW A;  1LQT A;  3RO6 A;  3IWA A;  3E1T A;  2BAC A;  4H4Z A;  3ENL A;  1S3B A;  3M12 A;  3FVD A;  2YQU A;  2O56 A;  3BOX A;  2WPE A;  1GRB A;  2C3C A;  4A65 A;  2WDQ A;  4FP1 A;  4I58 A;  4C74 A;  2H88 A;  4TM1 A;  2MNR A;  2ZAD A;  1M64 A;  1TDE A;  3UJ2 A;  2ACZ A;  3M13 A;  3VCC A;  4G74 A;  3NRZ B;  3SBF A;  4IZG A;  1KNR A;  3R11 A;  4H4X A;  4ECH A;  4K5R A;  2P88 A;  2PCE A;  3Q4D A;  5U63 A;  1N4W A;  1VRQ B;  2JB2 A;  1ONE A;  4IVO B;  1ZXI C;  3T0K A;  4NTC A;  3UKF A;  2OVL A;  2V3A A;  4J56 A;  5FS8 A;  3ADA B;  2ARD A;  4XWR A;  2WOI A;  4LII A;  3FMW A;  2DW6 A;  3F8D A;  4LU6 A;  3GSI A;  4BJZ A;  2Z5X A;  3P4Q A;  2GR1 A;  4GYP C;  2XCG A;  4CBQ A;  3NN0 X;  3UOZ A;  4UDP A;  3S5S A;  3ES8 A;  4J57 A;  5BRT A;  5M0Z A;  2E4G A;  5KMP A;  2EQ6 A;  4YTM A;  5FJU A;  1OEP A;  2NQL A;  4YT0 A;  3QFB A;  3SQS A;  3AE3 A;  1LTX R;  5J7X A;  5GSN A;  2WEU A;  3B3R A;  1W4X A;  3TJ4 A;  3SZW A;  4G9K A;  4GDP A;  5HYM A;  3CPH G;  3T2K A;  3NS1 B;  1M6I A;  4AT0 A;  2QJN A;  2XFN A;  3GC2 A;  5BOF A;  4NTD A;  3NVW B;  5DBJ A;  3CIR A;  4D03 A;  2V5Z A;  4OPL A;  3BNU A;  2RDX A;  4TM3 A;  2JB3 A;  3NHO X;  1KCZ A;  2XSX A;  3N6J A;  2AKM A;  3P4P A;  2C3D A;  4ZOH B;  2QGY A;  1ZK7 A;  2FJE A;  3UKK A;  1GRH A;  5KMS A;  1QJD A;  1NHR A;  5G5H B;  1DTN A;  3A7U A;  3CNT A;  3RR1 A;  1GV4 A;  1CC2 A;  2GB0 A;  3ISH A;  5CQF A;  4WX1 A;  1BF3 A;  4OPT A;  2GGE A;  3UXK A;  3SX6 A;  2OPJ A;  3UTF A;  3TCS A;  2XH0 A;  2XVF A;  3DG7 A;  1IUX A;  3WE0 A;  4K1W A;  3DJJ A;  3DFH A;  2WOW A;  3H8A A;  4B66 A;  3T31 A;  1K0L A;  1P48 A;  2WDV A;  4DYE A;  2Z5Y A;  1PDY A;  4JHM A;  2JAE A;  3K7M X;  2AQJ A;  3AEF A;  3VR9 A;  2XLP A;  4DSH A;  3RHA A;  1DOE A;  1VQZ A;  1BKW A;  2BA9 A;  5J04 A;  5M10 A;  3UOV A;  1PBC A;  1UKV G;  3CPJ G;  3DER A;  1YQ3 A;  1NPX A;  2V3B A;  4H4V A;  1OJT A;  3LXD A;  3CTY A;  3ZDN A;  1OJA A;  3MZN A;  1PS9 A;  2XDO A;  1TDF A;  3NN6 X;  2R46 A;  4MJW A;  1OJC A;  4GGB A;  4C3Y A;  3NG7 X;  4LA1 A;  4JY2 A;  1E7P A;  3P3B A;  4YSZ A;  2FKP A;  4EQR A;  3NVV B;  4H2H A;  4BJY A;  1JDF A;  3RGT A;  3LB8 A;  3L1R A;  3IK4 A;  6ENL A;  4J2W A;  1IYX A;  4B63 A;  3NVY B;  3LJP A;  4H4Q A;  4G8T A;  3QTP A;  4GUV A;  4NEV A;  1FEC A;  2X8G A;  1DOB A;  3KU9 A;  1PXA A;  3HW2 A;  1D4D A;  2WU2 A;  1VDV A;  1XHC A;  2XH7 A;  4X4J A;  3AED A;  2XLT A;  4A9W A;  3UTG A;  4JN9 A;  4EQS A;  4X9M A;  3VC6 A;  3H70 A;  4C5O A;  3UXL A;  4NZH A;  2PP3 A;  3OPS A;  1RYI A;  2B7S A;  3UOX A;  3NYF A;  1IUT A;  2MUC A;  4Y4L A;  5KOW A;  3CGC A;  1JOA A;  3NLC A;  1GT8 A;  2E5V A;  1JNR A;  5KWF A;  3AYJ A;  4KEM A;  4H4R A;  3QVP A;  1NEK A;  1KN0 A;  2BC0 A;  