4LISA

Crystal structure of udp-galactose-4-epimerase from aspergillus nidulans
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
364
structure length
364
Chain Sequence
b'PSGSVLVTGGTGYIGSFTTLALLEAGYKVVVADNLYNSSAEALNRIELISGKKAEFAQLDVTDEAAFDKVFEAHPDIDSVIHFAALKAVGESGEKPLDYYHVNVYGTICLLRSMVRHNVTNIVFSSSATVYGDATRFPDMIPIPEHCPLGPTNPYGNTKFAIELAITDVINAQRNNAKKAGNETEAAKWNGALLRYFNPAGAHPSGIMGEDPQGVPYNLLPLLAQVATGKREKLLVFGDDYASHDGTAIRDYIHILDLADGHLKALNYLRANNPGVRAWNLGTGRGSTVYEMIRAFSKAVGRDLPYEVAPRRAGDVLNLTSNPTRANTELGWKAQRTLEQACEDLWLWTKNNPQGYRQQPPAEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-glucose 4-epimerase
publication title Elucidation of Substrate Specificity in Aspergillus nidulans UDP-Galactose-4-Epimerase.
pubmed doi rcsb
source organism Aspergillus nidulans fgsc a4
molecule tags Isomerase
total genus 125
structure length 364
sequence length 364
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lisA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4lisA02
4CLHA 2J5QA 2XPCA 4P8RA 2C07A 1KVUA 1DPGA 1JAYA 3NT5A 3TDKA 3RUDA 4B7UA 4U6SA 5DBGA 1JA9A 1CIVA 2NSDA 2BRUA 1ZNQO 1QYWA 4NBUA 2CY0A 4BKUA 4CODB 3AI2A 5TT1A 3JQDA 4JBIA 4XB1A 1R0SA 2WYUA 3SLGA 2AE1A 3DOOA 3B1JA 4OOEA 3O26A 2GN9A 3L07A 4YJHA 5ITWA 3PJFA 1C0LA 1E7RA 1HDGO 2O23A 1MFPA 1K6XA 4IS2A 5IN5A 4UAGA 4M49A 4YCAA 3O9ZA 4N5LA 3FI9A 1NP3A 1FDVA 3ICCA 3DZJA 3MTGA 4FR5A 3DAPA 3R3SA 4NNJA 1ULUA 1P1KA 1ZW1A 3ZDFA 1LEHA 1RKXA 4WNCA 5TJHA 2HAEA 3QWIA 2OOSA 4NFYA 2VZ8A 1Y9AA 1WP4A 5A03A 5F5LA 4D7AA 2GD1O 2HJSA 4ITUA 4P4GA 4ND2A 3D4PA 2EWMA 3KRTA 4KQXA 1HSOA 4FCCA 4LK3A 2YW9A 3ONDA 4CMCA 2NVBA 2ZYDA 2PA3A 1XWFA 1HE5A 4D3DA 3EGOA 1YBAA 4CLEA 3ZWPA 1A7AA 3DHYA 4EW6A 2VYVA 3DOJA 1SBYA 2GF2A 2YDYA 5LC1A 1RJWA 3OJEA 3KUXA 2FSVA 5TF4A 4AJJA 5JCJD 1O89A 4J4TA 1K6JA 4Q3DA 1ENZA 3QWFA 3VHRA 5L7TA 3QVOA 4CMHA 1AGNA 3E82A 4E5KA 3DFUA 3OSUA 2BI8A 3WQRA 3JQAD 5L4LA 1J0XO 3DBVO 3L6OO 3LC2O 3NT2A 4QUKA 3VPGA 4BNZA 4EDFA 4RQTA 4XX0A 2E37A 5BSEA 3AJRA 2X1HA 1VL6A 3FPLA 3UCXA 2DBVO 5DOZA 2VQ3A 4W82A 4OH1A 2PZMA 4XYLA 1YOVB 2DFDA 5J23A 3ENKA 1P1IA 2VTEA 2Q49A 3WSWA 3TL2A 1XR3A 4KOAA 4ALLA 1EMDA 3I9NA 3U49A 3IP1A 3D7LA 2HLPA 3D4OA 4H16A 1GAEO 1KY4A 3TN7A 4UUNA 1GUZA 4XEHA 5IZCA 4GH5A 4ZHSA 3DZKA 1GEGA 3I9MA 2WSBA 3D3WB 3LQFA 1DAOA 2PH5A 2Y05A 4NZ9A 5I9LA 3GH3A 2X23A 3DZBA 3CMMA 3UFXA 5L51A 1SB8A 2OHXA 1SCUA 2DUUA 3PHHA 4J90A 4RDIA 5I8ZA 3INRA 2C20A 4ALMA 4CPDA 1KEVA 3PHJA 1ZKMA 2Q45A 4YQYA 4HNGA 4RF5A 4A26A 4OGWA 1EVJA 1HLDA 1TB4A 2B5VA 4OYRA 2JCVA 2HO5A 4CLRB 3PHLA 4GVXA 4W7HA 3JQFC 4BNGA 4C4OA 3PI7A 2O48X 1JVBA 3PJEA 2YFHA 1OBFO 1ZJYA 3DONA 5G4KB 2GZ3A 3B70A 3NDRA 4K6FA 2QX7A 3AUSA 1U1IA 1GQ2A 3DZFA 5EQDA 5JDCA 1NBOA 3DBHA 4CQMA 3R0IA 1A9ZA 1UAGA 4N54A 5CDUA 2PH3A 2F00A 1P1FA 3VTZA 1JU9A 4IJUA 3Q0EA 4KDEA 2OP0A 4BNKA 1B8PA 3C7AA 4PLPA 1U3WA 3MWEB 4J7CA 2PKRA 5EERA 1QXSA 2YV2A 1ZK4A 3KLPX 3EHEA 4UEOA 1VKOA 4LSMA 3FSRA 1U9JA 4EJMA 1EFKA 1Q0QA 4EUEA 4JCOA 5DCUA 1EE2A 2DTEA 4BNMA 1DC5A 1ZBQA 2RIRA 3VZQA 2DBRA 5KVQA 4UREA 1NVMB 3DFZA 4K1LA 1K5HA 1GD1O 4QSMA 1B3RA 5T67A 3BMQA 3K2BA 5T8KA 1C1XB 4KUHA 1PGPA 3BTVA 1YGYA 2I65A 4GX2A 1ZK0A 4YDRA 4J3FA 4MIYA 3CZMA 1EQ2A 2HMWA 5JPIA 4TMFA 1U2DA 3VZRA 3ASUA 3B1KA 3TOZA 4HFRA 3U4DA 5CHEA 4A03A 3WX0A 3DBLA 3JYNA 4BUCA 1HT0A 4M86A 5DBIA 3PQEA 1EZ4A 4D3FA 1TEHA 1DFIA 2EXXA 4AJIA 2BELA 3H7AA 4UUOA 1H93A 2RBEA 4GKVA 1T1SA 4NDNE 5A1TA 1NHWA 2V65A 5FI3A 3EUWA 1ZK2A 4NBVA 2FR8A 3FNEA 3AFMA 2HMSA 5COBA 3WGGA 3PLRA 4IXWA 4LSWA 1F06A 4FS3A 4Z3KA 1VM6A 2D4AA 7MDHA 3VZPA 1LLCA 1IUKA 2YHIB 2ZJ0A 3W1VA 1Z6ZA 5GMOA 3VH1A 5GZ3A 3ZV5A 3SVTA 4D42A 2PR2A 1YBMA 1YONA 2A92A 2IODA 3LT2A 4NIMA 1M6HA 2QRLA 3C7CB 1KVRA 3RKRA 1B8VA 3CINA 5IDWA 5KVSA 4JROA 2VZ9A 3PIDA 1GQYA 1LX6A 1ONNA 2WE7A 4NFHA 3D5TA 1KC3A 3JQ9C 3RUIA 4NBTA 5HM8A 3HADA 4MKXA 3G1UA 4PLGA 5DT9A 2RHRA 4I9UA 2J3HA 2ZB4A 3LC7O 1M67A 4XQGA 3GR6A 3RU9A 3ZWYA 2CVOA 2HU2A 3KYBA 3CIFA 3OJFA 3F6YA 1I3MA 1OOEA 2UDPA 2O3SA 1DHRA 1WDMA 3H9QA 1H6DA 1N9GA 3NTRA 4BIIA 1R4NA 3AOGA 3GVXA 4R54A 5C3MA 5CPBA 4WLOA 3RI3A 1EUZA 2WWRA 3HJAA 3D3EA 3MOIA 3JD3A 3O4RA 3PYLA 3LC1O 3ZHYA 1P44A 1D8AA 2EW2A 4GQAA 3OA0A 4YWJA 4Y6SA 1DFGA 3T4XA 2WJPA 3OMLA 4YJFA 2VYVD 1DIGA 4RORA 1Z7EA 5IFLA 3RKUA 1P31A 2GPTA 4AJEA 1P45A 3QVXA 4GSKA 4OQZA 4CM7A 5G0VA 3G49A 3JD1A 4Y6PA 5G0WA 1A5ZA 3GAZA 1ZH8A 4ZA2A 5JNLA 2FSSA 2Y1EA 4J2OA 4YXFA 2FPIA 4BO2A 1YQDA 4LVUA 3W6UA 3S55A 4GGPA 4PG7A 4JBGA 2H63A 2DU8A 4EJ6A 1UP4A 1Z73A 4PG6A 3HQ4O 1H0KA 3K31A 2VOJA 2XXJA 2DTDA 2EGHA 4J9VA 4OL9A 4CL3A 5JAMA 3ZNOA 1WVGA 3WNQA 1B15A 1NWCA 3AY7A 1PWZA 4R9SA 4W9NA 3GMDA 4F45A 2BGKA 5T57A 3OQBA 3AY6A 1LSUA 4F3YA 4JP2A 5CDGA 3FPCA 1XSEA 4DPMA 2FN7A 2I67A 2IXBA 1ADFA 3C3XA 1HE3A 1B16A 4MVJA 1NAIA 3WIEA 2C2YA 1HRDA 1IPFA 2OGUA 3VPSA 4D44A 4BNFA 3VDQA 3BTOA 1HYHA 3H2SA 2X0NA 3MJEA 4E31A 5KOIA 4JXKA 3LSYA 3OF2A 4DYVA 1ZO8A 1I3NA 3RBZA 2NADA 2NQTA 4GWKA 1LQUA 2EERA 2GN4A 2O7SA 2X0JA 2X9VA 4KUEA 1B26A 4OSPA 5TQVA 3GOHA 2AQHA 4JP3A 4XYEA 3ZWCA 4CV1A 5JDIC 5IJZA 2PZKA 4XA8A 2C0CA 4Q3CA 2SCUA 2DLDA 3ZNPA 4PN3A 3GG9A 2LDBA 3Q1LA 1RM4A 2G1UA 