4LISA

Crystal structure of udp-galactose-4-epimerase from aspergillus nidulans
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
364
structure length
364
Chain Sequence
PSGSVLVTGGTGYIGSFTTLALLEAGYKVVVADNLYNSSAEALNRIELISGKKAEFAQLDVTDEAAFDKVFEAHPDIDSVIHFAALKAVGESGEKPLDYYHVNVYGTICLLRSMVRHNVTNIVFSSSATVYGDATRFPDMIPIPEHCPLGPTNPYGNTKFAIELAITDVINAQRNNAKKAGNETEAAKWNGALLRYFNPAGAHPSGIMGEDPQGVPYNLLPLLAQVATGKREKLLVFGDDYASHDGTAIRDYIHILDLADGHLKALNYLRANNPGVRAWNLGTGRGSTVYEMIRAFSKAVGRDLPYEVAPRRAGDVLNLTSNPTRANTELGWKAQRTLEQACEDLWLWTKNNPQGYRQQPPAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elucidation of Substrate Specificity in Aspergillus nidulans UDP-Galactose-4-Epimerase.
pubmed doi rcsb
source organism Aspergillus nidulans fgsc a4
molecule tags Isomerase
molecule keywords UDP-glucose 4-epimerase
total genus 125
structure length 364
sequence length 364
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lisA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4lisA02
4JJIA 1V8BA 2I9PA 5F1OA 3B70A 2YHIB 1EBUA 2BFMA 3KV3O 1Y5RA 3DBRB 4DIBA 4RPLA 3ROKA 4EJ6A 1SOWA 2CVZA 2EEZA 4FCCA 4KDEA 3ZHYA 3H9GA 3AU9A 3ETEA 1UDCA 1UP4A 1A7KA 3HDHA 3KO8A 2W2KB 3UUWA 1PSDA 2E4AA 1YONA 2XXBA 1I10A 4FD3A 4C7KA 2O2YA 1GUFA 1U28A 2X5KO 1BXZA 2XPCA 1P3DA 1NR7A 3DMYA 3GR6A 5A5FA 3VPGA 1ORRA 4CLDA 5KJEA 5CAEA 5CEFA 1WDKA 1BWSA 2JFFA 3DR3A 1ZBQA 1QORA 5DCWA 2J3KA 1U1IA 1ZMTA 2X23A 1LLUA 4XRRA 4YJGB 4B4OA 4CJXA 1SAYA 3D64A 3I83A 4GWGA 4P4NA 1I3KA 4HADA 4XQEA 4JGBA 3VTZA 1LSUA 1Z7BA 2CD9A 2HK8A 3W8EA 3HB5X 1K3TA 2C7GA 2FSVA 3TF5A 1ADGA 2Q1WA 2X5JO 3UCXA 1E3SA 3K92A 5DCUA 2NVUA 5B12A 1DRUA 2AE1A 5JE8A 4F46A 2FPGA 4XZ3A 3JQAD 4WCFA 1E0DA 4RO0A 1I30A 3MOGA 2I76A 5TQVA 1WMAA 4MO2A 5IZCA 1Q7BA 4KOAA 3EZYA 4XR9A 4FIZA 5U4QA 3HADA 5THQA 4J90A 5A9RA 3WLFA 5CDGA 5DULA 4CMHA 4P38A 3AY6A 3IS3A 1LRKA 3ZNQA 3VHRA 1Q0HA 1PL8A 