4LIIA

Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (aifm1) from homo sapiens at 1.88 a resolution
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
Knots found
sequence length
487
structure length
474
Chain Sequence
QDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (AIFM1) from Homo sapiens at 1.88 A resolution
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase, apoptosis
total genus 147
structure length 474
sequence length 487
other databases KnotProt 2.0: S -31
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4liiA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4liiA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4liiA01
1GRHA 2GMHA 2UZZA 5J7XA 4J57A 5EB4A 4BURA 1K0LA 3NKSA 3UKQA 2XYOA 4C3XA 5U25A 1H82A 2DKIA 2BK5A 2YLXA 2BXRA 4IVOB 3O0HA 2B76A 1CF3A 4BJYA 4OCGA 1DOBA 4X9NA 1TDKA 1EL5A 3CGEA 3URHA 1GALA 5BULA 4ICYA 4NEWA 5FS9A 1L9EA 3RP6A 3REDA 4X9MA 2F5ZA 3AECA 1BF3A 3ATQA 5HY5A 4JQ9A 2TMDA 2ZBWA 4H4PA 5FS7A 3BHFA 3IF9A 3NH3X 4ZN0A 1NDAA 3BI2A 4I58A 2QAEA 1OJTA 3K7QX 1D7LA 4UP3A 2V60A 1UKVG 2YVFA 3B3RA 2YLTA 1GT8A 3LZXA 4OPCA 1REOA 3IHGA 3ZDNA 4U2TA 2VRLA 4UDRA 3NRNA 2V5ZA 4Z44A 1E1KA 1IUUA 1RSGA 4A6NB 2WOIA 2YVJA 3CGBA 4KPRA 1IUWA 1FCDA 4YSZA 4KX6A 3II4A 1QLBA 5U63A 3RP8A 4OPGA 2ARDA 3NT6A 2AAQA 1N4VA 2QA2A 4H4QA 3FPZA 2GAHB 3G5QA 1H86A 3GDPA 5KOXA 5FMHA 1EL9A 1O94A 3RP7A 3EF6A 3UTFA 4BV6A 4H4XA 4B64A 2PHHA 1GRAA 3P1WA 2YG7A 3L8KA 5FS8A 1COYA 5KWFA 1GETA 1Y0PA 4GCMA 1KF6A 1GSNA 1LQTA 2Q7VA 2FJAA 4EIQA 2YG3A 4YSHA 1PBCA 1CHUA 2C66A 1NHSA 1ZY8A 2GR2A 1X31B 4J33A 4WX1A 3NNEA 4YT0A 2AR8A 2JAEA 3CGDA 3NTAA 4D03A 2WDVA 2NVKX 2WESA 2VQBA 2XVIA 1LVLA 3NK1X 4YTMA 4TLXA 2C7GA 2YLSA 2EQ7A 5ER0A 4E0VA 1F8RA 1Y56A 4H2NA 3VR8A 3Q6JA 3K30A 1E1MA 4JNQA 2YR5A 5IQ4A 3EPTA 2YVGA 2CFYA 1YQ3A 4B63A 2GQWA 3HZLA 4BJZA 5JCLA 4J2WA 4YKGA 4C5OA 3F8PA 2BK3A 2C67A 1EBDA 2WDRA 3QSEA 4USQA 3P9UA 2IVDA 2BS4A 1KSUA 3GD4A 2C76A 1PBFA 4PAAA 4H2QA 4Z2TA 4LA1A 2R45A 2J3NA 4U8OA 1GEUA 2YWLA 2R4JA 4JY2A 3CNSA 3DGHA 4H50A 1ZMDA 2GR3A 3P4QA 3ADAB 5LV9A 2C73A 4IVMB 1LJ1A 3SGLA 3AE3A 2WHDA 1RP0A 3AE2A 4OPTA 2ACZA 4U8LA 1NAAA 4TM1A 2BC0A 2NPXA 1PBBA 4AP3A 4B67A 4XWRA 3FBSA 3FG2P 1PXAA 1PS9A 2R0CA 2WPCA 4REKA 3UTEA 4DSHA 2XVHA 4EQXA 1D4EA 3CPJG 2C72A 1BGJA 1DJNA 1NPXA 4Z25A 5KRQA 2C75A 1EL8A 3CNPA 4K7ZA 2XVJA 4B65A 4DSGA 5DBJA 2B9WA 4H4UA 3FIMB 2YLWA 2WP9A 2YQUA 3NK0X 2IVEA 3UP4A 2X99A 1JRYA 4H4VA 2FJDA 1E1LA 3M12A 4CCQA 3KA7A 4TM3A 1H6VA 1TRBA 3UKAA 3S5WA 3AE7A 1D7YA 4CNJA 2Q6UA 4C3YA 2BYBA 1GOSA 2OLOA 3DJDA 1LPFA 2A8XA 3CN8A 2E1MA 4OPDA 2XLTA 3T37A 3AE1A 1PJ5A 5J60A 3DK4A 2X8CA 2GMJA 3NGCX 3OZ2A 4J36A 4GRTA 4AT0A 1EL7A 4LIIA 4GDPA 4Y4NA 5JCNA 4FX9A 2YM1A 3ICTA 1FEAA 3ATRA 5IPYA 1V59A 2A89A 4EM4A 4GUVA 2R0PA 4IA5A 2XLUA 1XPQA 2APGA 2I0ZA 4C77A 3DJGX 4BK1A 1KDGA 1DXLA 3VRDB 4Z2UA 4U8PA 5BVAA 2V61A 4CY6A 4PABA 2XVEA 3VR9A 3ICSA 5EBKA 1QO8A 3UTHA 1YQ4A 3AYIA 4O5QA 4CRTA 3VRBA 5JCKA 4ZCCA 2WOWA 3S61A 3LOVA 3GWDA 3AEFA 4TM4A 4K8DA 1F3PA 4JDRA 4ADWA 4H2RA 4NTEA 4DGKA 1KFYA 2X50A 3BNMA 3QSMA 4Z26A 2YM2A 4K5RA 3AD7B 2V6OA 4A79A 1TDFA 3GWFA 3GMCA 4CBQA 4Z43A 2O9ZA 2VRMA 2YR4A 2XFUA 3K7MX 1O5WA 2GB0A 4ECHA 1B5QA 4H4ZA 2VQ7A 4I59A 1M6IA 1ZX9A 1DJQA 1FL2A 4RG3A 1OJAA 2VVMA 1CJCA 2Z5XA 4HA6A 2EQ9A 4U8JA 1GPEA 4EM3A 4APNA 1ZOVA 3PO7A 3AD8B 4K22A 1JOAA 1K0IA 4LU6A 5EB5A 2B9YA 2OA1A 2X3NA 1RYIA 3VQRA 3DGZA 3GRSA 1PJ6A 1OJ9A 3AB1A 5M0ZA 1PBDA 2Q0LA 2EQ6A 2W0HA 1N1PA 3AYJA 5CKUA 3AEBA 4YTPA 1B37A 3UKFA 2AQJA 2GV8A 3DK8A 3RHAA 4JY3A 1HYUA 3GRTA 3PVCA 2WP6A 2GVCA 4C74A 1PXCA 1XHCA 2Y6QA 2XCGA 1KNRA 1D5TA 1N4UA 2C3DA 3JSKA 1M64A 2A87A 2YG5A 3AEAA 3ALLA 3I3LA 4RSLA 3BI4A 3UKKA 1TYTA 3QFBA 4GR1A 2VOUA 2WU2A 3BI5A 4A99A 1YY5A 2WPFA 1W4XA 3AXBA 2JKCA 2RGJA 2R0GA 3C4AA 1Q1RA 3ABVA 3ZYXA 3P4PA 1GESA 1P2HA 1S3EA 2CVJA 1N4WA 2Y6RA 3UKLA 4B1BA 3KVEA 4O5UA 5U1OA 1QJDA 1Z6LA 1ZOYA 4H4YA 2YR6A 3GSIA 2IIDA 1XDIA 2B7SA 5L46A 3NK2X 2ZZBA 4YKFA 4P9SA 1DOCA 2C70A 4YSXA 4XWZA 1MXTA 5BUKA 4U8NA 1ONFA 3AEEA 2FBWA 1GRTA 2FJEA 4XXGA 4Y4LA 3V3NA 1NHRA 1PJ7A 1CBOA 2GRTA 1L9DA 2BABA 3CTYA 1PN0A 4X4JA 1ZMCA 3UOXA 1SEZA 4H4TA 3V3OA 2V3AA 3UTGA 4EMIA 4A6NA 5KOWA 1TYPA 3NTDA 2CULA 2WEUA 2XFPA 1NHPA 2C65A 4J31A 2GEWA 3IWAA 2B7RA 1JU2A 4YWOA 4A5LA 1E7PA 1ZDLA 3ITJA 1P2EA 1DODA 1NENA 1PXBA 2WDQA 4NTDA 1B8SA 1IUSA 1H83A 2PYXA 1L9CA 3FMWA 3DJJA 2WU5A 3G5SA 3PS9A 3LB8A 1JRZA 3I6DA 5HXIA 2HQMA 1LQUA 2JK6A 1DNCA 4YSYA 3GMBA 4YTNA 3ICRA 1S2QA 3UCLA 3NN0X 1CC6A 3R9UA 3GD3A 1O95A 2GAGB 2JBVA 2RABA 4B68A 1H84A 2R4EA 1GERA 4DNAA 3LXDA 4EMJA 1NG3A 1GRBA 2X8HA 3KKJA 3K7TA 4Y4MA 3GYJA 4N9XA 2VZ2A 1JEHA 2OALA 2RGHA 4U2LA 3UKHA 2TPRA 2E5VA 3DMEA 1ZKQA 3AD9B 3AWIA 3CNJA 3QSSA 3CPIG 3GYIA 3P4SA 4M52A 4A7AA 3AE4A 3NYFA 3QVRA 4EQSA 2XLSA 1NG4A 3L1RA 4UDPA 2DKHA 3SFEA 2ZZ0A 3NHOX 2JB2A 3B6DA 1ZP0A 3CNTA 1BGNA 2BK4A 1KNPA 2BS3A 3WE0A 4Z2RA 2WOVA 1YQZA 3SQPA 1VG9A 4OVIA 3Q9TA 1Y56B 3EANA 4U8IA 2BCGG 3KD9A 5KVIA 3F8DA 1IUVA 1S3BA 5KXJA 1FEBA 1AOGA 1GRGA 1D4CA 1LTXR 3M13A 3LADA 3NYCA 5GSNA 5HHFA 3UOYA 4A9WA 3DK9A 4OPIA 4B66A 3LJPA 2WQYA 2BS2A 1GREA 5IQ1A 1L0VA 1F8WA 3H4KA 1NEKA 3NYEA 4TM0A 4EIPA 1IUTA 3ALMA 1F6MA 4MJWA 4U2SA 2YLZA 4CY8A 4U8MA 1JRXA 1CC4A 1K0JA 1H7XA 2GR1A 4TLZA 4AT2A 1TDNA 3C96A 3EAOA 2OLNA 4AOSA 1GTEA 1ELIA 2GQFA 4EQWA 1E6EA 3BHKA 3H8LA 1VRQB 2H89A 2YG6A 4USRA 5HYMA 2ZZCA 3OC4A 2WBAA 3P4RA 4OPLA 4J34A 2V3BA 1K4QA 2WETA 2WS3A 2XLRA 3QVPA 1DOEA 4H7UA 3AEGA 3SM8A 5JCMA 4H4RA 4H2PA 2Z5YA 4H4SA 3KU9A 3F8RA 2E4GA 3QFAA 5C2TA 4K5SA 1IUXA 2XDOA 4D04A 3AE5A 2R46A 2QCUA 2YG4A 3CIRA 1CC2A 3KLJA 1S2YA 2R9ZA 1PDHA 4WCTA 4BK2A 3ALJA 4YXDA 2YLRA 3CGCA 3UOVA 1H7WA 3UP5A 5TR3A 2XVFA 3CPHG 5KVHA 1GNDA 2WPEA 1MO9A 1MOKA 3C4NA 4A65A 1H81A 3AE6A 4IA6A 1XANA 2B9XA 5M10A 1CL0A 5BRTA 1VDCA 4HB9A 3H8IA 4EQRA 5GRTA 5CQFA 2XFNA 2YAUA 3COXA 2C3CA 2BA9A 4B69A 4FDCB 2RGOA 2CDUA 3M0OA 3SFDA 1D4DA 1KSSA 4H4WA 3DH9A 3BNUA 3DJEA 3G5RA 3LZWA 2FJBA 5FS6A 4Z24A 1CJ3A 3D1CA 1Q1WA 4JN9A 1ZK7A 4ZCDA 1VG0A 3IC9A 3ISHA 3DA1A 2VVLG 3RNMA 4FK1A 1BZLA 3UOZA 3E1TA 4RG4A 3QJ4A 3NN6X 3GDNA 2EQ8A 1JNZA 1OJCA 3UKPA 3KPFA 2QA1A 5EOWA 1FECA 3IHMA 2BXSA 1FOHA 1VQWA 1PBEA 2BACA 2JB3A 2WP5A 2C64A 5JCIA 2JB1A 2VVLA 4BK3A 1CJ2A 1TDOA 4FK1C 1BWCA 1NHQA 2BC1A 2GH5A 4NEVA 4CCRA 3AYLA 2GR0A 1OJDA 2GF3A 2XLPA 4K2XA 1IJHA 2BCPA 4NZHA 4AOXA 1B4VA 1YKJA 4U8KA 1GRFA 4OPUA 4GDEA 1LV0A 2OAMA 3AE8A 3D8XA 4JNAA 4GF7A 2X8GA 3CNDA 2XFQA 4IV9A 4UDQA 1Q9IA 1GXFA 1CJ4A 4J56A 1E1NA 3VRAA 1E39A 3NLCA 2Q0KA 1GV4A 3AEDA 3V76A 2H88A 4NTCA 3NG7X 1GTHA 1PHHA 2XFOA 4CNKA 3AE9A 3NIXA 1TDEA 1JNRA 5C3JA 1BKWA 4EMWA 4AP1A 1F8SA
chains in the Genus database with same CATH superfamily
