4LIIA

Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (aifm1) from homo sapiens at 1.88 a resolution
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
Knots found
sequence length
487
structure length
474
Chain Sequence
QDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (AIFM1) from Homo sapiens at 1.88 A resolution
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase, apoptosis
total genus 147
structure length 474
sequence length 487
other databases KnotProt 2.0: S -31
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4liiA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4liiA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4liiA01
2X3NA 4XXGA 3RHAA 1D5TA 1D4EA 3L8KA 2YR5A 1F8RA 3CPIG 3GDPA 1GRTA 3AECA 3SFEA 4IVOB 3ATRA 4A65A 4AP1A 5BRTA 4OPGA 2GF3A 3CNPA 3KKJA 2EQ7A 3LADA 1O95A 4PAAA 3EAOA 2WEUA 1DNCA 3RP7A 3UKFA 3GDNA 1L9CA 1QJDA 4YSYA 2GAGB 3UTHA 5GSNA 2NVKX 1Q1WA 5M0ZA 4I59A 3FBSA 1XPQA 3CGCA 5KOXA 4U8JA 4K5SA 3ALJA 2XVEA 1QLBA 4B63A 5CKUA 4TM4A 3CGDA 3II4A 3AD7B 5L46A 1XDIA 3CN8A 4JQ9A 1Q9IA 1Y0PA 4U2LA 1TYTA 3AE4A 4Z2TA 4U2SA 1PJ7A 3LZWA 1GRAA 2YM2A 1EL7A 4ICYA 3DK4A 4APNA 1E39A 1YQ4A 3AWIA 3M0OA 2XFUA 4MJWA 4U8NA 4AOXA 4U8LA 5IQ1A 1NHPA 3QSMA 1NENA 3CNJA 3P4RA 1P2HA 1GNDA 1Z6LA 2YG4A 3NRNA 3NT6A 3PS9A 4FK1C 5EOWA 3UCLA 1O5WA 3P4PA 5HY5A 1BF3A 1FCDA 2BK5A 3NGCX 3DJDA 2B9YA 4RG3A 5KXJA 1FEAA 1AOGA 1CF3A 3GYIA 2Z5XA 1LPFA 3UKKA 1F6MA 2JK6A 2WOVA 2YLRA 4XWRA 4FK1A 3UOVA 2XLUA 1NDAA 2V5ZA 1OJTA 3DGHA 3G5SA 3AD9B 1TDEA 4CY8A 3DK9A 1IUUA 4A7AA 1PS9A 1JRXA 1VRQB 3REDA 3ITJA 5KWFA 1E1KA 4IA6A 4OPCA 3DJEA 1ELIA 2C7GA 3WE0A 1B5QA 3UKPA 2GAHB 1GTHA 2CDUA 2F5ZA 5KVIA 2C72A 2X50A 2R0PA 1FL2A 3LXDA 2FJDA 4U8KA 2WDRA 3NHOX 4EQSA 1TDNA 3G5QA 5LV9A 3K7TA 2Y6QA 1VDCA 1CC2A 4JY3A 2WOWA 2A89A 5IQ4A 1NPXA 4PABA 2JB3A 1KNRA 4HA6A 2BABA 1OJ9A 2GB0A 4Z44A 2GQFA 2WOIA 3GSIA 2WP5A 1K0IA 4OPTA 3VRDB 2BC1A 2V60A 4Y4NA 4JN9A 4K8DA 5JCKA 3VR9A 4J2WA 1UKVG 2RGHA 2ACZA 3EPTA 3AD8B 1IUTA 4K2XA 3UOXA 1DOCA 1D7YA 3AEDA 4GDPA 1YKJA 2XVJA 4K5RA 1F8SA 3LB8A 1BKWA 2R46A 1NEKA 1PXAA 4U2TA 3AE3A 1GALA 1GREA 1S2QA 3B3RA 4Y4LA 2YG7A 1PJ5A 3AE2A 4YXDA 4XWZA 4GR1A 1CC6A 4DSHA 4H4TA 1LVLA 4IA5A 1L0VA 3KVEA 1CJ2A 2WU2A 1GV4A 4EMIA 2TMDA 4YSHA 2JAEA 2A8XA 4AT2A 4YKFA 3KLJA 1NG4A 4H7UA 3AB1A 4EQXA 2Q6UA 3VQRA 1F3PA 3K7QX 2AAQA 3NLCA 2YVJA 3AE5A 1DOEA 1L9EA 1PN0A 2ZZCA 1D4CA 1PBBA 1PBEA 2XFQA 3CIRA 3DK8A 2VVLG 2TPRA 1JNZA 1TDOA 4EM4A 2YLXA 1KSUA 3Q6JA 2YG5A 4UDRA 3AYLA 1B8SA 4K7ZA 4N9XA 3NNEA 4FX9A 2GH5A 2BK4A 2BS3A 3PO7A 1DOBA 1MO9A 5FS6A 1H7WA 4RG4A 1K4QA 1PHHA 4EIPA 3UKQA 4BJYA 1O94A 3EF6A 3UTEA 4CRTA 3FIMB 3IC9A 4JNAA 4O5QA 4REKA 5BVAA 2WDVA 3ALMA 1TRBA 3V76A 5BUKA 2B9XA 4OPLA 3VR8A 4TM1A 4CCRA 1QO8A 4H4PA 1LTXR 4ZCDA 4EMJA 3IHMA 4BURA 5M10A 1Y56A 2V6OA 3QVPA 3AEAA 1PXCA 1D4DA 4WX1A 2WHDA 3OZ2A 1BGNA 1IJHA 1OJAA 2WP6A 4NEVA 4J57A 4JY2A 2B7RA 5TR3A 4OPDA 3RP8A 5KOWA 4USRA 1YQZA 1NG3A 4H4XA 3BNUA 2YR6A 3COXA 3SGLA 1ZMDA 2EQ8A 2GRTA 2VQBA 1N1PA 5C3JA 5FMHA 2R4JA 4B64A 2BXRA 3S5WA 1BGJA 1L9DA 5HHFA 3I6DA 4A79A 1BZLA 5DBJA 1GRHA 2C67A 2JBVA 4CBQA 1PBDA 1F8WA 1VQWA 2B76A 4EQWA 3NTAA 3NK0X 4D04A 2C64A 3OC4A 5ER0A 1KNPA 2WESA 1DJNA 3CGEA 2VRLA 4Z24A 4M52A 4OVIA 2FJAA 1BWCA 3SM8A 3FG2P 3AE7A 2C66A 3IHGA 4K22A 1KF6A 2CVJA 3UTGA 2EQ6A 2XCGA 3E1TA 2NPXA 2R4EA 3K30A 3NK2X 1JEHA 2J3NA 3G5RA 3C4NA 4J33A 2Q0LA 5GRTA 3C4AA 2XYOA 3NIXA 2ZZ0A 3ABVA 2I0ZA 3D1CA 4J34A 1GSNA 3F8PA 1DODA 1FECA 3KPFA 3VRBA 2X99A 5KVHA 2WETA 3C96A 1E7PA 2XVFA 1EBDA 4EMWA 2VZ2A 3ICRA 2AQJA 2DKHA 2C3CA 3FMWA 2FJBA 1H7XA 2Y6RA 3NYFA 3ISHA 4GF7A 3UKLA 1N4WA 3F8DA 3BI5A 2XVIA 5J7XA 3BHFA 1EL5A 3GMCA 2WPEA 3AE9A 2Q7VA 1M64A 4YTPA 3SQPA 3P9UA 1JOAA 4J36A 1YY5A 3F8RA 2BACA 3DA1A 4NZHA 1NHSA 2R45A 3KA7A 4GUVA 3JSKA 2YLWA 4BK3A 1CJCA 1RSGA 2H89A 2HQMA 3ICTA 2X8GA 2GR3A 4GCMA 4TLZA 4Z25A 1OJDA 1Y56B 4C3XA 2OAMA 1ZOYA 3DGZA 3AEFA 4BJZA 3RNMA 4U8OA 4AOSA 1M6IA 4H4YA 4UP3A 2WU5A 4Z43A 1RYIA 1TDFA 4J56A 5FS8A 3LZXA 2VOUA 2WDQA 1CHUA 1PBCA 4RSLA 1NHRA 1KDGA 1LQUA 1ZY8A 2YAUA 3LOVA 2R0GA 2C70A 2BS2A 4H2PA 4I58A 2W0HA 3K7MX 2BXSA 4KPRA 2V3AA 1GT8A 2E1MA 2XLTA 2YM1A 2CULA 1JU2A 4H2QA 3KU9A 3H8LA 3HZLA 2XDOA 1N4VA 3GWDA 4H4WA 3UKAA 1RP0A 3NK1X 1NHQA 2GR0A 3ZDNA 1Q1RA 1CL0A 3CPJG 4ECHA 4LU6A 3RP6A 2BCPA 3GRSA 1ZDLA 1VG0A 4H4QA 4H4SA 2AR8A 1N4UA 2R9ZA 1E6EA 1XANA 2QA1A 4LIIA 3BI4A 4B66A 1GETA 1CC4A 2WBAA 3DJGX 5J60A 2WPFA 1P2EA 4X9NA 1CBOA 2WQYA 5C2TA 3GD3A 1REOA 1S3EA 2BYBA 2YWLA 2GQWA 3UP4A 2QCUA 2V61A 4Z2RA 1TDKA 2XLSA 2IVDA 3T37A 3ALLA 4H4VA 4A6NA 4C74A 3DMEA 2O9ZA 4USQA 4YSZA 4FDCB 1IUVA 3IWAA 2BA9A 4WCTA 4IVMB 2GR2A 2YVFA 2ARDA 2B7SA 2APGA 3AE8A 1ZP0A 1MOKA 3GWFA 4AT0A 4DGKA 1EL9A 1CJ3A 2GEWA 4NTDA 3QJ4A 4B67A 2IVEA 4Z26A 3SFDA 3UP5A 4ZN0A 4GRTA 4YTMA 2GV8A 3NG7X 3CNTA 1D7LA 4C5OA 1H82A 3B6DA 2YG3A 2V3BA 2QA2A 2YLZA 4HB9A 2X8HA 1GPEA 3ATQA 4B68A 4Z2UA 3H4KA 1H86A 4TLXA 1PJ6A 1ZOVA 2YLSA 4E0VA 4U8IA 2JB2A 3QFBA 1W4XA 2B9WA 2DKIA 4NTEA 1K0JA 1H84A 3UOYA 1SEZA 3AYIA 2YQUA 1LJ1A 4BV6A 2OLNA 1V59A 3PVCA 3Q9TA 2UZZA 5JCMA 4CY6A 2XFNA 2Z5YA 3NN0X 1EL8A 4YSXA 4H2RA 4ADWA 2OLOA 3AYJA 3P4SA 5JCIA 1GERA 3DH9A 2E4GA 4P9SA 1S3BA 3O0HA 1IUSA 1DJQA 1TYPA 4O5UA 2YLTA 2XVHA 3D8XA 3IF9A 3NYCA 4YTNA 4LA1A 5JCLA 1GOSA 2GR1A 3AEEA 2RGJA 1HYUA 1MXTA 1PDHA 1S2YA 4B65A 4EQRA 3GD4A 3ICSA 3NTDA 4DSGA 4BK1A 3KD9A 3NKSA 1JRZA 2GMJA 2X8CA 4H4UA 1B4VA 2BCGG 1GXFA 2IIDA 2VVLA 3AE6A 1ONFA 2XLRA 2WP9A 4YKGA 3UOZA 4KX6A 2OALA 2YG6A 2C76A 2PHHA 3H8IA 1E1LA 4NEWA 5EBKA 4OPUA 4OPIA 3GYJA 1K0LA 2C73A 5HYMA 5U63A 1GTEA 3NYEA 4CNJA 1YQ3A 4C3YA 3CPHG 2Q0KA 3AEBA 3P4QA 3LJPA 3UKHA 4CNKA 1JNRA 3CNDA 1IUWA 2JB1A 5EB5A 2EQ9A 1GRBA 3BNMA 1DXLA 4Y4MA 4B69A 2VVMA 2BS4A 3M12A 5FS9A 3R9UA 5EB4A 2GMHA 1LQTA 3NN6X 4TM0A 2C75A 3ADAB 4A6NB 3BI2A 2RGOA 3ZYXA 2A87A 4A5LA 3CTYA 1CJ4A 2FBWA 2GVCA 4ZCCA 3GMBA 3L1RA 5U1OA 1FOHA 4J31A 3M13A 4NTCA 3VRAA 1ZKQA 1X31B 1ZMCA 3AE1A 4DNAA 4U8PA 3BHKA 4IV9A 2QAEA 1PXBA 2XFPA 2VRMA 1GESA 4YWOA 3URHA 2BC0A 4YT0A 2RABA 2XFOA 3V3NA 5CQFA 2ZZBA 4BK2A 1E1MA 1GRFA 4EIQA 4U8MA 4A99A 1VG9A 3V3OA 4AP3A 1IUXA 1H83A 3P1WA 2YR4A 1ZK7A 3GRTA 3S61A 4A9WA 5IPYA 3NH3X 4UDQA 1FEBA 1GEUA 2CFYA 2XLPA 1COYA 4CCQA 4H50A 4X4JA 5BULA 2YVGA 4H4ZA 5U25A 3QSSA 3AEGA 5HXIA 2JKCA 2OA1A 3QVRA 5FS7A 1PBFA 2E5VA 5JCNA 1LV0A 2ZBWA 3I3LA 4GDEA 3UTFA 3CNSA 1GRGA 2C65A 4D03A 1OJCA 3QFAA 1H81A 5KRQA 2FJEA 3QSEA 3CGBA 4TM3A 1KFYA 2BK3A 1ZX9A 4EM3A 2R0CA 4C77A 2PYXA 1B37A 1XHCA 1KSSA 1NAAA 4B1BA 3FPZA 1E1NA 2WPCA 3DJJA 4H4RA 4H2NA 2H88A 2VQ7A 4UDPA 2C3DA 3EANA 4X9MA 2WS3A 4JNQA 1JRYA 4JDRA 1H6VA 3AXBA 4OCGA
chains in the Genus database with same CATH superfamily