2DPHA 4J7UA 4B3IA 3C24A 4GLOA 1Y8QB 2R2GA 2J5KA 1M6WA 1YE3A 3WLEA 4BHTA 2GDZA 3NJ4A 3DQPA 4CQMD 4P22A 2B37A 3OICA 4BV8A 2OMEA 1YDWA 3AUTA 4PLTA 4AJOA 5JYDA 1PJTA 3PVZA 4MVJI 1RYEA 3L9WA 1RYDA 4LCJA 4ESOA 3DTYA 1ISGA 3NGXA 1O0SA 4R3NA 1EVYA 3KEQA 2W98A 2WEKA 2Y0DA 1ENPA 1PL7A 4AICA 4P4LA 2WTBA 2CDCA 1GUYA 5DP2A 4KWIA 1Y9EA 4H3VA 3QJ5A 4CR8A 3SC6A 2D59A 1Z7BA 2X86A 1JKFA 1E6EA 3HFGA 2IZZA 1BSVA 3A1NA 4FFRA 5KJ1A 2BHLA 5I7VA 3Q2KA 4YJGA 5A9TA 4ALNA 2ZYAA 4BGUA 2VHWA 1MB4A 3I1JA 3E5MA 5COQA 1U8FO 3M1AA 5EIOA 1NQOA 2NTNA 1UDAA 2RHCA 3UF0A 1PGJA 1VPDA 4WLUA 1N2SA 4PZEA 4EJ0A 4FIZA 3H5RA 3L6DA 4GMFA 4KUGA 3WNVA 3O8QA 1DO8A 4RGBA 1HWYA 2EEZA 1PQWA 2VTDA 3ZGYA 4XKJA 6ADHA 2BGMA 3E5RA 3PHGA 3QWHA 3JQ6A 1E3EA 1WPQA 1QP8A 3I23A 3N74A 1LC3A 4HV4A 1BHSA 5IDXA 5JYEA 1OC4A 3DZIA 3BMOB 4DIBA 4BGVA 2AW5A 2JFHA 1ISIA 4WNIA 2YY7A 4B79A 2VWHA 3MEQA 1BW9B 2EF1A 1LLDA 2Y0EA 2OP1A 4OO3A 4EEXA 1QLHA 3OETA 3U3XA 2QRJA 2CNBA 3DAFA 1X14A 5DN9A 1DAPA 1X7DA 1BW9A 2DBQA 1KVSA 3DB2A 3RWBA 4N5NA 3OHSX 4DPKA 1GZ6A 1B0AA 5ICMA 1M76A 2ZB3A 5G0TA 1ZXBA 3PP8A 2GERA 3JQ7A 1DC4A 1RM3A 1LRKA 1N5DA 3JQAB 3GDOA 4AJLA 3FCOA 2HDHA 3C1AA 4YBZA 1GFSA 5I9MA 1KBZA 1YB5A 3I9OA 4BO9A 1DXYA 4JLWA 4PG4A 4UEKA 4WPGA 4XQEA 3G17A 2BLLA 4A0SA 1E1NA 4IJKA 1GCOA 4Q9NA 2IE0A 3PLNA 4XJSA 4YAEA 3UAGA 3JYLA 3MJTA 3UH1A 1G0NA 1ZSNA 1QV7A 1PQUA 2IYPA 3K5PA 2AMFA 2QIOA 3JD2A 5JE8A 3GF4A 2Q2VA 4NK5A 2NVUA 1T2AA 2Q99A 5ER6A 4BVAA 1TXGA 3LVFO 1DC3A 1U2GA 3R6DA 5ICSA 3VOSA 1ZFNA 4A10A 1O95A 3PRJA 3WMWA 1R0LA 4CV3A 4CM4A 4YAIA 3IUSA 4NJMA 3E8XA 1M66A 2B4TO 1VJTA 3BIOA 3NTQA 2JL1A 3CSDA 1W73A 3NYWA 1NPTO 1AE1A 3WWYA 3PJDA 1GUFA 1JWBB 4M89A 1VL8A 1NPDA 4YJDA 1YWGO 4R1UA 1QYVA 2J3IA 1LUAA 1Q1NA 4IDEA 3PEFA 1DDOA 3M2PA 2R00A 2ZTVA 2GSDA 3DOCA 4PLFA 1T4BA 1B7GO 4QO7A 3IJRA 4YRBA 4CQLA 4AJKA 3IS3A 2DPGA 4A5OA 3AFNA 4PLWA 4FB5A 4UVHA 3K9QO 3C85A 3SXPA 2HRBA 1TI7A 5ES3A 3WGZA 4BNYA 3IKTA 1GEEA 4ALKA 2ZTUA 3JQGB 2W2LA 2ZB8A 2P5YA 3LT1A 5DULA 2Y0CA 3OJ0A 3I6IA 4NMHA 1W4ZA 4Z0TA 3NV9A 3P2OA 3ETEA 4RPGA 3E6AA 3OJLA 1ZIDA 3ADOA 4E21A 2NU7A 4XDZA 3DHEA 1J6UA 3CEAA 1IZ0A 2Y67A 1EK6A 4MVJD 3PFFA 2J3JA 3L9XA 1DRUA 1FDSA 2O3JA 4GX1A 5ILOA 4BS9A 4GX5A 5JMWA 4J43A 2X0RA 3GN2A 1NXQA 3WYEA 4XGNA 3KLMX 3GRKA 2ZQZA 1TLTA 3FTNA 4D46A 3ZHZA 2HJRA 3GN1A 1DFHA 3JCZA 1XA0A 5L7WA 4BMNA 2NU6A 1YH3A 3F5SA 3WBFA 1KOLA 4YT4A 4CL8A 4W7IA 2DTXA 5JBIA 2C54A 3IP3A 2BFAA 1CDOA 2NNLD 4TZTA 2I3GA 2PGJA 1E1LA 1GTMA 4R4JA 1EFLA 2W8ZA 1XELA 1YL5A 4DC1A 1H5QA 4IDCA 4RQUA 3TL3A 1H6BA 3IL2A 4DUPA 4IIVA 5A9RA 1X13A 2X58A 4HNHA 4GMGA 4S1VA 1CQIA 1V0JA 2P9GA 1TT5B 2BMAA 2Y1GA 4PFJA 3ZWVA 1PL8A 1RM0A 4BQRA 3ABIA 2VHXA 4K28A 1DEHA 2Y93A 3KXDA 3VDRA 1XHLA 3OH8A 1TT5A 4BB6A 3U4IA 3WDSA 4OIMA 1YXMA 4ONEA 2OORA 1SZJG 5AXBA 3F9IA 3UCEA 1C0PA 2RAFA 1PJQA 5CG2A 4G65A 4DXHA 3PGJA 4DMMA 2P4QA 4RPHA 3K73O 4ND5A 1ARZA 2Z5LA 3WQSB 5KNLA 4YJHB 3WJAA 1HETA 2FOIA 3HWRA 2LDXA 2C5AA 3KB6A 2PGDA 5KKCA 5FFFA 5H81A 4LCEA 5C7OO 3WJ7A 1P1JA 3TOXA 2V6BA 4N7RA 1GCUA 4OHUA 4CM1A 3ST7A 4QQRA 3L6EA 2E6UX 4U0KA 4H7PA 4IINA 3ROPA 1IY8A 1ZJZA 4ZQGA 4GAEA 1NAHA 1WDKA 3UVEA 3V5NA 1NTOA 3ZV4A 5A5FA 3QLJA 1ZK1A 4I1IA 5L4NA 4CR7A 4G81A 1LTHR 1UXHA 4WEOA 3GDFA 3QY9A 1KEPA 2HCTA 4BV9A 3IC5A 4XIYA 1K0UA 3WXBA 3OP4A 4ND4A 4D41A 4KTTE 4NU5A 3GNQA 1XG5A 3IOYA 4RVUA 5KJEA 4L76A 4L73A 5B4VA 5C37A 4MPDA 3RD5A 1S6YA 1U4OA 3FNGA 5F1KA 5JMPA 3DTTA 5C7IO 1D4FA 3RJ9A 3WFJA 1EUCA 1HSZA 1PSDA 4I9HA 4MP6A 4MOWA 4RDHA 1J5PA 3GUCA 5EQFA 5BQFA 4BMSA 4WECA 3OBBA 3U4CA 4BO4A 1F17A 3ON5A 3QV1A 4E5YA 2HRZA 3RASA 2ZK7A 3BYZA 4CMKA 4CR6A 3DC2A 1EBFA 5HRUA 1UXIA 3VKVA 4JIGA 4BO1A 4MJLA 1HEUA 1CRWG 3FNFA 4WJZA 4RVHA 5JY1A 2AEJA 1GYQA 4CLXA 2YV1A 4PGFA 5DCWA 3RVDA 1ID1A 4I5EA 4LRSB 1E3JA 2D5AA 2ZATA 5BR7A 2Q2WA 3ICPA 4ZQHA 2A9FA 3OEWA 3HN2A 5I9NA 3KV3O 3ZWOA 2YJZA 1V6AA 3JV7A 2VWQA 1QSGA 4J1NA 2PKQP 3PDUA 3NGLA 1NQAO 5A9SA 3ANLA 4H15A 1J4AA 3O03A 2CDBA 2Q4EA 3D64A 4RF3A 4FSHA 1TT7A 3OIDA 3QVSA 4CJXA 4ZRMA 3ZZNA 5AYVA 5TX7A 4Z0HO 1BG6A 2AXQA 4IUYA 1F0YA 1NX6A 2J6IA 3ETDA 1I0ZA 1UP6A 1I3LA 4XYMA 2Y66A 4CMEA 3JYPA 4E13A 4CMIA 2CZCA 3DXFA 4JNKA 3P19A 1YB4A 1DSSG 1I2BA 1JVSA 3DBHB 5CEFA 2HK7A 3HNPA 4MVJM 1I36A 4CQMB 4E2XA 2IZ0A 4RVDA 2AQ8A 1PJLA 2B4RO 4DRYA 3GFGA 1B2LA 1PJ4A 2YHUA 4JBHA 1A7KA 3VVCA 2IZ1A 3ONFA 1MG5A 1SOWA 2W2LD 1E7MA 1X0VA 4Z6KA 3ZNQA 1CQJA 3MJVA 3IMFA 5EINA 1I32A 3AUUA 4OJNA 1WNTA 1K6IA 1DIRA 1YQXA 2HK9A 2XXBA 2H6EA 3W4IA 4XYGA 3WGQA 5EJ2A 4RF2A 1A4IA 4R1SA 5BNIA 2X5JO 3JQFA 5IDYA 1HTBA 4XB2A 4RO0A 3BMQB 3EAGA 3VH2A 3ZI0A 2JAPA 4Z3DA 1U28A 3KM0A 3PJGA 4GPD1 3GVHA 7ADHA 1U7HA 4JJFA 2EP5A 4R41A 4E4YA 1XGKA 1Q7CA 2GLXA 2VYNA 2YQ5A 3JQ8A 1ADBA 3PYMA 4O0LA 1KERA 3LLSA 3H5NA 4QXMA 1QYXA 3DBLB 2A35A 4XR4A 3RAJA 1T2DA 4E3ZA 4IMPA 5TS3A 1P1RA 2C7GA 4GKBA 1ISJA 4JX8A 4AVYA 1DIAA 3PZRA 3WMXA 1C1DA 2DVMA 5EPOA 1SMKA 5HWSA 2H9IA 2X6TA 3ZV6A 4JJGA 4URFA 1N8KA 4J6FA 5IZ4A 2O3RA 4U0JA 2XAAA 5CDTA 2NACA 2UVDA 2VHYA 3BAZA 3K96A 3SC4A 5TT0A 1YL7A 1F14A 3ZNNA 1MGOA 4HFJA 2NLOA 1WWKA 1LU9A 3AOEC 1CETA 1XEAA 2B4QA 1YJQA 1PJ3A 1M2WA 1R37A 1K89A 3X2FA 2QYTA 3ZN2A 4B4WA 5EESA 