1NAIA 2OP0A 2VOEA 4OSPA 3TDKA 4I9HA 5EMHA 1UXGA 3NV9A 3NJ8A 4CM8A 2WTBA 4ZQFA 1WXDA 5HRUA 5B37A 1B8PA 4UEOA 3INRA 2PD6A 4ND2A 4ZHSA 2Y99A 9LDBA 4EDFA 3WGTA 3IP1A 4WNCA 5EERA 1R66A 4YQZA 3KYBA 2VUSA 4J6FA 3VPSA 1HF3A 2WYWA 3EYWA 3S2EA 3AOEC 3LVFO 5H81A 1U2DA 3FCOA 4FB5A 1VJ1A 5BR7A 3PWZA 4ZVVA 3EZLA 3VKVA 4CV2A 4DVJA 1EFLA 5H82A 1FXSA 3GZNB 1IY8A 5DNAA 2PR2A 2IZZA 4YRDA 2O4UX 1MC5A 3F47A 2X9VA 4BNWA 1JU9A 4NHEA 2OO5A 5I7EA 1LLDA 4AJHA 4E0BA 4PG5A 5K9ZA 2VTDA 2CF5A 3U4CA 1V9LA 3BMCB 1LRJA 2JHGA 1LTHR 1UXHA 4ALJA 1K0UA 3CKYA 3QWBA 2W98A 1GZ6A 4EEXA 1KERA 4HNHA 3BHIA 4XKJA 1X13A 1P77A 5J23A 4J4BA 3I52A 3JYLA 4YXFA 3SX2A 3DBLB 4Z9YA 5LDGA 5A1TA 5CDYA 6ADHA 1E1KA 4BB5A 1GYPA 4L4RA 2UVDA 1HLPA 1U3UA 1GAEO 1W0CA 2WD7A 1BMDA 1Y6JA 4B8ZA 3H4VA 2W90A 4TRRA 3FWZA 3OF2A 5DZSA 3DHEA 5C3MA 1B2LA 3GAFA 4MVJG 5ES3A 2YV1A 3JQBC 3GFGA 4HWKA 5JPIA 4MJLA 1M6HA 2GN9A 2YQ4A 2WD7B 2IYOA 4RV9A 1N1EA 3HSKA 3FPLA 1VL0A 4DIFA 2GZ1A 3TJRA 3DBLA 1J4AA 3I5MA 3ASVA 3P19A 1HL3A 1H6DA 1DSSG 1PIWA 1D3AA 3G1UA 4OSOA 3DTTA 2OHXA 4DYDA 3BMCA 3LQFA 1TVEA 1VRWA 1C14A 8ADHA 7MDHA 1GQYA 2HK7A 4JP2A 1L7DA 1KC3A 2OBYA 3ZWPA 1UZNA 4MINA 3GY0A 1E7YA 2JCXA 4MIYA 1DIGA 1EVIA 3GZNA 3WTBA 1R16A 2RCYA 1XA0A 2VHYA 4XQ9A 4B8WA 1KY5A 1ARZA 1PL6A 3N74A 1LA2A 4BNKA 5JAQA 3RUFA 2X0JA 1I8TA 3ZW8A 2G5CA 2BFPA 2A35A 1FDTA 2QYSA 3LT4A 3DB2A 5LCXA 4E2YA 3PDJA 5CDSA 3GOHA 4UEKA 3PP8A 4W7HA 3RC2A 5I7FA 3Q6IA 1YBAA 5T6BA 1EFKA 2DT5A 3QWIA 3OJFA 4RL6A 3ZWNA 1R6DA 5A05A 4IJVA 2AEMA 3U4IA 4EI2A 2NQ8A 2O23A 2J3JA 5G4LA 3E03A 1PJCA 4AJ1A 3ZHBA 4HV4A 2UUOA 2Q4BA 1ADBA 1A5ZA 2PKRA 4WCFC 2VWGA 4FFMA 4CM8B 4E6PA 4FQ8A 2Q3EA 4Q3DA 4NMHA 4UUNA 3A9WA 3ANLA 1GPDG 1YO6A 4OH1A 4Q3EA 4KTTE 4GH5A 3QVOA 3IP3A 2UDPA 5JCXA 1QYWA 1H2HA 4JJFA 2D2IA 4W99A 3NTQA 1PZHA 2B5WA 1BG6A 4BGVA 3VH3A 5LDHA 1YH3A 2VQ3A 1IHYA 2GRAA 3AOGA 3PHHA 4XB1A 3ZWBA 3CMMA 4J0EA 2H6EA 1CQJA 1M67A 