4BURA 3HYVA 4F4RA 5FJOA 1H82A 2YLXA 4IVOB 3O0HA 1MDRA 2QDEA 3IK4A 1TDKA 1EL5A 3URHA 1GALA 4ICYA 4JN8A 2XGZA 2F5ZA 2HZGA 4JQ9A 3MKCA 5FS7A 3NH3X 1NDAA 4I58A 2QAEA 2P8BA 2YVFA 2YLTA 3LZXA 4OPCA 1STZA 3IHGA 3T6CA 2VRLA 3THUA 1E1KA 1IUUA 2W3RA 4A6NB 2YVJA 1FCDA 2PA6A 3T4WA 1TE6A 3RP8A 1N4VA 2QA2A 4HCDA 1O94A 3RP7A 3EF6A 4H4XA 3P1WA 1GRAA 2YG7A 1JCTA 1GSNA 2FJAA 4YSHA 1S7MA 4IP4A 3UCDA 3GYXA 3CGDA 2WDVA 4YTMA 3IJLA 3NZGA 3VC6A 1F8RA 1Y56A 3VR8A 2YR5A 3EPTA 2YVGA 2PTXA 4G9KA 1EBDA 2P88A 4LA1A 1GEUA 3DGHA 3P4QA 4IVMB 2XH4A 3AE3A 3AE2A 3I4KA 1VQZA 1NAAA 4B67A 1PBBA 3FG2P 1PXAA 2R0CA 3UTEA 2WPCA 4MMWA 3VA8A 2C72A 1DJNA 4Z25A 3CNPA 1EL8A 4K7ZA 1TKKA 5DBJA 3CYJA 3UP4A 1JRYA 2FJDA 1E1LA 3M12A 3S5WA 3MWCA 3S47A 3SZ0A 1LPFA 2A8XA 2QJMA 1KD0A 3EUB3 2XLTA 3T8QA 2E3TA 3DERA 3VCCA 3OZ2A 4JN7A 4GDPA 1FEAA 2QGYA 4G74A 2A89A 1XPQA 2I0ZA 1KDGA 1TZZA 4Z2UA 4PABA 1QO8A 3VRBA 4ZCCA 1N63C 1MUCA 2PTZA 4TM4A 4K8DA 1F3PA 4ADWA 4H2RA 4NTEA 3AN1A 3VDGA 4GGHA 4A79A 1TDFA 3Q45A 2OX4A 2GB0A 4ECHA 2VQ7A 2EQ9A 3EKGA 1GPEA 4APNA 2RDXA 1V97A 3NXLA 1JOAA 5EB5A 3SY4A 4TVYA 2AL2B 3AB1A 1PBDA 2EQ6A 3PWIA 3HPFA 3AYJA 3RHAA 3IJQA 3GRTA 1JRPA 1N5XA 2GVCA 2GSHA 3AEAA 1TYTA 5KMSA 1YY5A 4DN1A 2RGJA 1Q1RA 3P4PA 4M6UA 1P2HA 4B1BA 4O5UA 5U1OA 1Z6LA 3GSIA 5L46A 3NK2X 2ZZBA 1DOCA 3ES7A 1MXTA 4U8NA 2AL1A 3V3NA 1NHRA 4GGBA 1L9DA 2BABA 3CTYA 3UOXA 1ZMCA 1IYXA 3UTGA 3NFUA 5KOWA 1E9IA 3IWAA 1JU2A 4YWOA 1E7PA 1ZDLA 2P3ZA 1P2EA 1PXBA 3FCPA 2WDQA 1IUSA 3PS9A 3GMBA 3B97A 2GL5A 3ICRA 3NN0X 3SN1A 2RABA 2W3SA 2OPJA 2DW6A 3MZNA 4DYEA 3K7TA 4N9XA 2OALA 2RGHA 3CXOA 2E5VA 3DMEA 1ECQA 3AE4A 2ZADA 3ZVIA 3TJIA 4UDPA 2DKHA 2ZZ0A 3NHOX 2JB2A 1ZP0A 3CNTA 2BS3A 1KNPA 1WUEA 1Y56B 3F8DA 4MGGA 1GRGA 3LADA 3NYCA 3L5OA 3UOYA 4G6HA 4HCLA 5IQ1A 2BS2A 1F8WA 3N6JA 3NYEA 4U2SA 1H7XA 1TDNA 3C96A 1GTEA 3H8LA 3VCNA 3OC4A 2WS3A 1K4QA 1EC8A 4A6GA 3T14A 1R6WA 4ENLA 3SM8A 5C2TA 2GGEA 3AE5A 4ZA0A 1CC2A 1PDHA 4BK2A 3ZVHB 3UP5A 2XVFA 1H81A 2B9XA 5M10A 3DEQA 1CL0A 3T9PA 3MQTA 5GRTA 2XFNA 3COXA 2C3CA 2BA9A 2O56A 3M0OA 4H4WA 3BNUA 3LZWA 2FJBA 1CJ3A 4JN9A 4MKSA 4ZCDA 1VG0A 3ISHA 2VVLG 1BZLA 3NN6X 3QTPA 3UKPA 1FECA 2JB3A 2WP5A 5JCIA 4BK3A 1FFUC 1NHQA 3TW9A 3AYLA 2GR0A 4GAVA 4AOXA 3NRZB 2ONEA 4U8KA 4GF7A 3CNDA 1CJ4A 1GV4A 3V76A 2OG9A 3D47A 1TDEA 1BKWA 3FYYA 1K0LA 3NKSA 3UKQA 5U25A 2DKIA 2B76A 4BJYA 2AKMA 2GGHA 2PP0A 4NEWA 3BSMA 1L9EA 3REDA 4E8GA 4X9MA 1SJBA 5HY5A 2MNRA 3IF9A 4ZN0A 4H4PA 2OVLA 1OJTA 3N4FA 3B3RA 3QLDA 3BJSA 3ZDNA 4U2TA 4DWDA 3NS1B 3NRNA 4HNLA 4Z44A 1RSGA 3CGBA 4YSZA 2OZTA 1QLBA 4OPGA 4E5TA 2AAQA 2OZ3A 2GGIA 4H4QA 3FPZA 1H86A 3UTFA 3DIPA 3PWGA 1ZXIC 3DESA 3A7AA 1COYA 4GCMA 3ZLHA 2YG3A 1NHSA 1ZY8A 2GR2A 1X31B 4J33A 4WX1A 3NNEA 2JAEA 3CB3A 2WESA 3NK1X 4TLXA 2YLSA 4E0VA 4A3RA 3A7UA 3Q6JA 4JNQA 5IQ4A 3UXLA 2CFYA 4B63A 4YKGA 3NVYB 3F8PA 2BK3A 3P9UA 4PAAA 2J3NA 3CNSA 4H50A 2FYMA 2C73A 3V4BA 2OQHA 1RP0A 2ACZA 4U8LA 1VDVA 4TM1A 4AP3A 4XWRA 4Z17A 4NNJA 1DTNA 1BGJA 1NPXA 5KRQA 3N6HA 4H4UA 3FIMB 2YLWA 2WP9A 2YQUA 3NK0X 2IVEA 2X99A 4H4VA 4TM3A 1H6VA 1TRBA 3UKAA 3UGVA 4CNJA 4C3YA 3CN8A 1XPYA 2E1MA 4OPDA 4E4UA 3T37A 3AE1A 5J60A 3UJSA 2GMJA 2GGJA 2XSXA 4LIIA 3ZLFA 4FX9A 1BQGA 4EM4A 3DJGX 1YEYA 1DXLA 4CY6A 3T0KA 3VR9A 3ICSA 3UTHA 4O5QA 3SX6A 5JCKA 2WOWA 4GIRA 3RRAA 2MUCA 4JDRA 1KFYA 2X50A 3AD7B 4Z43A 3GWFA 1ELSA 3K7MX 1B5QA 1DJQA 1FL2A 4RG3A 5KMRA 2VVMA 4HA6A 2Z5XA 2PP1A 2X3NA 3GRSA 1PJ6A 5M0ZA 3UCCA 1N1PA 3AEBA 3UKFA 3OW1A 1HYUA 3PVCA 1PXCA 1XHCA 1N4UA 1M64A 3BI4A 3UKKA 4GR1A 3D9XA 4HYRA 3C4AA 3ABVA 1GESA 2Y6RA 3UKLA 3RITA 2YR6A 2IIDA 1XDIA 2B7SA 4P9SA 2QJNA 4YSXA 4XWZA 2OZ8A 1JROA 1EC7A 2FBWA 4Y4LA 2GRTA 3U4FA 4X4JA 3PK7A 1SEZA 3H8AA 2CULA 4J31A 3H12A 3GO2A 4A5LA 4NTDA 1B8SA 3DJJA 3LB8A 1JRZA 1LQUA 3STPA 1DNCA 2OQYA 3GC2A 3R9UA 3GD3A 1O95A 2JBVA 4EMJA 1NG3A 2X8HA 3UKHA 1ZKQA 3P4SA 3SN4A 4A7AA 3NYFA 2C4CA 2PCEA 4EQSA 1NG4A 3L1RA 3EEZA 2QJJA 3SFEA 3B6DA 3TJ4A 2BK4A 5KMQA 3QN3A 1VG9A 4OVIA 3Q9TA 3SYIA 3EANA 2BCGG 4HPNA 5KVIA 3OZMA 3IJIA 4JHMA 1S3BA 4E6MA 5KXJA 1FEBA 5GSNA 4OPIA 3R1ZA 2PS2A 4B66A 1GREA 3H4KA 4TM0A 3ALMA 3SR6B 4MJWA 1JRXA 2GR1A 3R07C 4AT2A 3DDMA 3OPSA 3ES8A 3EAOA 3R11A 1ELIA 2H89A 2YG6A 4IP5A 4OPLA 2V3BA 2XLRA 3QVPA 1KKOA 3FJ4A 3AEGA 5JCMA 3TQPA 3K1GA 4DXKA 3KU9A 3F8RA 1IUXA 5G5GB 3NVZB 2YG4A 3CGCA 5KVHA 1GNDA 1MOKA 4H1ZA 1XANA 1VDCA 4HB9A 3H8IA 4KT2A 2PTYA 2ZC8A 5G5HB 2CDUA 1D4DA 1KSSA 2XH0A 3SXIA 3T31A 3SZCA 3E1TA 2EQ8A 1JNZA 3KPFA 1PDYA 3HYWA 3IHMA 3DG3A 1VQWA 3FV9A 5FJTA 2BC1A 3RGTA 3QPEA 1YKJA 1GRFA 4OPUA 4GDEA 4KEMA 1LV0A 2OAMA 3AE8A 3D8XA 3V5FA 4JNAA 2BRAA 3CXBA 4UDQA 3NLCA 2Q0KA 2PGWA 3NG7X 4AP1A 1GRHA 5J7XA 2UZZA 4J57A 5EB4A 2XYOA 3DFYA 4C3XA 2BXRA 4OCGA 4X9NA 3A7RA 4K1WA 5FS9A 1BF3A 1N5WC 2TMDA 2ZBWA 3BI2A 4HN8A 1UKVG 2W54A 3DG6A 2WOIA 3I6EA 4KX6A 2ARDA 3NT6A 2OKTA 2GAHB 5KOXA 5FMHA 3SN0A 1EL9A 3SZFA 2PHHA 5KWFA 1GETA 1KF6A 1LQTA 2Q7VA 1PBCA 1CHUA 4DHGA 4YT0A 2AR8A 3BOXA 2NVKX 2OO6A 2VQBA 1LVLA 2C7GA 1KCZA 2EQ7A 5ER0A 3K30A 1YQ3A 2GQWA 3HZLA 1KN0A 5JCLA 4J2WA 2PODA 2WDRA 2IVDA 3QSEA 3TTEA 2BS4A 1KSUA 3GD4A 2C76A 3SZWA 2HXTA 3OTRA 2R45A 3T2ZA 2YWLA 3Q4DA 3ADAB 3CT2A 3QKEA 1LJ1A 2WHDA 2BC0A 2NPXA 2NQLA 3FBSA 2XVHA 3CAWA 4EQXA 1WYGA 1D4EA 4B65A 2B9WA 2QVHA 1MNSA 4CCQA 3AE7A 2BYBA 3RCYA 1PJ5A 3SBFA 3NGCX 4GRTA 3SQSA 1EL7A 5KNLA 4Y4NA 5JCNA 2YM1A 3ICTA 3ATRA 5IPYA 1V59A 4GUVA 4IA5A 2R0PA 4GYPA 3VRDB 4H19A 1N60C 5BVAA 2V61A 3RO6A 5EBKA 3AYIA 3R25A 3S61A 3LOVA 5BOEA 3GWDA 3BNMA 4Z26A 2YM2A 3DG7A 4CBQA 3GMCA 2VRMA 2YR4A 2XFUA 4H4ZA 4I59A 1M6IA 5FJPA 1OJAA 1CJCA 3OZYA 3TWBA 3V5CA 4H2HA 1ZOVA 4EM3A 3PO7A 4K22A 4LU6A 1K0IA 4IT1A 3KPKA 2OA1A 1RYIA 3VQRA 4II2A 4FP1A 2W0HA 4IL2A 3UJFA 1B37A 2GV8A 3DK8A 2GGGA 4JY3A 4YWSA 2WP6A 4C74A 2Y6QA 1KNRA 2C3DA 3HRDC 4RSLA 3RR1A 1N61C 3CK5A 3BI5A 4A99A 2WPFA 3AXBA 2JKCA 2BRYA 2CVJA 1N4WA 1PDZA 1QJDA 1N62C 4GAPA 3JVAA 4YKFA 3P0WA 2C70A 5BUKA 1JPDX 1GRTA 2FJEA 1PN0A 5JRBA 4EMIA 1FFVC 3P3BA 1TYPA 2XFPA 2GEWA 1P43A 4II3A 5ENLA 1NENA 3UXKA 1H83A 2WU5A 1JPMA 2HQMA 2JK6A 4YSYA 4YTNA 1X2HA 1S2QA 1CC6A 2GAGB 2AL2A 4B68A 1FO4A 1GRBA 3KKJA 5IDZA 4Y4MA 3GYJA 3CNJA 3AWIA 3GYIA 2OFJA 2XH2A 2XLSA 1JDFA 4GMEA 4K2SA 4Z2RA 1EBGA 2WOVA 4ZOHB 1H2IA 1YQZA 2OLAA 3KD9A 3HW2A 1LTXR 5HHFA 1KKRA 3VFCA 4X2PA 4A9WA 3DK9A 3NVWB 4EIPA 1F6MA 2YLZA 1CC4A 4TLZA 1K0JA 2XH7A 2GQFA 1E6EA 1VRQB 4USRA 5HYMA 2ZZCA 2I5QA 3FVDA 2WETA 1DOEA 1SJAA 1T3QC 4H4RA 4TVWA 1NELA 4H4SA 4H83A 2E4GA 1XS2A 3OP2A 2XDOA 4D04A 3CIRA 4YXDA 3ALJA 5KMPA 3UOVA 1H7WA 5TR3A 3AE6A 4Z1YA 3ETRB 4IA6A 3P93A 4EQRA 1SB3B 2AKZA 3PFRA 5CQFA 3FXGA 4FDCB 4HCHA 3SFDA 3DJEA 3DH9A 2PGEA 5FS6A 2PPGA 3AM9A 3JZUA 3IC9A 3ZLGA 3UOZA 3MSYA 3GDNA 2QA1A 2P8CA 2BACA 2C64A 2VVLA 1CJ2A 1W6TA 1TDOA 2FKPA 2GH5A 4ZCWA 1IJHA 2BCPA 