1HKUA 3PWSA 4RCVA 4RLSA 4HBGA 3SJ7A 4D0RA 1H94A 1GY8A 2D0IA 3DDNA 3LYLA 2AHRA 3B1FA 3OECA 2RH4A 4MINA 2PKQO 5K6AC 2JCYA 2VCYA 2GUGA 2VWGA 1Y5RA 2PD3A 4YT2A 1C14A 2OO5A 1I3KA 3HHPA 2FHSA 4MVJG 1PIWA 4M1QA 1NYTA 4CLDA 3E48A 1E92A 4LMPA 1PU2A 4KQWA 9LDBA 1PR9A 5HS6A 3HUDA 3ZWAA 3RBVA 2POQX 5A04A 3FWNA 3HSKA 5CFZA 2CMDA 3HZZA 2NTJA 1MA0A 2O2YA 1N9GB 1VJ1A 1ZVMA 1R4NB 1AN9A 3V2HA 4OQYA 3VPFA 3F47A 1LLUA 2HMUA 4BNIA 2X7HA 3UN1A 1C0IA 2PZJA 3E1KA 2O4CA 1PL6A 1BGVA 2H5LA 2EW8A 5CEJA 1HYEA 4YJFB 1LDYA 2UYYA 4PIVA 3W4KA 4ZQBA 1BDBA 3TZHA 3LT0A 4FD3A 4JJIA 1SC6A 3WIDA 1LDGA 3EC7A 2Q2QA 2R6JA 3INGA 3PIIA 4ND1A 4A7PA 5KCZA 2D5CA 3JQ9A 2BFOA 4OAQA 4FJ1A 2B35A 3KYDA 5KJCA 3OIGA 3A9WA 1HDZA 2DUWA 4XJTA 1N92A 3KZVA 2V6FA 3ZWBA 5F5NA 1MFZA 5L4SA 3CE6A 3BMCA 4J7XA 4LGVA 5A02A 3H5AA 4O1MA 4TZKA 4W9NC 3GPIA 3U9LA 3TZKA 3GDGA 3N58A 1KS9A 1KETA 4Q3AA 4WUVA 4E2ZA 2Z95A 4FJ0A 5JY6A 3GHHA 3I9JA 3JYQA 3RUAA 1BWSA 1ONOA 2O2SA 4GGOA 2GRAA 4E2YA 4MP8A 1YVEI 2OFPA 3RROA 1LNQA 1MUUA 3F46A 1HE4A 2PWZA 4MVJP 1A27A 4KTVE 5ADHA 5L95A 4XWYA 2YFQA 4ALIA 1ZXLA 2W4QA 2Q1UA 1YQGA 1R4MA 1EDOA 4WLNA 3DO5A 2ET6A 4HWKA 3ULKA 2ZIZA 2ZYGA 4AJPA 1KVQA 4CM8A 1EBUA 2D2IA 5C5IA 1HL3A 3M2TA 4FFPA 4J0EA 4NPCA 4Y67A 3RU7A 3PWKA 3PFWO 4CUKA 3LT4A 5JW6A 3LU1A 4AJ2A 4NHEA 3F5QA 1XQ1A 4WOKA 2P5UA 2BF7A 1NFQA 5AVOA 2Y1CA 2PV7A 1R16A 1NPYA 1OFGA 4IDAA 3W4JA 3MJ4A 4C7JA 3BMNA 4J4BA 4OXKA 4DIOA 2I99A 1T4DA 4CMGA 3W8EA 1CEQA 5JS6A 1GPDG 3DMTC 1XCBA 3JQBC 1C0KA 5ENDA 1IOLA 5AXAA 3NTOA 2Q50A 4DA9A 4WGGA 3S2FA 4A27A 4E0BA 3ZWMA 2A4KA 2VUSA 2O50A 1RM5A 3ZU4A 4RPJA 2GN6A 2O7QA 2O3UA 3KTDA 3ORFA 4WCFB 1A72A 3AM3A 2DM6A 3WTBA 1L7DA 1K2WA 3P5SA 1VRWA 4WCFA 3F1LA 4RZHA 5JSFA 3H9JA 1QR6A 4HXYA 1GADO 3KEOA 3U09A 5BSFA 3CZRA 5BSHA 5DDIP 3GNTA 2ZQYA 3K30A 4IJVA 4YJGB 5JDIA 1QG6A 4RJTA 2OBYA 4R9RA 4BO6A 2JHFA 1T26A 3H65A 3ZU3A 4DYDA 5BT9A 3WGIA 4I5GA 4YEDA 4DC0A 5MGBA 4L0QA 1Q0LA 4TROA 5AXCA 5AOVA 3AI1A 3F1KA 4CM3A 3O8QB 5HS4A 5KVVA 2VYND 1NM5A 3F4BA 4E2WA 4WKGA 3U5TA 3DBRA 5JLAA 1E7SA 3D5QA 1VJ0A 5GZ1A 3GZNA 3A28A 1LDMA 1PZEA 4EITA 4IJWA 2PK3A 3LDHA 4R5MA 2E82A 5IN4A 3GT0A 3GPDG 1LLQA 2I76A 3GVCA 3KO8A 4WEQA 4HY3A 4ZVVA 4EEZA 2ZCUA 2VWPA 4D0SA 3GRPA 4P38A 4R5HA 1JAXA 1I30A 4R51A 5T5QA 1IULA 4L75A 3ASVA 1NFFA 4E5PA 3DMYA 1JKJA 2PTGA 1V8BA 3MTJA 3D4NA 1QYCA 3FRJA 1GYRA 1BVRA 3LF1A 3ZWXA 3VVBA 1BTOA 1OZAA 4TRNA 4FN4A 4QTZA 3WYCA 1F12A 3SX2A 3U0BA 2BH9A 4W99A 3JQ7B 4A2CA 3O38A 4IZHA 3FHLA 4PLHA 5TJ9A 4M54A 1HXHA 2Z1NA 5KWEA 2FPPA 1E0DA 2W90A 5CG1A 1UZLA 4OOFA 1E3IA 5CP8A 2B69A 3CMCO 3RUFA 5IXYA 1E1KA 1P0FA 2A94A 4UUPA 4ZGWA 3UCFA 1HZZA 5KKAA 4J1QA 1NHGA 2VT2A 3PHIA 4BGEA 3ZCXA 2Y1FA 3DWFA 2PFGA 4FW8A 5U4QA 5CDSA 2C82A 3PZBA 4IQ0A 4Q3BA 4BKQA 4L4SA 4HFMA 1BXGB 1V3UA 2V7PA 3GLQA 2NVUB 3WG9A 1Y81A 1U3UA 3NDJA 1BXGA 1IE3A 2W2KA 4D43A 1MXFA 4C7KA 4NH4A 3UGKA 1EE9A 2OZPA 4OKNA 4CM4B 4NJMB 2FPGA 3L4BC 4FFMA 3STHA 3RSHA 3I3OA 1WDLA 5A3JA 4O5OA 1ADGA 4MIOA 5THQA 3MWDB 4BKPA 4DIFA 3QWAA 4U6QA 5EL0A 2Q1SA 3QIVA 2C2XA 4WASA 1SOVA 3ONEA 2VRCA 2NTVA 1FDUA 1H2HA 8LDHA 1W6UA 1UDCA 4AJ1A 3D1LA 4OM8A 2GASA 3V2GA 1BRMA 1N7GA 4M87A 2NVWA 4E30A 1H9AA 4CQLB 4II3A 2Q46A 1PQPA 1PZGA 4CM5A 4DMLA 2DAPA 3I6QA 3QQPA 4KZPA 1IYZA 1OC2A 1DRWA 3QA9A 1FF9A 3IAHA 2RH8A 2ZTMA 3VTFA 1ORRA 1RPNA 4TVOA 3WLFA 4YB8A 3IJPA 4L8VA 3TPCA 2WD7A 3RIHA 1Y5MA 4JK3A 4L9RA 2E4AA 2ZTLA 1QLJA 4HFNA 5TGDA 2Q1TA 2DBZA 1Z74A 4HADA 2AQIA 3K6JA 4TQGA 3ZW9A 4CUJA 4IGFA 1E1MA 2EIHA 4OXYA 3H9UA 1GDHA 1MV8A 3EMKA 4QECA 2FZEA 2HMTA 3WICA 4BO7A 1PGNA 1O6ZA 2DQ4A 1GZ3A 4I08A 3E03A 3AUAA 1Y8RA 1E6UA 3GG2A 2Q1WA 1P3DA 1UP7A 3WSVA 2EKLA 1AHHA 3F4LA 5COAA 2PGLA 4DGSA 4YT8A 2P4HX 1SB9A 5TNXA 1LQTA 3HB4X 1UAYA 4II2A 5KJ6A 3A4VA 4JN6B 5I7FA 4UVDA 3GGOA 4RVSA 5H82A 3FBTA 4YRDA 1X0XA 4YRAA 3DAGA 1MC4A 1T2CA 3SBOA 4QO8A 1G6KA 5IG2A 3PXXA 4ND3A 4ZQEA 4XGKA 1MLDA 4J0FA 3NX4A 4FFLA 3EZYA 5JFOA 2GO1A 4FGWA 1UR5A 4XQCA 2QW8A 1EQUA 1E3WA 1UUFA 5TRTA 1X7GA 1MX3A 3BHMA 1W0CA 3I4CA 2ZB7A 5DBFA 5A3VA 4QEDA 1EVIA 3E9QA 5DF1A 3GUYA 3FWZA 3W8DA 4XDYA 4E6PA 3SLKA 4TSKA 3H9GA 3PPIA 3LK7A 4XYBA 4J49A 4N5MA 2I6TA 4BNUA 1EEHA 4HX5A 3TRIA 1UXJA 1KY5A 1PEDA 5TC4A 2F1KA 4FBGA 1A71A 4M55A 1G0OA 4IY1A 4J91A 3GGGA 4FFNA 4NI5A 5G4LA 1AUPA 4O59O 1PZFA 1PJBA 1N1EA 2VT3A 1NWHA 2UUOA 1WAMA 5A5EA 4IDBA 1ZEJA 1A9YA 4DQUA 1V3VA 4XCVA 3H9EO 3VH3A 4YPOA 3EDMA 2DT5A 3GAFA 3Q2IA 2QZZA 1U5AA 1H6CA 2VRBA 2BFMA 1VSUA 2AA3A 5B37A 4A73A 4YQZA 2ZKLA 3R1IA 3H3JA 1DC6A 2JFGA 3GEGA 3GK3A 4RL6A 4LVCA 4XRGA 8ADHA 1DLIA 1HLPA 3HB5X 1PR3A 3QHAA 3HDQA 4BOYA 5HBRA 4YYZA 5EN4A 4DQXA 3RC9A 1AXEA 4ZU3A 4IM7A 3T7EA 1I24A 3WGHA 2OL4A 5IAAA 4WCDA 3RCBA 3EVNA 3WYBA 3R3JA 1I33A 1XQ6A 2HSDA 4MVJH 5CAEA 1R15A 4I5DA 1Z82A 4RF4A 3VKUA 4MO2A 4DTIA 4KDFA 1U4SA 1E77A 1EDZA 1B14A 3FR8A 5DCYA 1VL0A 3EYWA 5EMHA 4WE3A 4ROSA 4RVFA 4Q3NA 4FQ8A 3S2EA 4ALJA 5L45A 2Q4BA 2XF8A 4R68A 2FR1A 4K6CA 1L7EA 4B3HA 4DVJA 4DWVA 4TWRA 5JO9A 4AFNA 3JD4A 4FJ2A 1P33A 5FWNA 1IL0A 4NK4A 1J49A 2YV3A 3WB9A 2IYOA 2V6GA 1ENYA 3I83A 4CMBA 4E5NA 5K9ZA 1QORA 2EV9A 3H2ZA 4EBFA 4R01A 1B3BA 4YACA 3HFSA 2WDZA 4BL5A 4ZRNA 2YYYA 