3ZLH A;  1EL9 A;  2PA6 A;  2X99 A;  2VOU A;  4Z17 A;  2WDR A;  4ZCD A;  2XLR A;  1JPM A;  2FJA A;  1JU2 A;  3V4B A;  1QO8 A;  1YKJ A;  2WBA A;  4Z43 A;  1SJA A;  1N63 C;  4CNJ A;  3ES7 A;  2AR8 A;  3IJI A;  2A8X A;  1PBB A;  4B68 A;  3QSS A;  3AWI A;  1BKH A;  3JZU A;  3AEE A;  2WS3 A;  1FL2 A;  3ETR B;  1PBD A;  3CXB A;  3GYI A;  2PHH A;  2XVJ A;  4N9X A;  3S61 A;  3AM9 A;  3O0H A;  2BCP A;  2XFP A;  4H19 A;  1E6E A;  3JSK A;  5EU9 A;  3ATQ A;  3NVZ B;  3QJ4 A;  2RAB A;  4D04 A;  2OX4 A;  4H4W A;  4KPR A;  5BUK A;  4IT1 A;  4FI4 A;  5U25 A;  3C96 A;  2OO6 A;  1H7W A;  3TQP A;  3UKQ A;  2VVL A;  4JQ9 A;  2VVM A;  1N60 C;  1B37 A;  1XAN A;  2A89 A;  3SSZ A;  4DN1 A;  5EB4 A;  3T37 A;  2HXT A;  2GGG A;  1KD0 A;  3D1C A;  3T6C A;  1E9I A;  4TVW A;  1GRT A;  3AE5 A;  4M52 A;  1F8S A;  1ZOY A;  5KMQ A;  3PFR A;  3SZF A;  1IUV A;  3NK0 X;  2DKH A;  4JDR A;  3ZLF A;  3I4K A;  3UKP A;  1IUS A;  4F4R A;  2WES A;  4DWD A;  3DJG X;  2FYM A;  3GRT A;  1GRF A;  1CF3 A;  1E39 A;  1LVL A;  1GOS A;  3CGB A;  4U8L A;  1EC9 A;  2P8C A;  1JRZ A;  2Y6Q A;  2W54 A;  2PYX A;  5U1O A;  4K2S A;  1VG9 A;  4ZCW A;  4FK1 A;  5G5G B;  1FEB A;  2W3R A;  2CFY A;  4GDE A;  3SN0 A;  4DX3 A;  3BJS A;  1CHU A;  3P4R A;  1PXC A;  3AYL A;  3EF6 A;  1KSU A;  3UJR A;  2XFQ A;  4GME A;  3NNE A;  1MDL A;  3AEA A;  1D7L A;  1WYG A;  1FHV A;  4BV6 A;  3N4E A;  4AOS A;  3II4 A;  4HYR A;  2HQM A;  2C64 A;  5JCI A;  5FMH A;  3OW1 A;  4E5T A;  3GDN A;  1YQ4 A;  3JW7 A;  2YVG A;  3DH9 A;  3SM8 A;  4KT2 A;  4B67 A;  5J60 A;  1F3P A;  1H6V A;  4GRT A;  2BRA A;  4H2N A;  4EIP A;  2YVF A;  1CJ3 A;  4MKS A;  2X50 A;  3NK2 X;  2P3Z A;  2AL2 B;  3UTH A;  3CMM A;  1BGJ A;  3VCN A;  1QLB A;  2AL1 A;  4JN7 A;  2OKT A;  1ZOV A;  2YR6 A;  1D5T A;  3LAD A;  3DA1 A;  4A35 A;  3OZ2 A;  5KOX A;  3NO1 A;  3COX A;  2BS3 A;  1EL7 A;  1Q9I A;  5HY5 A;  2Q0L A;  2BK3 A;  2TMD A;  3NZG A;  3DK8 A;  2CHR A;  2EQ7 A;  2VZ2 A;  1RSG A;  1PBE A;  5IQ4 A;  4HCD A;  3SQP A;  1K0J A;  2XH4 A;  3BHF A;  2YLS A;  1CL0 A;  3UP4 A;  2GGI A;  1H84 A;  3Q45 A;  2OQY A;  5KXJ A;  1TRB A;  3UTE A;  4J3Z A;  3U9I A;  2ZC8 A;  1DNC A;  2XYO A;  1MO9 A;  2XGZ A;  3DGH A;  1EC8 A;  3PS9 A;  3KVE A;  4YKG A;  3QSE A;  1S7M A;  1YEY A;  1SJB A;  4OPC A;  1H7X A;  2FJB A;  4TLZ A;  3EAN A;  4XWZ A;  3FJ4 A;  2CDU A;  3OP2 A;  2JK6 A;  3ZYX A;  4AP1 A;  1SJD A;  1CJC A;  1LQU A;  3VDG A;  3UOY A;  3DK4 A;  2A87 A;  1N4U A;  1PDH A;  1RM6 B;  3SN4 A;  1STZ A;  1JRY A;  3I3L A;  3EAO A;  1GSN A;  2WP9 A;  1ECQ A;  2GSH A;  2YG6 A;  1GAL A;  4G7F A;  4BK2 A;  4RG3 A;  1ELS A;  4EWJ A;  3MSY A;  1GRG A;  4BUR A;  2C66 A;  4U8J A;  2BRY A;  3DFY A;  1JRX A;  3GD4 A;  1TYP A;  