1L1FA 2VHXA 4BNMA 4PG6A 1VL6A 4RVSA 3HWRA 3WIDA 4WCFB 4GGPA 4II3A 3I6QA 5A3JA 4JNKA 1OBFO 1GYRA 3PQDA 3OICA 2NVUB 2PH3A 1LSJA 1VJTA 3EGOA 4DQUA 3VZRA 3PPIA 3RIHA 2PZJA 3E5MA 3BTVA 5EJ2A 3U49A 3PXXA 3PZRA 3WR5A 1ZFNA 3MCVA 5T8KA 5GMOA 4A26A 4J1TA 1Q1NA 5L9AA 1L7EA 4BNXA 1YB4A 1M66A 1V3TA 2C20A 3AUTA 3BXXA 3WLEA 2J5RA 4QXMA 4DWVA 3RWBA 2Q45A 4YJGA 1B16A 1P1FA 2CVOA 5DF1A 5EPOA 3DFZA 3S55A 2QIOA 4DPLA 4O0LA 4XEHA 1CWUA 1UXJA 1OC2A 3EDMA 3ST7A 2VN8A 3INGA 5BSFA 2W4QA 4BO6A 4YT4A 2WEKA 5KVSA 3KUXA 5TGDA 3V2HA 1NBOA 1U8FO 1RYDA 2CY0A 5FI3A 5TRTA 3UCFA 2Z5LA 2NTJA 3VVCA 3E9NA 5DP2A 1UJMA 1XKQA 3W4IA 3H6KA 3JV7A 2DTXA 4QO7A 5L4SA 2PZMA 3QVTA 2W2KA 4JBHA 1E3JA 4LGVA 1OC4A 3JD4A 1ZVMA 3QWHA 4MKZA 3VTFA 3LZ6A 5G2OA 3JQCA 4YRAA 2ZYDA 5KVVA 1BGVA 4I5GA 4I5FA 3WXBA 3DBRA 5L40A 4U7WA 5K6AA 4EUEA 2YHIA 1Y9AA 4DLLA 3DZGA 4YT5A 5JS6A 1F8GA 3GMDA 1EVZA 4O1MA 1MG0A 1F0YA 1DXYA 1E7QA 2Y1GA 2ZB7A 3IQDB 4RF3A 3TZHA 1BVRA 1CIVA 3L07A 4CLOA 2J6IA 3W6ZA 1B26A 3KOUA 1TB4A 1YBVA 4IY1A 2PZKA 3PI7A 4OL9A 2DLDA 1I33A 3K30A 3L9XA 4HFNA 3RD5A 1EK5A 4YAEA 4KQXA 3QLJA 4DMLA 3AI1A 5TC4A 1E3LA 2EG9A 4TWRA 2B5VA 3HFSA 4QO8A 2NNLD 4ND4A 1E3EA 1NPTO 2X8LA 1MGOA 5A02A 1AN9A 2P4HX 3DWFA 4Z3DA 3I4CA 5B4TA 4GX1A 1YWGO 4CMAA 3MJEA 3Q0EA 2Y66A 1N8KA 3A28A 2VZ8A 2E49A 4A73A 3IUPA 2PH5A 1NP3A 5JAIA 4Z3KA 4AICA 3GDOA 2ZYGA 1D7OA 1PGJA 2I65A 2NACA 4XYEA 4J7CA 5T57A 5G0VA 4NG5A 5CEEA 1PZGA 3QQPA 5AXBA 2D4AA 3GA0A 1F14A 4GSKA 2E48A 2VCYA 4RCVA 4E2XA 4GKBA 4HP8A 4K28A 4OQZA 1W6UA 1PX0A 4PLGA 2EXXA 2EWMA 5A03A 2AEJA 1DLJA 1UDBA 2NM0A 3ABIA 2E6UX 3OIFA 5JXWA 2CFCA 3MJCA 4RLSA 1C0KA 1ZSVA 3C7DB 1TT5A 4JLWA 4H7PA 4I5EA 4BNNA 1EUCA 3ZZNA 4FOSA 2Y0CA 4CMJA 1XR3A 4KQWA 1P45A 2BRUA 2EHDA 4IQ8A 3TFQA 5BSEA 1HDZA 3RUHA 4RVUA 4CV3A 4LSMA 1ZXLA 4IQ0A 4ID9A 3EY4A 5EINA 1Y5MA 3SLKA 5IDXA 4YPOA 2C54A 2YV2A 1MX3A 3B1KA 2O3RA 3O4RA 1XSEA 3WGOA 5IZCC 