4NZHA 1B4VA 2XFQA 4J56A 3SJNA 2PSNA 3VRAA 1E39A 1MDLA 2PTWA 4NTCA 1F9CA 1GTHA 3AE9A 3HYXA 1JNRA 2GMHA 3ZVHA 5FJUA 4J1OA 2BK5A 1CF3A 2QQ6A 1DOBA 4K8GA 3CGEA 5BULA 3RP6A 2P0IA 3AECA 3UJ2A 3ATQA 3BHFA 3K7QX 1P48A 1D7LA 4UP3A 2V60A 1MRAA 1GT8A 1REOA 4UDRA 4EWJA 2V5ZA 4A35A 1IUWA 4KPRA 4G73A 3II4A 3JW7A 5U63A 4GISA 3G5QA 3GDPA 3MY9A 4BV6A 3R0UA 4B64A 3L8KA 5FS8A 1Y0PA 4J3ZA 4EIQA 2C66A 3NTAA 4D03A 4G8TA 2XVIA 3R10A 3CMMA 3H7VA 1FHVA 4H2NA 3TCSA 1E1MA 4BJZA 1OEPA 4C5OA 2C67A 4USQA 1R0MA 3VC5A 1PBFA 4H2QA 3ENLA 4Z2TA 1EC9A 4U8OA 2R4JA 3T2YA 4JY2A 2DW7A 1ZMDA 2GR3A 5LV9A 3SGLA 4OPTA 4REKA 1PS9A 4DSHA 3CPJG 2C75A 1NU5A 2XVJA 4DSGA 1SJDA 3U9IA 3MUCA 3KA7A 1D7YA 2Q6UA 1GOSA 2OLOA 3DJDA 3NO1A 3DK4A 2X8CA 4J36A 4AT0A 4IL0A 3B9JB 4KPLA 4IHCA 3N4EA 2XLUA 2APGA 4C77A 4BK1A 4U8PA 4G6GA 1RM6B 2XVEA 1YQ4A 4CRTA 4IZGA 3R0KA 3AEFA 1SJCA 3H70A 4DGKA 7ENLA 3QSMA 4K5RA 2V6OA 4E4FA 2O9ZA 4NWZA 1O5WA 1ZX9A 4U8JA 3AD8B 1FHUA 1WUFA 2B9YA 3DGZA 2HNEA 1OJ9A 2Q0LA 4YTPA 5CKUA 2AQJA 3UJEA 2XCGA 1D5TA 3JSKA 2A87A 2YG5A 3I3LA 3ALLA 3QFBA 4M0XA 2VOUA 2WU2A 1W4XA 5EU9A 2R0GA 3ZYXA 1S3EA 2HXUA 3KVEA 3KUMA 1EBHA 1ZOYA 4H4YA 1RVKA 4FI4A 5J04A 1ONFA 3AEEA 3DGBA 4XXGA 1FIQB 1PJ7A 1CBOA 3V3OA 4H4TA 2V3AA 4A6NA 4KWSA 3NTDA 3I6TA 2WEUA 1NHPA 2C65A 2B7RA 3ITJA 2E5AA 1DODA 2PYXA 1L9CA 3FMWA 3G5SA 3I6DA 5HXIA 3S5SA 3UCLA 3V3WA 5BOFA 1H84A 2R4EA 1GERA 4DNAA 3TOYA 3LXDA 3D46A 2VZ2A 1JEHA 4U2LA 2TPRA 3AD9B 3GD6A 3CPIG 3QSSA 4M52A 3QVRA 2PMQA 1BGNA 4GFIA 3T2KA 3WE0A 2W55A 3SQPA 1ONEA 4U8IA 1IUVA 4GYPC 1AOGA 1D4CA 3M13A 3LJPA 2WQYA 1L0VA 1NEKA 1IUTA 4CY8A 4U8MA 4HNCA 2OLNA 4AOSA 1L8PA 1BKHA 5FJRA 3BHKA 4EQWA 3SSZA 2WBAA 2PP3A 3P4RA 4J34A 4H7UA 4H2PA 2Z5YA 3QFAA 4K5SA 3GY1A 4G7FA 2R46A 2GDQA 2QCUA 3KLJA 1S2YA 2R9ZA 4WCTA 2YLRA 3AMZA 3CPHG 2WPEA 3DFHA 1MO9A 3C4NA 4A65A 4ROPA 2PU1A 2CHRA 5BRTA 2YAUA 1X2GA 3TWAA 4B69A 2RGOA 3G5RA 4Z24A 3D1CA 1Q1WA 1ZK7A 3DA1A 4FK1A 3RNMA 4RG4A 3QJ4A 1OJCA 5EOWA 2BXSA 1FOHA 1PBEA 2JB1A 2POZA 4FK1C 1BWCA 4NEVA 4CCRA 1OJDA 2GF3A 2XLPA 4K2XA 4DX3A 2X8GA 2PU0A 2QDDA 3UJRA 4IV9A 6ENLA 1Q9IA 1GXFA 1E1NA 3PG6A 3AEDA 2H88A 1PHHA 2XFOA 4CNKA 3NIXA 5C3JA 3NVVB 4EMWA 1F8SA
chains in the Genus database with same CATH topology
1GRHA 2GMHA 2UZZA 5J7XA 4J57A 5EB4A 4BURA 1K0LA 3HYVA 3NKSA 3UKQA 2XYOA 4C3XA 5U25A 1H82A 2DKIA 2BK5A 2YLXA 2BXRA 4IVOB 3O0HA 2B76A 1CF3A 4BJYA 4OCGA 1DOBA 4X9NA 1TDKA 1EL5A 3CGEA 3URHA 1GALA 5BULA 4ICYA 4NEWA 5FS9A 1L9EA 3RP6A 3REDA 4X9MA 2F5ZA 3AECA 1BF3A 3ATQA 5HY5A 4JQ9A 2TMDA 2ZBWA 4H4PA 5FS7A 3BHFA 3IF9A 3NH3X 4ZN0A 1NDAA 3BI2A 4I58A 2QAEA 1OJTA 3K7QX 1D7LA 4UP3A 2V60A 1UKVG 2YVFA 3B3RA 2YLTA 1GT8A 3LZXA 4OPCA 1REOA 3IHGA 3ZDNA 4U2TA 2VRLA 4UDRA 3NRNA 2V5ZA 4Z44A 1E1KA 1IUUA 1RSGA 4A6NB 2WOIA 2YVJA 3CGBA 4KPRA 1IUWA 1FCDA 4G73A 4YSZA 4KX6A 3II4A 1QLBA 5U63A 3RP8A 4OPGA 2ARDA 3NT6A 2AAQA 1N4VA 2QA2A 4H4QA 3FPZA 2GAHB 3G5QA 1H86A 3GDPA 5KOXA 5FMHA 1EL9A 1O94A 3RP7A 3EF6A 3UTFA 4BV6A 4H4XA 3SZFA 4B64A 2PHHA 1GRAA 3P1WA 2YG7A 3L8KA 5FS8A 1COYA 5KWFA 1GETA 1Y0PA 4GCMA 1KF6A 1GSNA 1LQTA 2Q7VA 2FJAA 4EIQA 2YG3A 4YSHA 1PBCA 1CHUA 1S7MA 2C66A 1NHSA 1ZY8A 2GR2A 1X31B 3GYXA 4J33A 4WX1A 3NNEA 4YT0A 2AR8A 2JAEA 3CGDA 3NTAA 4D03A 2WDVA 2NVKX 2WESA 2VQBA 2XVIA 1LVLA 3NK1X 4YTMA 4TLXA 2C7GA 2YLSA 2EQ7A 5ER0A 4E0VA 1F8RA 3CMMA 1Y56A 4H2NA 3VR8A 3Q6JA 3K30A 1E1MA 4JNQA 2YR5A 5IQ4A 3EPTA 2YVGA 2CFYA 1YQ3A 4B63A 2GQWA 3HZLA 4BJZA 1KN0A 5JCLA 4J2WA 4YKGA 4G9KA 3F8PA 4C5OA 2BK3A 2C67A 1EBDA 2WDRA 3QSEA 4USQA 3P9UA 2IVDA 2BS4A 1KSUA 3GD4A 2C76A 1PBFA 4PAAA 4H2QA 3SZWA 4Z2TA 4LA1A 2R45A 2J3NA 4U8OA 3T2ZA 1GEUA 2YWLA 2R4JA 3T2YA 4JY2A 3CNSA 3DGHA 4H50A 1ZMDA 2GR3A 3P4QA 3ADAB 5LV9A 2C73A 4IVMB 1LJ1A 3SGLA 3AE3A 2WHDA 1RP0A 3AE2A 4OPTA 2ACZA 4U8LA 1NAAA 4TM1A 2BC0A 2NPXA 1PBBA 4AP3A 4B67A 4XWRA 3FBSA 3FG2P 1PXAA 1PS9A 2R0CA 2WPCA 4NNJA 4REKA 3UTEA 2XVHA 4DSHA 4EQXA 1D4EA 3CPJG 2C72A 1BGJA 1DJNA 1NPXA 4Z25A 5KRQA 2C75A 1EL8A 3CNPA 4K7ZA 2XVJA 4B65A 4DSGA 5DBJA 2B9WA 4H4UA 3FIMB 2YLWA 2WP9A 2YQUA 3NK0X 2IVEA 3UP4A 2X99A 1JRYA 4H4VA 2FJDA 1E1LA 3M12A 4CCQA 3KA7A 4TM3A 1H6VA 1TRBA 3UKAA 3S5WA 3AE7A 1D7YA 4CNJA 2Q6UA 4C3YA 2BYBA 1GOSA 2OLOA 3DJDA 1LPFA 2A8XA 3CN8A 3SZ0A 2E1MA 4OPDA 2XLTA 3T37A 3AE1A 1PJ5A 5J60A 3DK4A 2X8CA 2GMJA 3NGCX 3OZ2A 4J36A 4GRTA 4AT0A 1EL7A 4LIIA 4GDPA 4Y4NA 5KNLA 5JCNA 4FX9A 2YM1A 3ICTA 1FEAA 3ATRA 4G74A 1V59A 5IPYA 2A89A 4EM4A 4GUVA 2R0PA 4IA5A 2XLUA 1XPQA 2APGA 2I0ZA 4C77A 3DJGX 4BK1A 1KDGA 1DXLA 3VRDB 4Z2UA 4U8PA 4G6GA 5BVAA 2V61A 4CY6A 4PABA 3T0KA 2XVEA 3VR9A 3ICSA 5EBKA 1QO8A 3UTHA 1YQ4A 3AYIA 4O5QA 3SX6A 4CRTA 3VRBA 5JCKA 4ZCCA 2WOWA 3S61A 3LOVA 3GWDA 3AEFA 4TM4A 4K8DA 1F3PA 4JDRA 4ADWA 4H2RA 4NTEA 4DGKA 1KFYA 2X50A 3BNMA 3QSMA 4Z26A 2YM2A 4K5RA 3AD7B 2V6OA 4A79A 1TDFA 3GWFA 3GMCA 4CBQA 4Z43A 2O9ZA 2VRMA 2YR4A 2XFUA 3K7MX 4NWZA 1O5WA 2GB0A 4ECHA 1B5QA 4H4ZA 2VQ7A 4I59A 1M6IA 1ZX9A 1DJQA 1FL2A 3SXIA 4RG3A 5KMRA 1OJAA 2VVMA 1CJCA 2Z5XA 4HA6A 2EQ9A 4U8JA 1GPEA 4EM3A 4APNA 1ZOVA 3PO7A 3AD8B 4K22A 1JOAA 1K0IA 4LU6A 5EB5A 3KPKA 2B9YA 2OA1A 3SY4A 2X3NA 1RYIA 3VQRA 3DGZA 4II2A 3GRSA 1PJ6A 1OJ9A 3AB1A 5M0ZA 1PBDA 2Q0LA 2EQ6A 2W0HA 1N1PA 3AYJA 5CKUA 3AEBA 4YTPA 1B37A 3UKFA 2AQJA 2GV8A 3DK8A 3RHAA 4JY3A 1HYUA 3GRTA 3PVCA 2WP6A 2GVCA 4C74A 1PXCA 1XHCA 2Y6QA 2XCGA 1KNRA 1D5TA 1N4UA 2C3DA 3JSKA 1M64A 2A87A 2YG5A 3AEAA 3ALLA 3I3LA 4RSLA 3BI4A 3UKKA 1TYTA 3QFBA 4GR1A 2VOUA 2WU2A 3BI5A 4A99A 5KMSA 1YY5A 2WPFA 1W4XA 3AXBA 2JKCA 3D9XA 2RGJA 2R0GA 3C4AA 1Q1RA 3ABVA 3ZYXA 2BRYA 3P4PA 1GESA 1P2HA 1S3EA 2CVJA 1N4WA 2Y6RA 3UKLA 4B1BA 3KVEA 4O5UA 5U1OA 1QJDA 1Z6LA 1ZOYA 4H4YA 2YR6A 3GSIA 2IIDA 4GAPA 1XDIA 2B7SA 5L46A 3NK2X 2ZZBA 4YKFA 4P9SA 1DOCA 2C70A 4YSXA 4XWZA 1MXTA 5BUKA 4U8NA 1ONFA 3AEEA 2FBWA 1GRTA 2FJEA 4XXGA 4Y4LA 3V3NA 1NHRA 1PJ7A 1CBOA 2GRTA 1L9DA 2BABA 3CTYA 1PN0A 4X4JA 1ZMCA 3UOXA 1SEZA 4H4TA 3V3OA 2V3AA 5JRBA 4EMIA 3UTGA 4A6NA 5KOWA 1TYPA 3NTDA 2CULA 2WEUA 2XFPA 1NHPA 2C65A 4J31A 2GEWA 3IWAA 2B7RA 4II3A 1JU2A 4YWOA 4A5LA 1E7PA 1ZDLA 3ITJA 1P2EA 1DODA 1NENA 1PXBA 2WDQA 4NTDA 1B8SA 1IUSA 1H83A 2PYXA 1L9CA 3FMWA 3DJJA 2WU5A 3G5SA 3PS9A 3LB8A 1JRZA 3I6DA 5HXIA 2HQMA 1LQUA 2JK6A 1DNCA 4YSYA 3GMBA 4YTNA 3ICRA 1S2QA 3UCLA 3NN0X 1CC6A 3R9UA 3GD3A 1O95A 2GAGB 2JBVA 2RABA 4B68A 1H84A 2R4EA 1GERA 4DNAA 3LXDA 4EMJA 1NG3A 1GRBA 2X8HA 3KKJA 3K7TA 4Y4MA 3GYJA 4N9XA 2VZ2A 1JEHA 2OALA 2RGHA 4U2LA 3UKHA 2TPRA 2E5VA 3DMEA 1ZKQA 3AD9B 3AWIA 3CNJA 3QSSA 3CPIG 3GYIA 3P4SA 4M52A 4A7AA 3AE4A 3NYFA 2C4CA 3QVRA 4EQSA 2XLSA 1NG4A 3L1RA 4UDPA 2DKHA 3SFEA 2ZZ0A 3NHOX 2JB2A 3B6DA 1ZP0A 3CNTA 1BGNA 2BK4A 1KNPA 2BS3A 3T2KA 3WE0A 4Z2RA 5KMQA 2WOVA 1H2IA 1YQZA 3SQPA 1VG9A 4OVIA 3Q9TA 3SYIA 1Y56B 3EANA 4U8IA 