3EVTA 4XR9A 4IQGA 3AI3A 1PGQA 4PG8A 2JKVA 3PTZA 1IHXA 1V35A 4BO0A 5H83A 4J2HA 1RWBA 2EKQA 4MVJF 2EG9A 1NVTA 3BTSA 3ROQA 3UKOA 4B4VA 4NR0A 2X8LA 4NG5A 5B1YA 4PZDA 1OAAA 1PWXA 4WK6A 4BO3A 2AG5A 5JCXA 3OQ6A 5IZCC 2B36A 1DJQA 2FP4A 1PZHA 3GVPA 3WFIA 4Y9DA 3LLVA 4I5FA 1PTJA 1Q7GA 1LRJA 4NQZA 2ILTA 5A9SB 1HE2A 3PQDA 5U1PA 1SEPA 3MJSA 1I10A 2O4UX 3ZV3A 4PG5A 4FOSA 3CTMA 3WTCA 3FTPA 2P91A 1BXZA 2NU9A 4CMEC 2CD9A 2FWMX 2QG4A 2VRCD 3ANMA 3GMSA 4R3WA 1QRRA 2IEBA 1G1AA 1KEWA 4IGEA 5AQ1A 4GVLA 4PLCA 5B12A 2XOXA 2G17A 4R1NA 3RUEA 4CMIB 1K3TA 3H8VA 4B8WA 1YOVA 4IPTA 3NDIA 4IDDA 5KIAA 5JDCC 3QSGA 2GR9A 5F3RA 5IDQA 1MXHA 2UUPA 4DREA 5JAZA 1GZ4A 3V1UA 4AG3A 2VN8A 1Z75A 1Y6JA 1Z45A 1IHYA 1YJ8A 2B83A 4Y98A 4ZD6A 1ISFA 4PRLA 3WBBA 1DHTA 3K2EA 1IPEA 1N7HA 1KEUA 2GZ1A 1QV6A 5I7SA 3RUHA 4BQPA 2PY6A 3D3WA 1LRLA 5TSDA 2YQ4A 3AM4A 5A06A 1YBVA 1UXKA 3ZHBA 1Y7TA 3Q11A 3DHNA 1EK5A 3MOGA 4BKOA 1FMCA 1WZIA 1CWUA 4RPKA 4CMJA 5I8WA 3QE3A 2X22A 1P1HA 1O9BA 4U5QA 1HDCA 1GU7A 3DZHA 1I01A 4HKTA 4F46A 3HDHA 2NV6A 4YAKA 4CLRA 5TLSA 5JO0A 2CF6A 2VUTA 4CV2A 1U3VA 4GI2A 1M75A 1L1FA 1IB6A 3C7DB 5T8KC 2QYSA 4IXTA 4NBRA 5G4KA 4MDHA 4IIUA 3GHYA 3GGPA 4WLVA 4GWGA 2C7VA 1YB1A 3A14A 2BD0A 3JQ8B 1NQTA 1LA2A 2DKNA 3C1OA 4J4HA 3UHAA 3KYCB 3QVTA 3EZLA 2VOEA 3OEYA 3DR3A 2GNAA 4F6CA 5KVCA 1E7QA 1NQ5A 1JTVA 2EJWA 3EY4A 4XQ9A 3BHJA 1C1DB 3RFTA 3KYCA 3IKVA 3P2YA 3GNSA 2B0JA 3ITDA 3OA2A 3OIFA 3RFVA 3TQHA 2AEFA 5CEEA 2QHXA 1XLTA 3AY3A 3WGYA 3UW3A 4IQ8A 2BGLA 4FC7A 2X5OA 1NVGA 1SEVA 1UZMA 3GFBA 2VZ0A 3DL2A 2VHVA 4PLVA 1ZSYA 5JXWA 4D3SA 4GLLA 3I5MA 1LC0A 1PJCA 4I9NA 4UUMA 2P9EA 1XU7A 1U5CA 1C1XA 3RC2A 5BSGA 4R1TA 3TZCA 2JHGA 2Y68A 1LI4A 3NJ8A 4TVBA 4GX0A 2C5EA 4TRJA 1E5QA 1PGOA 2CF5A 1U3TA 1Q2XA 4RPLA 3OFSA 5F21A 1DIHA 4AL4A 4CLOB 4NFSA 3TJRA 1P74A 1X7HA 1P77A 1HDOA 1ZK3A 3NKLA 2WM3A 3PK0A 1GYPA 2HUNA 1YL6A 4KMSA 4L4RA 4MIEA 3T4EA 3PDJA 3UUWA 4CLOA 3GC6A 4N18A 4BNHA 1JN0A 4Z9XA 2IRWA 2G5CA 1QYDA 1TVEA 1LXCA 3B20A 3CUKA 5L7YA 2C29D 1O5IA 2P68A 4R16A 2VNSA 3CPSA 2D8AA 5HTOA 3KSUA 1ZMOA 3T7CA 3GA0A 3AOEA 5CPFA 3L77A 1FJHA 2GGSA 2YHIA 3RJ5A 2HK8A 3BXXA 4IS3A 3AU8A 3JD0A 3TZ6A 5JAIA 2X0IA 1MC5A 2YUTA 2V6MA 3AM5A 4L4XA 2X9GA 3RUCA 3U4HA 1H6AA 4YTEA 5JC8A 3C1TA 3SEFA 1DOHA 5F1OA 1FDWA 2QZ9A 1GV1A 2GYYA 1ADCA 4J16A 2HQ1A 2JD1A 1T1RA 2DFVA 4G2NA 4J9UE 5K6AA 1R66A 1V9LA 4LMRA 5DZSA 5ER9A 2PD4A 4IMRA 3MCVA 1VLLA 3W6ZA 4YAGA 4PCVA 3JQEA 3KYDB 3VC7A 1N1GA 1O94A 3ITKA 2CVZA 4O6VA 1LSJA 2H1SA 4Y8VA 4BNJA 3BMCB 1WMBA 1WLYA 4LN1A 1NFRA 4YVFA 5G0UA 5ITVA 1EVZA 3V8BA 3KBOA 1E3SA 1GR0A 4JQCA 3S2IA 4Q3EA 2TMDA 3LZ6A 2WD8A 1ML3A 2CSUA 3KSDO 3UXYA 2B5WA 4OSOA 4B7XA 1VSVA 3TZQA 3AK4A 3L0DA 2FRDA 3RFXA 3IIEA 4BNVA 3WWZA 1GQQA 3HE3A 1P9LA 1HZJA 3PYXA 3WOHA 5C7LO 3ZU2A 4MKRA 4R69A 3OJOA 4Y6RA 5ENVA 5GZ6A 5KJFA 3H6KA 1XYGA 5K0ZA 2JD0A 3VPXA 4CMAA 3A06A 1SNYA 3E9MA 2IEDA 1UZNA 5A4DA 1WW8A 1KC1A 1R4MB 1Q7BA 4JGBA 1FK8A 2EGGA 4CM8B 1JWAB 1S7CA 2BFPA 2HKIA 4ILKA 1JW9B 3I4FA 4K26A 4IDGA 2P9CA 4PZCA 3IDSA 4U7WA 1IZ9A 3PWZA 1LDBA 3G3EA 1DIBA 5HA5A 5THKA 9LDTA 4PVCA 1CF2O 1I2CA 3JYOA 1ISHA 3NEPX 4EYEA 4CM6A 2JCXA 1DLJA 3JQCA 3RBXA 2UAGA 4HP8A 3BMNB 2QQ5A 5IXSA 1D1SA 5FF9A 1JQBA 1YRLA 4UVGA 2E48A 3D0OA 5JAQA 4DPLA 3BHIA 1C3VA 1ZZEA 4IZIA 2VUUA 4D79A 2PNFA 4GBJA 4Q39A 1F8GA 4IBOA 3MZ0A 5FYDA 4AJ4A 1MG0A 4OXNA 4PLZA 5KTKA 4BNTA 4WCFC 4XGIA 3TNLA 3RC1A 3I52A 3K92A 4BGIA 2RCYA 3RQSA 3BZUA 3GZ4A 1UXGA 4O63O 1FDTA 4ZQFA 3BA1A 4WLEA 1EUDA 3ZWNA 1R6DA 1ENOA 1DJNA 1ZSVA 4K9DA 3GVIA 5BNFA 2FZWA 3QRWA 4NU6A 1LJ8A 5F1PA 1T25A 4Z0PA 5T6BA 4DL9A 4G5HA 3ZHXA 4EGFA 3K8ZA 4E5MA 1OMOA 3WQQA 2YZ7A 2VNAA 5L53A 5BNTA 4S3MA 4CM9A 3B6ZA 2ZJ1A 2QRKA 1U7TA 3Q9NA 2I3AA 4DLBA 1GL3A 1T2FA 4RZIA 4LISA 3UICA 1T2EA 4ID9A 1XDWA 5ILGA 1Y8QA 2G82A 1NASA 1ONPA 4BKRA 3CKYA 1H2BA 4J1SA 1R0KA 3INTA 3DMTA 3DBRB 3JQBA 4BB5A 1H9BA 3ADPA 3GZNB 4KP7A 3C8MA 2UV8A 3G79A 5DP1A 2PD6A 2NUAA 3PQFA 4MKZA 4EI2A 5G0SA 1NR1A 4QFCA 3KVOA 1OI7A 3NUGA 1PS0A 3HDYA 2CFCA 3NAQA 1FXSA 2AG8A 2Y1OA 3V2UA 5LDGA 6LDHA 3M1LA 4E33A 4FGSA 1HDYA 3G0OA 2VHZA 2J8ZA 1X1TA 4PLYA 4YT5A 2EP7A 1A4UA 1YDEA 3KSZO 4I8XA 3ENNA 1I5RA 4LW8A 4F6LA 4UEJA 1Y1PA 1SO8A 3AWDA 3I9LA 2X9NA 4BNNA 4GL4A 3H4VA 4TRRA 1KYQA 3DEYX 3GQVA 3GY0A 2PLAA 2JFFA 1TA4A 2FY8A 4YAJA 1D1TA 1B8UA 4RLHA 3FBGA 3WGOA 2WE8A 3M6IA 4DQVA 3CH6A 4EUHA 2D3TA 1LDNA 4W6ZA 1MP0A 3V1TC 1E6WA 4QX6A 1SPXA 1SAYA 1W8DA 2IXAA 3FF4A 3TF5A 1BMDA 1XKQA 2PZLA 2C59A 2TMGA 4BO8A 2CDAA 3QW2A 4GSLA 1NNUA 1PS9A 1U8XX 4RV9A 3QP9A 1CERA 4QFDA 3OQ1A 1WMAA 1I2ZA 3U62A 3SJUA 4DBZA 4OKIA 4MVJE 4NBWA 1UJMA 1YKFA 1LBEA 1QKIA 4MP3A 1BVUA 3BMOA 5T64A 2EKPA 2EHDA 1LSOA 2JJYA 5I7EA 2DC1A 2WYVA 4W4TA 4B7CA 4YR9A 5CDYA 2E49A 4L74A 5MDHA 1HF3A 1BXKA 1HDXA 3F3SA 3FR7A 2W2KB 2NWQA 1D7OA 3QWBA 2IDZA 5A05A 5JCJA 2OUIA 4XD2A 2G76A 1DRVA 4BNLA 3FD8A 1E7WA 1O8CA 4B3JA 3Q6IA 5FI5A 3HN7A 4E12A 1UDBA 4LRTB 1UH5A 2Z1MA 2CUKA 1XIVA 3DZGA 3KOUA 3ZH2A 3JQAA 4TRMA 5L3ZA 3JSAA 2J3KA 4J1TA 2ZCVA 1VKNA 3TWOA 2AEMA 3AU9A 1PJSA 3IQDB 4FOOA 2Q3EA 1R12A 3G1TA 3GEDA 4NJOA 2AE2A 3GEMA 1XU9A 2R00C 5LCXA 2Y99A 4XZ3A 5L40A 1JLLA 4E32A 3MJCA 5FEUA 