3H8L A;  2R4E A;  2QDD A;  4DXK A;  3FIM B;  2WQY A;  4Z44 A;  3G5R A;  3DDM A;  3IF9 A;  2F5Z A;  3FYY A;  3NGC X;  3VRA A;  4U2S A;  4DNA A;  4CCQ A;  3NK1 X;  2PPG A;  2ZBW A;  3QFA A;  3DIP A;  2WPC A;  1KDG A;  4K2X A;  3OC4 A;  1L9C A;  1X31 B;  3C4N A;  4K22 A;  3FPZ A;  3GMB A;  3SJN A;  2XH2 A;  1IUW A;  4GR1 A;  2GVC A;  3N4F A;  1E1L A;  1RVK A;  2PTZ A;  3JVA A;  3F8P A;  5KMR A;  1SJC A;  4YSY A;  4ZCC A;  4NEW A;  4OPI A;  4GF7 A;  3R0K A;  2YLR A;  4ADW A;  2POZ A;  3NH3 X;  4KPL A;  2R9Z A;  3NXL A;  1NU5 A;  3SR6 B;  3LZW A;  4J34 A;  4K5S A;  4HCL A;  2QA1 A;  2ZZ0 A;  3HZL A;  2I0Z A;  1ZMD A;  2Q6U A;  1GTH A;  1R6W A;  3AD7 B;  1D7Y A;  3RP6 A;  2P8B A;  3CGE A;  3IJL A;  2BS2 A;  2ONE A;  2OZ3 A;  1L0V A;  1TE6 A;  1ONF A;  2QDE A;  2AKZ A;  4ENL A;  3SYI A;  3CYJ A;  3ZVH A;  4AT2 A;  2EQ8 A;  3AB1 A;  3UJS A;  2YM2 A;  3V3N A;  3URH A;  3NKS A;  1NDA A;  4KWS A;  2X8H A;  1P2E A;  3THU A;  3K7Q X;  1PHH A;  3R0U A;  3FBS A;  3GY1 A;  2V61 A;  3CNJ A;  2QVH A;  1FFU C;  4I59 A;  5JRB A;  4IVM B;  1SB3 B;  2PMQ A;  3GO2 A;  4OVI A;  3T4W A;  4CCR A;  4H50 A;  1JCT A;  1RP0 A;  3D8X A;  3QSM A;  2GV8 A;  2C72 A;  3FV9 A;  1SEZ A;  1CC6 A;  4A6N B;  4JN8 A;  2E3T A;  4K8D A;  1JRP A;  1B5Q A;  3T2Y A;  1B4V A;  1P43 A;  4H4U A;  3ABV A;  2C67 A;  2EQ9 A;  3HYW A;  3VQR A;  3NYE A;  2PTX A;  4XXG A;  2YLT A;  1Y56 B;  2WP5 A;  1EC7 A;  1REO A;  4NWZ A;  4YWO A;  1JEH A;  3N6H A;  3DG6 A;  3ATR A;  4IL2 A;  1O95 A;  3S47 A;  3RRA A;  1D4C A;  3TW9 A;  1CJ2 A;  2YG4 A;  3EPT A;  2PGW A;  1GTE A;  4II2 A;  4OPU A;  1BGN A;  4YTP A;  4IA5 A;  3R9U A;  4U2L A;  3TOY A;  5ER0 A;  3L8K A;  3DES A;  3GDP A;  3GD3 A;  3VA8 A;  1S2Y A;  4YTN A;  3GRS A;  3BI4 A;  5JCN A;  1WUE A;  3UKL A;  1MDR A;  2JKC A;  3T14 A;  3UKA A;  3M0O A;  1NEL A;  3VR8 A;  2OLA A;  3PK7 A;  3GWD A;  2VVL G;  4HB9 A;  4EMJ A;  3TWA A;  2VQ7 A;  5KVI A;  4DGK A;  2C76 A;  4E0V A;  4A6N A;  3V5C A;  4YSH A;  3H12 A;  4EM3 A;  2GMJ A;  1N4V A;  3CT2 A;  2OZ8 A;  4A7A A;  4PAA A;  3C4A A;  3FXG A;  3EKG A;  3NFU A;  4B64 A;  2GEW A;  1NHP A;  4HCH A;  4EM4 A;  1AOG A;  2UZZ A;  5FJP A;  3QVR A;  4GGH A;  4K8G A;  1Y0P A;  1CJ4 A;  4G6H A;  2GQW A;  2Q7V A;  5BUL A;  3F8R A;  3STP A;  1DJQ A;  1KSS A;  2JB1 A;  1XPQ A;  2OFJ A;  4G6G A;  2I5Q A;  2R0P A;  4X2P A;  4B1B A;  2C7G A;  4Z24 A;  3K7T A;  2POD A;  4USR A;  4II3 A;  3DJD A;  1PJ7 A;  1FOH A;  3KPF A;  5ENL A;  3CPI G;  3ZVI A;  3UJE A;  4U8P A;  3DJE A;  2GAG B;  3ALM A;  3TWB A;  2XFO A;  4EQW A;  2CVJ A;  2Q0K A;  4GAV A;  1PJ5 A;  1LJ1 A;  4Z2T A;  4BK3 A;  3BI5 A;  3RNM A;  2DKI A;  3VC5 A;  3PVC A;  3P93 A;  2VRM A;  4JNQ A;  1W6T A;  