2BCGG 3KD9A 5KVIA 3F8DA 1IUVA 1S3BA 5KXJA 1FEBA 1AOGA 1GRGA 1D4CA 1LTXR 3M13A 3LADA 3NYCA 5GSNA 5HHFA 3L5OA 3UOYA 4G6HA 4A9WA 3DK9A 4OPIA 4B66A 3LJPA 2WQYA 2BS2A 1GREA 5IQ1A 1L0VA 1F8WA 3H4KA 1NEKA 3NYEA 4TM0A 4EIPA 1IUTA 3ALMA 1F6MA 4MJWA 4U2SA 2YLZA 4CY8A 4U8MA 1JRXA 1CC4A 1K0JA 1H7XA 2GR1A 4TLZA 4AT2A 1TDNA 3C96A 3EAOA 2OLNA 4AOSA 1GTEA 1ELIA 2GQFA 4EQWA 1E6EA 3BHKA 3H8LA 1VRQB 2H89A 2YG6A 4USRA 5HYMA 2ZZCA 3OC4A 2WBAA 3P4RA 4OPLA 4J34A 2V3BA 1K4QA 2WETA 2WS3A 2XLRA 3QVPA 1DOEA 4H7UA 3AEGA 3T14A 3SM8A 5JCMA 4H4RA 4H2PA 2Z5YA 4H4SA 3KU9A 3F8RA 2E4GA 3QFAA 5C2TA 4K5SA 1IUXA 2XDOA 4D04A 3AE5A 2R46A 2QCUA 2YG4A 3CIRA 1CC2A 3KLJA 1S2YA 2R9ZA 1PDHA 4WCTA 4BK2A 3ALJA 4YXDA 5KMPA 2YLRA 3CGCA 3UOVA 1H7WA 3UP5A 5TR3A 2XVFA 3CPHG 5KVHA 1GNDA 2WPEA 1MO9A 1MOKA 3C4NA 4A65A 1H81A 3AE6A 4IA6A 1XANA 2B9XA 5M10A 1CL0A 5BRTA 1VDCA 4HB9A 3H8IA 4EQRA 5GRTA 5CQFA 2XFNA 2YAUA 3COXA 2C3CA 2BA9A 4B69A 4FDCB 2RGOA 2CDUA 3M0OA 3SFDA 1D4DA 1KSSA 4H4WA 3DH9A 3BNUA 3DJEA 3G5RA 3LZWA 2FJBA 5FS6A 4Z24A 3T31A 1CJ3A 3D1CA 1Q1WA 4JN9A 1ZK7A 4ZCDA 1VG0A 3SZCA 3IC9A 3ISHA 3DA1A 2VVLG 3RNMA 4FK1A 1BZLA 3UOZA 3E1TA 4RG4A 3QJ4A 3NN6X 3GDNA 2EQ8A 1JNZA 1OJCA 3UKPA 3KPFA 2QA1A 5EOWA 1FECA 3HYWA 3IHMA 2BXSA 1FOHA 1VQWA 1PBEA 2BACA 2JB3A 2WP5A 2C64A 5JCIA 2JB1A 2VVLA 4BK3A 1CJ2A 1TDOA 4FK1C 1BWCA 1NHQA 2BC1A 2GH5A 4NEVA 4CCRA 3AYLA 2GR0A 1OJDA 2GF3A 2XLPA 4K2XA 1IJHA 2BCPA 4NZHA 4GAVA 4AOXA 1B4VA 1YKJA 4U8KA 1GRFA 4OPUA 4GDEA 1LV0A 2OAMA 3AE8A 3D8XA 4JNAA 4GF7A 2X8GA 3CNDA 2XFQA 2BRAA 4IV9A 1Q9IA 1GXFA 1CJ4A 4J56A 1E1NA 4UDQA 3VRAA 1E39A 3NLCA 2Q0KA 1GV4A 3PG6A 3AEDA 3V76A 2H88A 4NTCA 3NG7X 1GTHA 1PHHA 2XFOA 4CNKA 3AE9A 3HYXA 3NIXA 1TDEA 1JNRA 5C3JA 1BKWA 4EMWA 4AP1A 1F8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GRH A;  2GMH A;  2UZZ A;  5J7X A;  4J57 A;  5EB4 A;  4BUR A;  1K0L A;  3NKS A;  3UKQ A;  2XYO A;  4C3X A;  5U25 A;  1H82 A;  2DKI A;  2BK5 A;  2YLX A;  2BXR A;  4IVO B;  3O0H A;  2B76 A;  1CF3 A;  4BJY A;  4OCG A;  1DOB A;  4X9N A;  1TDK A;  1EL5 A;  3CGE A;  3URH A;  1GAL A;  5BUL A;  4ICY A;  4NEW A;  5FS9 A;  1L9E A;  3RP6 A;  3RED A;  4X9M A;  2F5Z A;  3AEC A;  1BF3 A;  3ATQ A;  5HY5 A;  4JQ9 A;  2TMD A;  2ZBW A;  4H4P A;  5FS7 A;  3BHF A;  3IF9 A;  3NH3 X;  4ZN0 A;  1NDA A;  3BI2 A;  4I58 A;  2QAE A;  1OJT A;  3K7Q X;  1D7L A;  4UP3 A;  2V60 A;  1UKV G;  2YVF A;  3B3R A;  2YLT A;  1GT8 A;  3LZX A;  4OPC A;  1REO A;  3IHG A;  3ZDN A;  4U2T A;  2VRL A;  4UDR A;  3NRN A;  2V5Z A;  4Z44 A;  1E1K A;  1IUU A;  1RSG A;  4A6N B;  2WOI A;  2YVJ A;  3CGB A;  4KPR A;  1IUW A;  1FCD A;  4YSZ A;  4KX6 A;  3II4 A;  1QLB A;  5U63 A;  3RP8 A;  4OPG A;  2ARD A;  3NT6 A;  2AAQ A;  1N4V A;  2QA2 A;  4H4Q A;  3FPZ A;  2GAH B;  3G5Q A;  1H86 A;  3GDP A;  5KOX A;  5FMH A;  1EL9 A;  1O94 A;  3RP7 A;  3EF6 A;  3UTF A;  4BV6 A;  4H4X A;  4B64 A;  2PHH A;  1GRA A;  3P1W A;  2YG7 A;  3L8K A;  5FS8 A;  1COY A;  5KWF A;  1GET A;  1Y0P A;  4GCM A;  1KF6 A;  1GSN A;  1LQT A;  2Q7V A;  2FJA A;  4EIQ A;  2YG3 A;  4YSH A;  1PBC A;  1CHU A;  2C66 A;  1NHS A;  1ZY8 A;  2GR2 A;  1X31 B;  4J33 A;  4WX1 A;  3NNE A;  4YT0 A;  2AR8 A;  2JAE A;  3CGD A;  3NTA A;  4D03 A;  2WDV A;  2NVK X;  2WES A;  2VQB A;  2XVI A;  1LVL A;  3NK1 X;  4YTM A;  4TLX A;  2C7G A;  2YLS A;  2EQ7 A;  5ER0 A;  4E0V A;  1F8R A;  1Y56 A;  4H2N A;  3VR8 A;  3Q6J A;  3K30 A;  1E1M A;  4JNQ A;  2YR5 A;  5IQ4 A;  3EPT A;  2YVG A;  2CFY A;  1YQ3 A;  4B63 A;  2GQW A;  3HZL A;  4BJZ A;  5JCL A;  4J2W A;  4YKG A;  4C5O A;  3F8P A;  2BK3 A;  2C67 A;  1EBD A;  2WDR A;  3QSE A;  4USQ A;  3P9U A;  2IVD A;  2BS4 A;  1KSU A;  3GD4 A;  2C76 A;  1PBF A;  4PAA A;  4H2Q A;  4Z2T A;  4LA1 A;  2R45 A;  2J3N A;  4U8O A;  1GEU A;  2YWL A;  2R4J A;  4JY2 A;  3CNS A;  3DGH A;  4H50 A;  1ZMD A;  2GR3 A;  3P4Q A;  3ADA B;  5LV9 A;  2C73 A;  4IVM B;  1LJ1 A;  3SGL A;  3AE3 A;  2WHD A;  1RP0 A;  3AE2 A;  4OPT A;  2ACZ A;  4U8L A;  1NAA A;  4TM1 A;  2BC0 A;  2NPX A;  1PBB A;  4AP3 A;  4B67 A;  4XWR A;  3FBS A;  3FG2 P;  1PXA A;  1PS9 A;  2R0C A;  2WPC A;  4REK A;  3UTE A;  4DSH A;  2XVH A;  4EQX A;  1D4E A;  3CPJ G;  2C72 A;  1BGJ A;  1DJN A;  1NPX A;  4Z25 A;  5KRQ A;  2C75 A;  1EL8 A;  3CNP A;  4K7Z A;  2XVJ A;  4B65 A;  4DSG A;  5DBJ A;  2B9W A;  4H4U A;  3FIM B;  2YLW A;  2WP9 A;  2YQU A;  3NK0 X;  2IVE A;  3UP4 A;  2X99 A;  1JRY A;  4H4V A;  2FJD A;  1E1L A;  3M12 A;  4CCQ A;  3KA7 A;  4TM3 A;  1H6V A;  1TRB A;  3UKA A;  3S5W A;  3AE7 A;  1D7Y A;  4CNJ A;  2Q6U A;  4C3Y A;  2BYB A;  1GOS A;  2OLO A;  3DJD A;  1LPF A;  2A8X A;  3CN8 A;  2E1M A;  4OPD A;  2XLT A;  3T37 A;  3AE1 A;  1PJ5 A;  5J60 A;  3DK4 A;  2X8C A;  2GMJ A;  3NGC X;  3OZ2 A;  4J36 A;  4GRT A;  4AT0 A;  1EL7 A;  4LII A;  4GDP A;  4Y4N A;  5JCN A;  4FX9 A;  2YM1 A;  3ICT A;  1FEA A;  3ATR A;  5IPY A;  1V59 A;  2A89 A;  4EM4 A;  4GUV A;  2R0P A;  4IA5 A;  2XLU A;  1XPQ A;  2APG A;  2I0Z A;  4C77 A;  3DJG X;  4BK1 A;  1KDG A;  1DXL A;  3VRD B;  4Z2U A;  4U8P A;  5BVA A;  2V61 A;  4CY6 A;  4PAB A;  2XVE A;  3VR9 A;  3ICS A;  5EBK A;  1QO8 A;  3UTH A;  1YQ4 A;  3AYI A;  4O5Q A;  4CRT A;  3VRB A;  5JCK A;  4ZCC A;  2WOW A;  3S61 A;  3LOV A;  3GWD A;  3AEF A;  4TM4 A;  4K8D A;  1F3P A;  4JDR A;  4ADW A;  4H2R A;  4NTE A;  4DGK A;  1KFY A;  2X50 A;  3BNM A;  3QSM A;  4Z26 A;  2YM2 A;  4K5R A;  3AD7 B;  2V6O A;  4A79 A;  1TDF A;  3GWF A;  3GMC A;  4CBQ A;  4Z43 A;  2O9Z A;  2VRM A;  2YR4 A;  2XFU A;  3K7M X;  1O5W A;  2GB0 A;  4ECH A;  1B5Q A;  4H4Z A;  2VQ7 A;  4I59 A;  1M6I A;  1ZX9 A;  1DJQ A;  1FL2 A;  4RG3 A;  1OJA A;  2VVM A;  1CJC A;  2Z5X A;  4HA6 A;  2EQ9 A;  4U8J A;  1GPE A;  4EM3 A;  4APN A;  1ZOV A;  3PO7 A;  3AD8 B;  4K22 A;  1JOA A;  1K0I A;  4LU6 A;  5EB5 A;  2B9Y A;  2OA1 A;  2X3N A;  1RYI A;  3VQR A;  3DGZ A;  3GRS A;  1PJ6 A;  1OJ9 A;  3AB1 A;  5M0Z A;  1PBD A;  2Q0L A;  2EQ6 A;  2W0H A;  1N1P A;  3AYJ A;  5CKU A;  3AEB A;  4YTP A;  1B37 A;  3UKF A;  2AQJ A;  2GV8 A;  3DK8 A;  3RHA A;  4JY3 A;  1HYU A;  3GRT A;  3PVC A;  2WP6 A;  2GVC A;  4C74 A;  1PXC A;  1XHC A;  2Y6Q A;  2XCG A;  1KNR A;  1D5T A;  1N4U A;  2C3D A;  3JSK A;  1M64 A;  2A87 A;  2YG5 A;  3AEA A;  3ALL A;  3I3L A;  4RSL A;  3BI4 A;  3UKK A;  1TYT A;  3QFB A;  4GR1 A;  2VOU A;  2WU2 A;  3BI5 A;  4A99 A;  1YY5 A;  2WPF A;  1W4X A;  3AXB A;  2JKC A;  2RGJ A;  2R0G A;  3C4A A;  1Q1R A;  3ABV A;  3ZYX A;  3P4P A;  1GES A;  1P2H A;  1S3E A;  2CVJ A;  1N4W A;  2Y6R A;  3UKL A;  4B1B A;  3KVE A;  4O5U A;  5U1O A;  1QJD A;  1Z6L A;  1ZOY A;  4H4Y A;  2YR6 A;  3GSI A;  2IID A;  1XDI A;  2B7S A;  5L46 A;  3NK2 X;  2ZZB A;  4YKF A;  4P9S A;  