1Q0HA 1X15A 4P4NA 3IUPA 4Z9YA 3ZU5A 2I9PA 1LSSA 2GCGA 3TSCA 1PX0A 1P0CA 3OM9A 2OXIA 1HYGA 4B4OA 3E9NA 3VZSA 3TFOA 2OBNA 2WD7B 2NM0A 1E5LA 4Z9FA 4EZBA 3ZWWA 1NR7A 2WMDA 2BKAA 4QT0A 3AW9A 3L4BA 1QMGA 5B4UA 2I66A 3S1LA 2GZ2A 5LDHA 1CJCA 1VC2A 1ULSA 4INAA 4DLAA 4PRKA 1KIFA 1ZEMA 1VE9A 3HDJA 3ETGA 1WXDA 4UULA 3WS7A 3ANNA 1Y8RB 3ROKA 2Y1DA 4TKLA 1E7YA 4KWHA 3S8MA 4DBVO 3W8FA 3KETA 2GN8A 2P2SA 3CXRA 3N7UA 5DNAA 4CUZA 2WYWA 2YDXA 3BTUA 4FFOA 4IDFA 4D45A 3NRCA 3RC7A 4B8ZA 4U8GA 3ZW8A 4XRRA 2JD2A 4M8SA 1LDEA 1F8FA 3FNHA 2I5PO 5U9CA 3JQGA 3VAZA 4RVGA 5IF3A 1ZUD1 4OMUA 1KVTA 4AJNA 2NQ8A 2G0TA 5GY7A 4DLLA 4EUFA 3Q9UA 4X54A 3HG7A 2AQKA 2JAHA 2X4GA 5JC1A 2NU8A 4FDAA 1E3WB 1YO6A 3EW7A 4PVDA 1YS4A 1ZCJA 2FMUA 3EK2A 5DOVA 3H3FA 5AXDA 3WGTA 3TFQA 2BI7A 3X2EA 4B4UA 4UVEA 5B4TA 1GV0A 4YA6A 3PGXA 1T24A 4FC6A 1PJ2A 4WLFA 1ZMTA 3NT4A 5TIIA 1PS8A 1X1EA 1D3AA 4ZICA 1V3TA 1ISMA 3VPHA 4FPXA 4ZJUA 4BO5A 2J5RA 4TKMA 4BNWA 4BMVA 2X5KO 3COSA 3FN4A 2FR0A 3S2GA 5L9AA 2EJVA 3Q3CA 5G2OA 4BNXA 4WOJA 3WR5A 1JKIA 3P7MA 1BDMA 1E3LA 2O3QA 3QVWA 4CM9D 1JDJA 1WZEA 3JTMA 1DB3A 1HDRA 1VI2A 4HUJA 3LF2A 3VH4A 2CVQA 2O3TA 3L4SO 1AXGA 4ZN6A 4AJHA 3E18A 2D1YA 3ROMA 4CV0A 3I9KA 1CYDA 1GPJA 3KHUA 4UVIA 3V1YA 1I8TA 3UOGA 1DBVO 4XIJA 2HMVA 1AHIA
chains in the Genus database with same CATH superfamily
3GGCA 4RDXA 4CLHA 1DMSA 1HK7A 4X3OA 1F2VA 4P8RA 1Y34E 3LRXA 4LSGA 4UDXX 1O7JA 3K1AB 3VYTB 3W78A 4TS3A 2CXSA 2HA6A 1HG1A 4D96A 3NT5A 3MG9A 3PQ3A 4HQFA 4U2BA 1MTOA 2BN4A 3E3MA 5DNVA 5HQ3B 5LWQA 1TF2A 4UTVA 2HNKA 2FPSA 4LNUA 1ZNQO 1QYWA 1QVRA 2CUZA 4NBUA 1RADA 5FKJA 4CODB 3MJHA 5AVWA 2IYTA 5CAEB 1U9IC 3OEEA 4D4IA 2WYUA 3WP1B 3EWNA 4GWLA 2FX3A 1JFFB 4MLPA 1IC6A 2PKXA 5AHOA 5HIIA 4N7BA 4MCIA 3PDIA 4BJHB 5ITWA 2BH2A 2GEKA 3UV7A 5HK9A 2O23A 1MFPA 2IITA 1RLMA 2EWVA 3BF7A 4NRDA 4YCAA 4ZI7B 3WRYC 3O9ZA 2WNHA 1LFDB 1QH8B 1KBOA 4HEQA 2Q5CA 2YV5A 3AKCA 3PB3A 1PD1A 4NNJA 2O1EA 3DEAA 1RBYA 3N2LA 4ZI7A 1ULUA 5KMGB 3MQFA 4C4SA 5TJHA 2DCMA 3EOBI 3WSTA 2Z6VA 5C8YA 3TMAA 1UBUS 3KU4A 1Y9AA 5B1HA 1U9YA 5EKDA 3UJBA 4DM3A 4D4GA 3PNQA 3LS2A 5A03A 2BE9A 4RHXA 1HFWA 3DOIA 3UC9A 3I01M 2I22A 4EPWA 1LNZA 1ZM7A 5FNZA 5EP2A 2JLCA 3KRTA 3AZQA 1JEDA 4O0MA 4JBXA 3IAS1 4FCCA 3K9BA 1ESCA 3BL6A 1UK7A 1LJUA 4HDNB 5KYYB 5GIOE 1E9EA 1JEQB 1K68A 2II6A 2QE6A 5JROA 1XNGA 2GHQA 2J09A 1HE5A 1CUSA 4CLEA 3B2EA 1E1DA 1NMZA 5DLDA 5HJEA 5CD1A 1D2HA 4EPTA 3DOJA 3DZDA 3ROZA 1UL1X 2DFKB 1RJWA 1V6SA 3ORYA 3V4OA 3QI7A 4G24A 4FUTA 1SUSA 1HE1C 1ZVQA 2B3DA 5TF4A 3FHJA 4AJJA 5AM2A 1RLJA 4H18A 4KVAA 1E3MA 3SR0A 2IYQA 1C9NA 4D82A 2PA0A 2XZLA 7REQA 2ZIXA 4RX1A 3SNHA 4YCJA 1H23A 2RK3A 1FYVA 3L7DA 5K0LA 1ZRMA 3JQAD 2DPYA 3ONNA 4L78A 1J0XO 4YNBA 4QUKA 3LC2O 2IYUA 4KO1S 2A9QA 4RETA 4ZHQA 2E37A 2YVLA 1QOQB 4ENTA 1MCZA 1VL6A 1GKKA 3QK7A 2VJOA 3K4QA 1O9GA 4EBBA 1KYVA 3VX3A 5DOZA 1J0AA 5JT1A 4YCSA 4WOPA 4U2EA 2Q0SA 3D6HA 4OH1A 5BUCA 1M7BA 1YOVB 3G7UA 5TY0A 3KJHA 5DHQA 3EA5A 2BMDA 2ODTX 2IY9A 1Y37A 3KOMA 2PUWA 3IP1A 3RGWS 4ARIA 4YUYA 3D7LA 5IFKA 4TV8B 2CHUA 2ANCA 5CUQA 1YHNA 4Z8XA 1U7WA 3FGPA 4H60A 3NKVA 2HZ7A 2OBMA 4ZCIA 1ZD9A 2WZDA 4YK7A 5DNCA 3BJEA 2DR0A 3G2KA 3DZKA 3IEIA 3NVMB 1R0YA 5D51S 1KEEB 2RIPA 4Z49A 1IJEA 2GPYA 2HRDA 1SKYB 4TQUS 4NZ9A 2IHBA 4FMCB 4BJ6A 2ES4A 3IERA 3UGQA 4EHNA 1V96A 4MYDA 4UHKA 3QVGB 2DUUA 3INRA 1TM7E 3A9UA 1KEVA 1GLVA 1O97C 1ZKMA 2D8MA 3I32A 4X92A 4Q9KA 1IY9A 1HLDA 1EU1A 2B5VA 4OYRA 1N2XA 1WTAA 4CLRB 4WBNB 2VNHA 4W7HA 1M2EA 1WEKA 2PH1A 5B6IA 3B7PA 1FOEB 5C2JB 3KDPA 1SIUA 2YFHA 4G56A 2DOKA 4OSEA 1N2ZA 3ZVMA 3DONA 4JYMA 5J3JA 5HUHA 4PWZA 4QXAA 1GGNA 4O2BB 2M6KA 5HKKD 5BNZA 1AMUA 2QX7A 1U1IA 3BD6A 1PT7A 1KAGA 1ZVKA 4ARZA 2ZVQX 3AI7A 2R84A 3DBHA 3PCXA 3NVAA 4MGZR 5CRIA 5AUOB 2M98A 5CDUA 1G20E 5E6RB 2OLKA 5ALVA 5JHHB 3IBCA 4IJUA 1WPRA 4KDEA 1SVNA 2XCRB 5LIPA 4BC0A 2IP1A 1TA0A 1XP5A 2P4EA 3C7AA 5LUBA 3ROEA 2PKRA 2XMPA 3MC1A 2E55A 1I7SB 5KEIA 2IKQA 3B3AA 4K9RA 1LBSA 1AUQA 1UIMA 1W25A 4UEOA 4MGHA 4LSMA 4OQFA 5IHXA 4TT3A 1U2TA 1UJ4A 3R7LA 4EUEA 5IAEA 1KHHA 4DSTA 1GL9B 1DKPA 2DTEA 4PSKA 1DC5A 1ZBQA 2RIRA 4P4SA 3ZHSA 2YIDA 1J00A 4NDAA 4BP3A 3AKDA 4BU0A 4OPMA 1XDGA 4K1LA 3HB1A 2BJWA 4B71A 1PR4A 3NP9A 1Y3DE 4GP7A 4QSMA 5HZMA 5T67A 2FUNB 3BMQA 3K2BA 5GAJA 5T8KA 2M2IA 3HEBA 4QRDA 1RXIA 3W2TA 4EENA 1Y3FE 1YGYA 2XSZA 3R3YA 2X7XA 3FTQA 1A5AB 1X1BA 4G8BA 2IPAB 1EQ2A 3EMVA 4R8MA 4TMFA 3K0KA 1U0FA 1U2DA 1WV1A 2O8EA 2KS6A 3VZRA 4XI9A 1BE6A 2VTKA 4P7KA 4QREA 2EC5A 3OQIA 4ZT6A 1C50A 3TD2A 5DBIA 5BO5A 2RKBA 5IK2A 2YH2A 1EZ4A 3WWDA 2Q2NA 4JI1B 3BDAA 3LGAA 2R2AA 3W05A 2LKCA 3RT1A 2G5GX 4AJIA 3B8HA 3H7AA 3ADDA 4UUOA 2NO7A 3ESRA 5GPBA 1YQUA 4IJ5A 4C0SA 5ICCA 2DPLA 5BSMA 2RBEA 3VKHA 2O8BB 1PEKE 4YWHA 3WRVA 2B8WA 4GM4A 2V65A 1ZK2A 2IHNA 4NBVA 2FR8A 2A0FA 4Z2YA 3C8DA 2CVPA 3L7NA 1NC3A 3MVEA 4LQDA 3ZHRA 5ALTA 1SH7A 1CFZA 5HDQA 1G8YA 2H2AA 2JGJA 1NJ5A 1QC5B 5M7EA 2ZBGA 3X1XA 4RQBA 1HDEA 1CJSA 5LB2A 4Z3KA 2VH1A 1VM6A 4PAGA 1ZM9A 3RM3A 4BQSA 3TNJA 1LLCA 4PO3X 1ZGGA 1ULTA 2ZJ0A 4FMDB 4QVGA 1JEOA 1K08A 1MA3A 1AK1A 3SVTA 2OK8A 1FXWA 1MH1A 1RAHA 1YBMA 1Z08A 2H7YA 2P3OA 4NIMA 4OF4A 1D0SA 1H3FA 1IN7A 2EATA 4JQOA 2QRLA 3D2AA 