1QV7A 1WDLA 2Y1DA 3E82A 1IZ9A 5HWSA 3ASUA 4R3NA 4D41A 2NU7A 2YUTA 1I2BA 5IJZA 2GN4A 2J5QA 4OGWA 1T2FA 1PU2A 1DFHA 1K6XA 1VLLA 2O3TA 4J3FA 3U4DA 1YB1A 3L9WA 4EUFA 3WBBA 4GI2A 4FJ2A 1DIBA 5TNXA 3LC1O 4IXTA 1JTVA 1YS4A 5BNTA 5JY6A 2QRLA 3WQRA 1R4NA 2Z95A 3HZZA 4U0KA 4BKQA 4AL4A 5JLAA 2X5OA 1N1GA 3QY9A 4CM9A 3BMNB 4U6SA 1K2WA 3AFNA 1NFQA 1ENPA 3GG9A 1LX6A 4URFA 3IC5A 4KWHA 1PGNA 4GX2A 2BI7A 3ENNA 4KUGA 2VZ9A 1SCUA 2C5EA 3NEPX 1XCBA 4BL5A 1WPQA 3PYMA 4MVJH 2FZEA 2QQ5A 3AOEA 5A9TA 5DT9A 2BGMA 5KJCA 4RQTA 4O59O 2X1HA 1P1RA 4RVDA 4CMIA 1LI4A 3NYWA 4YJHB 1B15A 1Y8QA 2BI8A 3VPXA 3NT4A 2Y1OA 1HSOA 2VYVA 4L0QA 4CQLA 4WLEA 1WAMA 1WP4A 5A3VA 2UYYA 2AQHA 2P2SA 4MKRA 4TRJA 3UAGA 3RROA 3LC7O 2O7QA 4IDDA 5T8KC 3U09A 5COAA 1LEHA 4UVGA 3VPFA 1IPEA 2W2LA 1E5LA 3V1YA 4ALIA 5DBGA 2OFPA 3QP9A 4R5MA 1DFIA 2YZ7A 5ENDA 1VE9A 1SEPA 2Q2VA 2AQ8A 3B1JA 1KETA 4QT0A 3DO5A 1LDGA 1XHLA 5DN9A 1LBEA 2NUAA 3JQ9A 2HUNA 1E7MA 3I1JA 3D3WB 4ZD6A 3NGXA 2WSBA 2GN6A 1F17A 1I24A 1WNTA 1Q7GA 1I36A 1R4MB 3L6DA 3UF0A 5L7WA 2PWZA 3Q11A 4MVJP 4GMFA 3WS7A 3W1VA 5KKCA 3EK2A 1N2SA 2D3TA 2I99A 3FRJA 4FFNA 4PZEA 4OM8A 1BHSA 1G0OA 1LNQA 3D1LA 2HDHA 4RORA 1DDOA 4UREA 1HE3A 3AM5A 3NX4A 2VNSA 1FDWA 3KM0A 4EGFA 1E3WA 5AOVA 5K6AC 3H2SA 5IDYA 1IYZA 5IAAA 1AE1A 4PLWA 1P31A 1P9LA 2EERA 4EEZA 1H9BA 5I7VA 4U6QA 1EMDA 1LUAA 1VKNA 3ZHZA 3HFGA 1ID1A 4FS3A 3V5NA 2XOXA 3Q2IA 3PQEA 4D44A 1LXCA 2YFHA 3O03A 3STHA 3BHMA 1C1DA 1N7GA 2X0RA 4MIEA 1NPYA 1WMBA 5L7TA 3PWKA 1ENOA 3G1TA 3K2EA 2RH8A 3PHLA 1DIRA 3AY3A 1VI2A 1HDOA 3EVNA 5HA5A 3IKTA 1UZLA 3UVEA 2ZTUA 2B4TO 4ALKA 4XYMA 4O6VA 4DRYA 4FJ1A 1E1NA 5KNLA 4CL8A 5G4KA 4CM1A 4QUKA 3NGLA 3EVTA 2EKQA 2HAEA 2Y1CA 4RVHA 2ZKLA 4KZPA 1ENYA 1ZH8A 4PVCA 3RUDA 1ISGA 3PJDA 1YL7A 3V1TC 1U2GA 1XG5A 3IJPA 1U3WA 5KVQA 4D45A 1IHXA 1XDWA 4YAJA 4BGEA 4GVXA 2Q4EA 2HSDA 3IL2A 3NDJA 1PR9A 3JQ6A 1JVSA 4MVJD 2WYUA 3RJ5A 5MGBA 1HE2A 1DIAA 