3L8KA 2YR5A 2QJJA 3SZWA 4IVOB 1FO4A 1XPYA 4OPGA 2GGGA 2XH7A 3LADA 1O95A 4PAAA 1DNCA 3GDNA 2GAGB 3UTHA 1Q1WA 3DG3A 3FBSA 4HPNA 1W6TA 4U8JA 5CKUA 3AD7B 3T31A 4G73A 4DWDA 4Z2TA 4ICYA 3DK4A 1E39A 3AWIA 4U8NA 3QSMA 2OZ8A 3NRNA 4II3A 1BF3A 1JROA 1H2IA 3VCNA 1CF3A 3UKKA 3OP2A 2WOVA 2YLRA 5KNLA 3MY9A 1RM6B 3DK9A 4A7AA 1VRQB 5KWFA 4IA6A 1B5QA 3VDGA 3UKPA 2GAHB 1GTHA 3UXLA 3PG6A 3H12A 3LXDA 4U8KA 2CHRA 3NHOX 4H1ZA 4DXKA 3B9JB 4J3ZA 2WOWA 2A89A 4HA6A 2GB0A 4Z44A 2GQFA 2WP5A 2V60A 4Y4NA 3JZUA 4K8DA 4DN1A 4J2WA 1UKVG 2ACZA 3EPTA 3AD8B 3UOXA 1DOCA 4K5RA 2GSHA 4U2TA 1NEKA 1PXAA 1GALA 4Y4LA 4DSHA 1LVLA 4IA5A 1L0VA 3KVEA 1JPMA 1NG4A 3VQRA 1F3PA 4KPLA 3BSMA 3DK8A 2TPRA 1TDOA 2YLXA 4N9XA 4GYPA 1MO9A 1H7WA 3U4FA 1PHHA 2GDQA 1O94A 3VFCA 4CRTA 2WDVA 3V76A 4OPLA 4FI4A 4TM1A 3VR8A 1QO8A 3AM9A 4CCRA 2PP0A 3AEAA 3ZLFA 1OJAA 3OW1A 3SJNA 4NEVA 2B7RA 2YR6A 3SGLA 2GRTA 2VQBA 5C3JA 2PTYA 1VQZA 4G8TA 3SN1A 2R4JA 4B64A 3S5WA 2DW7A 1L9DA 4A79A 1BZLA 1PBDA 4H83A 1TE6A 3CGEA 2VRLA 1BWCA 2HXTA 3IJLA 3C4NA 4J33A 3R0UA 2GGJA 2QDDA 2WETA 3R1ZA 3ICRA 3THUA 2DKHA 3NZGA 2C3CA 2FJBA 3NYFA 4GF7A 3UKLA 3BI5A 2XVIA 1EL5A 1M64A 4J36A 1NHSA 3JSKA 2YLWA 3QTPA 4BK3A 1CJCA 2PU1A 2HQMA 2GR3A 4GCMA 3UJ2A 3ES8A 4C3XA 2OAMA 4AOSA 1M6IA 4UP3A 5FS8A 3LZXA 4GIRA 1CHUA 1EC9A 2PS2A 5J04A 3LOVA 2BS2A 2V3AA 3MSYA 3EKGA 2XLTA 3H8LA 3HZLA 2XDOA 3GWDA 4A35A 1RP0A 1NHQA 1Q1RA 1CL0A 4LU6A 2BCPA 4H4QA 1E6EA 3FCPA 4DYEA 5IDZA 1ELSA 1P2EA 3SY4A 4DHGA 1SJAA 3HPFA 1T3QC 1MDRA 2QJMA 3KUMA 4H4VA 4C74A 3ZLHA 2O9ZA 4FDCB 3R07C 1IUVA 2XH2A 3P3BA 2ARDA 3GWFA 1ZP0A 1MOKA 4NTDA 3V5CA 1BQGA 4YTMA 2GV8A 4C5OA 1H82A 2X8HA 1TKKA 1H86A 3D47A 4TLXA 4KEMA 4IT1A 3QFBA 3AYIA 1MUCA 2OLNA 3TW9A 2DW6A 1EL8A 4YSXA 4GISA 3BOXA 4H2RA 5JCIA 2I5QA 3SQSA 4P9SA 3O0HA 1DJQA 3N4EA 5JCLA 3ICSA 4NNJA 3I6TA 3TWAA 1JRZA 2VVLA 2IIDA 1B4VA 4G9KA 2OALA 2C76A 2PHHA 1E1LA 5EBKA 4OPUA 4OPIA 2C73A 1XS2A 1GTEA 4CNJA 2OX4A 2QVHA 3HYWA 3SBFA 3DFHA 1DXLA 5FJRA 2VVMA 2BS4A 5EB4A 4TM0A 3BI2A 2A87A 3JVAA 3V5FA 4ZCCA 3SSZA 3L1RA 3M13A 3NS1B 3URHA 2PTWA 3V3NA 4ENLA 1E1MA 4EIQA 3P1WA 3T6CA 3GRTA 4A9WA 2CFYA 2XLPA 3N4FA 5BOFA 3PWIA 3T8QA 2W55A 5FS7A 2E5VA 3I3LA 3CNSA 1OJCA 1H81A 5KRQA 3QSEA 1KFYA 2BK3A 2QDEA 3IJQA 4A6GA 4B1BA 3DJJA 3SN0A 4H4RA 4H2NA 3EANA 2WS3A 2X3NA 3STPA 4G7FA 3CPIG 3GDPA 3AECA 3SFEA 4A65A 3ATRA 3CNPA 3EAOA 2WEUA 3RP7A 1FFVC 3UKFA 2HXUA 2NVKX 4I59A 2PSNA 2XVEA 3T9PA 5JRBA 1QLBA 1P48A 5L46A 1XDIA 4JQ9A 1Q9IA 4U2SA 1PJ7A 3EEZA 1EL7A 4GGHA 1N60C 2XFUA 3ZLGA 5IQ1A 2AKMA 1Z6LA 3RITA 3PS9A 3UCLA 3ES7A 5HY5A 4HNCA 3NGCX 2B9YA 4RG3A 5KXJA 1AOGA 3GYIA 1LPFA 1F6MA 3FJ4A 4FK1A 3UOVA 3CAWA 3RO6A 3DGHA 2NQLA 4GMEA 1TDEA 1IUUA 1JRXA 3REDA 3ITJA 2PGWA 3DERA 3NVZB 2CDUA 4IL0A 5KVIA 2C72A 1FL2A 3DGBA 4EQSA 1TDNA 4G6GA 2Y6QA 1CC2A 2XSXA 2WOIA 3SX6A 3VRDB 4K2SA 2BC1A 4JN9A 5JCKA 2RGHA 5FJPA 4K2XA 3Q4DA 3AEDA 2XVJA 1BKWA 4FP1A 2R46A 4MMWA 2W54A 1GREA 3AE2A 4XWZA 2E5AA 1CC6A 3TQPA 1CJ2A 2WU2A 4EMIA 4YSHA 2A8XA 3AB1A 2Q6UA 3AE5A 4GYPC 4X2PA 1L9EA 1PN0A 4GAPA 2ZZCA 2AL1A 2VVLG 1KSUA 3Q6JA 3AYLA 1B8SA 4K7ZA 3NNEA 2BS3A 3PO7A 1DOBA 4RG4A 2MNRA 5BOEA 1R0MA 3UTEA 1EBHA 1MNSA 3IC9A 4JNAA 3K1GA 5BVAA 3ALMA 5BUKA 2B9XA 1LTXR 3MKCA 3IHMA 2P8BA 2V6OA 1PXCA 3P93A 1BGNA 3ETRB 1IJHA 2WP6A 4EWJA 3T2YA 4H19A 2EQ8A 3N6HA 3I6DA 1GRHA 2C67A 2B76A 1F8WA 3NTAA 4D04A 4Z24A 4M52A 2C66A 2W3RA 3UTGA 4GAVA 2XCGA 3VC5A 3E1TA 2R4EA 5G5HB 3C4AA 3NIXA 3ABVA 4J34A 2BRYA 2PODA 1GSNA 1SJCA 3F8PA 3D9XA 1DODA 3VRBA 2X99A 5KVHA 4CCQA 1E7PA 2VZ2A 4EMWA 3FMWA 1YEYA 4ZA0A 5J7XA 2Q7VA 2PU0A 3S47A 3R25A 4YTPA 3SQPA 4NZHA 1RSGA 2GL5A 2H89A 2OZ3A 1OJDA 2OG9A 3A7AA 3IJIA 3QKEA 1ZOYA 1FFUC 4U8OA 4Z43A 3ZVHB 1PDZA 3TWBA 1TDFA 3MZNA 1NHRA 2FKPA 1LQUA 1ZY8A 2YAUA 2R0GA 2C70A 4I58A 2BXSA 3MUCA 1GT8A 2E1MA 4H2QA 3OZMA 1N4VA 4TVYA 3RP6A 3GRSA 3QPEA 3I4KA 2AR8A 1N4UA 3BI4A 4LIIA 3VC6A 1FHUA 1GETA 1CC4A 3DJGX 2WPFA 2WQYA 5KMRA 5C2TA 2PTXA 2BYBA 2GQWA 3UP4A 2V61A 2OZTA 2XLSA 3DG7A 3ZVIA 4A6NA 4YSZA 4AT0A 1JDFA 2GEWA 3QJ4A 3ZVHA 1EC8A 4ZN0A 4H2HA 3NG7X 1D7LA 4HB9A 3UXKA 1GPEA 5G5GB 4IP5A 1ZOVA 4E0VA 3CT2A 4NTEA 5FJUA 1H84A 1WUEA 1LJ1A 1SJDA 3PVCA 1EBGA 5JCMA 2UZZA 2XFNA 4CY6A 3NN0X 4ADWA 3AYJA 3P4SA 4O5UA 3D8XA 3CB3A 4OPDA 4B65A 1MXTA 3NTDA 3BJSA 4BK1A 3NKSA 2GMJA 1ONFA 4JN7A 4KX6A 3AN1A 5HYMA 2GGIA 1N61C 1YQ3A 2PPGA 3DG6A 2Q0KA 3AEBA 3P4QA 3SN4A 3CNDA 2EQ9A 4JN8A 3M12A 1N63C 2GMHA 3ADAB 2RGOA 4KWSA 4M6UA 1SJBA 2RDXA 2GVCA 1S7MA 5FJTA 5U1OA 4Z17A 1FOHA 3KPKA 4NTCA 1X31B 2ZADA 4U8PA 1IYXA 3DIPA 1PXBA 2VRMA 3CMMA 4U8MA 1VG9A 5KMSA 2ZC8A 5EU9A 5IPYA 1COYA 5BULA 4H50A 5U25A 3HYVA 4E5TA 3QVRA 1LV0A 2ZBWA 1X2GA 4GDEA 3UTFA 1GRGA 4D03A 3UJFA 4C77A 1B37A 1NAAA 2WPCA 2H88A 1KD0A 1WUFA 1JRYA 4JDRA 3AXBA 2POZA 3RHAA 1D5TA 1D4EA 3NFUA 4AP1A 5BRTA 2EQ7A 2W3SA 3SR6B 1L9CA 5GSNA 5M0ZA 3T2KA 1XPQA 4K5SA 3ALJA 3II4A 3CN8A 4U2LA 1Y0PA 1TYTA 3LZWA 1GRAA 2YM2A 1YQ4A 4MJWA 4U8LA 3P4RA 4FK1C 3P4PA 1F9CA 2P88A 4E4UA 3DJDA 2Z5XA 2JK6A 2XLUA 2V5ZA 1L8PA 1PS9A 3OTRA 1E1KA 4OPCA 3DJEA 2C7GA 3WE0A 2XGZA 2F5ZA 2QGYA 2X50A 2FJDA 3OPSA 1N5XA 5LV9A 3K7TA 2OVLA 1VDCA 2E3TA 4JY3A 5IQ4A 1KNRA 2BABA 3GSIA 4OPTA 3VR9A 1MRAA 1IUTA 1YKJA 2PCEA 1F8SA 3AE3A 3B3RA 3SXIA 2YG7A 4MGGA 4HNLA 1PJ5A 4YXDA 1GV4A 4AT2A 3KLJA 4H7UA 4EQXA 3K7QX 2AAQA 7ENLA 3NLCA 2YVJA 3FYYA 3CIRA 1D4CA 1JNZA 3VA8A 2YG5A 4UDRA 4FX9A 2BK4A 2PP1A 4IZGA 3UKQA 3EF6A 1TRBA 4H4PA 4NWZA 5M10A 1Y56A 3QVPA 1JCTA 3ENLA 4JY2A 3R0KA 5KOWA 3R11A 4USRA 1NG3A 2QQ6A 3BNUA 3QLDA 1ZMDA 3DESA 4JHMA 3FVDA 2BXRA 1BGJA 3MQTA 5HHFA 3NK0X 3CYJA 4K8GA 2O56A 3FG2P 3AE7A 3IHGA 4K22A 1KF6A 3SZ0A 2FYMA 3NK2X 1JEHA 5GRTA 2XYOA 2ZZ0A 3D1CA 2I0ZA 1FECA 2XVFA 3ISHA 1WYGA 1N4WA 2ONEA 3F8DA 3BHFA 4KT2A 3NVYB 3P9UA 2BACA 3DA1A 1N5WC 4HYRA 4ROPA 3KA7A 3ICTA 3PK7A 4TLZA 4Z25A 3DGZA 4BJZA 2P8CA 4H4YA 3T4WA 1RYIA 4J56A 2VOUA 4RSLA 2W0HA 4KPRA 4ZOHB 4J1OA 1JU2A 3KU9A 3HW2A 1EC7A 2GR0A 4ECHA 1KN0A 1ZDLA 1VG0A 1XANA 2QA1A 3V4BA 3HYXA 1KCZA 3FXGA 2WBAA 3VCCA 1JRPA 1S3EA 2YWLA 2QCUA 4Z2RA 2HNEA 3ALLA 2OLAA 4WCTA 4IVMB 2XH4A 2GR2A 2B7SA 2APGA 3AE8A 1CJ3A 2IVEA 3UP5A 4GRTA 3A7RA 3UJEA 3CNTA 2YG3A 3JW7A 4B68A 3H4KA 4U8IA 2JB2A 2DKIA 3UOYA 1V59A 3Q9TA 1GERA 3DH9A 3PFRA 2E4GA 2XVHA 1S2YA 4EQRA 2AL2A 2X8CA 2BCGG 3DEQA 3AE6A 4YKGA 2YG6A 4NEWA 1K0LA 3NYEA 2GGEA 4HN8A 3T2ZA 3CPHG 4G6HA 4DX3A 4CNKA 3SYIA 1JNRA 2JB1A 3UCDA 3BNMA 4Y4MA 2PA6A 5FS9A 3GYXA 4A6NB 1LQTA 3NN6X 3DFYA 3SZFA 1CJ4A 3GMBA 4TVWA 1ZKQA 3AE1A 4DNAA 1SB3B 3BHKA 3B97A 4YWOA 2BC0A 4YT0A 2RABA 4GGBA 2ZZBA 4A99A 1IUXA 1H83A 2YR4A 1ZK7A 3Q45A 3S61A 3NH3X 1X2HA 1FEBA 1JPDX 4X4JA 2YVGA 3QSSA 4HCDA 5HXIA 2JKCA 2OA1A 1PBFA 3QFAA 2FJEA 1ZX9A 2PYXA 3H70A 1XHCA 1KSSA 5ENLA 1E1NA 4UDPA 2VQ7A 4X9MA 2C3DA 4JNQA 1H6VA 4OCGA 4XXGA 