2GDQ A;  4Y4M A;  4U2T A;  4IL0 A;  5KRQ A;  1KKO A;  1T3Q C;  3I6T A;  4HNL A;  4B65 A;  4NTE A;  2XVH A;  5EBK A;  1H2I A;  3QLD A;  1BQG A;  4GAP A;  2CUL A;  1IJH A;  2B76 A;  2XVE A;  5BOE A;  4J36 A;  3PO7 A;  4JNA A;  3AXB A;  2E5A A;  1OJ9 A;  4A5L A;  5EOW A;  3MY9 A;  1H83 A;  3MQT A;  1ELI A;  4E4F A;  2P0I A;  1MXT A;  1GER A;  4H83 A;  5JCL A;  3T8Q A;  1JNZ A;  2JBV A;  4DSG A;  3MWC A;  2IVD A;  3P1W A;  1WUF A;  4GFI A;  1EL5 A;  2QJJ A;  3MUC A;  2RGH A;  3QPE A;  2C75 A;  1ZKQ A;  2ZZB A;  4FX9 A;  2B9Y A;  1N61 C;  3UJF A;  1FO4 A;  3I6D A;  3G5S A;  2GMH A;  4REK A;  4OCG A;  2X3N A;  4U8M A;  2VRL A;  3ALL A;  1GET A;  4U8K A;  3S5W A;  5L46 A;  4NNJ A;  3RP8 A;  1O94 A;  3BNM A;  4C3X A;  3CND A;  1K4Q A;  4FK1 C;  3R1Z A;  3R10 A;  4AOX A;  2BXR A;  4P9S A;  4H1Z A;  4WCT A;  3V3O A;  3NT6 A;  2V60 A;  3SFD A;  2GH5 A;  1X2G A;  5IQ1 A;  4ZN0 A;  1GES A;  3AEG A;  4GIR A;  1EBD A;  3RP7 A;  2YWL A;  3KLJ A;  3CB3 A;  3GD6 A;  2AL2 A;  3T2Z A;  1E1K A;  1R0M A;  3G5Q A;  2QCU A;  2PGE A;  3AE2 A;  3RCY A;  1GRA A;  3AE7 A;  3BI2 A;  3V3W A;  1JPD X;  5TR3 A;  2BK4 A;  2DW7 A;  2GR0 A;  1V97 A;  5FS7 A;  1OJD A;  3B6D A;  1NEN A;  1VG0 A;  4OPG A;  4Z26 A;  2WOV A;  4EQX A;  3AD9 B;  7ENL A;  4ROP A;  1ZMC A;  1F6M A;  4FDC B;  4UDQ A;  3P0W A;  3UCD A;  1BWC A;  1TYT A;  4H4P A;  1VDC A;  4U8I A;  5FS9 A;  4JY3 A;  1E1M A;  3GYX A;  2QJM A;  3B97 A;  3EEZ A;  3D9X A;  2OG9 A;  2W3S A;  3HYX A;  3A7R A;  3NRN A;  3AYI A;  3A7A A;  2YM1 A;  4HN8 A;  2PTY A;  3D47 A;  2C65 A;  4H7U A;  2HNE A;  1DOC A;  1GRE A;  2R45 A;  1VQW A;  2WPF A;  2TPR A;  3ZLG A;  1NG3 A;  5EB5 A;  4M0X A;  1YQZ A;  2OLN A;  3ALJ A;  3FCP A;  3P9U A;  3AD8 B;  4G73 A;  4A6G A;  3CAW A;  1KFY A;  3H8I A;  2YG3 A;  3AE8 A;  1ZDL A;  3AMZ A;  4X9N A;  4Z2R A;  3ICR A;  1FHU A;  3ICS A;  2B9X A;  2WU5 A;  2IID A;  4APN A;  4U8O A;  1EBG A;  2E1M A;  2WET A;  5FS6 A;  3HRD C;  3OZM A;  2VQB A;  4Y4N A;  1COY A;  3NTA A;  2BYB A;  1S3E A;  4H2R A;  3Q9T A;  3EUB 3;  1XPY A;  4HNC A;  3Q6J A;  2B7R A;  2BS4 A;  4YSX A;  1Q1W A;  1TDK A;  1TDO A;  5IDZ A;  3P4S A;  4OPD A;  2XVI A;  4H4S A;  1B8S A;  3KA7 A;  4RG4 A;  2YR5 A;  4BK1 A;  1NAA A;  1L9D A;  4J1O A;  2C73 A;  2FJD A;  1JRO A;  2YG7 A;  1GXF A;  2V6O A;  3PWG A;  4UP3 A;  5C3J A;  1PN0 A;  2XFU A;  1FFV C;  3DK9 A;  1ZP0 A;  4RSL A;  1PDZ A;  4UDR A;  1ZY8 A;  3IHG A;  2GF3 A;  3D46 A;  3SFE A;  2XLU A;  1XDI A;  4Z25 A;  3R07 C;  2R4J A;  1TDN A;  1P2H A;  4H2P A;  3GWF A;  2FBW A;  2GR3 A;  1TZZ A;  2GQF A;  2GL5 A;  3AEB A;  1F9C A;  1NG4 A;  3SXI A;  2OAM A;  2ZZC A;  2PU1 A;  2AAQ A;  2GGJ A;  3NIX A;  3UCC A;  5FJR A;  4U8N A;  