3M6LA 4IMIB 1OLUA 1FNCA 3ZE1B 4BLVA 5JPDA 3V4LA 4AZVA 4TL6A 4AY2A 3OEED 4Q01A 4A23A 3A6HA 4NMXB 1FCJA 1VKZA 4M7PA 5ALHA 4Q7MB 3NS7A 4FZJA 5TMDA 1KJ9A 1P6UA 4GG1A 1T6XA 4G0XA 5EYPB 3JQ9C 3FMFA 2BKVA 2VXOA 4MKXA 4WZBB 3TEMA 5FBLB 3PE6A 2XB8A 4I9UA 4HR7A 2C83A 2JLXA 3LC7O 3GI1A 1EAYA 1J22A 4WZBA 1E2DA 2IYYA 3ZUPA 4C3OB 5ARBA 1PT6A 5IT9A 1M5RA 4IRUB 4CTOA 2LNDA 5TE9A 4IHJF 4QDJA 4ZCSA 1Q1BA 2FK8A 1CUCA 5T3YA 2UDPA 3FCCA 3H9QA 4GR4A 1ZN7A 2LGJA 5IDXA 4G5YA 2DLCX 3NTRA 1THTA 3OCVA 4BIIA 3WNZA 3GVXA 5CT9A 4CDMA 1GPUA 2GX6A 3DDZX 2OCPA 4WLOA 1EFAA 4DCOA 4B3SB 1FFWA 3PYLA 3O4RA 3O9VA 2QTMA 3LC1O 3OIYA 2GTHA 1P44A 3IHKA 4HWSA 1WCV1 2MOKA 3A2MA 5CIYA 4EFLA 3LO8A 3PPVA 3DCJA 3P8ZA 2RJ3A 3LUKA 1NOJA 3Q1KA 4Y6SA 5TQ0A 3TDNA 4ESVA 2H7XA 1RABA 2WJPA 4RPIA 1G6OA 3CISA 2O20A 3UUGA 2YWJA 5B7GA 4TPKA 1BD3A 1UPXA 1P45A 4Y1FA 1E0JA 1O6CA 2ZT7A 5AKHA 5G0VA 3VYVA 1SHKA 5EE1A 5G0WA 4AP6A 1SA0B 4ZA2A 1ZH8A 1ZR2A 2FSSA 4Q1AA 4J2OA 3U6BA 3G2IA 4RKQA 4UBIA 4YXFA 3VUFA 2A9PA 5KNCA 1VCNA 5BQPA 3HKDA 2A86A 3MXTA 2CFRA 3AV0B 4BDTA 1X8KA 1CUIA 5IYZA 3S55A 3OUTA 4JBGA 2H63A 2PVSA 3CRMA 3EISA 3OFNA 3SVLA 1XLUA 4QUDA 1BX0A 2RGNC 3K31A 1DU4A 4KQ2A 3BOSA 3WNDA 2G25A 4YCCA 4EW3A 2XXJA 4FNMA 1JALA 2EGHA 2W42A 2QLTA 3ZNOA 3ZCUA 4IJMA 2EX0A 2W5UA 1MGPA 3Q6MA 4MULA 1II8B 1NWCA 1VPTA 2R87A 3AY7A 1FL9A 2VAPA 3C8HA 4B1FA 3FMGA 4P5DA 4FYIA 4KLZA 4I9GA 1F5NA 2VAMA 4BCCA 1K5PA 1P2FA 2I4TA 3AY6A 3EZ6A 1QP7A 1XRQA 3HI4A 2XMDA 2HHLA 4JP2A 4GRAA 1XSEA 4PGAA 3DL4A 1Z6GA 1ADFA 1H2RS 2V4ZA 1B16A 1S3FA 1HPLA 1YDFA 2H18A 3RRYA 1DP4A 3KE9A 2R86A 3NTUA 3N2EA 2CE7A 1NAIA 2J3DA 2XKBA 3HKCA 4MVJA 5GVRA 5C7YA 2WBLC 2UYCA 2J1LA 3VPSA 2QB5A 3MT0A 4BNFA 3OQOA 2MINA 4OAOA 3DTVA 4UJ3A 1YZKA 2JIDA 1GRNA 3ZVLA 1RYMA 4F4CA 1EK0A 5KOIA 2GO7A 1NBHA 3LSYA 3OF2A 2Z98A 3AHHA 2DG2A 1I3NA 1XZIA 5ED0A 5E3HA 5BUZA 1OWMA 2FRXA 4O2AB 4CXMA 1RACA 4IDUB 2GAAA 2GN4A 2O7SA 2X9VA 2PT9A 1YJAA 4JP3A 3QLEA 3ZWCA 5KHOC 1ORIA 1W0JA 2RB5A 4PZLA 4XA8A 3LL7A 4YAWA 4AIRA 2C0CA 1T5IA 1Z5GA 3BGWA 3EQ6A 4QDKA 1FEZA 4QPZA 4XPZA 5EHGA 2G4VA 5JALA 2LDBA 3RF6A 5GTDA 3WLQA 2XVXA 1POXA 1CU1A 3OIWA 4RANA 3GP3A 1YR2A 2LWIA 1Y8QB 2DB3A 1GGVA 1FLNA 2R2GA 4OEHA 4ZV9A 4HZIA 5CNKA 2GDZA 1BX1A 1MQ8B 2O8CA 4QOFA 2ZIVB 3ZDDA 3I8OA 3N0WA 1G8HA 3AUTA 3CJQA 3RVSA 3DEZA 3RYCB 1PJAA 1NRXA 1P9RA 2GN2A 2EFGA 2W58A 5F76A 3LI2A 4UNPA 3T1VA 3ABOB 2Z6QA 1RYEA 3BCRA 3L9WA 3NIWA 1T5TA 1PNQA 3EEIA 4R3NA 5BYJA 2ZBFA 4EHJA 1ENPA 1W88A 4P4LA 2A0WA 5HRCA 4LNAA 2CDCA 1YJCA 3TSYA 4LCBA 4XASA 5DP2A 2R66A 4TT3D 1QIGA 3D6TB 4KXYA 5K45A 3QJ5A 2DR3A 3UHOA 4K86A 4LZJA 4DMCA 3DE4X 4DVGA 1OIWA 1MVLA 1V4NA 3M4NA 4FGLA 1CY7A 3USCS 1LK7A 5JG7A 2WUGA 1XZEA 1S01A 3C5HA 1U8UA 2Z58A 3WRWA 4YJGA 2ZYAA 2IP4A 4QT4A 3K1YA 2K4MA 3N2KB 4MICA 4YV7A 2JLBA 1NQOA 5H59A 1AO3A 4U8HA 2PUBA 3FNIA 3UG6A 3DC7A 4GYWA 3ENZA 4IF6A 2PWPA 2XSZD 3TEFA 4WLUA 1M8JA 1OTHA 4UHCA 5EXTA 2I0FA 3H5RA 1G7SA 1FQJA 3DCIA 4KKVA 3AG5A 4KUGA 2G4CA 2IOYA 3GCZA 4RGBA 3GPCA 1HWYA 3L7YA 2EEZA 2HRRA 4QATA 4Q9IA 5KSPA 3N2GB 1NXOA 3FTEA 4LAFA 4UNQA 3U26A 4XXHA 1HDIA 1KJJA 4XPIB 1ECJA 4LYFA 1OTYA 2XWPA 3WHPA 5IK2D 4DCSA 4YV1A 1WA5A 2BBOA 2QR5A 3CLUD 1VHTA 3JQ6A 3THRA 2FCAA 1X1RA 2WF6A 3REFA 5BQ3A 3TB4A 1PFWA 3AEUB 3I64A 3EF3A 5CLGA 4ZI3A 1LC3A 4YDQA 4Q7KA 1FP2A 2IPXA 3KVYA 3LUJA 3P9IA 5JRZA 4DIBA 3FPFA 2JFHA 2RGEA 1NMYA 4WNIA 4E5UA 4U9UA 4B79A 4FXOA 4MV0A 3GOQA 3L3BA 4BBZA 3NWPA 5KYGA 2EARA 2EFYA 1NXTA 2WTEA 5ARDA 1P72A 1QLHA 4M1WA 4OBEA 3RYFB 4ETWA 5F51A 4EW1A 1KZYC 3OETA 3A4MA 2GUWA 3VC2A 1KVSA 3K2IA 1PEAA 2X8JB 3V8VA 2WWGA 4DPKA 3A2NA 1KAQA 1GZ6A 1B0AA 4P80A 1B23P 5FPSA 2DHEA 1N5JA 3QX9A 3M9WA 1DJPA 1LBQA 5TQJA 3UMVA 3DDHA 5EHQA 3DSRA 2GERA 1FIUA 3JQ7A 2IBSA 1I4DD 3GT7A 4YRSA 1AH2A 3ILVA 2ZBDA 1MQ9A 1T34A 2HDHA 2V7TA 3MIZA 4HJXA 5FWDA 1DGQA 4FNGA 2H5IA 4CF6A 3OFVA 4BYGA 2C5SA 2JAQA 4ZDJA 2CKMA 4MB0A 2O8DA 1UQTA 2AJDA 1KZ6A 1JLKA 3HCPA 1W36D 1NQWA 1WCYA 4QICA 5BOSB 5JLJA 4PG4A 4PHFA 4XQEA 1CEXA 1HH4A 1V8PA 4Q9NA 2F3UA 2IE0A 2WABA 4XJSA 4YAEA 4EPXA 1ZNZA 4D6PA 3NOOA 3GFPA 1G3IA 4G85A 3BE4A 5BN1A 2GJ9A 3K5PA 3DE1X 1NG9A 2XV1A 2J9XB 3CF4G 5DBOA 4NK5A 4DV1B 4NZNA 1JYEA 5CIWA 1VE5A 1JTFA 4I6GA 5ICFA 3L7LA 1DARA 3BH0A 5D5PA 4R8RA 3T3PB 3R6DA 3OOEA 3BT7A 3P9KA 3QE2A 2GD6A 4IL5A 3ASZA 1ZFNA 1AUXA 2IHJA 2JLRA 3LY5A 4HN2A 1IIBA 4A10A 4PXYA 3SIXA 4CV3A 2E85A 1M54A 1R0LA 2W2NA 3P5BA 4MW0A 4CM4A 3E8XA 1M66A 3D0QA 2B4TO 2J45A 4DG8A 1W73A 3K6RA 5FRDA 2XQJA 2VNIA 2ZSBA 3IKLA 2CJPA 1Y1QA 4LRUA 4C4AA 4TWZA 2J0SA 3U80A 4CL2A 2C3UA 3G5UA 2XCLA 4IVNA 3PXGA 5KBYA 2CXOA 4D1YA 4HDKA 4G4GA 3H5OA 3C14C 5JATA 5EKUA 2ZRIA 1BMTA 4NJEA 2HCJB 5KNCD 3GNLA 1FNNA 1NYLA 1Q92A 3RABA 5JV5A 3D5EA 2ZYSA 3AHFA 1A9OA 1NI3A 3OKFA 1YI0A 3F5MA 3UHJA 1BS9A 1JJIA 3NHKA 4CQLA 1OXTA 2JFZA 1FFXB 3OFND 1JSCA 3B8EA 4GT1A 1TAHA 1D2EA 2DPGA 3B5EA 1V8DA 4FB5A 3P45A 4LJ6A 2G6BA 3K9QO 1T9GS 4NOLA 1FYDA 3WGZA 4BNYA 3LVRE 3LG2A 4GLJA 3ZDXB 3IKTA 4LXQA 3JQGB 4UD6A 1JQDA 3C16C 4XIIA 3FKSD 3SHVA 1IY2A 4FDTA 1XAJA 1P9OA 1R9NA 1Z2EA 3I76A 3OJ0A 4EDHA 4LYDA 4Q4LA 3JSXA 1KI2A 3CUWA 4TUYF 5ANRB 1V71A 2WSLA 3IE1A 3ETEA 2FUCA 3D0KA 