2AKZA 1F8RA 1GRTA 2GF3A 3KKJA 2BRAA 2PGEA 1R6WA 1QJDA 3OZYA 4YSYA 3TJIA 3NXLA 3AMZA 3CGCA 5KOXA 3UGVA 1PDYA 1E9IA 3H7VA 3CXBA 4B63A 4TM4A 3CGDA 3H8AA 3AE4A 3GO2A 2PP3A 4APNA 3QN3A 3M0OA 4AOXA 2PTZA 1NHPA 3D46A 1NENA 3CNJA 1P2HA 1GNDA 3NT6A 2YG4A 5EOWA 1O5WA 1FCDA 2BK5A 1FEAA 3UJSA 4XWRA 3CXOA 2OO6A 5KMPA 1NDAA 1OJTA 3G5SA 3AD9B 2P0IA 4CY8A 4K1WA 1ELIA 2R0PA 2WDRA 3G5QA 3GD6A 1NPXA 4PABA 2JB3A 1OJ9A 1K0IA 2OQHA 1N62C 1D7YA 4GFIA 4GDPA 3P0WA 3LB8A 1S2QA 4A3RA 4GR1A 4H4TA 3TOYA 2TMDA 4IL2A 2JAEA 4YKFA 1DOEA 1PBBA 1PBEA 2XFQA 4EM4A 1FIQB 2GH5A 2OFJA 1DTNA 5FS6A 1K4QA 4EIPA 4BJYA 4E4FA 3FIMB 4O5QA 4REKA 3T14A 4ZCDA 4EMJA 1ONEA 4BURA 1D4DA 3DDMA 4WX1A 2WHDA 3OZ2A 4J57A 5TR3A 3RP8A 1YQZA 4H4XA 4HCLA 3COXA 1N1PA 4ZCWA 5FMHA 3GC2A 1KKRA 5DBJA 2JBVA 4CBQA 1VQWA 2OPJA 4EQWA 2C64A 3OC4A 5ER0A 1KNPA 3TTEA 2WESA 1DJNA 4OVIA 2FJAA 5KMQA 3SM8A 3NRZB 3UCCA 2CVJA 2EQ6A 2NPXA 3K30A 2J3NA 3G5RA 2Q0LA 3SZCA 2PMQA 3KPFA 3HRDC 3C96A 1EBDA 2AQJA 1H7XA 2Y6RA 2C4CA 1ZXIC 3GMCA 2WPEA 3AE9A 1JOAA 1YY5A 3F8RA 3EUB3 2R45A 3MWCA 3NVWB 4GUVA 2XH0A 3RR1A 2X8GA 1Y56B 3AEFA 3RNMA 2WU5A 2HZGA 2WDQA 3U9IA 3TCSA 1PBCA 1KDGA 4H2PA 3K7MX 3RGTA 2YM1A 2CULA 3A7UA 4H4WA 3UKAA 3PWGA 3NK1X 3ZDNA 3CPJG 3CK5A 4M0XA 4H4SA 2R9ZA 4B66A 1RVKA 5J60A 4X9NA 1CBOA 3GD3A 1REOA 3TJ4A 1TDKA 2IVDA 3T37A 3DMEA 4USQA 3IWAA 2BA9A 1STZA 2YVFA 4DGKA 1EL9A 4B67A 4Z26A 3SFDA 2OKTA 3B6DA 1VDVA 2V3BA 2QA2A 2YLZA 3ATQA 4Z2UA 1PJ6A 2YLSA 3N6JA 1W4XA 2B9WA 1ECQA 1K0JA 3V3WA 4E6MA 1SEZA 6ENLA 2YQUA 4BV6A 3NO1A 2Z5YA 2OLOA 3R10A 1S3BA 1IUSA 1TYPA 2YLTA 3IF9A 4YTNA 3NYCA 4LA1A 3AEEA 1GOSA 2GR1A 2RGJA 1HYUA 1PDHA 3GD4A 1MDLA 4DSGA 3KD9A 1TZZA 4H4UA 1GXFA 3S5SA 3L5OA 3I6EA 2XLRA 2WP9A 2P3ZA 3UOZA 3H8IA 3GYJA 5U63A 3NVVB 1P43A 4C3YA 3LJPA 3UKHA 4YWSA 1IUWA 5EB5A 1GRBA 4B69A 1OEPA 3R9UA 2GGHA 2C75A 4MKSA 3ZYXA 2QJNA 4A5LA 3CTYA 3RRAA 2MUCA 4IHCA 2FBWA 1NELA 1BKHA 4Z1YA 5FJOA 4IP4A 4J31A 3VRAA 4II2A 1ZMCA 4IV9A 2QAEA 2XFPA 1GESA 2XFOA 5CQFA 4BK2A 1GRFA 1NU5A 3T0KA 3V3OA 4AP3A 4G74A 1V97A 4UDQA 1GEUA 3FV9A 4HCHA 4F4RA 4H4ZA 3UJRA 3AEGA 5JCNA 2C65A 4TM3A 1FHVA 2OQYA 3CGBA 3IK4A 4EM3A 2R0CA 2AL2B 3FPZA 4E8GA 3GY1A 3RCYA 1KKOA
chains in the Genus database with same CATH topology
2X3NA 4XXGA 3RHAA 1D5TA 1D4EA 3L8KA 2YR5A 1F8RA 3CPIG 3SZWA 3GDPA 1GRTA 3AECA 3SFEA 4IVOB 3ATRA 4A65A 4AP1A 5BRTA 4OPGA 2GF3A 3CNPA 3KKJA 2EQ7A 2BRAA 3LADA 1O95A 4PAAA 3EAOA 2WEUA 1DNCA 3RP7A 3UKFA 3GDNA 1L9CA 1QJDA 4YSYA 2GAGB 3UTHA 5GSNA 2NVKX 1Q1WA 5M0ZA 4I59A 3T2KA 3FBSA 1XPQA 3CGCA 5KOXA 4U8JA 4K5SA 3ALJA 2XVEA 5JRBA 1QLBA 4B63A 5CKUA 4TM4A 3CGDA 3II4A 3AD7B 3T31A 5L46A 1XDIA 3CN8A 4JQ9A 1Q9IA 1Y0PA 4G73A 4U2LA 1TYTA 3AE4A 4Z2TA 4U2SA 1PJ7A 3LZWA 1GRAA 2YM2A 1EL7A 4ICYA 3DK4A 4APNA 1E39A 1YQ4A 3AWIA 3M0OA 2XFUA 4MJWA 4U8NA 4AOXA 4U8LA 5IQ1A 1NHPA 3QSMA 1NENA 3CNJA 3P4RA 1P2HA 1GNDA 1Z6LA 2YG4A 3NRNA 3NT6A 3PS9A 4FK1C 4II3A 5EOWA 3UCLA 1O5WA 3P4PA 5HY5A 1BF3A 1FCDA 1H2IA 2BK5A 3NGCX 3DJDA 2B9YA 4RG3A 5KXJA 1FEAA 1AOGA 1CF3A 3GYIA 2Z5XA 1LPFA 3UKKA 1F6MA 2JK6A 2WOVA 2YLRA 4XWRA 5KNLA 5KMPA 4FK1A 3UOVA 2XLUA 1NDAA 2V5ZA 1OJTA 3DGHA 3G5SA 3AD9B 1TDEA 4CY8A 3DK9A 1IUUA 4A7AA 1PS9A 1JRXA 1VRQB 3REDA 3ITJA 5KWFA 1E1KA 4IA6A 4OPCA 3DJEA 1ELIA 2C7GA 3WE0A 1B5QA 3UKPA 2GAHB 1GTHA 2CDUA 2F5ZA 5KVIA 2C72A 3PG6A 2X50A 2R0PA 1FL2A 3LXDA 2FJDA 4U8KA 2WDRA 3NHOX 4EQSA 1TDNA 3G5QA 5LV9A 3K7TA 4G6GA 2Y6QA 1VDCA 1CC2A 4JY3A 2WOWA 2A89A 5IQ4A 1NPXA 4PABA 2JB3A 1KNRA 4HA6A 2BABA 1OJ9A 2GB0A 4Z44A 2GQFA 2WOIA 3GSIA 2WP5A 3SX6A 1K0IA 4OPTA 3VRDB 2BC1A 2V60A 4Y4NA 4JN9A 4K8DA 5JCKA 3VR9A 4J2WA 1UKVG 2RGHA 2ACZA 3EPTA 3AD8B 1IUTA 4K2XA 3UOXA 1DOCA 1D7YA 3AEDA 4GDPA 1YKJA 2XVJA 4K5RA 1F8SA 3LB8A 1BKWA 2R46A 1NEKA 1PXAA 4U2TA 3AE3A 1GALA 1GREA 1S2QA 3B3RA 4Y4LA 3SXIA 2YG7A 1PJ5A 3AE2A 4YXDA 4XWZA 4GR1A 1CC6A 4DSHA 4H4TA 1LVLA 4IA5A 1L0VA 3KVEA 1CJ2A 2WU2A 1GV4A 4EMIA 2TMDA 4YSHA 2JAEA 2A8XA 4AT2A 4YKFA 3KLJA 1NG4A 4H7UA 3AB1A 4EQXA 2Q6UA 3VQRA 1F3PA 3K7QX 2AAQA 3NLCA 2YVJA 3AE5A 1DOEA 1L9EA 1PN0A 4GAPA 2ZZCA 1D4CA 1PBBA 1PBEA 2XFQA 3CIRA 3DK8A 2VVLG 2TPRA 1JNZA 1TDOA 4EM4A 2YLXA 1KSUA 3Q6JA 2YG5A 4UDRA 3AYLA 1B8SA 4K7ZA 4N9XA 3NNEA 4FX9A 2GH5A 2BK4A 2BS3A 3PO7A 1DOBA 1MO9A 5FS6A 1H7WA 4RG4A 1K4QA 1PHHA 4EIPA 3UKQA 4BJYA 1O94A 3EF6A 3UTEA 4CRTA 3FIMB 3IC9A 4JNAA 4O5QA 4REKA 5BVAA 2WDVA 3ALMA 1TRBA 3V76A 3T14A 2B9XA 4OPLA 3VR8A 4TM1A 4CCRA 1QO8A 5BUKA 4H4PA 1LTXR 4ZCDA 4EMJA 3IHMA 4NWZA 4BURA 5M10A 1Y56A 2V6OA 3QVPA 3AEAA 1PXCA 1D4DA 4WX1A 2WHDA 3OZ2A 1BGNA 1IJHA 1OJAA 2WP6A 4NEVA 4J57A 4JY2A 2B7RA 5TR3A 4OPDA 3RP8A 5KOWA 4USRA 1YQZA 1NG3A 4H4XA 3BNUA 2YR6A 3COXA 3SGLA 3T2YA 1ZMDA 2EQ8A 2GRTA 2VQBA 1N1PA 5C3JA 5FMHA 2R4JA 4B64A 2BXRA 3S5WA 1BGJA 1L9DA 5HHFA 3I6DA 4A79A 1BZLA 5DBJA 1GRHA 2C67A 2JBVA 4CBQA 1PBDA 1F8WA 1VQWA 2B76A 4EQWA 3NTAA 3NK0X 4D04A 2C64A 3OC4A 5ER0A 1KNPA 2WESA 1DJNA 3CGEA 2VRLA 4Z24A 4M52A 4OVIA 2FJAA 5KMQA 1BWCA 3SM8A 3FG2P 3AE7A 2C66A 3IHGA 4K22A 1KF6A 2CVJA 3UTGA 4GAVA 2EQ6A 2XCGA 3E1TA 3SZ0A 2NPXA 2R4EA 3K30A 3NK2X 1JEHA 2J3NA 3G5RA 3C4NA 4J33A 2Q0LA 5GRTA 3C4AA 3SZCA 2XYOA 3NIXA 2ZZ0A 3ABVA 2I0ZA 3D1CA 4J34A 2BRYA 1GSNA 3F8PA 3D9XA 1DODA 1FECA 3KPFA 3VRBA 2X99A 5KVHA 2WETA 3C96A 1E7PA 2XVFA 1EBDA 4EMWA 2VZ2A 3ICRA 2AQJA 2DKHA 2C3CA 3FMWA 2FJBA 1H7XA 2Y6RA 3NYFA 3ISHA 4GF7A 3UKLA 2C4CA 1N4WA 3F8DA 3BI5A 2XVIA 5J7XA 3BHFA 1EL5A 3GMCA 2WPEA 3AE9A 2Q7VA 1M64A 4YTPA 3SQPA 3P9UA 1JOAA 4J36A 1YY5A 3F8RA 2BACA 3DA1A 4NZHA 1NHSA 2R45A 3KA7A 4GUVA 3JSKA 2YLWA 4BK3A 1CJCA 1RSGA 2H89A 2HQMA 3ICTA 2X8GA 2GR3A 4GCMA 4TLZA 4Z25A 1OJDA 1Y56B 4C3XA 2OAMA 1ZOYA 3DGZA 3AEFA 4BJZA 3RNMA 4U8OA 4AOSA 1M6IA 4H4YA 4UP3A 2WU5A 4Z43A 1RYIA 1TDFA 4J56A 5FS8A 3LZXA 2VOUA 2WDQA 1CHUA 1PBCA 4RSLA 1NHRA 1KDGA 1LQUA 1ZY8A 2YAUA 3LOVA 2R0GA 2C70A 2BS2A 4H2PA 4I58A 2W0HA 3K7MX 2BXSA 4KPRA 2V3AA 1GT8A 2E1MA 2XLTA 2YM1A 2CULA 1JU2A 4H2QA 3KU9A 3H8LA 3HZLA 2XDOA 1N4VA 3GWDA 4H4WA 3UKAA 1RP0A 3NK1X 1NHQA 2GR0A 3ZDNA 1Q1RA 1CL0A 3CPJG 4ECHA 4LU6A 3RP6A 1KN0A 2BCPA 1ZDLA 3GRSA 1VG0A 4H4QA 4H4SA 2AR8A 1N4UA 2R9ZA 1E6EA 1XANA 2QA1A 4LIIA 3BI4A 4B66A 1GETA 1CC4A 3HYXA 2WBAA 3DJGX 5J60A 2WPFA 1P2EA 4X9NA 1CBOA 2WQYA 5KMRA 5C2TA 3GD3A 1REOA 1S3EA 3SY4A 2BYBA 2YWLA 2GQWA 3UP4A 2QCUA 2V61A 4Z2RA 1TDKA 2XLSA 2IVDA 3T37A 3ALLA 4H4VA 4A6NA 4C74A 3DMEA 2O9ZA 4USQA 4YSZA 4FDCB 1IUVA 3IWAA 2BA9A 4WCTA 4IVMB 2GR2A 2YVFA 2ARDA 2B7SA 2APGA 3AE8A 1ZP0A 1MOKA 3GWFA 4AT0A 4DGKA 1EL9A 1CJ3A 2GEWA 4NTDA 3QJ4A 4B67A 2IVEA 4Z26A 3SFDA 3UP5A 4ZN0A 4GRTA 4YTMA 2GV8A 3NG7X 3CNTA 1D7LA 4C5OA 1H82A 3B6DA 2YG3A 2V3BA 2QA2A 2YLZA 4HB9A 2X8HA 1GPEA 3ATQA 4B68A 4Z2UA 3H4KA 1H86A 4TLXA 1PJ6A 1ZOVA 2YLSA 4E0VA 4U8IA 2JB2A 3QFBA 1W4XA 2B9WA 