2O9Z A;  3TTE A;  3LOV A;  3VFC A;  4E8G A;  2R0G A;  3AE1 A;  4IHC A;  2X8C A;  1MRA A;  2GRT A;  3RED A;  4E6M A;  4AP3 A;  5BVA A;  5IPY A;  2PU0 A;  2W0H A;  4YKF A;  5HXI A;  1EL8 A;  1KNP A;  2HZG A;  1MUC A;  3V5F A;  3UP5 A;  4GCM A;  2PP1 A;  1FCD A;  2BCG G;  4J31 A;  5HHF A;  1Y56 A;  2YR4 A;  1F8R A;  2GGH A;  2OA1 A;  1MNS A;  1NHS A;  5LV9 A;  4MGG A;  4YWS A;  3IC9 A;  4C77 A;  4YXD A;  4ZA0 A;  2APG A;  5CKU A;  4B69 A;  1FEA A;  2RGJ A;  4HA6 A;  2QAE A;  1LV0 A;  3HYV A;  4KX6 A;  3U4F A;  1N5W C;  1BZL A;  1MOK A;  1X2H A;  3K1G A;  2RGO A;  2W55 A;  3R25 A;  2R0C A;  2YLX A;  1TKK A;  2WHD A;  4GIS A;  3AE9 A;  3KUM A;  3ITJ A;  3SN1 A;  1N1P A;  3QN3 A;  1EBH A;  4USQ A;  1L9E A;  1H81 A;  4TM4 A;  1S2Q A;  3BHK A;  3ICT A;  1H86 A;  3UCL A;  2YVJ A;  3H7V A;  4HPN A;  2B9W A;  4TVY A;  2QA2 A;  5FJO A;  4CRT A;  4K7Z A;  3I6E A;  1DXL A;  2PTW A;  3KKJ A;  1GEU A;  4IP5 A;  1PJ6 A;  3UKH A;  3OZY A;  2PS2 A;  4H4Y A;  5KNL A;  3LZX A;  3K30 A;  1DJN A;  1CC4 A;  2WP6 A;  2OZT A;  4EMI A;  3DEQ A;  2BXS A;  3DGB A;  2BK5 A;  1DOD A;  3DG3 A;  1O5W A;  2BAB A;  4A99 A;  3QKE A;  4CY6 A;  3DGZ A;  3VRD B;  1H82 A;  4Z1Y A;  3V76 A;  3AEC A;  2YAU A;  3GMC A;  5JCM A;  1LPF A;  3OTR A;  2YLW A;  2OQH A;  2PP0 A;  1PXB A;  2Y6R A;  3ZVH B;  3SGL A;  1D4E A;  3VRB A;  3L5O A;  1KF6 A;  4CY8 A;  4TM0 A;  3FG2 P;  5C2T A;  1HYU A;  4EMW A;  3IHM A;  3RIT A;  4TLX A;  5GRT A;  4IV9 A;  1XS2 A;  1ZX9 A;  3NTD A;  4PAB A;  4E4U A;  4IP4 A;  4CNK A;  1L8P A;  4IA6 A;  2QQ6 A;  2OLO A;  3KPK A;  2HXU A; 
#chains in the Genus database with same CATH homology
 4Y4L A;  3SZC A;  3F8P A;  3KLJ A;  5KOW A;  5KMR A;  3T2Z A;  1K0I A;  4YSY A;  3CGC A;  2OAL A;  1JOA A;  3NLC A;  4ZCC A;  2GR2 A;  4NEW A;  2H89 A;  1GT8 A;  4GF7 A;  1E1K A;  4OPI A;  2E5V A;  1JNR A;  3G5Q A;  2YLR A;  4ADW A;  2QCU A;  5KWF A;  3H4K A;  3NH3 X;  3AYJ A;  3GYJ A;  3AE6 A;  4H4R A;  3QVP A;  2R9Z A;  3AE2 A;  1NEK A;  3LZW A;  2YG5 A;  1GRA A;  4J34 A;  1E1N A;  3AE7 A;  4K5S A;  3BI2 A;  2QA1 A;  2ZZ0 A;  3HZL A;  2I0Z A;  1KN0 A;  1ZMD A;  2BC0 A;  2Q6U A;  5TR3 A;  4EIQ A;  2BK4 A;  1GTH A;  1EL9 A;  2GR0 A;  3AD7 B;  2X99 A;  1D7Y A;  2J3N A;  2C4C A;  5FS7 A;  2NPX A;  3PG6 A;  2XLS A;  3CN8 A;  3RP6 A;  1OJD A;  2VOU A;  3B6D A;  1NEN A;  1VG0 A;  3CGE A;  2WDR A;  4OPG A;  4Z26 A;  2IVE A;  4ZCD A;  3RP7 A;  2XLR A;  2BS2 A;  2NVK X;  2WOV A;  2FJA A;  1JU2 A;  1QO8 A;  4EQX A;  1IUU A;  1YKJ A;  3AD9 B;  1L0V A;  2WBA A;  4Z43 A;  4CNJ A;  1ONF A;  1PBF A;  1NHQ A;  3CNP A;  1ZMC A;  2AR8 A;  2GAH B;  1F6M A;  2A8X A;  3AE4 A;  3CNS A;  1PBB A;  4B68 A;  3QSS A;  3SY4 A;  4FDC B;  3SYI A;  