1HEUA 4BNLA 1PGQA 1RWBA 2H9IA 2B0JA 1A9ZA 1GEEA 5L53A 4PG7A 3UCEA 3GQVA 3F1LA 3FI9A 4NH4A 5G0WA 3OJEA 3HDYA 3JQAB 3CXRA 3AI3A 1KVTA 1I2CA 1GY8A 2GF2A 3V8BA 1LDNA 1LU9A 2QHXA 3QW2A 4IJWA 4BV9A 1DPGA 1AXEA 3ZWWA 1UP7A 5JYEA 1YOVA 2YFQA 4X54A 3VZPA 4XRGA 4YA6A 4BKPA 1V6AA 1UXIA 5A9SA 1RM5A 2VWPA 1A9YA 4YR9A 1WWKA 1WW8A 5DBIA 1G1AA 1H94A 4PLTA 1UXKA 3RU7A 3C1OA 1BXKA 2DAPA 4R9SA 4AJKA 4J16A 3GF4A 5TIIA 4OOFA 5C7LO 3V2UA 3HE3A 3K31A 4GAEA 4ALLA 2HU2A 2OP1A 3DQPA 2O4CA 4P4LA 4BNTA 1MUUA 2OL4A 3C1TA 4KP7A 2IZ0A 1DJQA 2OMEA 4IIUA 2VWQA 1C1XA 1KVUA 4IZHA 3HQ4O 4XCVA 3O8QB 3PGJA 3EC7A 4D3FA 5HBRA 4FSHA 2DBQA 1NTOA 1ZNQO 3JQ7B 4Z9XA 5JCJA 3KYCA 4RZIA 3WX0A 1YGYA 2AXQA 2EF1A 2HQ1A 1YDWA 2ZYAA 1ZK2A 3HUDA 4LCEA 4XDZA 1H93A 1YJQA 4BMSA 5JBIA 3GNTA 3FD8A 2VRCD 1NFFA 4DL9A 3KTDA 3NAQA 2YYYA 2I5PO 3JQEA 1D1TA 4WGGA 2QX7A 5I9LA 4ROSA 5C7IO 1PR3A 2HO5A 3KRTA 1HTBA 4ZICA 1OAAA 1ONPA 4WUVA 3U3XA 2FMUA 1XIVA 2C29D 4CMKA 3UHAA 1ULSA 5CPBA 1E3IA 2GDZA 4N5LA 3CPSA 1O6ZA 2FOIA 3GHHA 1IZ0A 2BGKA 3GVPA 3IJRA 3JSAA 3KZVA 5F1KA 1KOLA 4J0FA 3C24A 3ZWMA 2WD8A 4DQVA 3ANMA 5IDWA 1HZZA 1SZJG 3K2BA 1H2BA 1H9AA 1XU9A 3C85A 3RUCA 4CM4A 1U5CA 2H5LA 8LDHA 1NX6A 4BNGA 2V7PA 5JAZA 1KIFA 2VYVD 1E6EA 1QSGA 4RDIA 1EBFA 4ZJUA 5JFOA 4YQYA 2PGLA 4M86A 1DHTA 1JN0A 4QTZA 2HLPA 5IXYA 2SCUA 3WYEA 1B14A 1QLHA 1Y8RA 2C2YA 3BTSA 5DOZA 3DZBA 2ZQZA 4GMGA 3ULKA 4EJMA 1DC3A 3HG7A 4AJ4A 4XGNA 3KHUA 4WPGA 4J1SA 2O3QA 4K26A 1HETA 4Y98A 5IN4A 4BO3A 5IN5A 4TKLA 3EMKA 2BFAA 1E6UA 4B3HA 1R0LA 4CM7A 5AYVA 4IPTA 5IDQA 3D5TA 3ORFA 3KETA 2C0CA 4ZGWA 1EE9A 4M87A 1T2CA 1X7HA 3D4OA 3ZV3A 2D59A 3LK7A 3OJLA 5TSDA 3DMTC 2QRJA 1GYQA 4JX8A 3DAFA 3INTA 1B0AA 5ITVA 4FR5A 4Q9NA 2QZ9A 3K5PA 4RVGA 4F6LA 2IXBA 1QYDA 3F4BA 3SC4A 3F5QA 1UDAA 1YL5A 2IEDA 4ZQGA 4IMRA 4OO3A 3RBVA 4B3JA 4YAKA 4U0JA 4W9NA 1YKFA 4B4WA 4JBIA 4A03A 3DOOA 5JMPA 4OQYA 1AUPA 1JKIA 1ZJZA 2PGJA 