2DKIA 4NTEA 1K0JA 1H84A 3UOYA 1SEZA 3AYIA 2YQUA 1LJ1A 4BV6A 2OLNA 1V59A 3PVCA 3Q9TA 2UZZA 5JCMA 4CY6A 2XFNA 2Z5YA 3NN0X 1EL8A 4YSXA 4H2RA 4ADWA 2OLOA 3AYJA 3P4SA 5JCIA 1GERA 3DH9A 2E4GA 4P9SA 1S3BA 3O0HA 1IUSA 1DJQA 1TYPA 4O5UA 2YLTA 2XVHA 3D8XA 3IF9A 3NYCA 4YTNA 4LA1A 5JCLA 1GOSA 2GR1A 3AEEA 2RGJA 1HYUA 1MXTA 1PDHA 1S2YA 4B65A 4EQRA 3GD4A 3ICSA 3NTDA 4NNJA 4DSGA 4BK1A 3KD9A 3NKSA 1JRZA 2GMJA 2X8CA 4H4UA 1B4VA 2BCGG 1GXFA 2IIDA 2VVLA 4G9KA 3L5OA 3AE6A 1ONFA 2XLRA 2WP9A 4YKGA 3UOZA 4KX6A 2OALA 2YG6A 2C76A 2PHHA 3H8IA 1E1LA 4NEWA 5EBKA 4OPUA 4OPIA 3GYJA 1K0LA 2C73A 5HYMA 5U63A 1GTEA 3NYEA 3T2ZA 4CNJA 1YQ3A 4C3YA 3CPHG 3HYWA 2Q0KA 3AEBA 3P4QA 3LJPA 4G6HA 3UKHA 4CNKA 3SYIA 1JNRA 3CNDA 1IUWA 2JB1A 5EB5A 2EQ9A 1GRBA 3BNMA 1DXLA 4Y4MA 4B69A 2VVMA 2BS4A 3M12A 5FS9A 3R9UA 3GYXA 5EB4A 2GMHA 1LQTA 3NN6X 4TM0A 2C75A 3ADAB 4A6NB 3BI2A 2RGOA 3ZYXA 2A87A 4A5LA 3SZFA 3CTYA 1CJ4A 2FBWA 2GVCA 1S7MA 4ZCCA 3GMBA 3L1RA 5U1OA 1FOHA 3KPKA 4J31A 3M13A 4NTCA 3VRAA 1ZKQA 1X31B 1ZMCA 4II2A 3AE1A 4DNAA 4U8PA 3BHKA 4IV9A 2QAEA 1PXBA 2XFPA 2VRMA 1GESA 4YWOA 3URHA 3CMMA 2BC0A 4YT0A 2RABA 2XFOA 3V3NA 5CQFA 2ZZBA 4BK2A 1E1MA 1GRFA 4EIQA 4U8MA 4A99A 1VG9A 3T0KA 3V3OA 4AP3A 5KMSA 1IUXA 1H83A 3P1WA 4G74A 2YR4A 1ZK7A 3GRTA 3S61A 4A9WA 5IPYA 3NH3X 4UDQA 1FEBA 1GEUA 2CFYA 2XLPA 1COYA 4CCQA 4H50A 4X4JA 5BULA 2YVGA 4H4ZA 5U25A 3HYVA 3QSSA 3AEGA 5HXIA 2JKCA 2OA1A 3QVRA 5FS7A 1PBFA 2E5VA 5JCNA 1LV0A 2ZBWA 3I3LA 4GDEA 3UTFA 3CNSA 1GRGA 2C65A 4D03A 1OJCA 3QFAA 1H81A 5KRQA 2FJEA 3QSEA 3CGBA 4TM3A 1KFYA 2BK3A 1ZX9A 4EM3A 2R0CA 4C77A 2PYXA 1B37A 1XHCA 1KSSA 1NAAA 4B1BA 3FPZA 1E1NA 2WPCA 3DJJA 4H4RA 4H2NA 2H88A 2VQ7A 4UDPA 2C3DA 3EANA 4X9MA 2WS3A 4JNQA 1JRYA 4JDRA 1H6VA 3AXBA 4OCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3N A;  4XXG A;  3RHA A;  1D5T A;  1D4E A;  3L8K A;  2YR5 A;  1F8R A;  3CPI G;  3GDP A;  1GRT A;  3AEC A;  3SFE A;  4IVO B;  3ATR A;  4A65 A;  4AP1 A;  5BRT A;  4OPG A;  2GF3 A;  3CNP A;  3KKJ A;  2EQ7 A;  3LAD A;  1O95 A;  4PAA A;  3EAO A;  2WEU A;  1DNC A;  3RP7 A;  3UKF A;  3GDN A;  1L9C A;  1QJD A;  4YSY A;  2GAG B;  3UTH A;  5GSN A;  2NVK X;  1Q1W A;  5M0Z A;  4I59 A;  3FBS A;  1XPQ A;  3CGC A;  5KOX A;  4U8J A;  4K5S A;  3ALJ A;  2XVE A;  1QLB A;  4B63 A;  5CKU A;  4TM4 A;  3CGD A;  3II4 A;  3AD7 B;  5L46 A;  1XDI A;  3CN8 A;  4JQ9 A;  1Q9I A;  1Y0P A;  4U2L A;  1TYT A;  3AE4 A;  4Z2T A;  4U2S A;  1PJ7 A;  3LZW A;  1GRA A;  2YM2 A;  1EL7 A;  4ICY A;  3DK4 A;  4APN A;  1E39 A;  1YQ4 A;  3AWI A;  3M0O A;  2XFU A;  4MJW A;  4U8N A;  4AOX A;  4U8L A;  5IQ1 A;  1NHP A;  3QSM A;  1NEN A;  3CNJ A;  3P4R A;  1P2H A;  1GND A;  1Z6L A;  2YG4 A;  3NRN A;  3NT6 A;  3PS9 A;  4FK1 C;  5EOW A;  3UCL A;  1O5W A;  3P4P A;  5HY5 A;  1BF3 A;  1FCD A;  2BK5 A;  3NGC X;  3DJD A;  2B9Y A;  4RG3 A;  5KXJ A;  1FEA A;  1AOG A;  1CF3 A;  3GYI A;  2Z5X A;  1LPF A;  3UKK A;  1F6M A;  2JK6 A;  2WOV A;  2YLR A;  4XWR A;  4FK1 A;  3UOV A;  2XLU A;  1NDA A;  2V5Z A;  1OJT A;  3DGH A;  3G5S A;  3AD9 B;  1TDE A;  4CY8 A;  3DK9 A;  1IUU A;  4A7A A;  1PS9 A;  1JRX A;  1VRQ B;  3RED A;  3ITJ A;  5KWF A;  1E1K A;  4IA6 A;  4OPC A;  3DJE A;  1ELI A;  2C7G A;  3WE0 A;  1B5Q A;  3UKP A;  2GAH B;  1GTH A;  2CDU A;  2F5Z A;  5KVI A;  2C72 A;  2X50 A;  2R0P A;  1FL2 A;  3LXD A;  2FJD A;  4U8K A;  2WDR A;  3NHO X;  4EQS A;  1TDN A;  3G5Q A;  5LV9 A;  3K7T A;  2Y6Q A;  1VDC A;  1CC2 A;  4JY3 A;  2WOW A;  2A89 A;  5IQ4 A;  1NPX A;  4PAB A;  2JB3 A;  1KNR A;  4HA6 A;  2BAB A;  1OJ9 A;  2GB0 A;  4Z44 A;  2GQF A;  2WOI A;  3GSI A;  2WP5 A;  1K0I A;  4OPT A;  3VRD B;  2BC1 A;  2V60 A;  4Y4N A;  4JN9 A;  4K8D A;  5JCK A;  3VR9 A;  4J2W A;  1UKV G;  2RGH A;  2ACZ A;  3EPT A;  3AD8 B;  1IUT A;  4K2X A;  3UOX A;  1DOC A;  1D7Y A;  3AED A;  4GDP A;  1YKJ A;  2XVJ A;  4K5R A;  1F8S A;  3LB8 A;  1BKW A;  2R46 A;  1NEK A;  1PXA A;  4U2T A;  3AE3 A;  1GAL A;  1GRE A;  1S2Q A;  3B3R A;  4Y4L A;  2YG7 A;  1PJ5 A;  3AE2 A;  4YXD A;  4XWZ A;  4GR1 A;  1CC6 A;  4DSH A;  4H4T A;  1LVL A;  4IA5 A;  1L0V A;  3KVE A;  1CJ2 A;  2WU2 A;  1GV4 A;  4EMI A;  2TMD A;  4YSH A;  2JAE A;  2A8X A;  4AT2 A;  4YKF A;  3KLJ A;  1NG4 A;  4H7U A;  3AB1 A;  4EQX A;  2Q6U A;  3VQR A;  1F3P A;  3K7Q X;  2AAQ A;  3NLC A;  2YVJ A;  3AE5 A;  1DOE A;  1L9E A;  1PN0 A;  2ZZC A;  1D4C A;  1PBB A;  1PBE A;  2XFQ A;  3CIR A;  3DK8 A;  2VVL G;  2TPR A;  1JNZ A;  1TDO A;  4EM4 A;  2YLX A;  1KSU A;  3Q6J A;  2YG5 A;  4UDR A;  3AYL A;  1B8S A;  4K7Z A;  4N9X A;  3NNE A;  4FX9 A;  2GH5 A;  2BK4 A;  2BS3 A;  3PO7 A;  1DOB A;  1MO9 A;  5FS6 A;  1H7W A;  4RG4 A;  1K4Q A;  1PHH A;  4EIP A;  3UKQ A;  4BJY A;  1O94 A;  3EF6 A;  3UTE A;  4CRT A;  3FIM B;  3IC9 A;  4JNA A;  4O5Q A;  4REK A;  5BVA A;  2WDV A;  3ALM A;  1TRB A;  3V76 A;  5BUK A;  2B9X A;  4OPL A;  3VR8 A;  4TM1 A;  4CCR A;  1QO8 A;  4H4P A;  1LTX R;  4ZCD A;  4EMJ A;  3IHM A;  4BUR A;  5M10 A;  1Y56 A;  2V6O A;  3QVP A;  3AEA A;  1PXC A;  1D4D A;  4WX1 A;  2WHD A;  3OZ2 A;  1BGN A;  1IJH A;  1OJA A;  2WP6 A;  4NEV A;  4J57 A;  4JY2 A;  2B7R A;  5TR3 A;  4OPD A;  3RP8 A;  5KOW A;  4USR A;  1YQZ A;  1NG3 A;  4H4X A;  3BNU A;  2YR6 A;  3COX A;  3SGL A;  1ZMD A;  2EQ8 A;  2GRT A;  2VQB A;  1N1P A;  5C3J A;  5FMH A;  2R4J A;  4B64 A;  2BXR A;  3S5W A;  1BGJ A;  1L9D A;  5HHF A;  3I6D A;  4A79 A;  1BZL A;  5DBJ A;  1GRH A;  2C67 A;  2JBV A;  4CBQ A;  1PBD A;  1F8W A;  1VQW A;  2B76 A;  4EQW A;  3NTA A;  3NK0 X;  4D04 A;  2C64 A;  3OC4 A;  5ER0 A;  1KNP A;  2WES A;  1DJN A;  3CGE A;  2VRL A;  4Z24 A;  4M52 A;  4OVI A;  2FJA A;  1BWC A;  3SM8 A;  3FG2 P;  3AE7 A;  2C66 A;  3IHG A;  4K22 A;  1KF6 A;  2CVJ A;  3UTG A;  2EQ6 A;  2XCG A;  3E1T A;  2NPX A;  2R4E A;  3K30 A;  3NK2 X;  1JEH A;  2J3N A;  3G5R A;  3C4N A;  4J33 A;  2Q0L A;  5GRT A;  3C4A A;  2XYO A;  3NIX A;  2ZZ0 A;  3ABV A;  2I0Z A;  3D1C A;  4J34 A;  1GSN A;  3F8P A;  1DOD A;  1FEC A;  3KPF A;  3VRB A;  2X99 A;  5KVH A;  2WET A;  3C96 A;  1E7P A;  2XVF A;  1EBD A;  4EMW A;  2VZ2 A;  3ICR A;  2AQJ A;  2DKH A;  2C3C A;  3FMW A;  2FJB A;  1H7X A;  2Y6R A;  3NYF A;  3ISH A;  4GF7 A;  3UKL A;  1N4W A;  3F8D A;  3BI5 A;  2XVI A;  5J7X A;  3BHF A;  1EL5 A;  3GMC A;  2WPE A;  3AE9 A;  2Q7V A;  1M64 A;  4YTP A;  3SQP A;  3P9U A;  1JOA A;  4J36 A;  1YY5 A;  3F8R A;  2BAC A;  3DA1 A;  4NZH A;  1NHS A;  2R45 A;  3KA7 A;  4GUV A;  3JSK A;  2YLW A;  4BK3 A;  1CJC A;  1RSG A;  2H89 A;  2HQM A;  3ICT A;  2X8G A;  2GR3 A;  4GCM A;  4TLZ A;  4Z25 A;  1OJD A;  1Y56 B;  4C3X A;  2OAM A;  1ZOY A;  3DGZ A;  3AEF A;  4BJZ A;  3RNM A;  4U8O A;  4AOS A;  1M6I A;  4H4Y A;  4UP3 A;  2WU5 A;  4Z43 