1Q1R A;  4A79 A;  4J33 A;  5JCK A;  4UDQ A;  3AWI A;  4AT2 A;  1BWC A;  1V59 A;  1TYT A;  2EQ8 A;  3CGD A;  4H4P A;  2WS3 A;  3AB1 A;  1VDC A;  3AEE A;  1FL2 A;  4Z2U A;  2YM2 A;  1PBD A;  3V3N A;  3URH A;  5FS9 A;  3GYI A;  4U8I A;  3NKS A;  2PHH A;  4JY3 A;  1NDA A;  2XVJ A;  3DME A;  3KD9 A;  2X8H A;  1P2E A;  1Z6L A;  1E1M A;  4N9X A;  3GYX A;  3S61 A;  3O0H A;  5KVH A;  2BCP A;  2XFP A;  1E6E A;  3JSK A;  3K7Q X;  3ATQ A;  3D9X A;  3QJ4 A;  2RAB A;  1PHH A;  4D04 A;  4H4W A;  4KPR A;  3FBS A;  5BUK A;  2V61 A;  3HYX A;  2BC1 A;  3CNJ A;  3SZ0 A;  2YLZ A;  3NRN A;  1GND A;  5U25 A;  1F8W A;  3C96 A;  3AYI A;  4I59 A;  5JRB A;  3NYC A;  4H4T A;  2YM1 A;  4H2Q A;  1H7W A;  4ICY A;  2C65 A;  4H7U A;  1CBO A;  4IVM B;  4O5Q A;  3UKQ A;  2VVL A;  4OVI A;  1GPE A;  1YY5 A;  4CCR A;  4JQ9 A;  2C70 A;  4O5U A;  4H50 A;  1DOC A;  1GRE A;  2VVM A;  1LQT A;  2R45 A;  3IWA A;  3E1T A;  1VQW A;  4H4Z A;  2WPF A;  2BAC A;  2TPR A;  1XAN A;  1B37 A;  2A89 A;  5EB4 A;  1RP0 A;  3D8X A;  3T37 A;  1NG3 A;  3QSM A;  5EB5 A;  2GV8 A;  2C72 A;  1S3B A;  1SEZ A;  1YQZ A;  2YQU A;  2OLN A;  3ALJ A;  3M12 A;  3P9U A;  3D1C A;  1CC6 A;  3AD8 B;  4A6N B;  2WPE A;  4G73 A;  1GRB A;  1GRT A;  1KFY A;  3AE5 A;  3H8I A;  4K8D A;  2C3C A;  2YG3 A;  2WDQ A;  3AE8 A;  4M52 A;  4A65 A;  1ZDL A;  4Z2R A;  4X9N A;  1F8S A;  4I58 A;  4C74 A;  1B5Q A;  3ICR A;  1ZOY A;  5KMQ A;  2H88 A;  4TM1 A;  3SZF A;  1IUV A;  3NK0 X;  2DKH A;  4JDR A;  3T2Y A;  1B4V A;  4H4U A;  3UKP A;  3ICS A;  3ABV A;  2B9X A;  1IUS A;  2C67 A;  2WU5 A;  1M64 A;  1TDE A;  2WES A;  3DJG X;  2EQ9 A;  2ACZ A;  2IID A;  3M13 A;  4APN A;  4G74 A;  4U8O A;  3GRT A;  1GRF A;  1CF3 A;  2E1M A;  1KNR A;  3HYW A;  3VQR A;  1E39 A;  1LVL A;  3NYE A;  1GOS A;  3CGB A;  2WET A;  5FS6 A;  4H4X A;  2VQB A;  4ECH A;  4U8L A;  4K5R A;  1JRZ A;  4Y4N A;  2Y6Q A;  4XXG A;  2PYX A;  2YLT A;  5U1O A;  1COY A;  1VG9 A;  3NTA A;  1Y56 B;  2WP5 A;  2BYB A;  5U63 A;  1S3E A;  4FK1 A;  4H2R A;  3Q9T A;  1FEB A;  1N4W A;  1REO A;  4YWO A;  1VRQ B;  2JB2 A;  4NWZ A;  2CFY A;  4GDE A;  4IVO B;  1JEH A;  3T0K A;  3Q6J A;  2B7R A;  4NTC A;  3ATR A;  3UKF A;  2BS4 A;  2V3A A;  4YSX A;  4J56 A;  5FS8 A;  1Q1W A;  1CHU A;  1O95 A;  1TDK A;  2ARD A;  3ADA B;  3P4R A;  4XWR A;  1TDO A;  3P4S A;  4OPD A;  1D4C A;  2XVI A;  1PXC A;  1CJ2 A;  2YG4 A;  3AYL A;  3EPT A;  4H4S A;  3EF6 A;  2WOI A;  1KSU A;  1B8S A;  4LII A;  1GTE A;  3FMW A;  4II2 A;  3KA7 A;  2XFQ A;  4OPU A;  1BGN A;  4RG4 A;  3NNE A;  4YTP A;  2YR5 A;  4IA5 A;  3R9U A;  4BK1 A;  1NAA A;  3AEA A;  1D7L A;  4U2L A;  1L9D A;  5ER0 A;  3L8K A;  4BV6 A;  3F8D A;  3GDP A;  4LU6 A;  2C73 A;  3GD3 A;  2FJD A;  3GSI A;  1S2Y A;  4BJZ A;  2YG7 A;  4AOS A;  3II4 A;  2Z5X A;  1EBD A;  2HQM A;  1GXF A;  2V6O A;  3P4Q A;  2GR1 A;  5JCI A;  1PN0 A;  2C64 A;  2XFU A;  4UP3 A;  5FMH A;  4YTN A;  5C3J A;  3GDN A;  3GRS A;  1YQ4 A;  3DK9 A;  1ZP0 A;  4RSL A;  3BI4 A;  4UDR A;  2YVG A;  1ZY8 A;  5JCN A;  3IHG A;  3DH9 A;  3UKL A;  3SM8 A;  2GF3 A;  2XCG A;  2JKC A;  4CBQ A;  4B67 A;  3T14 A;  3UKA A;  3NN0 X;  3M0O A;  5J60 A;  3SFE A;  3UOZ A;  3VR8 A;  4UDP A;  4GRT A;  1F3P A;  1H6V A;  2BRA A;  2XLU A;  1XDI A;  4H2N A;  3GWD A;  4EIP A;  2YVF A;  1CJ3 A;  5BRT A;  4J57 A;  5M0Z A;  2X50 A;  4Z25 A;  2R4J A;  2VVL G;  2E4G A;  5KMP A;  3NK2 X;  2EQ6 A;  4HB9 A;  4YTM A;  4EMJ A;  2VQ7 A;  1TDN A;  5KVI A;  4DGK A;  4YT0 A;  2C76 A;  1P2H A;  4E0V A;  4A6N A;  3QFB A;  3AE3 A;  4H2P A;  3GWF A;  3UTH A;  1LTX R;  2FBW A;  4YSH A;  5J7X A;  3CMM A;  1BGJ A;  5GSN A;  2GR3 A;  2WEU A;  3B3R A;  1W4X A;  2GQF A;  1QLB A;  4EM3 A;  3SZW A;  2GMJ A;  4G9K A;  1N4V A;  4GDP A;  3AEB A;  5HYM A;  3CPH G;  3T2K A;  4A7A A;  4PAA A;  1ZOV A;  2YR6 A;  1M6I A;  3C4A A;  1D5T A;  3LAD A;  4AT0 A;  4B64 A;  3DA1 A;  2GEW A;  1NG4 A;  3OZ2 A;  2XFN A;  1NHP A;  3SXI A;  5KOX A;  2OAM A;  4EM4 A;  4NTD A;  2ZZC A;  1AOG A;  2UZZ A;  2AAQ A;  5DBJ A;  3COX A;  2BS3 A;  3CIR A;  3NIX A;  4D03 A;  2V5Z A;  3QVR A;  4OPL A;  1EL7 A;  1Q9I A;  1Y0P A;  4U8N A;  5HY5 A;  1CJ4 A;  2O9Z A;  2Q0L A;  3LOV A;  4G6H A;  2GQW A;  2BK3 A;  2TMD A;  3BNU A;  2Q7V A;  3DK8 A;  2VZ2 A;  2EQ7 A;  4TM3 A;  3F8R A;  2JB3 A;  3NHO X;  5BUL A;  1DJQ A;  1KSS A;  1RSG A;  2JB1 A;  1PBE A;  2R0G A;  3AE1 A;  5IQ4 A;  1XPQ A;  2X8C A;  3RED A;  2GRT A;  4AP3 A;  5BVA A;  5IPY A;  2W0H A;  3P4P A;  4G6G A;  4YKF A;  2C3D A;  3SQP A;  2R0P A;  1K0J A;  5HXI A;  1EL8 A;  1KNP A;  2YLS A;  3BHF A;  4B1B A;  1ZK7 A;  1CL0 A;  2C7G A;  2FJE A;  3UKK A;  3UP5 A;  3UP4 A;  4Z24 A;  3K7T A;  4GCM A;  1GRH A;  1H84 A;  4USR A;  2BCG G;  1FCD A;  4II3 A;  4J31 A;  5HHF A;  1QJD A;  5KMS A;  1NHR A;  1Y56 A;  3DJD A;  5KXJ A;  1PJ7 A;  2YR4 A;  1F8R A;  1FOH A;  2OA1 A;  3KPF A;  1TRB A;  1NHS A;  3CNT A;  5LV9 A;  1GV4 A;  1CC2 A;  2GB0 A;  3CPI G;  3UTE A;  3ISH A;  3IC9 A;  4C77 A;  4U8P A;  3DJE A;  2GAG B;  3ALM A;  5CQF A;  4YXD A;  1DNC A;  2APG A;  5CKU A;  4B69 A;  2XFO A;  1FEA A;  4EQW A;  2XYO A;  2CVJ A;  2Q0K A;  2RGJ A;  4GAV A;  4HA6 A;  2QAE A;  4WX1 A;  1PJ5 A;  1LV0 A;  1LJ1 A;  1BF3 A;  3HYV A;  4KX6 A;  4OPT A;  3SX6 A;  4Z2T A;  4BK3 A;  3BI5 A;  1BZL A;  3RNM A;  3UTF A;  1MO9 A;  2DKI A;  3PVC A;  3DGH A;  3PS9 A;  3KVE A;  2XVF A;  4YKG A;  2VRM A;  1MOK A;  4JNQ A;  3QSE A;  1IUX A;  3WE0 A;  1S7M A;  4Y4M A;  2RGO A;  4U2T