1DOC A;  2C70 A;  4YSX A;  4XWZ A;  1MXT A;  5BUK A;  4U8N A;  1ONF A;  3AEE A;  2FBW A;  1GRT A;  2FJE A;  4XXG A;  4Y4L A;  3V3N A;  1NHR A;  1PJ7 A;  1CBO A;  2GRT A;  1L9D A;  2BAB A;  3CTY A;  1PN0 A;  4X4J A;  1ZMC A;  3UOX A;  1SEZ A;  4H4T A;  3V3O A;  2V3A A;  3UTG A;  4EMI A;  4A6N A;  5KOW A;  1TYP A;  3NTD A;  2CUL A;  2WEU A;  2XFP A;  1NHP A;  2C65 A;  4J31 A;  2GEW A;  3IWA A;  2B7R A;  1JU2 A;  4YWO A;  4A5L A;  1E7P A;  1ZDL A;  3ITJ A;  1P2E A;  1DOD A;  1NEN A;  1PXB A;  2WDQ A;  4NTD A;  1B8S A;  1IUS A;  1H83 A;  2PYX A;  1L9C A;  3FMW A;  3DJJ A;  2WU5 A;  3G5S A;  3PS9 A;  3LB8 A;  1JRZ A;  3I6D A;  5HXI A;  2HQM A;  1LQU A;  2JK6 A;  1DNC A;  4YSY A;  3GMB A;  4YTN A;  3ICR A;  1S2Q A;  3UCL A;  3NN0 X;  1CC6 A;  3R9U A;  3GD3 A;  1O95 A;  2GAG B;  2JBV A;  2RAB A;  4B68 A;  1H84 A;  2R4E A;  1GER A;  4DNA A;  3LXD A;  4EMJ A;  1NG3 A;  1GRB A;  2X8H A;  3KKJ A;  3K7T A;  4Y4M A;  3GYJ A;  4N9X A;  2VZ2 A;  1JEH A;  2OAL A;  2RGH A;  4U2L A;  3UKH A;  2TPR A;  2E5V A;  3DME A;  1ZKQ A;  3AD9 B;  3AWI A;  3CNJ A;  3QSS A;  3CPI G;  3GYI A;  3P4S A;  4M52 A;  4A7A A;  3AE4 A;  3NYF A;  3QVR A;  4EQS A;  2XLS A;  1NG4 A;  3L1R A;  4UDP A;  2DKH A;  3SFE A;  2ZZ0 A;  3NHO X;  2JB2 A;  3B6D A;  1ZP0 A;  3CNT A;  1BGN A;  2BK4 A;  1KNP A;  2BS3 A;  3WE0 A;  4Z2R A;  2WOV A;  1YQZ A;  3SQP A;  1VG9 A;  4OVI A;  3Q9T A;  1Y56 B;  3EAN A;  4U8I A;  2BCG G;  3KD9 A;  5KVI A;  3F8D A;  1IUV A;  1S3B A;  5KXJ A;  1FEB A;  1AOG A;  1GRG A;  1D4C A;  1LTX R;  3M13 A;  3LAD A;  3NYC A;  5GSN A;  5HHF A;  3UOY A;  4A9W A;  3DK9 A;  4OPI A;  4B66 A;  3LJP A;  2WQY A;  2BS2 A;  1GRE A;  5IQ1 A;  1L0V A;  1F8W A;  3H4K A;  1NEK A;  3NYE A;  4TM0 A;  4EIP A;  1IUT A;  3ALM A;  1F6M A;  4MJW A;  4U2S A;  2YLZ A;  4CY8 A;  4U8M A;  1JRX A;  1CC4 A;  1K0J A;  1H7X A;  2GR1 A;  4TLZ A;  4AT2 A;  1TDN A;  3C96 A;  3EAO A;  2OLN A;  4AOS A;  1GTE A;  1ELI A;  2GQF A;  4EQW A;  1E6E A;  3BHK A;  3H8L A;  1VRQ B;  2H89 A;  2YG6 A;  4USR A;  5HYM A;  2ZZC A;  3OC4 A;  2WBA A;  3P4R A;  4OPL A;  4J34 A;  2V3B A;  1K4Q A;  2WET A;  2WS3 A;  2XLR A;  3QVP A;  1DOE A;  4H7U A;  3AEG A;  3SM8 A;  5JCM A;  4H4R A;  4H2P A;  2Z5Y A;  4H4S A;  3KU9 A;  3F8R A;  2E4G A;  3QFA A;  5C2T A;  4K5S A;  1IUX A;  2XDO A;  4D04 A;  3AE5 A;  2R46 A;  2QCU A;  2YG4 A;  3CIR A;  1CC2 A;  3KLJ A;  1S2Y A;  2R9Z A;  1PDH A;  4WCT A;  4BK2 A;  3ALJ A;  4YXD A;  2YLR A;  3CGC A;  3UOV A;  1H7W A;  3UP5 A;  5TR3 A;  2XVF A;  3CPH G;  5KVH A;  1GND A;  2WPE A;  1MO9 A;  1MOK A;  3C4N A;  4A65 A;  1H81 A;  3AE6 A;  4IA6 A;  1XAN A;  2B9X A;  5M10 A;  1CL0 A;  5BRT A;  1VDC A;  4HB9 A;  3H8I A;  4EQR A;  5GRT A;  5CQF A;  2XFN A;  2YAU A;  3COX A;  2C3C A;  2BA9 A;  4B69 A;  4FDC B;  2RGO A;  2CDU A;  3M0O A;  3SFD A;  1D4D A;  1KSS A;  4H4W A;  3DH9 A;  3BNU A;  3DJE A;  3G5R A;  3LZW A;  2FJB A;  5FS6 A;  4Z24 A;  1CJ3 A;  3D1C A;  1Q1W A;  4JN9 A;  1ZK7 A;  4ZCD A;  1VG0 A;  3IC9 A;  3ISH A;  3DA1 A;  2VVL G;  3RNM A;  4FK1 A;  1BZL A;  3UOZ A;  3E1T A;  4RG4 A;  3QJ4 A;  3NN6 X;  3GDN A;  2EQ8 A;  1JNZ A;  1OJC A;  3UKP A;  3KPF A;  2QA1 A;  5EOW A;  1FEC A;  3IHM A;  2BXS A;  1FOH A;  1VQW A;  1PBE A;  2BAC A;  2JB3 A;  2WP5 A;  2C64 A;  5JCI A;  2JB1 A;  2VVL A;  4BK3 A;  1CJ2 A;  1TDO A;  4FK1 C;  1BWC A;  1NHQ A;  2BC1 A;  2GH5 A;  4NEV A;  4CCR A;  3AYL A;  2GR0 A;  1OJD A;  2GF3 A;  2XLP A;  4K2X A;  1IJH A;  2BCP A;  4NZH A;  4AOX A;  1B4V A;  1YKJ A;  4U8K A;  1GRF A;  4OPU A;  4GDE A;  1LV0 A;  2OAM A;  3AE8 A;  3D8X A;  4JNA A;  4GF7 A;  2X8G A;  3CND A;  2XFQ A;  4IV9 A;  4UDQ A;  1Q9I A;  1GXF A;  1CJ4 A;  4J56 A;  1E1N A;  3VRA A;  1E39 A;  3NLC A;  2Q0K A;  1GV4 A;  3AED A;  3V76 A;  2H88 A;  4NTC A;  3NG7 X;  1GTH A;  1PHH A;  2XFO A;  4CNK A;  3AE9 A;  3NIX A;  1TDE A;  1JNR A;  5C3J A;  1BKW A;  4EMW A;  4AP1 A;  1F8S A; 
#chains in the Genus database with same CATH topology
 4BUR A;  3HYV A;  4F4R A;  5FJO A;  1H82 A;  2YLX A;  4IVO B;  3O0H A;  1MDR A;  2QDE A;  3IK4 A;  1TDK A;  1EL5 A;  3URH A;  1GAL A;  4ICY A;  4JN8 A;  2XGZ A;  2F5Z A;  2HZG A;  4JQ9 A;  3MKC A;  5FS7 A;  3NH3 X;  1NDA A;  4I58 A;  2QAE A;  2P8B A;  2YVF A;  2YLT A;  3LZX A;  4OPC A;  1STZ A;  3IHG A;  3T6C A;  2VRL A;  3THU A;  1E1K A;  1IUU A;  2W3R A;  4A6N B;  2YVJ A;  1FCD A;  2PA6 A;  3T4W A;  1TE6 A;  3RP8 A;  1N4V A;  2QA2 A;  4HCD A;  1O94 A;  3RP7 A;  3EF6 A;  4H4X A;  3P1W A;  1GRA A;  2YG7 A;  1JCT A;  1GSN A;  2FJA A;  4YSH A;  1S7M A;  4IP4 A;  3UCD A;  3GYX A;  3CGD A;  2WDV A;  4YTM A;  3IJL A;  3NZG A;  3VC6 A;  1F8R A;  1Y56 A;  3VR8 A;  2YR5 A;  3EPT A;  2YVG A;  2PTX A;  4G9K A;  1EBD A;  2P88 A;  4LA1 A;  1GEU A;  3DGH A;  3P4Q A;  4IVM B;  2XH4 A;  3AE3 A;  3AE2 A;  3I4K A;  1VQZ A;  1NAA A;  4B67 A;  1PBB A;  3FG2 P;  1PXA A;  2R0C A;  3UTE A;  2WPC A;  4MMW A;  3VA8 A;  2C72 A;  1DJN A;  4Z25 A;  3CNP A;  1EL8 A;  4K7Z A;  1TKK A;  5DBJ A;  3CYJ A;  3UP4 A;  1JRY A;  2FJD A;  1E1L A;  3M12 A;  3S5W A;  3MWC A;  3S47 A;  3SZ0 A;  1LPF A;  2A8X A;  2QJM A;  1KD0 A;  3EUB 3;  2XLT A;  3T8Q A;  2E3T A;  3DER A;  3VCC A;  3OZ2 A;  4JN7 A;  4GDP A;  1FEA A;  2QGY A;  4G74 A;  2A89 A;  1XPQ A;  2I0Z A;  1KDG A;  1TZZ A;  4Z2U A;  4PAB A;  1QO8 A;  3VRB A;  4ZCC A;  1N63 C;  1MUC A;  2PTZ A;  4TM4 A;  4K8D A;  1F3P A;  4ADW A;  4H2R A;  4NTE A;  3AN1 A;  3VDG A;  4GGH A;  4A79 A;  1TDF A;  3Q45 A;  2OX4 A;  2GB0 A;  4ECH A;  2VQ7 A;  2EQ9 A;  3EKG A;  1GPE A;  4APN A;  2RDX A;  1V97 A;  3NXL A;  1JOA A;  5EB5 A;  3SY4 A;  4TVY A;  2AL2 B;  3AB1 A;  1PBD A;  2EQ6 A;  3PWI A;  3HPF A;  3AYJ A;  3RHA A;  3IJQ A;  3GRT A;  1JRP A;  1N5X A;  2GVC A;  2GSH A;  3AEA A;  1TYT A;  5KMS A;  1YY5 A;  4DN1 A;  2RGJ A;  1Q1R A;  3P4P A;  4M6U A;  1P2H A;  4B1B A;  4O5U A;  5U1O A;  1Z6L A;  3GSI A;  5L46 A;  3NK2 X;  2ZZB A;  1DOC A;  3ES7 A;  1MXT A;  4U8N A;  2AL1 A;  3V3N A;  1NHR A;  4GGB A;  1L9D A;  2BAB A;  3CTY A;  3UOX A;  1ZMC A;  1IYX A;  3UTG A;  3NFU A;  5KOW A;  1E9I A;  3IWA A;  1JU2 A;  4YWO A;  1E7P A;  1ZDL A;  2P3Z A;  1P2E A;  1PXB A;  3FCP A;  2WDQ A;  1IUS A;  3PS9 A;  3GMB A;  3B97 A;  2GL5 A;  3ICR A;  3NN0 X;  3SN1 A;  2RAB A;  2W3S A;  2OPJ A;  2DW6 A;  3MZN A;  4DYE A;  3K7T A;  4N9X A;  2OAL A;  2RGH A;  3CXO A;  2E5V A;  3DME A;  1ECQ A;  3AE4 A;  2ZAD A;  3ZVI A;  3TJI A;  4UDP A;  2DKH A;  2ZZ0 A;  3NHO X;  2JB2 A;  1ZP0 A;  3CNT A;  2BS3 A;  1KNP A;  1WUE A;  1Y56 B;  3F8D A;  4MGG A;  1GRG A;  3LAD A;  3NYC A;  3L5O A;  3UOY A;  4G6H A;  4HCL A;  5IQ1 A;  2BS2 A;  1F8W