A;  1RYI A;  1TDF A;  4J56 A;  5FS8 A;  3LZX A;  2VOU A;  2WDQ A;  1CHU A;  1PBC A;  4RSL A;  1NHR A;  1KDG A;  1LQU A;  1ZY8 A;  2YAU A;  3LOV A;  2R0G A;  2C70 A;  2BS2 A;  4H2P A;  4I58 A;  2W0H A;  3K7M X;  2BXS A;  4KPR A;  2V3A A;  1GT8 A;  2E1M A;  2XLT A;  2YM1 A;  2CUL A;  1JU2 A;  4H2Q A;  3KU9 A;  3H8L A;  3HZL A;  2XDO A;  1N4V A;  3GWD A;  4H4W A;  3UKA A;  1RP0 A;  3NK1 X;  1NHQ A;  2GR0 A;  3ZDN A;  1Q1R A;  1CL0 A;  3CPJ G;  4ECH A;  4LU6 A;  3RP6 A;  2BCP A;  3GRS A;  1ZDL A;  1VG0 A;  4H4Q A;  4H4S A;  2AR8 A;  1N4U A;  2R9Z A;  1E6E A;  1XAN A;  2QA1 A;  4LII A;  3BI4 A;  4B66 A;  1GET A;  1CC4 A;  2WBA A;  3DJG X;  5J60 A;  2WPF A;  1P2E A;  4X9N A;  1CBO A;  2WQY A;  5C2T A;  3GD3 A;  1REO A;  1S3E A;  2BYB A;  2YWL A;  2GQW A;  3UP4 A;  2QCU A;  2V61 A;  4Z2R A;  1TDK A;  2XLS A;  2IVD A;  3T37 A;  3ALL A;  4H4V A;  4A6N A;  4C74 A;  3DME A;  2O9Z A;  4USQ A;  4YSZ A;  4FDC B;  1IUV A;  3IWA A;  2BA9 A;  4WCT A;  4IVM B;  2GR2 A;  2YVF A;  2ARD A;  2B7S A;  2APG A;  3AE8 A;  1ZP0 A;  1MOK A;  3GWF A;  4AT0 A;  4DGK A;  1EL9 A;  1CJ3 A;  2GEW A;  4NTD A;  3QJ4 A;  4B67 A;  2IVE A;  4Z26 A;  3SFD A;  3UP5 A;  4ZN0 A;  4GRT A;  4YTM A;  2GV8 A;  3NG7 X;  3CNT A;  1D7L A;  4C5O A;  1H82 A;  3B6D A;  2YG3 A;  2V3B A;  2QA2 A;  2YLZ A;  4HB9 A;  2X8H A;  1GPE A;  3ATQ A;  4B68 A;  4Z2U A;  3H4K A;  1H86 A;  4TLX A;  1PJ6 A;  1ZOV A;  2YLS A;  4E0V A;  4U8I A;  2JB2 A;  3QFB A;  1W4X A;  2B9W A;  2DKI A;  4NTE A;  1K0J A;  1H84 A;  3UOY A;  1SEZ A;  3AYI A;  2YQU A;  1LJ1 A;  4BV6 A;  2OLN A;  1V59 A;  3PVC A;  3Q9T A;  2UZZ A;  5JCM A;  4CY6 A;  2XFN A;  2Z5Y A;  3NN0 X;  1EL8 A;  4YSX A;  4H2R A;  4ADW A;  2OLO A;  3AYJ A;  3P4S A;  5JCI A;  1GER A;  3DH9 A;  2E4G A;  4P9S A;  1S3B A;  3O0H A;  1IUS A;  1DJQ A;  1TYP A;  4O5U A;  2YLT A;  2XVH A;  3D8X A;  3IF9 A;  3NYC A;  4YTN A;  4LA1 A;  5JCL A;  1GOS A;  2GR1 A;  3AEE A;  2RGJ A;  1HYU A;  1MXT A;  1PDH A;  1S2Y A;  4B65 A;  4EQR A;  3GD4 A;  3ICS A;  3NTD A;  4DSG A;  4BK1 A;  3KD9 A;  3NKS A;  1JRZ A;  2GMJ A;  2X8C A;  4H4U A;  1B4V A;  2BCG G;  1GXF A;  2IID A;  2VVL A;  3AE6 A;  1ONF A;  2XLR A;  2WP9 A;  4YKG A;  3UOZ A;  4KX6 A;  2OAL A;  2YG6 A;  2C76 A;  2PHH A;  3H8I A;  1E1L A;  4NEW A;  5EBK A;  4OPU A;  4OPI A;  3GYJ A;  1K0L A;  2C73 A;  5HYM A;  5U63 A;  1GTE A;  3NYE A;  4CNJ A;  1YQ3 A;  4C3Y A;  3CPH G;  2Q0K A;  3AEB A;  3P4Q A;  3LJP A;  3UKH A;  4CNK A;  1JNR A;  3CND A;  1IUW A;  2JB1 A;  5EB5 A;  2EQ9 A;  1GRB A;  3BNM A;  1DXL A;  4Y4M A;  4B69 A;  2VVM A;  2BS4 A;  3M12 A;  5FS9 A;  3R9U A;  5EB4 A;  2GMH A;  1LQT A;  3NN6 X;  4TM0 A;  2C75 A;  3ADA B;  4A6N B;  3BI2 A;  2RGO A;  3ZYX A;  2A87 A;  4A5L A;  3CTY A;  1CJ4 A;  2FBW A;  2GVC A;  4ZCC A;  3GMB A;  3L1R A;  5U1O A;  1FOH A;  4J31 A;  3M13 A;  4NTC A;  3VRA A;  1ZKQ A;  1X31 B;  1ZMC A;  3AE1 A;  4DNA A;  4U8P A;  3BHK A;  4IV9 A;  2QAE A;  1PXB A;  2XFP A;  2VRM A;  1GES A;  4YWO A;  3URH A;  2BC0 A;  4YT0 A;  2RAB A;  2XFO A;  3V3N A;  5CQF A;  2ZZB A;  4BK2 A;  1E1M A;  1GRF A;  4EIQ A;  4U8M A;  4A99 A;  1VG9 A;  3V3O A;  4AP3 A;  1IUX A;  1H83 A;  3P1W A;  2YR4 A;  1ZK7 A;  3GRT A;  3S61 A;  4A9W A;  5IPY A;  3NH3 X;  4UDQ A;  1FEB A;  1GEU A;  2CFY A;  2XLP A;  1COY A;  4CCQ A;  4H50 A;  4X4J A;  5BUL A;  2YVG A;  4H4Z A;  5U25 A;  3QSS A;  3AEG A;  5HXI A;  2JKC A;  2OA1 A;  3QVR A;  5FS7 A;  1PBF A;  2E5V A;  5JCN A;  1LV0 A;  2ZBW A;  3I3L A;  4GDE A;  3UTF A;  3CNS A;  1GRG A;  2C65 A;  4D03 A;  1OJC A;  3QFA A;  1H81 A;  5KRQ A;  2FJE A;  3QSE A;  3CGB A;  4TM3 A;  1KFY A;  2BK3 A;  1ZX9 A;  4EM3 A;  2R0C A;  4C77 A;  2PYX A;  1B37 A;  1XHC A;  1KSS A;  1NAA A;  4B1B A;  3FPZ A;  1E1N A;  2WPC A;  3DJJ A;  4H4R A;  4H2N A;  2H88 A;  2VQ7 A;  4UDP A;  2C3D A;  3EAN A;  4X9M A;  2WS3 A;  4JNQ A;  1JRY A;  4JDR A;  1H6V A;  3AXB A;  4OCG A; 
#chains in the Genus database with same CATH topology
 3L8K A;  2YR5 A;  2QJJ A;  3SZW A;  4IVO B;  1FO4 A;  1XPY A;  4OPG A;  2GGG A;  2XH7 A;  3LAD A;  1O95 A;  4PAA A;  1DNC A;  3GDN A;  2GAG B;  3UTH A;  1Q1W A;  3DG3 A;  3FBS A;  4HPN A;  1W6T A;  4U8J A;  5CKU A;  3AD7 B;  3T31 A;  4G73 A;  4DWD A;  4Z2T A;  4ICY A;  3DK4 A;  1E39 A;  3AWI A;  4U8N A;  3QSM A;  2OZ8 A;  3NRN A;  4II3 A;  1BF3 A;  1JRO A;  1H2I A;  3VCN A;  1CF3 A;  3UKK A;  3OP2 A;  2WOV A;  2YLR A;  5KNL A;  3MY9 A;  1RM6 B;  3DK9 A;  4A7A A;  1VRQ B;  5KWF A;  4IA6 A;  1B5Q A;  3VDG A;  3UKP A;  2GAH B;  1GTH A;  3UXL A;  3PG6 A;  3H12 A;  3LXD A;  4U8K A;  2CHR A;  3NHO X;  4H1Z A;  4DXK A;  3B9J B;  4J3Z A;  2WOW A;  2A89 A;  4HA6 A;  2GB0 A;  4Z44 A;  2GQF A;  2WP5 A;  2V60 A;  4Y4N A;  3JZU A;  4K8D A;  4DN1 A;  4J2W A;  1UKV G;  2ACZ A;  3EPT A;  3AD8 B;  3UOX A;  1DOC A;  4K5R A;  2GSH A;  4U2T A;  1NEK A;  1PXA A;  1GAL A;  4Y4L A;  4DSH A;  1LVL A;  4IA5 A;  1L0V A;  3KVE A;  1JPM A;  1NG4 A;  3VQR A;  1F3P A;  4KPL A;  3BSM A;  3DK8 A;  2TPR A;  1TDO A;  2YLX A;  4N9X A;  4GYP A;  1MO9 A;  1H7W A;  3U4F A;  1PHH A;  2GDQ A;  1O94 A;  3VFC A;  4CRT A;  2WDV A;  3V76 A;  4OPL A;  4FI4 A;  4TM1 A;  3VR8 A;  1QO8 A;  3AM9 A;  4CCR A;  2PP0 A;  3AEA A;  3ZLF A;  1OJA A;  3OW1 A;  3SJN A;  4NEV A;  2B7R A;  2YR6 A;  3SGL A;  2GRT A;  2VQB A;  5C3J A;  2PTY A;  1VQZ A;  4G8T A;  3SN1 A;  2R4J A;  4B64 A;  3S5W A;  2DW7 A;  1L9D A;  4A79 A;  1BZL A;  1PBD A;  4H83 A;  1TE6 A;  3CGE A;  2VRL A;  1BWC A;  2HXT A;  3IJL A;  3C4N A;  4J33 A;  3R0U A;  2GGJ A;  2QDD A;  2WET A;  3R1Z A;  3ICR A;  3THU A;  2DKH A;  3NZG A;  2C3C A;  2FJB A;  3NYF A;  4GF7 A;  3UKL A;  3BI5 A;  2XVI A;  1EL5 A;  1M64 A;  4J36 A;  1NHS A;  3JSK A;  2YLW A;  3QTP A;  4BK3 A;  1CJC A;  2PU1 A;  2HQM A;  2GR3 A;  4GCM A;  3UJ2 A;  3ES8 A;  4C3X A;  2OAM A;  4AOS A;  1M6I A;  4UP3 A;  5FS8 A;  3LZX A;  4GIR A;  1CHU A;  1EC9 A;  2PS2 A;  5J04 A;  3LOV A;  2BS2 A;  2V3A A;  3MSY A;  3EKG A;  2XLT A;  3H8L A;  3HZL A;  2XDO A;  3GWD A;  4A35 A;  1RP0 A;  1NHQ A;  1Q1R A;  1CL0 A;  4LU6 A;  2BCP A;  4H4Q A;  1E6E A;  3FCP A;  4DYE A;  5IDZ A;  1ELS A;  1P2E A;  3SY4 A;  4DHG A;  1SJA A;  3HPF A;  1T3Q C;  1MDR A;  2QJM A;  3KUM A;  4H4V A;  4C74 A;  3ZLH A;  2O9Z A;  4FDC B;  3R07 C;  1IUV A;  2XH2 A;  3P3B A;  2ARD A;  3GWF A;  1ZP0 A;  1MOK A;  4NTD A;  3V5C A;  1BQG A;  4YTM A;  2GV8 A;  4C5O A;  1H82 A;  2X8H A;  1TKK A;  1H86 A;  3D47 A;  4TLX A;  4KEM A;  4IT1 A;  3QFB A;  3AYI A;  1MUC A;  2OLN A;  3TW9 A;  2DW6 A;  1EL8 A;  4YSX A;  4GIS A;  3BOX A;  4H2R A;  5JCI A;  2I5Q A;  3SQS A;  4P9S A;  3O0H A;  1DJQ A;  3N4E A;  5JCL A;  3ICS A;  4NNJ A;  3I6T A;  3TWA A;  1JRZ A;  2VVL A;  2IID A;  1B4V A;  4G9K A;  2OAL A;  2C76 A;  2PHH A;  1E1L A;  5EBK A;  4OPU A;  4OPI A;  2C73 A;  1XS2 A;  1GTE A;  4CNJ A;  2OX4 A;  2QVH A;  3HYW A;  3SBF A;  3DFH A;  1DXL A;  5FJR A;  2VVM A;  2BS4 A;  5EB4 A;  4TM0 A;  3BI2 A;  2A87 A;  3JVA A;  3V5F A;  4ZCC A;  3SSZ A;  3L1R A;  3M13 A;  3NS1 B;  3URH A;  2PTW A;  3V3N A;  4ENL A;  1E1M A;  4EIQ A;  3P1W A;  3T6C A;  3GRT A;  4A9W A;  2CFY A;  2XLP A;  3N4F A;  5BOF A;  3PWI A;  3T8Q A;  2W55 A;  5FS7 A;  2E5V A;  3I3L A;  3CNS A;  1OJC A;  1H81 A;  5KRQ A;  3QSE A;  1KFY A;  2BK3 A;  2QDE A;  3IJQ A;  4A6G A;  4B1B A;  3DJJ A;  3SN0 A;  4H4R A;  4H2N A;  3EAN A;  2WS3 A;  2X3N A;  3STP A;  4G7F A;  3CPI G;  3GDP A;  3AEC A;  3SFE A;  4A65 A;  3ATR A;  3CNP A;  3EAO A;  2WEU A;  3RP7 A;  1FFV C;  3UKF A;  2HXU A;  2NVK X;  4I59 A;  2PSN A;  2XVE A;  3T9P A;  5JRB A;  1QLB A;  1P48 A;  5L46 A;  1XDI A;  4JQ9 A;  1Q9I A;  4U2S A;  1PJ7 A;  3EEZ A;  1EL7 A;  4GGH A;  1N60 C;  2XFU A;  3ZLG A;  5IQ1 A;  2AKM A;  1Z6L A;  3RIT A;  3PS9 A;  3UCL A;  3ES7 A;  5HY5 A;  4HNC A;  3NGC X;  2B9Y A;  4RG3 A;  5KXJ A;  1AOG A;  3GYI A;  1LPF A;  1F6M A;  3FJ4 A;  4FK1 A;  3UOV A;  3CAW A;  3RO6 A;  3DGH A;  2NQL A;  4GME A;  1TDE A;  1IUU A;  1JRX A;  3RED A;  3ITJ A;  2PGW A;  3DER A;  3NVZ B;  2CDU A;  4IL0 A;  5KVI A;  2C72 A;  1FL2 A;  3DGB A;  4EQS A;  1TDN A;  4G6G A;  2Y6Q A;  1CC2 A;  2XSX A;  2WOI A;  3SX6 A;  3VRD B;  4K2S A;  2BC1 A;  4JN9 A;  5JCK A;  2RGH A;  5FJP A;  4K2X A;  3Q4D A;  3AED A;  2XVJ A;  1BKW A;  4FP1 A;  2R46 A;  4MMW A;  2W54 A;  1GRE A;  3AE2 A;  4XWZ A;  2E5A A;  1CC6 A;  3TQP A;  1CJ2 A;  2WU2 A;  4EMI A;  4YSH A;  2A8X A;  3AB1 A;  2Q6U A;  3AE5 A;  4GYP C;  4X2P A;  1L9E A;  1PN0 A;  4GAP A;  2ZZC A;  2AL1 A;  2VVL G;  1KSU A;  3Q6J A;  3AYL A;  1B8S A;  4K7Z A;  3NNE A;  2BS3 A;  3PO7 A;  1DOB A;  4RG4 A;  2MNR A;  5BOE A;  1R0M A;  3UTE A;  1EBH A;  1MNS A;  3IC9 A;  4JNA A;  3K1G A;  5BVA A;  3ALM A;  5BUK A;  2B9X A;  1LTX R;  3MKC A;  3IHM A;  2P8B A;  2V6O A;  1PXC A;  3P93 A;  1BGN A;  3ETR B;  1IJH A;  2WP6 A;  4EWJ A;  3T2Y A;  4H19 A;  2EQ8 A;  3N6H A;  3I6D A;  1GRH A;  2C67 A;  2B76 A;  1F8W A;  3NTA A;  4D04 A;  4Z24 A;  4M52 A;  2C66 A;  2W3R A;  3UTG A;  4GAV A;  2XCG A;  3VC5 A;  3E1T A;  2R4E A;  5G5H B;  3C4A A;  3NIX A;  3ABV A;  4J34 A;  2BRY A;  2POD A;  1GSN A;  1SJC A;  3F8P A;  3D9X A;  1DOD A;  3VRB A;  2X99 A;  5KVH A;  4CCQ A;  1E7P A;  2VZ2 A;  4EMW A;  3FMW A;  1YEY A;  4ZA0 A;  5J7X A;  2Q7V A;  2PU0 A;  3S47 A;  3R25 A;  4YTP A;  3SQP A;  4NZH A;  1RSG A;  2GL5 A;  2H89 A;  2OZ3 A;  1OJD A;  2OG9 A;  3A7A A;  3IJI A;  3QKE A;  1ZOY A;  1FFU C;  4U8O A;  4Z43 A;  3ZVH B;  1PDZ A;  3TWB A;  1TDF A;  3MZN A;  1NHR A;  2FKP A;  1LQU A;  1ZY8 A;  2YAU A;  2R0G A;  2C70 A;  4I58 A;  2BXS A;  3MUC A;  1GT8 A;  2E1M A;  4H2Q A;  3OZM A;  1N4V A;  4TVY A;  3RP6 A;  3GRS A;  3QPE A;  3I4K A;  2AR8 A;  1N4U A;  3BI4 A;  4LII A;  3VC6 A;  1FHU A;  1GET A;  1CC4 A;  3DJG X;  2WPF A;  2WQY A;  5KMR A;  5C2T A;  2PTX A;  2BYB A;  2GQW A;  3UP4 A;  2V61 A;  2OZT A;  2XLS A;  3DG7 A;  3ZVI A;  4A6N A;  4YSZ A;  4AT0 A;  1JDF A;  2GEW A;  3QJ4 A;  3ZVH A;  1EC8 A;  4ZN0 A;  4H2H A;  3NG7 X;  1D7L A;  4HB9 A;  3UXK A;  1GPE A;  5G5G B;  4IP5 A;  1ZOV A;  4E0V A;  3CT2 A;  4NTE A;  5FJU A;  1H84 A;  1WUE A;  1LJ1 A;  1SJD A;  3PVC A;  1EBG A;  5JCM A;  2UZZ A;  2XFN A;  4CY6 A;  3NN0 X;  4ADW A;  3AYJ A;  3P4S A;  4O5U A;  3D8X A;  3CB3 A;  4OPD A;  4B65 A;  1MXT A;  3NTD A;  3BJS A;  4BK1 A;  3NKS A;  2GMJ A;  1ONF A;  4JN7 A;  4KX6 A;  3AN1 A;  5HYM A;  2GGI A;  1N61 C;  1YQ3 A;  2PPG A;  3DG6 A;  2Q0K A;  3AEB A;  3P4Q A;  3SN4 A;  3CND A;  2EQ9 A;  4JN8 A;  3M12 A;  1N63 C;  2GMH A;  3ADA B;  2RGO A;  4KWS A;  4M6U A;  1SJB A;  2RDX A;  2GVC A;  1S7M A;  5FJT A;  5U1O A;  4Z17 A;  1FOH A;  3KPK A;  4NTC A;  1X31 B;  2ZAD A;  4U8P A;  1IYX A;  3DIP A;  1PXB A;  2VRM A;  3CMM A;  4U8M A;  1VG9 A;  5KMS A;  2ZC8 A;  5EU9 A;  5IPY A;  1COY A;  5BUL A;  4H50 A;  5U25 A;  3HYV A;  4E5T A;  3QVR A;  1LV0 A;  2ZBW A;  1X2G A;  4GDE A;  3UTF A;  1GRG A;  4D03 A;  3UJF A;  4C77 A;  1B37 A;  1NAA A;  2WPC A;  2H88 A;  1KD0 A;  1WUF A;  1JRY A;  4JDR A;  3AXB A;  2POZ A;  3RHA A;  1D5T A;  1D4E A;  3NFU A;  4AP1 A;  5BRT A;  2EQ7 A;  2W3S A;  3SR6 B;  1L9C A;  5GSN A;  5M0Z A;  3T2K A;  1XPQ A;  4K5S A;  3ALJ A;  3II4 A;  3CN8 A;  4U2L A;  1Y0P A;  1TYT A;  3LZW A;  1GRA A;  2YM2 A;  1YQ4 A;  4MJW A;  4U8L A;  3P4R A;  4FK1 C;  3P4P A;  1F9C A;  2P88 A;  4E4U A;  3DJD A;  2Z5X A;  2JK6 A;  2XLU A;  2V5Z A;  1L8P A;  1PS9 A;  3OTR A;  1E1K A;  4OPC A;  3DJE A;  2C7G A;  3WE0 A;  2XGZ A;  2F5Z A;  2QGY A;  2X50 A;  2FJD A;  3OPS A;  1N5X A;  5LV9 A;  3K7T A;  2OVL A;  1VDC A;  2E3T A;  4JY3 A;  5IQ4 A;  1KNR A;  2BAB A;  3GSI A;  4OPT A;  3VR9 A;  1MRA A;  1IUT A;  1YKJ A;  2PCE A;  1F8S A;  3AE3 A;  3B3R A;  3SXI A;  2YG7 A;  4MGG A;  4HNL A;  1PJ5 A;  4YXD A;  1GV4 A;  4AT2 A;  3KLJ A;  4H7U A;  4EQX A;  3K7Q X;  2AAQ A;  7ENL A;  3NLC A;  2YVJ A;  3FYY A;  3CIR A;  1D4C A;  1JNZ A;  3VA8 A;  2YG5 A;  4UDR A;  4FX9 A;  2BK4 A;  2PP1 A;  4IZG A;  3UKQ A;  3EF6 A;  1TRB A;  4H4P A;  4NWZ A;  5M10 A;  1Y56 A;  3QVP A;  1JCT A;  3ENL A;  4JY2 A;  3R0K A;  5KOW A;  3R11 A;  4USR A;  1NG3 A;  2QQ6 A;  3BNU A;  3QLD A;  1ZMD A;  3DES A;  4JHM A;  3FVD A;  2BXR A;  1BGJ A;  3MQT A;  5HHF A;  3NK0 X;  3CYJ A;  4K8G A;  2O56 A;  3FG2 P;  3AE7 A;  3IHG A;  4K22 A;  1KF6 A;  3SZ0 A;  2FYM A;  3NK2 X;  1JEH A;  5GRT A;  2XYO A;  2ZZ0 A;  3D1C A;  2I0Z A;  1FEC A;  2XVF A;  3ISH A;  1WYG A;  1N4W A;  2ONE A;  3F8D A;  3BHF A;  4KT2 A;  3NVY B;  3P9U A;  2BAC A;  3DA1 A;  1N5W C;  4HYR A;  4ROP A;  3KA7 A;  3ICT A;  3PK7 A;  4TLZ A;  4Z25 A;  3DGZ A;  4BJZ A;  2P8C A;  4H4Y A;  3T4W A;  1RYI A;  4J56 A;  2VOU A;  4RSL A;  2W0H A;  4KPR A;  4ZOH B;  4J1O A;  1JU2 A;  3KU9 A;  3HW2 A;  1EC7 A;  2GR0 A;  4ECH A;  1KN0 A;  1ZDL A;  1VG0 A;  1XAN A;  2QA1 A;  3V4B A;  3HYX A;  1KCZ A;  3FXG A;  2WBA A;  3VCC A;  1JRP A;  1S3E A;  2YWL A;  2QCU A;  4Z2R A;  2HNE A;  3ALL A;  2OLA A;  4WCT A;  4IVM B;  2XH4 A;  2GR2 A;  2B7S A;  2APG A;  3AE8 A;  1CJ3 A;  2IVE A;  3UP5 A;  4GRT A;  3A7R A;  3UJE A;  3CNT A;  2YG3 A;  3JW7 A;  4B68 A;  3H4K A;  4U8I A;  2JB2 A;  2DKI A;  3UOY A;  1V59 A;  3Q9T A;  1GER A;  3DH9 A;  3PFR A;  2E4G A;  2XVH A;  1S2Y A;  4EQR A;  2AL2 A;  2X8C A;  2BCG G;  3DEQ A;  3AE6 A;  4YKG A;  2YG6 A;  4NEW