3OQVA 4UKDA 2NU8B 2V7EA 2GCOB 2OCLA 3HZRA 2ADFA 3KQTA 4ER5A 5F98A 1DBRA 1VHLA 2D2EA 3OJLA 1VTKA 2NU7A 3H7IA 4NLLA 4E21A 1JG4A 4LDPA 5E4YA 1YS6A 4MVJD 4C2TA 2WJHA 4LXHA 4Y2QA 4OHYA 4XUDA 1DRUA 3BB4A 3UB2A 2J4FA 3A32A 2O3JA 2V9ZA 1N7IA 2VDJA 4PFSA 4BTVA 5IJ0A 4JU9A 4J43A 4ND8B 3GN2A 4ZVSA 2P77A 1ELOA 2ZQZA 1TLTA 4V0RA 1CF4A 3ZHZA 2GZSA 3ZG6A 1L8AA 1OKKA 1UJNA 2NO4A 1DFHA 1JMYA 1AQNA 1RWVA 1CRPA 1B41A 4OIFA 3TUJC 5K05A 1NUTA 1ZD5A 1W0JD 4RY0A 3A04A 5C46F 5LQUA 2PU7A 2WVGA 4YT4A 1SQ6A 4CL8A 1V45E 3I04A 3V32A 4RNCA 1YIDA 4L8LA 1BDHA 1IPHA 4LRQA 5JBIA 4QLOA 3AJEA 3PNPA 3NYIA 4ZMBA 2OQRA 2P1ZA 3C4JA 1NUSA 1JE0A 4I55A 1QZTA 4XSVA 4BFVA 2BFBB 4KQ1A 1H5QA 4RQUA 1H6BA 3N86A 4DUPA 3ZDZB 5EXEA 4ER3A 3GFTA 1X13A 4OHCA 2AZMA 1OV6A 1F8UA 5CX1A 2ZI6A 4S1VA 4YI5A 1V0JA 4D8VA 2BMAA 2JDID 1JFRA 1ORDA 2OXFA 3FPBA 3I92A 3LVBA 2C88A 2OUKA 4BQRA 5JTTA 1BHJA 4QOEA 3OH8A 4MQ6A 4G4IA 3C97A 3R3HA 3MWLA 2R7LA 1S9HA 2GWRA 4L8WB 4ONEA 1QQ6A 1ZHFA 1IIRA 1CRZA 3OZVA 5AXBA 4B32A 3BERA 8GPBA 3DT6A 4DXHA 1PFQA 4MPRA 1ABFA 4Y2HA 2VR1A 2P4QA 1JDBC 2ONYA 3MK31 1N3IA 1MVNA 4FKZA 5DYYA 4GE0A 4ND5A 4WADA 1AUVA 4B3BA 1PD0A 2ZWAA 4DIUA 3F7MA 4H77A 1G5FA 2AFIA 3EVEA 1D8TA 4UASA 4UHJA 1L5HA 1F2DA 3VZCA 3WQSB 1DX9A 1L8XA 1QWSA 2RBKA 5F5XA 1WB6A 2BGJA 3HWRA 4JI8B 1PFVA 4OJTA 2QWXA 3FMVA 1DAHA 3KB6A 3HRHA 3T4UA 2H4YA 5DM4A 1ZI9A 3HLYA 1AD2A 1F0PA 1YKGA 3CVOA 4X93A 5DSTA 4BLOA 1P1JA 3TOXA 4UNRA 2BHRA 2OHFA 1O9HA 4CQNA 2EQAA 1GCUA 3IX7A 3D8HA 4FDUA 2ZWVA 3GLSA 4H7PA 1XD8A 1A0OA 1Z7GA 5CBKA 4AXXA 3DEIA 3ODPA 4XW2A 3ROPA 4ER6A 3G2NA 1RXCA 2A5FA 3HR7A 4WXEA 4ZQGA 4FMBB 4Z1MA 2JNWA 3ZV4A 3WBKA 3HBLA 1RYZA 1ZK1A 1J0EA 1JIKA 1CFJA 3RSCA 3STXA 5CB4B 5SZIA 1LTHR 1UXHA 2YINC 5DLEA 3SHWA 1G5QA 2AWOA 2FUG1 3K72B 5ALXA 3VPDA 2ZPTX 1E9FA 1CY8A 2ZWMA 3IC5A 4QAQA 4XIYA 5B30A 3OP4A 3NBAA 4WUTA 4KTTE 1PBTA 5FCDA 1IVYA 1UK8A 1DV1A 1XG5A 2GRUA 3VC3A 2QQFA 4RVUA 4F93B 5KJEA 3NC1C 4C76A 2DBYA 3ECAA 5B4VA 2XDQA 1T9CA 3RD5A 3SBDA 1U4OA 1PTJC 4EOGA 1E58A 3B1WA 5F1KA 3CVUA 4QYSA 3AUKA 4HDQB 3GGJA 1DKQA 1DBPA 5DTRA 2XZDA 1PSDA 4MOWA 1G60A 5EQFA 2PJZA 3C3YA 2B1QA 4ON9A 3OBBA 4RAOA 4WECA 3VAAA 4OGKA 4BEWA 4WX2B 1MPTA 3QV1A 4E5YA 1YMQA 2JGLA 4Q03A 4HX9A 3IEPA 2P5TB 5BVHB 3BYZA 1SVWA 5H9WA 5ICEA 1CUAA 3S4YA 2JG3A 4WK4B 4C78A 2DFNA 2CLFB 1PWHA 4EG5A 4PO9A 1VXRA 2IOHA 1L4FA 2YRWA 3O9MA 2G09A 4KAXA 2XZTA 1MZPA 3FNFA 4WJZA 1VJGA 2GTPA 4ACAA 1XJCA 1P81A 2AEJA 1GYQA 2IA5A 4P5PA 5IMSA 4O08A 5H02A 5JBQA 3OCYA 1XD2B 2QXYA 1SUDA 1WULS 2C0PA 4Y2VA 5CH3A 1KSHA 3I05A 1GDDA 1GGHA 4LRSB 4ZOLF 2ZATA 2ZSEA 1EVKA 2PT6A 5FTWA 2JI9A 1OLXB 3ICPA 3OEWA 4PFQA 3ZWOA 3RVBA 4ASUA 1T1GA 4UPDA 4EAAA 3JV7A 3P26A 3QEKA 4MGKR 1QSGA 5BW8A 1OLXA 1XQYA 1G5IA 3RREA 4AZSA 3NGLA 4MS3B 2B2NA 1QONA 5A9SA 3C6ZA 3EMDA 1F51E 1J4AA 1XZPA 3KKEA 4KLNA 1JZSA 4GBGA 3S1AB 4RF3A 4C07A 3NCHA 3QVSA 1RE1A 3RANA 4TYNA 3N07A 4ZZIA 3KHKA 5LQNA 3KQVA 1FP6A 2J4CA 1C7FA 2P2NA 1NX6A 2NXEA 4IUYA 3AF3A 2J6IA 3BIWA 4GYYA 5D2CA 5CDFA 3ETDA 5FAXA 5AIBA 1PR2A 2XKJE 4WZZA 1AK9A 1TM5E 2GF9A 4QJIA 1ZOLA 2AT1A 1UP6A 3NRBA 1I3LA 4BXOA 2ANBA 4OQXA 3PR1A 3U3ZA 1TQ4A 4CMIA 5K4GA 1GCIA 1R0BA 3IIIA 4LXYA 4EHHA 3COZA 2ZYUX 2WF9A 5EJFA 1I2BA 2JAOA 4L07A 1UPAA 4CQMB 4FFBB 5DIZA 2K2QB 5F7OA 1RYFA 1IQPA 5I8PA 4RVDA 4C7MA 3M3PA 4P3YA 1RLUA 4D92A 1PJ4A 1A7KA 2BTQA 4TWBA 5FUQA 4FGUA 2DSNA 3ONFA 4Q02A 1G8AA 2J5BA 4F0JA 3FHCB 4Q34A 3HVIA 4Z6KA 3ZNQA 3QBTA 4ADSG 1N34B 1EVLA 5FOUA 4Y6OA 3RRJA 2UZ4A 3QA3E 1KDYA 1NONA 1WQ4A 1GKYA 1YVRA 2BZ1A 3AUUA 3FG9A 4NMMA 4IG9A 5IU6A 2NNWB 3VNUA 3OTHA 3OEHD 1FSSA 1K6IA 2H17A 1OYOA 1PK7A 2HK9A 2P7IA 4NG4A 3VBEA 1QE5A 2FUEA 5K4AA 4AY5A 5AJYA 5BR8B 3W6NA 4XYGA 4TQ9A 3WGQA 2VH2A 3CG4A 5GGXA 5T7BA 2R1VB 1D2AA 3H0EA 1P0MA 4D8XA 1C3JA 2BWJA 2QSZA 1U8YA 2ZAYA 2ZQ5A 4R1SA 4PNZA 3TZEA 3VDXA 1E18A 1XTPA 1Z6AA 3H99A 4M7RA 1HTBA 5IDYA 4PN7A 4OQQA 4QLAA 2G83A 2JHAA 3SKXA 3OAAA 1U28A 3KM0A 3IQFA 3CNQS 1GTSA 1U7HA 3D6MA 1DUVG 2H7CA 1T3ZA 4GOLD 2JARA 3UT5A 5CA0B 5I7HA 1S2LA 1BKYA 3RRMA 1CS0B 1T3SA 2JFXA 3M5DA 2GILA 3GLTA 4O0LA 3RF7A 4ZOEA 4EJ2A 4ISBA 5DM60 4YMGA 1OW3B 3VRHA 3RAJA 1X7ZB 2VUIB 2AF4C 4EUKA 2CJFA 1U0HC 4R6XA 4CDRA 4EZIA 2NN3C 1TZJA 3WGNA 4GKBA 1D2MA 5NULA 2QROA 4AYXA 4DSAA 4MV8A 3T3GA 3WMXA 1C29B 2B2XA 1UWVA 2G9NA 4CIYA 1EBBA 3A1DA 1TC1A 3L7CA 2XCQA 1U31A 5IZ4A 2N0SA 2O3RA 1XROA 1A2BA 2XAAA 3BGVA 4IUCS 2NACA 2IJGX 4HTAA 1E9CA 1HOXA 4N82A 5AKJA 3W7VA 4C22A 1J20A 4CFZA 3LUFA 3MJDA 1V8OA 1K88A 1GNSA 2C5FA 4P33A 5TT0A 1RR6A 3TQQA 1P2DA 4D26A 2QN9A 5HNKA 2OV1A 1LU9A 3DDWA 3JWEA 4PYRA 1A4RA 2IYLD 2ZI9A 5AW1A 4C7XA 4NZPA 3TIVA 4GEGA 1AGPA 2QN7A 5DPMA 2FLVA 2GPWA 1BDIA 2PUCA 1PJ3A 3D3JA 4IDHA 1Y1TA 1KK0A 3EPLA 3Q12A 1IEXA 2DFTA 4OI0A 3F3MA 4KL8S 3ZN2A 1J2EA 3M5PA 5AKLA 3Q7TA 4HZUA 2AZTA 2ZRGA 3FUUA 3MT9A 4RD6A 1TQ6A 1EWRA 3MTEA 4HBGA 1XDBA 3DDNA 4QEZA 5FV4A 2AD5A 3B1FA 2ROQA 2RH4A 3K05A 4N7MA 4X95A 3KJFA 5AKKA 3R7SA 4B76A 3AJAA 3VZDA 3A31A 3G59A 2PUJA 1CY6A 2VWGA 3SOZA 2JJ2D 4E11A 5DMXA 4YT2A 4QD3A 2GHIA 2L69A 5A62A 3IP8A 1NYTA 2H3HA 1WUJS 3LPNA 3PIRA 4RHYA 5FADA 1KAHA 1T5LA 1E66A 2YWGA 4L08A 1XV5A 4QUAA 3X43A 3QLVC 