3AI2A 4IBOA 1Z7EA 4TSKA 2FSSA 4M54A 5IG2A 3RUIA 1S7CA 3BHJA 3QE3A 2EW2A 3QVSA 4YTEA 1EEHA 4BO0A 4XQCA 1GCUA 2YW9A 4ILKA 4XGKA 1SO8A 2CSUA 1CRWG 3I23A 3PJGA 2OORA 2I3GA 5GZ6A 3AW9A 1R0KA 2AMFA 3ADPA 4M8SA 3GVCA 3I3OA 1KBZA 4XJSA 3WFIA 4BVAA 5JC8A 3MZ0A 3EUWA 1T4BA 2DKNA 2DTDA 4YB8A 1LQTA 2B69A 4LMPA 2CDBA 3VAZA 3ZNNA 3SXPA 4AJPA 3LT1A 4J4HA 2C2XA 2P9CA 1TLTA 3MJSA 4W6ZA 1E7SA 3RVDA 3WDSA 3X2FA 3ROPA 1IL0A 1UAGA 3GPIA 4J7UA 2H63A 3H9EO 3CEAA 4IDEA 4J1NA 3ZU2A 4II2A 5EL0A 1PTJA 4ND1A 2PZLA 2CZCA 1MA0A 3IMFA 3ZCXA 1XEAA 3FNHA 3ZV4A 4D79A 4WEOA 2YY7A 2ZQYA 1DC5A 3GK3A 5KVCA 1DB3A 2CDAA 1M2WA 3MJ4A 1MP0A 3H2ZA 1ONNA 3HJAA 4KUEA 3W6UA 4C4OA 4DC0A 3LF1A 3HB4X 2FWMX 3IUSA 3QVXA 4Y8VA 3RAJA 5JAMA 2NV6A 3B20A 4J9VA 3AY7A 1OI7A 4HBGA 1U4SA 4NU6A 3SEFA 2JCVA 1J6UA 1M6WA 1XWFA 1ISHA 4LN1A 3MJVA 5FYDA 2HMTA 2O3SA 2JAPA 4R1NA 3ONFA 3MJTA 1YQXA 3ICPA 2HKIA 3JQDA 2X0NA 3OSUA 1ZK1A 5AQ1A 1VKOA 1T2AA 3WJ7A 3GUCA 4O63O 2IXAA 4PN3A 1JKFA 4M49A 4HX5A 4JIGA 4NNJA 4R5HA 1Z45A 4BGIA 3E9QA 3KLPX 4E30A 1J5PA 1N5DA 1KS9A 2XF8A 3ZWXA 5BNIA 4BQPA 2Q49A 3WSVA 4UAGA 3DZIA 4ALNA 1ZCJA 4BNUA 5ILGA 4I8XA 1PEDA 2O3JA 1KC1A 3P2YA 4L8VA 4N5NA 3W8DA 5BQFA 2Q1UA 4W4TA 1PS8A 2VRBA 4CR6A 2ZTMA 4E4YA 1RYEA 1M75A 3E9MA 1GQQA 1IB6A 4PLZA 1FK8A 3W4KA 5GZ3A 2O3UA 3GGOA 3EHEA 3WYBA 4IMPA 4PLFA 4R1SA 3WIEA 1HRDA 1P44A 1UZMA 3JQ8A 4CMCA 3D5QA 2G1UA 4ZN6A 4OAQA 3EW7A 3GVHA 4RLHA 4Q3CA 2E82A 3JQGB 1ZO8A 1YRLA 1ML3A 4R01A 4CQMA 1C0IA 2PK3A 1GADO 1LC0A 1MV8A 5ADHA 1ZEMA 3FNEA 4MVJF 4Z0TA 1DOHA 4IIVA 1XGKA 3GGPA 2POQX 2VYNA 4GVLA 1BSVA 2X22A 4OHUA 4HKTA 3FBGA 1B8VA 3RKRA 4YAIA 4DA9A 3OQ1A 5FF9A 3WSWA 3DC2A 1H0KA 1DIHA 1H6AA 1Z75A 4OOEA 2C59A 1JVBA 3JCZA 3JD2A 2G82A 1R37A 3UXYA 4WK6A 4IM7A 1P33A 3AUSA 4S3MA 2J8ZA 2QW8A 4UVIA 1O8CA 3M2TA 2ZTLA 2B4QA 4GX5A 1PWXA 4NDNE 5KJFA 4XJTA 4BNVA 3WGYA 1GUYA 1E7RA 1DAOA 2NLOA 4PLCA 1LDMA 4CUZA 5IZ4A 5KCZA 