A;  3N6J A;  3NYE A;  4U2S A;  1H7X A;  1TDN A;  3C96 A;  1GTE A;  3H8L A;  3VCN A;  3OC4 A;  2WS3 A;  1K4Q A;  1EC8 A;  4A6G A;  3T14 A;  1R6W A;  4ENL A;  3SM8 A;  5C2T A;  2GGE A;  3AE5 A;  4ZA0 A;  1CC2 A;  1PDH A;  4BK2 A;  3ZVH B;  3UP5 A;  2XVF A;  1H81 A;  2B9X A;  5M10 A;  3DEQ A;  1CL0 A;  3T9P A;  3MQT A;  5GRT A;  2XFN A;  3COX A;  2C3C A;  2BA9 A;  2O56 A;  3M0O A;  4H4W A;  3BNU A;  3LZW A;  2FJB A;  1CJ3 A;  4JN9 A;  4MKS A;  4ZCD A;  1VG0 A;  3ISH A;  2VVL G;  1BZL A;  3NN6 X;  3QTP A;  3UKP A;  1FEC A;  2JB3 A;  2WP5 A;  5JCI A;  4BK3 A;  1FFU C;  1NHQ A;  3TW9 A;  3AYL A;  2GR0 A;  4GAV A;  4AOX A;  3NRZ B;  2ONE A;  4U8K A;  4GF7 A;  3CND A;  1CJ4 A;  1GV4 A;  3V76 A;  2OG9 A;  3D47 A;  1TDE A;  1BKW A;  3FYY A;  1K0L A;  3NKS A;  3UKQ A;  5U25 A;  2DKI A;  2B76 A;  4BJY A;  2AKM A;  2GGH A;  2PP0 A;  4NEW A;  3BSM A;  1L9E A;  3RED A;  4E8G A;  4X9M A;  1SJB A;  5HY5 A;  2MNR A;  3IF9 A;  4ZN0 A;  4H4P A;  2OVL A;  1OJT A;  3N4F A;  3B3R A;  3QLD A;  3BJS A;  3ZDN A;  4U2T A;  4DWD A;  3NS1 B;  3NRN A;  4HNL A;  4Z44 A;  1RSG A;  3CGB A;  4YSZ A;  2OZT A;  1QLB A;  4OPG A;  4E5T A;  2AAQ A;  2OZ3 A;  2GGI A;  4H4Q A;  3FPZ A;  1H86 A;  3UTF A;  3DIP A;  3PWG A;  1ZXI C;  3DES A;  3A7A A;  1COY A;  4GCM A;  3ZLH A;  2YG3 A;  1NHS A;  1ZY8 A;  2GR2 A;  1X31 B;  4J33 A;  4WX1 A;  3NNE A;  2JAE A;  3CB3 A;  2WES A;  3NK1 X;  4TLX A;  2YLS A;  4E0V A;  4A3R A;  3A7U A;  3Q6J A;  4JNQ A;  5IQ4 A;  3UXL A;  2CFY A;  4B63 A;  4YKG A;  3NVY B;  3F8P A;  2BK3 A;  3P9U A;  4PAA A;  2J3N A;  3CNS A;  4H50 A;  2FYM A;  2C73 A;  3V4B A;  2OQH A;  1RP0 A;  2ACZ A;  4U8L A;  1VDV A;  4TM1 A;  4AP3 A;  4XWR A;  4Z17 A;  4NNJ A;  1DTN A;  1BGJ A;  1NPX A;  5KRQ A;  3N6H A;  4H4U A;  3FIM B;  2YLW A;  2WP9 A;  2YQU A;  3NK0 X;  2IVE A;  2X99 A;  4H4V A;  4TM3 A;  1H6V A;  1TRB A;  3UKA A;  3UGV A;  4CNJ A;  4C3Y A;  3CN8 A;  1XPY A;  2E1M A;  4OPD A;  4E4U A;  3T37 A;  3AE1 A;  5J60 A;  3UJS A;  2GMJ A;  2GGJ A;  2XSX A;  4LII A;  3ZLF A;  4FX9 A;  1BQG A;  4EM4 A;  3DJG X;  1YEY A;  1DXL A;  4CY6 A;  3T0K A;  3VR9 A;  3ICS A;  3UTH A;  4O5Q A;  3SX6 A;  5JCK A;  2WOW A;  4GIR A;  3RRA A;  2MUC A;  4JDR A;  1KFY A;  2X50 A;  3AD7 B;  4Z43 A;  3GWF A;  1ELS A;  3K7M X;  1B5Q A;  1DJQ A;  1FL2 A;  4RG3 A;  5KMR A;  2VVM A;  4HA6 A;  2Z5X A;  2PP1 A;  2X3N A;  3GRS A;  1PJ6 A;  5M0Z A;  3UCC A;  1N1P A;  3AEB A;  3UKF A;  3OW1 A;  1HYU A;  3PVC A;  1PXC A;  1XHC A;  1N4U A;  1M64 A;  3BI4 A;  3UKK A;  4GR1 A;  3D9X A;  4HYR A;  3C4A A;  3ABV A;  1GES A;  2Y6R A;  3UKL A;  3RIT A;  2YR6 A;  2IID A;  1XDI A;  2B7S A;  4P9S A;  2QJN A;  4YSX A;  4XWZ A;  2OZ8 A;  1JRO A;  1EC7 A;  2FBW A;  4Y4L A;  2GRT A;  3U4F A;  4X4J A;  3PK7 A;  1SEZ A;  3H8A A;  2CUL A;  4J31 A;  3H12 A;  3GO2 A;  4A5L A;  4NTD A;  1B8S A;  3DJJ A;  3LB8 A;  1JRZ A;  1LQU A;  3STP A;  1DNC A;  2OQY A;  3GC2 A;  3R9U A;  3GD3 A;  1O95 A;  2JBV A;  4EMJ A;  1NG3 A;  2X8H A;  3UKH A;  1ZKQ A;  3P4S A;  3SN4 A;  4A7A A;  3NYF A;  2C4C A;  2PCE A;  4EQS A;  1NG4 A;  3L1R A;  3EEZ A;  2QJJ A;  3SFE A;  3B6D A;  3TJ4 A;  2BK4 A;  5KMQ A;  3QN3 A;  1VG9 A;  4OVI A;  3Q9T A;  3SYI A;  3EAN A;  2BCG G;  4HPN A;  5KVI A;  3OZM A;  3IJI A;  4JHM A;  1S3B A;  4E6M A;  5KXJ A;  1FEB A;  5GSN A;  4OPI A;  3R1Z A;  2PS2 A;  4B66 A;  1GRE A;  3H4K A;  4TM0 A;  3ALM A;  3SR6 B;  4MJW A;  1JRX A;  2GR1 A;  3R07 C;  4AT2 A;  3DDM A;  3OPS A;  3ES8 A;  3EAO A;  3R11 A;  1ELI A;  2H89 A;  2YG6 A;  4IP5 A;  4OPL A;  2V3B A;  2XLR A;  3QVP A;  1KKO A;  3FJ4 A;  3AEG A;  5JCM A;  3TQP A;  3K1G A;  4DXK A;  3KU9 A;  3F8R A;  1IUX A;  5G5G B;  3NVZ B;  2YG4 A;  3CGC A;  5KVH A;  1GND A;  1MOK A;  4H1Z A;  1XAN A;  1VDC A;  4HB9 A;  3H8I A;  4KT2 A;  2PTY A;  2ZC8 A;  5G5H B;  2CDU A;  1D4D A;  1KSS A;  2XH0 A;  3SXI A;  3T31 A;  3SZC A;  3E1T A;  2EQ8 A;  1JNZ A;  3KPF A;  1PDY A;  3HYW A;  3IHM A;  3DG3 A;  1VQW A;  3FV9 A;  5FJT A;  2BC1 A;  3RGT A;  3QPE A;  1YKJ A;  1GRF A;  4OPU A;  4GDE A;  4KEM A;  1LV0 A;  2OAM A;  3AE8 A;  3D8X A;  3V5F A;  4JNA A;  2BRA A;  3CXB A;  4UDQ A;  3NLC A;  2Q0K A;  2PGW A;  3NG7 X;  4AP1 A;  1GRH A;  5J7X A;  2UZZ A;  4J57 A;  5EB4 A;  2XYO A;  3DFY A;  4C3X A;  2BXR A;  4OCG A;  4X9N A;  3A7R A;  4K1W A;  5FS9 A;  1BF3 A;  1N5W C;  2TMD A;  2ZBW A;  3BI2 A;  4HN8 A;  1UKV G;  2W54 A;  3DG6 A;  2WOI A;  3I6E A;  4KX6 A;  2ARD A;  3NT6 A;  2OKT A;  2GAH B;  5KOX A;  5FMH A;  3SN0 A;  1EL9 A;  3SZF A;  2PHH A;  5KWF A;  1GET A;  1KF6 A;  1LQT A;  2Q7V A;  1PBC A;  1CHU A;  4DHG A;  4YT0 A;  2AR8 A;  3BOX A;  2NVK X;  2OO6 A;  2VQB A;  1LVL A;  2C7G A;  1KCZ A;  2EQ7 A;  5ER0 A;  3K30 A;  1YQ3 A;  2GQW A;  3HZL A;  1KN0 A;  5JCL A;  4J2W A;  2POD A;  2WDR A;  2IVD A;  3QSE A;  3TTE A;  2BS4 A;  1KSU A;  3GD4 A;  2C76 A;  3SZW A;  2HXT A;  3OTR A;  2R45 A;  3T2Z A;  2YWL A;  3Q4D A;  3ADA B;  3CT2 A;  3QKE A;  1LJ1 A;  2WHD A;  2BC0 A;  2NPX A;  2NQL A;  3FBS A;  2XVH A;  3CAW A;  4EQX A;  1WYG A;  1D4E A;  4B65 A;  2B9W A;  2QVH A;  1MNS A;  4CCQ A;  3AE7 A;  2BYB A;  3RCY A;  1PJ5 A;  3SBF A;  3NGC X;  4GRT A;  3SQS A;  1EL7 A;  5KNL A;  4Y4N A;  5JCN A;  2YM1 A;  3ICT A;  3ATR A;  5IPY A;  1V59 A;  4GUV A;  4IA5 A;  2R0P A;  4GYP A;  3VRD B;  4H19 A;  1N60 C;  5BVA A;  2V61 A;  3RO6 A;  5EBK A;  3AYI A;  3R25 A;  3S61 A;  3LOV A;  5BOE A;  3GWD A;  3BNM A;  4Z26 A;  2YM2 A;  3DG7 A;  4CBQ A;  3GMC A;  2VRM A;  2YR4 A;  2XFU A;  4H4Z A;  4I59 A;  1M6I A;  5FJP A;  1OJA A;  1CJC A;  3OZY A;  3TWB A;  3V5C A;  4H2H A;  1ZOV A;  4EM3 A;  3PO7 A;  4K22 A;  4LU6 A;  1K0I A;  4IT1 A;  3KPK A;  2OA1 A;  1RYI A;  3VQR A;  4II2 A;  4FP1 A;  2W0H A;  4IL2 A;  3UJF A;  1B37 A;  2GV8 A;  3DK8 A;  2GGG A;  4JY3 A;  4YWS A;  2WP6 A;  4C74 A;  2Y6Q A;  1KNR A;  2C3D A;  3HRD C;  4RSL A;  3RR1 A;  1N61 C;  3CK5 A;  3BI5 A;  4A99 A;  2WPF A;  3AXB A;  2JKC A;  2BRY A;  2CVJ A;  1N4W A;  1PDZ A;  1QJD A;  1N62 C;  4GAP A;  3JVA A;  4YKF A;  3P0W A;  2C70 A;  5BUK A;  1JPD X;  1GRT A;  2FJE A;  1PN0 A;  5JRB A;  4EMI A;  1FFV C;  3P3B A;  1TYP A;  2XFP A;  2GEW A;  1P43 A;  4II3 A;  5ENL A;  1NEN A;  3UXK A;  1H83 A;  2WU5 A;  1JPM A;  2HQM A;  2JK6 A;  4YSY A;  4YTN A;  1X2H A;  1S2Q A;  1CC6 A;  2GAG B;  2AL2 A;  4B68 A;  1FO4 A;  1GRB A;  3KKJ A;  5IDZ A;  4Y4M A;  3GYJ A;  3CNJ A;  3AWI A;  3GYI A;  2OFJ A;  2XH2 A;  2XLS A;  1JDF A;  4GME A;  4K2S A;  4Z2R A;  1EBG A;  2WOV A;  4ZOH B;  1H2I A;  1YQZ A;  2OLA A;  3KD9 A;  3HW2 A;  1LTX R;  5HHF A;  1KKR A;  3VFC A;  4X2P A;  4A9W A;  3DK9 A;  3NVW