A;  1K0L A;  3NYE A;  2GGE A;  4HN8 A;  3T2Z A;  3CPH G;  4G6H A;  4DX3 A;  4CNK A;  3SYI A;  1JNR A;  2JB1 A;  3UCD A;  3BNM A;  4Y4M A;  2PA6 A;  5FS9 A;  3GYX A;  4A6N B;  1LQT A;  3NN6 X;  3DFY A;  3SZF A;  1CJ4 A;  3GMB A;  4TVW A;  1ZKQ A;  3AE1 A;  4DNA A;  1SB3 B;  3BHK A;  3B97 A;  4YWO A;  2BC0 A;  4YT0 A;  2RAB A;  4GGB A;  2ZZB A;  4A99 A;  1IUX A;  1H83 A;  2YR4 A;  1ZK7 A;  3Q45 A;  3S61 A;  3NH3 X;  1X2H A;  1FEB A;  1JPD X;  4X4J A;  2YVG A;  3QSS A;  4HCD A;  5HXI A;  2JKC A;  2OA1 A;  1PBF A;  3QFA A;  2FJE A;  1ZX9 A;  2PYX A;  3H70 A;  1XHC A;  1KSS A;  5ENL A;  1E1N A;  4UDP A;  2VQ7 A;  4X9M A;  2C3D A;  4JNQ A;  1H6V A;  4OCG A;  4XXG A;  2AKZ A;  1F8R A;  1GRT A;  2GF3 A;  3KKJ A;  2BRA A;  2PGE A;  1R6W A;  1QJD A;  3OZY A;  4YSY A;  3TJI A;  3NXL A;  3AMZ A;  3CGC A;  5KOX A;  3UGV A;  1PDY A;  1E9I A;  3H7V A;  3CXB A;  4B63 A;  4TM4 A;  3CGD A;  3H8A A;  3AE4 A;  3GO2 A;  2PP3 A;  4APN A;  3QN3 A;  3M0O A;  4AOX A;  2PTZ A;  1NHP A;  3D46 A;  1NEN A;  3CNJ A;  1P2H A;  1GND A;  3NT6 A;  2YG4 A;  5EOW A;  1O5W A;  1FCD A;  2BK5 A;  1FEA A;  3UJS A;  4XWR A;  3CXO A;  2OO6 A;  5KMP A;  1NDA A;  1OJT A;  3G5S A;  3AD9 B;  2P0I A;  4CY8 A;  4K1W A;  1ELI A;  2R0P A;  2WDR A;  3G5Q A;  3GD6 A;  1NPX A;  4PAB A;  2JB3 A;  1OJ9 A;  1K0I A;  2OQH A;  1N62 C;  1D7Y A;  4GFI A;  4GDP A;  3P0W A;  3LB8 A;  1S2Q A;  4A3R A;  4GR1 A;  4H4T A;  3TOY A;  2TMD A;  4IL2 A;  2JAE A;  4YKF A;  1DOE A;  1PBB A;  1PBE A;  2XFQ A;  4EM4 A;  1FIQ B;  2GH5 A;  2OFJ A;  1DTN A;  5FS6 A;  1K4Q A;  4EIP A;  4BJY A;  4E4F A;  3FIM B;  4O5Q A;  4REK A;  3T14 A;  4ZCD A;  4EMJ A;  1ONE A;  4BUR A;  1D4D A;  3DDM A;  4WX1 A;  2WHD A;  3OZ2 A;  4J57 A;  5TR3 A;  3RP8 A;  1YQZ A;  4H4X A;  4HCL A;  3COX A;  1N1P A;  4ZCW A;  5FMH A;  3GC2 A;  1KKR A;  5DBJ A;  2JBV A;  4CBQ A;  1VQW A;  2OPJ A;  4EQW A;  2C64 A;  3OC4 A;  5ER0 A;  1KNP A;  3TTE A;  2WES A;  1DJN A;  4OVI A;  2FJA A;  5KMQ A;  3SM8 A;  3NRZ B;  3UCC A;  2CVJ A;  2EQ6 A;  2NPX A;  3K30 A;  2J3N A;  3G5R A;  2Q0L A;  3SZC A;  2PMQ A;  3KPF A;  3HRD C;  3C96 A;  1EBD A;  2AQJ A;  1H7X A;  2Y6R A;  2C4C A;  1ZXI C;  3GMC A;  2WPE A;  3AE9 A;  1JOA A;  1YY5 A;  3F8R A;  3EUB 3;  2R45 A;  3MWC A;  3NVW B;  4GUV A;  2XH0 A;  3RR1 A;  2X8G A;  1Y56 B;  3AEF A;  3RNM A;  2WU5 A;  2HZG A;  2WDQ A;  3U9I A;  3TCS A;  1PBC A;  1KDG A;  4H2P A;  3K7M X;  3RGT A;  2YM1 A;  2CUL A;  3A7U A;  4H4W A;  3UKA A;  3PWG A;  3NK1 X;  3ZDN A;  3CPJ G;  3CK5 A;  4M0X A;  4H4S A;  2R9Z A;  4B66 A;  1RVK A;  5J60 A;  4X9N A;  1CBO A;  3GD3 A;  1REO A;  3TJ4 A;  1TDK A;  2IVD A;  3T37 A;  3DME A;  4USQ A;  3IWA A;  2BA9 A;  1STZ A;  2YVF A;  4DGK A;  1EL9 A;  4B67 A;  4Z26 A;  3SFD A;  2OKT A;  3B6D A;  1VDV A;  2V3B A;  2QA2 A;  2YLZ A;  3ATQ A;  4Z2U A;  1PJ6 A;  2YLS A;  3N6J A;  1W4X A;  2B9W A;  1ECQ A;  1K0J A;  3V3W A;  4E6M A;  1SEZ A;  6ENL A;  2YQU A;  4BV6 A;  3NO1 A;  2Z5Y A;  2OLO A;  3R10 A;  1S3B A;  1IUS A;  1TYP A;  2YLT A;  3IF9 A;  4YTN A;  3NYC A;  4LA1 A;  3AEE A;  1GOS A;  2GR1 A;  2RGJ A;  1HYU A;  1PDH A;  3GD4 A;  1MDL A;  4DSG A;  3KD9 A;  1TZZ A;  4H4U A;  1GXF A;  3S5S A;  3L5O A;  3I6E A;  2XLR A;  2WP9 A;  2P3Z A;  3UOZ A;  3H8I A;  3GYJ A;  5U63 A;  3NVV B;  1P43 A;  4C3Y A;  3LJP A;  3UKH A;  4YWS A;  1IUW A;  5EB5 A;  1GRB A;  4B69 A;  1OEP A;  3R9U A;  2GGH A;  2C75 A;  4MKS A;  3ZYX A;  2QJN A;  4A5L A;  3CTY A;  3RRA A;  2MUC A;  4IHC A;  2FBW A;  1NEL A;  1BKH A;  4Z1Y A;  5FJO A;  4IP4 A;  4J31 A;  3VRA A;  4II2 A;  1ZMC A;  4IV9 A;  2QAE A;  2XFP A;  1GES A;  2XFO A;  5CQF A;  4BK2 A;  1GRF A;  1NU5 A;  3T0K A;  3V3O A;  4AP3 A;  4G74 A;  1V97 A;  4UDQ A;  1GEU A;  3FV9 A;  4HCH A;  4F4R A;  4H4Z A;  3UJR A;  3AEG A;  5JCN A;  2C65 A;  4TM3 A;  1FHV A;  2OQY A;  3CGB A;  3IK4 A;  4EM3 A;  2R0C A;  2AL2 B;  3FPZ A;  4E8G A;  3GY1 A;  3RCY A;  1KKO A; 
#chains in the Genus database with same CATH homology
 2X3N A;  4XXG A;  3RHA A;  1D5T A;  1D4E A;  3L8K A;  2YR5 A;  1F8R A;  3CPI G;  3SZW A;  3GDP A;  1GRT A;  3AEC A;  3SFE A;  4IVO B;  3ATR A;  4A65 A;  4AP1 A;  5BRT A;  4OPG A;  2GF3 A;  3CNP A;  3KKJ A;  2EQ7 A;  2BRA A;  3LAD A;  1O95 A;  4PAA A;  3EAO A;  2WEU A;  1DNC A;  3RP7 A;  3UKF A;  3GDN A;  1L9C A;  1QJD A;  4YSY A;  2GAG B;  3UTH A;  5GSN A;  2NVK X;  1Q1W A;  5M0Z A;  4I59 A;  3T2K A;  3FBS A;  1XPQ A;  3CGC A;  5KOX A;  4U8J A;  4K5S A;  3ALJ A;  2XVE A;  5JRB A;  1QLB A;  4B63 A;  5CKU A;  4TM4 A;  3CGD A;  3II4 A;  3AD7 B;  3T31 A;  5L46 A;  1XDI A;  3CN8 A;  4JQ9 A;  1Q9I A;  1Y0P A;  4G73 A;  4U2L A;  1TYT A;  3AE4 A;  4Z2T A;  4U2S A;  1PJ7 A;  3LZW A;  1GRA A;  2YM2 A;  1EL7 A;  4ICY A;  3DK4 A;  4APN A;  1E39 A;  1YQ4 A;  3AWI A;  3M0O A;  2XFU A;  4MJW A;  4U8N A;  4AOX A;  4U8L A;  5IQ1 A;  1NHP A;  3QSM A;  1NEN A;  3CNJ A;  3P4R A;  1P2H A;  1GND A;  1Z6L A;  2YG4 A;  3NRN A;  3NT6 A;  3PS9 A;  4FK1 C;  4II3 A;  5EOW A;  3UCL A;  1O5W A;  3P4P A;  5HY5 A;  1BF3 A;  1FCD A;  1H2I A;  2BK5 A;  3NGC X;  3DJD A;  2B9Y A;  4RG3 A;  5KXJ A;  1FEA A;  1AOG A;  1CF3 A;  3GYI A;  2Z5X A;  1LPF A;  3UKK A;  1F6M A;  2JK6 A;  2WOV A;  2YLR A;  4XWR A;  5KNL A;  5KMP A;  4FK1 A;  3UOV A;  2XLU A;  1NDA A;  2V5Z A;  1OJT A;  3DGH A;  3G5S A;  3AD9 B;  1TDE A;  4CY8 A;  3DK9 A;  1IUU A;  4A7A A;  1PS9 A;  1JRX A;  1VRQ B;  3RED A;  3ITJ A;  5KWF A;  1E1K A;  4IA6 A;  4OPC A;  3DJE A;  1ELI A;  2C7G A;  3WE0 A;  1B5Q A;  3UKP A;  2GAH B;  1GTH A;  2CDU A;  2F5Z A;  5KVI A;  2C72 A;  3PG6 A;  2X50 A;  2R0P A;  1FL2 A;  3LXD A;  2FJD A;  4U8K A;  2WDR A;  3NHO X;  4EQS A;  1TDN A;  3G5Q A;  5LV9 A;  3K7T A;  4G6G A;  2Y6Q A;  1VDC A;  1CC2 A;  4JY3 A;  2WOW A;  2A89 A;  5IQ4 A;  1NPX A;  4PAB A;  2JB3 A;  1KNR A;  4HA6 A;  2BAB A;  1OJ9 A;  2GB0 A;  4Z44 A;  2GQF A;  2WOI A;  3GSI A;  2WP5 A;  3SX6 A;  1K0I A;  4OPT A;  3VRD B;  2BC1 A;  2V60 A;  4Y4N A;  4JN9 A;  4K8D A;  5JCK A;  3VR9 A;  4J2W A;  1UKV G;  2RGH A;  2ACZ A;  3EPT A;  3AD8 B;  1IUT A;  4K2X A;  3UOX A;  1DOC A;  1D7Y A;  3AED A;  4GDP A;  1YKJ A;  2XVJ A;  4K5R A;  1F8S A;  3LB8 A;  1BKW A;  2R46 A;  1NEK A;  1PXA A;  4U2T A;  3AE3 A;  1GAL A;  1GRE A;  1S2Q A;  3B3R A;  4Y4L A;  3SXI A;  2YG7 A;  1PJ5 A;  3AE2 A;  4YXD A;  4XWZ A;  4GR1 A;  1CC6 A;  4DSH A;  4H4T A;  1LVL A;  4IA5 A;  1L0V A;  3KVE A;  1CJ2 A;  2WU2 A;  1GV4 A;  4EMI A;  2TMD A;  4YSH A;  2JAE A;  2A8X A;  4AT2 A;  4YKF A;  3KLJ A;  1NG4 A;  4H7U A;  3AB1 A;  4EQX A;  2Q6U A;  3VQR A;  1F3P A;  3K7Q X;  2AAQ A;  3NLC A;  2YVJ A;  3AE5 A;  1DOE