A;  2YLX A;  2R0C A;  2WHD A;  3DJJ A;  3AE9 A;  3ITJ A;  4OPC A;  5KRQ A;  1N1P A;  1H7X A;  2WOW A;  2FJB A;  1L9E A;  1H81 A;  4TM4 A;  1K0L A;  4TLZ A;  1S2Q A;  3EAN A;  3BHK A;  3ICT A;  1H86 A;  4XWZ A;  3T31 A;  2CDU A;  3UCL A;  2WDV A;  4B65 A;  2JK6 A;  3ZYX A;  4AP1 A;  2Z5Y A;  2JAE A;  2YVJ A;  3K7M X;  4NTE A;  2XVH A;  2AQJ A;  5EBK A;  3AEF A;  1H2I A;  3VR9 A;  2B9W A;  4GAP A;  1CJC A;  1LQU A;  3UOY A;  2CUL A;  1IJH A;  3DK4 A;  2QA2 A;  2B76 A;  2XLP A;  2A87 A;  4K7Z A;  1N4U A;  2XVE A;  4CRT A;  4DSH A;  1PDH A;  3RHA A;  1DXL A;  1DOE A;  1BKW A;  2BA9 A;  4J36 A;  5M10 A;  3PO7 A;  1JRY A;  3I3L A;  4JNA A;  3EAO A;  3AXB A;  3KKJ A;  1GEU A;  3UOV A;  1PBC A;  1GSN A;  1PJ6 A;  1UKV G;  2WP9 A;  3UKH A;  1OJ9 A;  3CPJ G;  4A5L A;  4H4Y A;  2YG6 A;  1YQ3 A;  5KNL A;  1NPX A;  2V3B A;  4H4V A;  3LZX A;  1OJT A;  1GAL A;  3K30 A;  3LXD A;  3CTY A;  5EOW A;  3ZDN A;  1DJN A;  1OJA A;  1CC4 A;  1H83 A;  1PS9 A;  2XDO A;  2WP6 A;  1TDF A;  4EMI A;  3NN6 X;  2R46 A;  1ELI A;  4MJW A;  2BXS A;  1OJC A;  4BK2 A;  2BK5 A;  1MXT A;  4RG3 A;  1GER A;  5JCL A;  2JBV A;  1DOD A;  1JNZ A;  4DSG A;  4C3Y A;  3NG7 X;  4LA1 A;  2IVD A;  1O5W A;  2BAB A;  1GRG A;  3P1W A;  4BUR A;  1EL5 A;  4A99 A;  4JY2 A;  2C66 A;  4U8J A;  2BRY A;  1E7P A;  1JRX A;  2RGH A;  4CY6 A;  3DGZ A;  3VRD B;  4YSZ A;  4EQR A;  1H82 A;  4BJY A;  3GD4 A;  2C75 A;  1ZKQ A;  1TYP A;  2ZZB A;  4FX9 A;  3H8L A;  2B9Y A;  2R4E A;  3V76 A;  3LB8 A;  3L1R A;  3AEC A;  2YAU A;  3FIM B;  3GMC A;  4J2W A;  5JCM A;  2WQY A;  3I6D A;  1LPF A;  4Z44 A;  4B63 A;  3LJP A;  4H4Q A;  3G5S A;  2GMH A;  2YLW A;  4REK A;  1PXB A;  2Y6R A;  3G5R A;  4OCG A;  2X3N A;  4GUV A;  4U8M A;  3SGL A;  1D4E A;  2VRL A;  4NEV A;  1FEC A;  2X8G A;  1DOB A;  3IF9 A;  2F5Z A;  3L5O A;  3ALL A;  1GET A;  4USQ A;  3VRB A;  3KU9 A;  3NGC X;  4U8K A;  1PXA A;  1KF6 A;  3S5W A;  4CY8 A;  5L46 A;  4TM0 A;  3FG2 P;  4NNJ A;  3RP8 A;  5C2T A;  1HYU A;  1O94 A;  1D4D A;  2WU2 A;  4EMW A;  3BNM A;  3IHM A;  4C3X A;  1XHC A;  3VRA A;  3CND A;  1K4Q A;  4U2S A;  4X4J A;  3AED A;  4B66 A;  2XLT A;  4TLX A;  5GRT A;  4DNA A;  4CCQ A;  4FK1 C;  3NK1 X;  3UTG A;  4IV9 A;  4JN9 A;  4A9W A;  4EQS A;  1ZX9 A;  4X9M A;  3NTD A;  4AOX A;  2BXR A;  2ZBW A;  3QFA A;  4PAB A;  4P9S A;  2WPC A;  1KDG A;  4CNK A;  4WCT A;  4C5O A;  3V3O A;  4K2X A;  3NT6 A;  3OC4 A;  1L9C A;  1X31 B;  4IA6 A;  3C4N A;  2V60 A;  4K22 A;  3FPZ A;  3SFD A;  2GH5 A;  4NZH A;  3GMB A;  5IQ1 A;  1IUW A;  1RYI A;  2OLO A;  3KPK A;  4ZN0 A;  4GR1 A;  2B7S A;  3UOX A;  1GES A;  3AEG A;  2GVC A;  3NYF A;  1IUT A;  1E1L A;  2YWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...