B;  4EIP A;  1F6M A;  2YLZ A;  1CC4 A;  4TLZ A;  1K0J A;  2XH7 A;  2GQF A;  1E6E A;  1VRQ B;  4USR A;  5HYM A;  2ZZC A;  2I5Q A;  3FVD A;  2WET A;  1DOE A;  1SJA A;  1T3Q C;  4H4R A;  4TVW A;  1NEL A;  4H4S A;  4H83 A;  2E4G A;  1XS2 A;  3OP2 A;  2XDO A;  4D04 A;  3CIR A;  4YXD A;  3ALJ A;  5KMP A;  3UOV A;  1H7W A;  5TR3 A;  3AE6 A;  4Z1Y A;  3ETR B;  4IA6 A;  3P93 A;  4EQR A;  1SB3 B;  2AKZ A;  3PFR A;  5CQF A;  3FXG A;  4FDC B;  4HCH A;  3SFD A;  3DJE A;  3DH9 A;  2PGE A;  5FS6 A;  2PPG A;  3AM9 A;  3JZU A;  3IC9 A;  3ZLG A;  3UOZ A;  3MSY A;  3GDN A;  2QA1 A;  2P8C A;  2BAC A;  2C64 A;  2VVL A;  1CJ2 A;  1W6T A;  1TDO A;  2FKP A;  2GH5 A;  4ZCW A;  1IJH A;  2BCP A;  4NZH A;  1B4V A;  2XFQ A;  4J56 A;  3SJN A;  2PSN A;  3VRA A;  1E39 A;  1MDL A;  2PTW A;  4NTC A;  1F9C A;  1GTH A;  3AE9 A;  3HYX A;  1JNR A;  2GMH A;  3ZVH A;  5FJU A;  4J1O A;  2BK5 A;  1CF3 A;  2QQ6 A;  1DOB A;  4K8G A;  3CGE A;  5BUL A;  3RP6 A;  2P0I A;  3AEC A;  3UJ2 A;  3ATQ A;  3BHF A;  3K7Q X;  1P48 A;  1D7L A;  4UP3 A;  2V60 A;  1MRA A;  1GT8 A;  1REO A;  4UDR A;  4EWJ A;  2V5Z A;  4A35 A;  1IUW A;  4KPR A;  4G73 A;  3II4 A;  3JW7 A;  5U63 A;  4GIS A;  3G5Q A;  3GDP A;  3MY9 A;  4BV6 A;  3R0U A;  4B64 A;  3L8K A;  5FS8 A;  1Y0P A;  4J3Z A;  4EIQ A;  2C66 A;  3NTA A;  4D03 A;  4G8T A;  2XVI A;  3R10 A;  3CMM A;  3H7V A;  1FHV A;  4H2N A;  3TCS A;  1E1M A;  4BJZ A;  1OEP A;  4C5O A;  2C67 A;  4USQ A;  1R0M A;  3VC5 A;  1PBF A;  4H2Q A;  3ENL A;  4Z2T A;  1EC9 A;  4U8O A;  2R4J A;  3T2Y A;  4JY2 A;  2DW7 A;  1ZMD A;  2GR3 A;  5LV9 A;  3SGL A;  4OPT A;  4REK A;  1PS9 A;  4DSH A;  3CPJ G;  2C75 A;  1NU5 A;  2XVJ A;  4DSG A;  1SJD A;  3U9I A;  3MUC A;  3KA7 A;  1D7Y A;  2Q6U A;  1GOS A;  2OLO A;  3DJD A;  3NO1 A;  3DK4 A;  2X8C A;  4J36 A;  4AT0 A;  4IL0 A;  3B9J B;  4KPL A;  4IHC A;  3N4E A;  2XLU A;  2APG A;  4C77 A;  4BK1 A;  4U8P A;  4G6G A;  1RM6 B;  2XVE A;  1YQ4 A;  4CRT A;  4IZG A;  3R0K A;  3AEF A;  1SJC A;  3H70 A;  4DGK A;  7ENL A;  3QSM A;  4K5R A;  2V6O A;  4E4F A;  2O9Z A;  4NWZ A;  1O5W A;  1ZX9 A;  4U8J A;  3AD8 B;  1FHU A;  1WUF A;  2B9Y A;  3DGZ A;  2HNE A;  1OJ9 A;  2Q0L A;  4YTP A;  5CKU A;  2AQJ A;  3UJE A;  2XCG A;  1D5T A;  3JSK A;  2A87 A;  2YG5 A;  3I3L A;  3ALL A;  3QFB A;  4M0X A;  2VOU A;  2WU2 A;  1W4X A;  5EU9 A;  2R0G A;  3ZYX A;  1S3E A;  2HXU A;  3KVE A;  3KUM A;  1EBH A;  1ZOY A;  4H4Y A;  1RVK A;  4FI4 A;  5J04 A;  1ONF A;  3AEE A;  3DGB A;  4XXG A;  1FIQ B;  1PJ7 A;  1CBO A;  3V3O A;  4H4T A;  2V3A A;  4A6N A;  4KWS A;  3NTD A;  3I6T A;  2WEU A;  1NHP A;  2C65 A;  2B7R A;  3ITJ A;  2E5A A;  1DOD A;  2PYX A;  1L9C A;  3FMW A;  3G5S A;  3I6D A;  5HXI A;  3S5S A;  3UCL A;  3V3W A;  5BOF A;  1H84 A;  2R4E A;  1GER A;  4DNA A;  3TOY A;  3LXD A;  3D46 A;  2VZ2 A;  1JEH A;  4U2L A;  2TPR A;  3AD9 B;  3GD6 A;  3CPI G;  3QSS A;  4M52 A;  3QVR A;  2PMQ A;  1BGN A;  4GFI A;  3T2K A;  3WE0 A;  2W55 A;  3SQP A;  1ONE A;  4U8I A;  1IUV A;  4GYP C;  1AOG A;  1D4C A;  3M13 A;  3LJP A;  2WQY A;  1L0V A;  1NEK A;  1IUT A;  4CY8 A;  4U8M A;  4HNC A;  2OLN A;  4AOS A;  1L8P A;  1BKH A;  5FJR A;  3BHK A;  4EQW A;  3SSZ A;  2WBA A;  2PP3 A;  3P4R A;  4J34 A;  4H7U A;  4H2P A;  2Z5Y A;  3QFA A;  4K5S A;  3GY1 A;  4G7F A;  2R46 A;  2GDQ A;  2QCU A;  3KLJ A;  1S2Y A;  2R9Z A;  4WCT A;  2YLR A;  3AMZ A;  3CPH G;  2WPE A;  3DFH A;  1MO9 A;  3C4N A;  4A65 A;  4ROP A;  2PU1 A;  2CHR A;  5BRT A;  2YAU A;  1X2G A;  3TWA A;  4B69 A;  2RGO A;  3G5R A;  4Z24 A;  3D1C A;  1Q1W A;  1ZK7 A;  3DA1 A;  4FK1 A;  3RNM A;  4RG4 A;  3QJ4 A;  1OJC A;  5EOW A;  2BXS A;  1FOH A;  1PBE A;  2JB1 A;  2POZ A;  4FK1 C;  1BWC A;  4NEV A;  4CCR A;  1OJD A;  2GF3 A;  2XLP A;  4K2X A;  4DX3 A;  2X8G A;  2PU0 A;  2QDD A;  3UJR A;  4IV9 A;  6ENL A;  1Q9I A;  1GXF A;  1E1N A;  3PG6 A;  3AED A;  2H88 A;  1PHH A;  2XFO A;  4CNK A;  3NIX A;  5C3J A;  3NVV B;  4EMW A;  1F8S A; 
#chains in the Genus database with same CATH homology
 1GRH A;  2GMH A;  2UZZ A;  5J7X A;  4J57 A;  5EB4 A;  4BUR A;  1K0L A;  3HYV A;  3NKS A;  3UKQ A;  2XYO A;  4C3X A;  5U25 A;  1H82 A;  2DKI A;  2BK5 A;  2YLX A;  2BXR A;  4IVO B;  3O0H A;  2B76 A;  1CF3 A;  4BJY A;  4OCG A;  1DOB A;  4X9N A;  1TDK A;  1EL5 A;  3CGE A;  3URH A;  1GAL A;  5BUL A;  4ICY A;  4NEW A;  5FS9 A;  1L9E A;  3RP6 A;  3RED A;  4X9M A;  2F5Z A;  3AEC A;  1BF3 A;  3ATQ A;  5HY5 A;  4JQ9 A;  2TMD A;  2ZBW A;  4H4P A;  5FS7 A;  3BHF A;  3IF9 A;  3NH3 X;  4ZN0 A;  1NDA A;  3BI2 A;  4I58 A;  2QAE A;  1OJT A;  3K7Q X;  1D7L A;  4UP3 A;  2V60 A;  1UKV G;  2YVF A;  3B3R A;  2YLT A;  1GT8 A;  3LZX A;  4OPC A;  1REO A;  3IHG A;  3ZDN A;  4U2T A;  2VRL A;  4UDR A;  3NRN A;  2V5Z A;  4Z44 A;  1E1K A;  1IUU A;  1RSG A;  4A6N B;  2WOI A;  2YVJ A;  3CGB A;  4KPR A;  1IUW A;  1FCD A;  4G73 A;  4YSZ A;  4KX6 A;  3II4 A;  1QLB A;  5U63 A;  3RP8 A;  4OPG A;  2ARD A;  3NT6 A;  2AAQ A;  1N4V A;  2QA2 A;  4H4Q A;  3FPZ A;  2GAH B;  3G5Q A;  1H86 A;  3GDP A;  5KOX A;  5FMH A;  1EL9 A;  1O94 A;  3RP7 A;  3EF6 A;  3UTF A;  4BV6 A;  4H4X A;  3SZF A;  4B64 A;  2PHH A;  1GRA A;  3P1W A;  2YG7 A;  3L8K A;  5FS8 A;  1COY A;  5KWF A;  1GET A;  1Y0P A;  4GCM A;  1KF6 A;  1GSN A;  1LQT A;  2Q7V A;  2FJA A;  4EIQ A;  2YG3 A;  4YSH A;  1PBC A;  1CHU A;  1S7M A;  2C66 A;  1NHS A;  1ZY8 A;  2GR2 A;  1X31 B;  3GYX A;  4J33 A;  4WX1 A;  3NNE A;  4YT0 A;  2AR8 A;  2JAE A;  3CGD A;  3NTA A;  4D03 A;  2WDV A;  2NVK X;  2WES A;  2VQB A;  2XVI A;  1LVL A;  3NK1 X;  4YTM A;  4TLX A;  2C7G A;  2YLS A;  2EQ7 A;  5ER0 A;  4E0V A;  1F8R A;  3CMM A;  1Y56 A;  4H2N A;  3VR8 A;  3Q6J A;  3K30 A;  1E1M A;  4JNQ A;  2YR5 A;  5IQ4 A;  3EPT A;  2YVG A;  2CFY A;  1YQ3 A;  4B63 A;  2GQW A;  3HZL A;  4BJZ A;  1KN0 A;  5JCL A;  4J2W A;  4YKG A;  4G9K A;  3F8P A;  4C5O A;  2BK3 A;  2C67 A;  1EBD A;  2WDR A;  3QSE A;  4USQ A;  3P9U A;  2IVD A;  2BS4 A;  1KSU A;  3GD4 A;  2C76 A;  1PBF A;  4PAA A;  4H2Q A;  3SZW A;  4Z2T A;  4LA1 A;  2R45 A;  2J3N A;  4U8O A;  3T2Z A;  1GEU A;  2YWL A;  2R4J A;  3T2Y A;  4JY2 A;  3CNS A;  3DGH A;  4H50 A;  1ZMD A;  2GR3 A;  3P4Q A;  3ADA B;  5LV9 A;  2C73 A;  4IVM B;  1LJ1 A;  3SGL A;  3AE3 A;  2WHD A;  1RP0 A;  3AE2 A;  4OPT A;  2ACZ A;  4U8L A;  1NAA A;  4TM1 A;  2BC0 A;  2NPX A;  1PBB A;  4AP3 A;  4B67 A;  4XWR A;  3FBS A;  3FG2 P;  1PXA A;  1PS9 A;  2R0C A;  2WPC A;  4NNJ A;  4REK A;  3UTE A;  2XVH A;  4DSH A;  4EQX A;  1D4E A;  3CPJ G;  2C72 A;  1BGJ A;  1DJN A;  1NPX A;  4Z25 A;  5KRQ A;  2C75 A;  1EL8 A;  3CNP A;  4K7Z A;  2XVJ A;  4B65 A;  4DSG A;  5DBJ A;  2B9W A;  4H4U A;  3FIM B;  2YLW