2C8VA 3HUDA 1RZVA 2EFDB 3RBVA 4R2XA 3AG6A 1AS2A 3FWNA 4Z4IA 4OYYA 3HZZA 1JDUA 2TRSB 1OXSC 3MBIA 2GM4A 1N9GB 4G1MB 4Z1MD 3K7EA 3KT3A 3ZGLA 1FUIA 2DWUA 4JVSB 2C3OA 4N39A 3VKFA 4ZJYA 3WLHA 2WC1A 1VFNA 4KFSA 4YRZA 3F47A 1L7PA 2NQ2C 1HA3A 2N1BA 3E2IA 4OATA 1IUNA 1LLUA 1QTIA 2HMUA 2KMLA 3CH4B 4IHQA 3IR7A 3GFRA 3E0XA 2R5FA 1PL6A 4OHXA 4V38A 1X8XA 4QJ5A 2GEFA 3W3AD 5CEJA 2C42A 1XNHA 5FBKA 1QV9A 3I9V6 2MTBA 4FYVA 3UK7A 3LM8A 5FD8A 1BDBA 3UPDA 1G2QA 4FD3A 4CGYA 1D09A 3WIDA 3Q7IA 3O82A 4A7PA 2R6JA 2VPXA 3Q7PA 1VMAA 3BF8A 2MR5A 2CD7A 4D9GA 5FQOA 4C0WA 1KO8A 2VBCA 4JVOA 4OAQA 4B74A 4FJ1A 2WU1A 3EASA 2HPAA 3F8WA 4DLPA 1FPMA 5KJCA 4L15A 4A0RA 3VKGA 1A8UA 1HDZA 2A9KA 2DUWA 1N92A 4IGAA 3T8YA 1P5RA 3QG5A 3ZWBA 5L4SA 2AC4A 2OGWA 1ZCAA 1RVV1 1VMKA 2QTGA 3HO8A 4WESA 5KYUA 4BFLA 1Y0BA 5A02A 2R6AA 1IZ7A 1Z34A 4OUKX 5K20A 2V55B 3R20A 3TZKA 3OT1A 3U9LA 5ADVA 3CW2A 5DGTA 3ZKWB 3OCJA 3SPXA 3UA3A 4XVCA 5JZMA 3P4XA 2Z95A 2BEWA 2RGRA 5DN6D 1B0UA 3GHHA 3I9JA 3RUAA 1Z4NA 3DLPX 2HA5A 5IPFA 1XMSA 1SHLA 1ONOA 2IZ7A 2O2SA 2OHOA 5DVZA 1DKLA 4QIHA 1TIPA 4E2YA 2JZNA 4LK2A 2VP4A 2ZM6B 4LJ5A 1XQXA 1LNQA 1MUUA 4QDTA 3KWJA 2HBQA 4MVJP 4DKJA 5ADHA 3CJTA 2JS7A 1UKZA 2YFQA 4WMLA 3N9IA 1DWOA 1UMBB 2HL6A 2W4QA 4B82A 4LQCA 4DR5B 1NV8A 1WHSB 3DD1A 3QNWA 4WLNA 4ASUD 4D9HA 5BUSA 5L6LB 2ET6A 4UATA 2I7VA 4KO2S 2C5BA 2COUA 5D84A 1VECA 4M0LA 3I2HA 1O6BA 2D2IA 3GFFA 3KYJB 3M2TA 5DX1A 3ZTYA 2KYRA 1ZNYA 1QGED 3V9PA 3WLNA 1XQ1A 1NN1A 4IV8A 2P5UA 3ZV7A 2SCUB 5KCMA 2JEYA 1BXRB 1VLQA 1IWOA 3KZCA 2PV7A 4F92B 2XT6A 3JVUA 1OB5A 3CV3A 3MJ4A 5D5QA 4DZZA 1X87A 1NVXQ 4MW9A 1NY5A 2PPLA 4DIOA 4G9GA 3SQOA 1FPQA 5SZHB 1FUKA 1HQDA 3TD9A 1CEQA 3I2FA 4OJKA 4BP9A 4CMGA 1GPDG 5IF9A 1WB4A 5JS6A 4I50B 1XCBA 1ATZA 4R6WA 1FYEA 3H13A 1IOLA 3L0PA 1SXPA 2R65A 3U3JA 2VFAA 3EQ2A 3MRXA 4DA9A 1XHEA 3FYUA 3RGGA 3S2FA 4A27A 3GIWA 3OQPA 2A4KA 2C94A 4I50A 4QGAA 4FFDA 3SXUA 3E81A 2H65A 3ORFA 2RGAA 1II0A 3I1IA 1L4LA 2DM6A 1AIPA 4L5YA 5CVUA 5K1ZA 2IEZA 5TEWA 3UJPA 1L7DA 3P5SA 1JDNA 2DPXA 2BY4A 3KZNA 5FOQA 5KOHA 5ESDA 2ZJ7A 2JFBA 4P4UA 4JLJA 1VLZA 3NTXA 4YRQA 4C5CA 4HXYA 5LZ9A 3K5WA 4EL0A 2V9PA 1BOFA 3DEJA 3IBGA 3KEOA 3U09A 4TM8A 5HEKA 1HGXA 3NM4A 1KI3A 3BPSA 5CB0A 5DDIP 1G42A 1EFDN 4JUCA 1RRFA 2WVAA 2C3MA 4Q1BA 2CB9A 2J3LA 2IOFA 5G1NA 3B6MA 2W43A 3LQKA 4REQB 4KO3S 1T26A 1Q0PA 2ACKA 3QUTA 5F2KA 3OAAD 3ZD9A 1ISRA 4DYDA 5BT9A 5CB6A 1UIRA 5CNJA 4RTQA 4F86A 2ZVDA 5MGBA 1Q0LA 2XHZA 3CRW1 2E0IA 3CLTD 1GT6A 2VP6A 3F1KA 1WPXA 4EG7A 5DXAA 3TD6A 3K0FA 2GNOA 4DZTA 1Z18A 1WBJB 1A8HA 3U7QA 3FWYA 4J07A 2HSZA 1E7SA 1PSWA 4P2BA 4MYUA 3RTBA 3DV0A 3GZNA 1IXRC 4EITA 1OIVA 1XVLA 4TTSA 3LDHA 1EAMA 2UZ3A 3GT4A 2B92A 2E82A 4R5MA 3JATB 3O95A 5EMJA 2PO5A 4TTRA 3EBOA 5IN4A 4LPKA 2GHTA 2H48A 2I76A 4DR1B 2ESRA 3ORRA 5HX7A 1W1IA 2XEDA 3NXSA 3KO8A 1M2HA 4ZVVA 4N49A 8AT1A 3CB4A 2X14A 1YZFA 5GJCA 1EWQA 5AUQA 4YAFA 1Q3TA 5CLHA 3Q9SA 3H4IA 4EY4A 2K7FA 3ASVA 4TMVA 4U2FA 1DAEA 2ZBRA 3J80A 2WHYA 2GESA 3QNMA 2A84A 2PTGA 4MUFA 3WAGA 1QFZA 3MTJA 1LQ2A 4X1KA 3OLXA 2ORVA 1J06A 4QQNA 2Y2UA 4X41A 5DH9A 1CC1S 4K5QA 1SOAA 4A16A 4TXJA 3ZWXA 2ZJZA 3VVBA 3KEFA 2R1TB 2QNIA 5CDHA 4B6GA 2XYRA 4IFEA 5E2BA 1F12A 3SX2A 2CLKB 1XQVA 4Q4AA 2QXTA 4W99A 2DEUA 4YLYA 2XEXA 1U0EA 3JQQA 3FHLA 2RJOA 4M54A 1PV2A 2PKCA 4TTTS 2XJ9A 1E0DA 3ACBA 3KR9A 3NBUA 4H7IA 4RVOA 5DCLA 5G1PA 3EGDB 4PO8A 2AGVA 3GH1A 4K9QA 1FS5A 4YC7A 4G67A 5EHIA 1V25A 3B3QA 3VO8A 1CY1A 1E1KA 1P0FA 2PSHA 3RS4A 1HZZA 5KKAA 3FKQA 1C9KA 3RFUA 1XEXB 3D6VA 1TLFA 3ZXSA 3CEHA 3C3DA 3GRVA 1YS1X 1YZ3A 1GQFA 2REQA 3PHIA 3A6DA 5FWXB 5G40A 3ZCXA 3QBDA 2RH9B 2NYUA 2VUHB 2X3UA 1ESZA 3THWA 5U4QA 4UOQA 2YR0A 1HFEL 4WW0A 4IQ0A 1PNOA 3Q5GA 4YHHB 2INGX 1KK1A 1XTBA 5JZBA 4KAJA 4TXLA 4JB2A 1V3UA 4B8YA 2V7PA 3GFVA 3GLQA 3A4LA 3OO0A 3RHFA 2XA2A 1WZ2A 1NRIA 3EA4A 3ICOA 3LECA 1OWNA 1FP4A 4EFMA 4HWRA 1YSCA 4OVKA 1IE3A 3ND8A 2OV3A 5HF6A 3C5WP 4MQLA 1BMFA 3NTLA 4NBNA 4NH4A 2P69A 3UGKA 2G8LA 3FOWA 2CXRA 2BJVA 3DFKA 3EXIB 4MUEA 3L4BC 2OQVA 5KUTA 1HQCA 2OYRA 1KJYA 3HKBB 1PZNA 3DVAB 5AVKA 1S3GA 4LY6A 2LE0A 4N6OA 3IT1A 2W00A 3LQRA 4KPUB 5C81A 4TL9A 5B1EA 3EXIA 1VB5A 4C87A 2X2EA 1PUIA 3ZI4A 1NULA 3GJRA 2F4NA 3I45A 4A8JB 2NTVA 5AQEA 3WO0A 1H2HA 3BWVA 3KJNA 3ZY2A 1W6UA 1TKAA 8LDHA 1JWLA 5AK6A 3E58A 4M87A 1X1AA 3S1SA 4E30A 2ZCJA 5FUYA 1Z88A 1MO5A 1IRXA 3N75A 4MQ5A 1QRDA 4DTCA 4LOJA 5EWJA 2AYXA 2BC9A 3KKLA 2WUDA 3LBHA 4RZ3A 1RP7A 2CLSA 2DAPA 1FTNA 3I6QA 3QQPA 4KZPA 4Q93A 1DRWA 4AY4A 5ADUS 4X7RA 3G2HA 1Y5NA 2LV8A 4ETMA 1L5VA 4KDRA 1WZUA 3ZW7A 1ODFA 4EG1A 3D4LA 3ZR4B 3HYLA 2BCGY 1RPNA 4PCLA 3VTFA 4YB8A 1Y7IA 1JHVA 3BK2A 1N5LA 5E95A 2XCIA 3DM9B 5TGDA 2Q1TA 4GC5A 2DBZA 3MCUA 4RA9A 1GZVA 2WIDA 3R0VA 5DLYA 5GP1A 2ACEA 2AQIA 4ENPA 4KE8A 4KFTA 1IOVA 4NOMA 1UDRA 3Q7SA 4QUEA 1SUFA 4B2IA 2K7ZA 4JQSA 2DF8A 3CEPB 2O2EA 1MV8A 3EMKA 4MZDA 2HMTA 4IJ6A 5TS2A 3SYNA 1PGNA 3E23A 3WICA 2DQ4A 1GZ3A 4I08A 3F8TA 1Y4SA 4LGYA 4BE4A 2FEOA 5C1BA 1G8MA 5B5SA 2CYBA 2ZZKA 3UWKA 2NSYA 2DLNA 2QRVB 4H0NA 3W2FA 3AQIA 4K6OA 2GM5A 1EFVB 2PSDA 1CD5A 2M6RA 1UP7A 2C4UA 3GCWA 4ILEA 3WSVA 1RKUA 3L1KA 2HGZA 2PGLA 4ZTBA 2Q9BA 1SURA 2P4HX 5JFGA 4IIYA 3M5CA