A;  1L9E A;  1PN0 A;  4GAP A;  2ZZC A;  1D4C A;  1PBB A;  1PBE A;  2XFQ A;  3CIR A;  3DK8 A;  2VVL G;  2TPR A;  1JNZ A;  1TDO A;  4EM4 A;  2YLX A;  1KSU A;  3Q6J A;  2YG5 A;  4UDR A;  3AYL A;  1B8S A;  4K7Z A;  4N9X A;  3NNE A;  4FX9 A;  2GH5 A;  2BK4 A;  2BS3 A;  3PO7 A;  1DOB A;  1MO9 A;  5FS6 A;  1H7W A;  4RG4 A;  1K4Q A;  1PHH A;  4EIP A;  3UKQ A;  4BJY A;  1O94 A;  3EF6 A;  3UTE A;  4CRT A;  3FIM B;  3IC9 A;  4JNA A;  4O5Q A;  4REK A;  5BVA A;  2WDV A;  3ALM A;  1TRB A;  3V76 A;  3T14 A;  2B9X A;  4OPL A;  3VR8 A;  4TM1 A;  4CCR A;  1QO8 A;  5BUK A;  4H4P A;  1LTX R;  4ZCD A;  4EMJ A;  3IHM A;  4NWZ A;  4BUR A;  5M10 A;  1Y56 A;  2V6O A;  3QVP A;  3AEA A;  1PXC A;  1D4D A;  4WX1 A;  2WHD A;  3OZ2 A;  1BGN A;  1IJH A;  1OJA A;  2WP6 A;  4NEV A;  4J57 A;  4JY2 A;  2B7R A;  5TR3 A;  4OPD A;  3RP8 A;  5KOW A;  4USR A;  1YQZ A;  1NG3 A;  4H4X A;  3BNU A;  2YR6 A;  3COX A;  3SGL A;  3T2Y A;  1ZMD A;  2EQ8 A;  2GRT A;  2VQB A;  1N1P A;  5C3J A;  5FMH A;  2R4J A;  4B64 A;  2BXR A;  3S5W A;  1BGJ A;  1L9D A;  5HHF A;  3I6D A;  4A79 A;  1BZL A;  5DBJ A;  1GRH A;  2C67 A;  2JBV A;  4CBQ A;  1PBD A;  1F8W A;  1VQW A;  2B76 A;  4EQW A;  3NTA A;  3NK0 X;  4D04 A;  2C64 A;  3OC4 A;  5ER0 A;  1KNP A;  2WES A;  1DJN A;  3CGE A;  2VRL A;  4Z24 A;  4M52 A;  4OVI A;  2FJA A;  5KMQ A;  1BWC A;  3SM8 A;  3FG2 P;  3AE7 A;  2C66 A;  3IHG A;  4K22 A;  1KF6 A;  2CVJ A;  3UTG A;  4GAV A;  2EQ6 A;  2XCG A;  3E1T A;  3SZ0 A;  2NPX A;  2R4E A;  3K30 A;  3NK2 X;  1JEH A;  2J3N A;  3G5R A;  3C4N A;  4J33 A;  2Q0L A;  5GRT A;  3C4A A;  3SZC A;  2XYO A;  3NIX A;  2ZZ0 A;  3ABV A;  2I0Z A;  3D1C A;  4J34 A;  2BRY A;  1GSN A;  3F8P A;  3D9X A;  1DOD A;  1FEC A;  3KPF A;  3VRB A;  2X99 A;  5KVH A;  2WET A;  3C96 A;  1E7P A;  2XVF A;  1EBD A;  4EMW A;  2VZ2 A;  3ICR A;  2AQJ A;  2DKH A;  2C3C A;  3FMW A;  2FJB A;  1H7X A;  2Y6R A;  3NYF A;  3ISH A;  4GF7 A;  3UKL A;  2C4C A;  1N4W A;  3F8D A;  3BI5 A;  2XVI A;  5J7X A;  3BHF A;  1EL5 A;  3GMC A;  2WPE A;  3AE9 A;  2Q7V A;  1M64 A;  4YTP A;  3SQP A;  3P9U A;  1JOA A;  4J36 A;  1YY5 A;  3F8R A;  2BAC A;  3DA1 A;  4NZH A;  1NHS A;  2R45 A;  3KA7 A;  4GUV A;  3JSK A;  2YLW A;  4BK3 A;  1CJC A;  1RSG A;  2H89 A;  2HQM A;  3ICT A;  2X8G A;  2GR3 A;  4GCM A;  4TLZ A;  4Z25 A;  1OJD A;  1Y56 B;  4C3X A;  2OAM A;  1ZOY A;  3DGZ A;  3AEF A;  4BJZ A;  3RNM A;  4U8O A;  4AOS A;  1M6I A;  4H4Y A;  4UP3 A;  2WU5 A;  4Z43 A;  1RYI A;  1TDF A;  4J56 A;  5FS8 A;  3LZX A;  2VOU A;  2WDQ A;  1CHU A;  1PBC A;  4RSL A;  1NHR A;  1KDG A;  1LQU A;  1ZY8 A;  2YAU A;  3LOV A;  2R0G A;  2C70 A;  2BS2 A;  4H2P A;  4I58 A;  2W0H A;  3K7M X;  2BXS A;  4KPR A;  2V3A A;  1GT8 A;  2E1M A;  2XLT A;  2YM1 A;  2CUL A;  1JU2 A;  4H2Q A;  3KU9 A;  3H8L A;  3HZL A;  2XDO A;  1N4V A;  3GWD A;  4H4W A;  3UKA A;  1RP0 A;  3NK1 X;  1NHQ A;  2GR0 A;  3ZDN A;  1Q1R A;  1CL0 A;  3CPJ G;  4ECH A;  4LU6 A;  3RP6 A;  1KN0 A;  2BCP A;  1ZDL A;  3GRS A;  1VG0 A;  4H4Q A;  4H4S A;  2AR8 A;  1N4U A;  2R9Z A;  1E6E A;  1XAN A;  2QA1 A;  4LII A;  3BI4 A;  4B66 A;  1GET A;  1CC4 A;  3HYX A;  2WBA A;  3DJG X;  5J60 A;  2WPF A;  1P2E A;  4X9N A;  1CBO A;  2WQY A;  5KMR A;  5C2T A;  3GD3 A;  1REO A;  1S3E A;  3SY4 A;  2BYB A;  2YWL A;  2GQW A;  3UP4 A;  2QCU A;  2V61 A;  4Z2R A;  1TDK A;  2XLS A;  2IVD A;  3T37 A;  3ALL A;  4H4V A;  4A6N A;  4C74 A;  3DME A;  2O9Z A;  4USQ A;  4YSZ A;  4FDC B;  1IUV A;  3IWA A;  2BA9 A;  4WCT A;  4IVM B;  2GR2 A;  2YVF A;  2ARD A;  2B7S A;  2APG A;  3AE8 A;  1ZP0 A;  1MOK A;  3GWF A;  4AT0 A;  4DGK A;  1EL9 A;  1CJ3 A;  2GEW A;  4NTD A;  3QJ4 A;  4B67 A;  2IVE A;  4Z26 A;  3SFD A;  3UP5 A;  4ZN0 A;  4GRT A;  4YTM A;  2GV8 A;  3NG7 X;  3CNT A;  1D7L A;  4C5O A;  1H82 A;  3B6D A;  2YG3 A;  2V3B A;  2QA2 A;  2YLZ A;  4HB9 A;  2X8H A;  1GPE A;  3ATQ A;  4B68 A;  4Z2U A;  3H4K A;  1H86 A;  4TLX A;  1PJ6 A;  1ZOV A;  2YLS A;  4E0V A;  4U8I A;  2JB2 A;  3QFB A;  1W4X A;  2B9W A;  2DKI A;  4NTE A;  1K0J A;  1H84 A;  3UOY A;  1SEZ A;  3AYI A;  2YQU A;  1LJ1 A;  4BV6 A;  2OLN A;  1V59 A;  3PVC A;  3Q9T A;  2UZZ A;  5JCM A;  4CY6 A;  2XFN A;  2Z5Y A;  3NN0 X;  1EL8 A;  4YSX A;  4H2R A;  4ADW A;  2OLO A;  3AYJ A;  3P4S A;  5JCI A;  1GER A;  3DH9 A;  2E4G A;  4P9S A;  1S3B A;  3O0H A;  1IUS A;  1DJQ A;  1TYP A;  4O5U A;  2YLT A;  2XVH A;  3D8X A;  3IF9 A;  3NYC A;  4YTN A;  4LA1 A;  5JCL A;  1GOS A;  2GR1 A;  3AEE A;  2RGJ A;  1HYU A;  1MXT A;  1PDH A;  1S2Y A;  4B65 A;  4EQR A;  3GD4 A;  3ICS A;  3NTD A;  4NNJ A;  4DSG A;  4BK1 A;  3KD9 A;  3NKS A;  1JRZ A;  2GMJ A;  2X8C A;  4H4U A;  1B4V A;  2BCG G;  1GXF A;  2IID A;  2VVL A;  4G9K A;  3L5O A;  3AE6 A;  1ONF A;  2XLR A;  2WP9 A;  4YKG A;  3UOZ A;  4KX6 A;  2OAL A;  2YG6 A;  2C76 A;  2PHH A;  3H8I A;  1E1L A;  4NEW A;  5EBK A;  4OPU A;  4OPI A;  3GYJ A;  1K0L A;  2C73 A;  5HYM A;  5U63 A;  1GTE A;  3NYE A;  3T2Z A;  4CNJ A;  1YQ3 A;  4C3Y A;  3CPH G;  3HYW A;  2Q0K A;  3AEB A;  3P4Q A;  3LJP A;  4G6H A;  3UKH A;  4CNK A;  3SYI A;  1JNR A;  3CND A;  1IUW A;  2JB1 A;  5EB5 A;  2EQ9 A;  1GRB A;  3BNM A;  1DXL A;  4Y4M A;  4B69 A;  2VVM A;  2BS4 A;  3M12 A;  5FS9 A;  3R9U A;  3GYX A;  5EB4 A;  2GMH A;  1LQT A;  3NN6 X;  4TM0 A;  2C75 A;  3ADA B;  4A6N B;  3BI2 A;  2RGO A;  3ZYX A;  2A87 A;  4A5L A;  3SZF A;  3CTY A;  1CJ4 A;  2FBW A;  2GVC A;  1S7M A;  4ZCC A;  3GMB A;  3L1R A;  5U1O A;  1FOH A;  3KPK A;  4J31 A;  3M13 A;  4NTC A;  3VRA A;  1ZKQ A;  1X31 B;  1ZMC A;  4II2 A;  3AE1 A;  4DNA A;  4U8P A;  3BHK A;  4IV9 A;  2QAE A;  1PXB A;  2XFP A;  2VRM A;  1GES A;  4YWO A;  3URH A;  3CMM A;  2BC0 A;  4YT0 A;  2RAB A;  2XFO A;  3V3N A;  5CQF A;  2ZZB A;  4BK2 A;  1E1M A;  1GRF A;  4EIQ A;  4U8M A;  4A99 A;  1VG9 A;  3T0K A;  3V3O A;  4AP3 A;  5KMS A;  1IUX A;  1H83 A;  3P1W A;  4G74 A;  2YR4 A;  1ZK7 A;  3GRT A;  3S61 A;  4A9W A;  5IPY A;  3NH3 X;  4UDQ A;  1FEB A;  1GEU A;  2CFY A;  2XLP A;  1COY A;  4CCQ A;  4H50 A;  4X4J A;  5BUL A;  2YVG A;  4H4Z A;  5U25 A;  3HYV A;  3QSS A;  3AEG A;  5HXI A;  2JKC A;  2OA1 A;  3QVR A;  5FS7 A;  1PBF A;  2E5V A;  5JCN A;  1LV0 A;  2ZBW A;  3I3L A;  4GDE A;  3UTF A;  3CNS A;  1GRG A;  2C65 A;  4D03 A;  1OJC A;  3QFA A;  1H81 A;  5KRQ A;  2FJE A;  3QSE A;  3CGB A;  4TM3 A;  1KFY A;  2BK3 A;  1ZX9 A;  4EM3 A;  2R0C A;  4C77 A;  2PYX A;  1B37 A;  1XHC A;  1KSS A;  1NAA A;  4B1B A;  3FPZ A;  1E1N A;  2WPC A;  3DJJ A;  4H4R A;  4H2N A;  2H88 A;  2VQ7 A;  4UDP A;  2C3D A;  3EAN A;  4X9M A;  2WS3 A;  4JNQ A;  1JRY A;  4JDR A;  1H6V A;  3AXB A;  4OCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...