A;  2WP9 A;  2YQU A;  3NK0 X;  2IVE A;  3UP4 A;  2X99 A;  1JRY A;  4H4V A;  2FJD A;  1E1L A;  3M12 A;  4CCQ A;  3KA7 A;  4TM3 A;  1H6V A;  1TRB A;  3UKA A;  3S5W A;  3AE7 A;  1D7Y A;  4CNJ A;  2Q6U A;  4C3Y A;  2BYB A;  1GOS A;  2OLO A;  3DJD A;  1LPF A;  2A8X A;  3CN8 A;  3SZ0 A;  2E1M A;  4OPD A;  2XLT A;  3T37 A;  3AE1 A;  1PJ5 A;  5J60 A;  3DK4 A;  2X8C A;  2GMJ A;  3NGC X;  3OZ2 A;  4J36 A;  4GRT A;  4AT0 A;  1EL7 A;  4LII A;  4GDP A;  4Y4N A;  5KNL A;  5JCN A;  4FX9 A;  2YM1 A;  3ICT A;  1FEA A;  3ATR A;  4G74 A;  1V59 A;  5IPY A;  2A89 A;  4EM4 A;  4GUV A;  2R0P A;  4IA5 A;  2XLU A;  1XPQ A;  2APG A;  2I0Z A;  4C77 A;  3DJG X;  4BK1 A;  1KDG A;  1DXL A;  3VRD B;  4Z2U A;  4U8P A;  4G6G A;  5BVA A;  2V61 A;  4CY6 A;  4PAB A;  3T0K A;  2XVE A;  3VR9 A;  3ICS A;  5EBK A;  1QO8 A;  3UTH A;  1YQ4 A;  3AYI A;  4O5Q A;  3SX6 A;  4CRT A;  3VRB A;  5JCK A;  4ZCC A;  2WOW A;  3S61 A;  3LOV A;  3GWD A;  3AEF A;  4TM4 A;  4K8D A;  1F3P A;  4JDR A;  4ADW A;  4H2R A;  4NTE A;  4DGK A;  1KFY A;  2X50 A;  3BNM A;  3QSM A;  4Z26 A;  2YM2 A;  4K5R A;  3AD7 B;  2V6O A;  4A79 A;  1TDF A;  3GWF A;  3GMC A;  4CBQ A;  4Z43 A;  2O9Z A;  2VRM A;  2YR4 A;  2XFU A;  3K7M X;  4NWZ A;  1O5W A;  2GB0 A;  4ECH A;  1B5Q A;  4H4Z A;  2VQ7 A;  4I59 A;  1M6I A;  1ZX9 A;  1DJQ A;  1FL2 A;  3SXI A;  4RG3 A;  5KMR A;  1OJA A;  2VVM A;  1CJC A;  2Z5X A;  4HA6 A;  2EQ9 A;  4U8J A;  1GPE A;  4EM3 A;  4APN A;  1ZOV A;  3PO7 A;  3AD8 B;  4K22 A;  1JOA A;  1K0I A;  4LU6 A;  5EB5 A;  3KPK A;  2B9Y A;  2OA1 A;  3SY4 A;  2X3N A;  1RYI A;  3VQR A;  3DGZ A;  4II2 A;  3GRS A;  1PJ6 A;  1OJ9 A;  3AB1 A;  5M0Z A;  1PBD A;  2Q0L A;  2EQ6 A;  2W0H A;  1N1P A;  3AYJ A;  5CKU A;  3AEB A;  4YTP A;  1B37 A;  3UKF A;  2AQJ A;  2GV8 A;  3DK8 A;  3RHA A;  4JY3 A;  1HYU A;  3GRT A;  3PVC A;  2WP6 A;  2GVC A;  4C74 A;  1PXC A;  1XHC A;  2Y6Q A;  2XCG A;  1KNR A;  1D5T A;  1N4U A;  2C3D A;  3JSK A;  1M64 A;  2A87 A;  2YG5 A;  3AEA A;  3ALL A;  3I3L A;  4RSL A;  3BI4 A;  3UKK A;  1TYT A;  3QFB A;  4GR1 A;  2VOU A;  2WU2 A;  3BI5 A;  4A99 A;  5KMS A;  1YY5 A;  2WPF A;  1W4X A;  3AXB A;  2JKC A;  3D9X A;  2RGJ A;  2R0G A;  3C4A A;  1Q1R A;  3ABV A;  3ZYX A;  2BRY A;  3P4P A;  1GES A;  1P2H A;  1S3E A;  2CVJ A;  1N4W A;  2Y6R A;  3UKL A;  4B1B A;  3KVE A;  4O5U A;  5U1O A;  1QJD A;  1Z6L A;  1ZOY A;  4H4Y A;  2YR6 A;  3GSI A;  2IID A;  4GAP A;  1XDI A;  2B7S A;  5L46 A;  3NK2 X;  2ZZB A;  4YKF A;  4P9S A;  1DOC A;  2C70 A;  4YSX A;  4XWZ A;  1MXT A;  5BUK A;  4U8N A;  1ONF A;  3AEE A;  2FBW A;  1GRT A;  2FJE A;  4XXG A;  4Y4L A;  3V3N A;  1NHR A;  1PJ7 A;  1CBO A;  2GRT A;  1L9D A;  2BAB A;  3CTY A;  1PN0 A;  4X4J A;  1ZMC A;  3UOX A;  1SEZ A;  4H4T A;  3V3O A;  2V3A A;  5JRB A;  4EMI A;  3UTG A;  4A6N A;  5KOW A;  1TYP A;  3NTD A;  2CUL A;  2WEU A;  2XFP A;  1NHP A;  2C65 A;  4J31 A;  2GEW A;  3IWA A;  2B7R A;  4II3 A;  1JU2 A;  4YWO A;  4A5L A;  1E7P A;  1ZDL A;  3ITJ A;  1P2E A;  1DOD A;  1NEN A;  1PXB A;  2WDQ A;  4NTD A;  1B8S A;  1IUS A;  1H83 A;  2PYX A;  1L9C A;  3FMW A;  3DJJ A;  2WU5 A;  3G5S A;  3PS9 A;  3LB8 A;  1JRZ A;  3I6D A;  5HXI A;  2HQM A;  1LQU A;  2JK6 A;  1DNC A;  4YSY A;  3GMB A;  4YTN A;  3ICR A;  1S2Q A;  3UCL A;  3NN0 X;  1CC6 A;  3R9U A;  3GD3 A;  1O95 A;  2GAG B;  2JBV A;  2RAB A;  4B68 A;  1H84 A;  2R4E A;  1GER A;  4DNA A;  3LXD A;  4EMJ A;  1NG3 A;  1GRB A;  2X8H A;  3KKJ A;  3K7T A;  4Y4M A;  3GYJ A;  4N9X A;  2VZ2 A;  1JEH A;  2OAL A;  2RGH A;  4U2L A;  3UKH A;  2TPR A;  2E5V A;  3DME A;  1ZKQ A;  3AD9 B;  3AWI A;  3CNJ A;  3QSS A;  3CPI G;  3GYI A;  3P4S A;  4M52 A;  4A7A A;  3AE4 A;  3NYF A;  2C4C A;  3QVR A;  4EQS A;  2XLS A;  1NG4 A;  3L1R A;  4UDP A;  2DKH A;  3SFE A;  2ZZ0 A;  3NHO X;  2JB2 A;  3B6D A;  1ZP0 A;  3CNT A;  1BGN A;  2BK4 A;  1KNP A;  2BS3 A;  3T2K A;  3WE0 A;  4Z2R A;  5KMQ A;  2WOV A;  1H2I A;  1YQZ A;  3SQP A;  1VG9 A;  4OVI A;  3Q9T A;  3SYI A;  1Y56 B;  3EAN A;  4U8I A;  2BCG G;  3KD9 A;  5KVI A;  3F8D A;  1IUV A;  1S3B A;  5KXJ A;  1FEB A;  1AOG A;  1GRG A;  1D4C A;  1LTX R;  3M13 A;  3LAD A;  3NYC A;  5GSN A;  5HHF A;  3L5O A;  3UOY A;  4G6H A;  4A9W A;  3DK9 A;  4OPI A;  4B66 A;  3LJP A;  2WQY A;  2BS2 A;  1GRE A;  5IQ1 A;  1L0V A;  1F8W A;  3H4K A;  1NEK A;  3NYE A;  4TM0 A;  4EIP A;  1IUT A;  3ALM A;  1F6M A;  4MJW A;  4U2S A;  2YLZ A;  4CY8 A;  4U8M A;  1JRX A;  1CC4 A;  1K0J A;  1H7X A;  2GR1 A;  4TLZ A;  4AT2 A;  1TDN A;  3C96 A;  3EAO A;  2OLN A;  4AOS A;  1GTE A;  1ELI A;  2GQF A;  4EQW A;  1E6E A;  3BHK A;  3H8L A;  1VRQ B;  2H89 A;  2YG6 A;  4USR A;  5HYM A;  2ZZC A;  3OC4 A;  2WBA A;  3P4R A;  4OPL A;  4J34 A;  2V3B A;  1K4Q A;  2WET A;  2WS3 A;  2XLR A;  3QVP A;  1DOE A;  4H7U A;  3AEG A;  3T14 A;  3SM8 A;  5JCM A;  4H4R A;  4H2P A;  2Z5Y A;  4H4S A;  3KU9 A;  3F8R A;  2E4G A;  3QFA A;  5C2T A;  4K5S A;  1IUX A;  2XDO A;  4D04 A;  3AE5 A;  2R46 A;  2QCU A;  2YG4 A;  3CIR A;  1CC2 A;  3KLJ A;  1S2Y A;  2R9Z A;  1PDH A;  4WCT A;  4BK2 A;  3ALJ A;  4YXD A;  5KMP A;  2YLR A;  3CGC A;  3UOV A;  1H7W A;  3UP5 A;  5TR3 A;  2XVF A;  3CPH G;  5KVH A;  1GND A;  2WPE A;  1MO9 A;  1MOK A;  3C4N A;  4A65 A;  1H81 A;  3AE6 A;  4IA6 A;  1XAN A;  2B9X A;  5M10 A;  1CL0 A;  5BRT A;  1VDC A;  4HB9 A;  3H8I A;  4EQR A;  5GRT A;  5CQF A;  2XFN A;  2YAU A;  3COX A;  2C3C A;  2BA9 A;  4B69 A;  4FDC B;  2RGO A;  2CDU A;  3M0O A;  3SFD A;  1D4D A;  1KSS A;  4H4W A;  3DH9 A;  3BNU A;  3DJE A;  3G5R A;  3LZW A;  2FJB A;  5FS6 A;  4Z24 A;  3T31 A;  1CJ3 A;  3D1C A;  1Q1W A;  4JN9 A;  1ZK7 A;  4ZCD A;  1VG0 A;  3SZC A;  3IC9 A;  3ISH A;  3DA1 A;  2VVL G;  3RNM A;  4FK1 A;  1BZL A;  3UOZ A;  3E1T A;  4RG4 A;  3QJ4 A;  3NN6 X;  3GDN A;  2EQ8 A;  1JNZ A;  1OJC A;  3UKP A;  3KPF A;  2QA1 A;  5EOW A;  1FEC A;  3HYW A;  3IHM A;  2BXS A;  1FOH A;  1VQW A;  1PBE A;  2BAC A;  2JB3 A;  2WP5 A;  2C64 A;  5JCI A;  2JB1 A;  2VVL A;  4BK3 A;  1CJ2 A;  1TDO A;  4FK1 C;  1BWC A;  1NHQ A;  2BC1 A;  2GH5 A;  4NEV A;  4CCR A;  3AYL A;  2GR0 A;  1OJD A;  2GF3 A;  2XLP A;  4K2X A;  1IJH A;  2BCP A;  4NZH A;  4GAV A;  4AOX A;  1B4V A;  1YKJ A;  4U8K A;  1GRF A;  4OPU A;  4GDE A;  1LV0 A;  2OAM A;  3AE8 A;  3D8X A;  4JNA A;  4GF7 A;  2X8G A;  3CND A;  2XFQ A;  2BRA A;  4IV9 A;  1Q9I A;  1GXF A;  1CJ4 A;  4J56 A;  1E1N A;  4UDQ A;  3VRA A;  1E39 A;  3NLC A;  2Q0K A;  1GV4 A;  3PG6 A;  3AED A;  3V76 A;  2H88 A;  4NTC A;  3NG7 X;  1GTH A;  1PHH A;  2XFO A;  4CNK A;  3AE9 A;  3HYX A;  3NIX A;  1TDE A;  1JNR A;  5C3J A;  1BKW A;  4EMW A;  4AP1 A;  1F8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...