4L75A 2EJVA 3BIOA 3ZU3A 1J0XO 1N9GB 2FPPA 1T26A 1OFGA 2D5AA 2NU8A 3RFVA 2NWQA 5ICSA 2O50A 1F06A 2DQ4A 5CPFA 4GX0A 3BYZA 3V1UA 2VHVA 1ENZA 3VZQA 1IOLA 2I3AA 4DTIA 2XAAA 4RF2A 3L4BA 1NVTA 1BW9A 1H6CA 2PD4A 3KYDB 4H16A 1T1RA 5AXDA 5C5IA 2B37A 1RJWA 2P5YA 3H9JA 4NBWA 4NJMA 2AHRA 1C3VA 3ZU4A 3I6IA 1RKXA 3D4PA 2D8AA 4TROA 2BLLA 5G0TA 4BNIA 4LCJA 4YAGA 4QX6A 4U5QA 3ZI0A 4YCAA 2I67A 2Y0DA 3RC9A 4XIYA 1MB4A 2B4RO 4CM5A 1Y9EA 3K6JA 5AXCA 4ND3A 4WECA 1ZIDA 4MVJA 3JTMA 3OETA 2JFGA 1B3BA 3LC2O 2PGDA 5TX7A 3OQBA 3P5SA 2X9NA 3N7UA 3WBFA 1XQ1A 4OMUA 1E6WA 2EW8A 3DBHB 4TZTA 4AJEA 1W4ZA 5ILOA 4INAA 3BMOA 2HMWA 3CH6A 3GT0A 3HN7A 3QVWA 4UVDA 1IUKA 4W82A 3L6OO 3BMQB 4BQRA 5EQFA 1DRVA 5I7SA 3QRWA 3I9OA 2VWHA 4DC1A 1NWHA 4RPJA 5C37A 3PHJA 1LRLA 3L77A 2FN7A 3COSA 4TVOA 5EN4A 1PJ2A 4LRSB 3VZSA 3H3JA 5F3RA 4CLRB 4ZA2A 1PJ4A 3MOIA 5HM8A 2Y68A 1PJ3A 4RJTA 2JCYA 2NQTA 5TT0A 1B7GO 3UKOA 3FHLA 2DBVO 1YVEI 4E2ZA 1BVUA 3GVXA 4EUHA 1PQWA 1JKJA 3PFWO 1Z6ZA 3I9MA 4EITA 1A7AA 1Q7CA 1GPJA 2X0IA 4E5NA 5TLSA 2JAHA 2P9EA 1T4DA 3ENKA 3WGZA 4Z0HO 2RBEA 5G0SA 2GNAA 2J5KA 3GHYA 2VRCA 4H15A 4Y9DA 4E5YA 1W8DA 1ZXBA 3PLNA 4L4SA 5DOVA 2CMDA 2W8ZA 1YB5A 3ZH2A 4BV8A 5B4UA 3LLVA 2GO1A 1NYTA 1S6YA 3H9UA 7ADHA 3OECA 1R0SA 2DTEA 4GLLA 3QJ5A 4MP6A 4O5OA 3RKUA 5HS6A 2EV9A 5ICMA 5JCJD 2X58A 3OEYA 4D46A 4IJKA 4KWIA 2WE8A 4HFRA 4MKXA 2FPIA 3GRKA 3D4NA 1NM5A 2IDZA 3LLSA 3H8VA 1JDJA 5EESA 4B7UA 3D0OA 3FNGA 4NBRA 1MG5A 3JYQA 4LVCA 1HSZA 3U0BA 2J3IA 1WZIA 1VL8A 3VVBA 2WE7A 3K9QO 1VM6A 3VH4A 4NFYA 2ZB4A 3M1LA 1EUDA 1U7TA 1BXGA 4GL4A 4Q3BA 1TI7A 4XGIA 3LYLA 1CETA 1HKUA 1D1SA 1I5RA 1BDBA 2VHZA 4YJFA 3AWDA 3GRPA 5FEUA 3ONEA 4MP3A 3DTYA 3ZV6A 3DOCA 4RVFA 3DEYX 3OJ0A 4BNFA 2Y93A 4Y6PA 4AFNA 2ZIZA 2YJZA 2XXJA 5JYDA 1HYHA 2DUUA 2Q50A 3TNLA 3R0IA 4XWYA 1K5HA 4D0SA 2OOSA 3FN4A 3GMSA 3UICA 2JHFA 4I5DA 4L76A 5JY1A 3VKUA 1U8XX 2VT2A 2X6TA 2Y05A 3VH1A 1I32A 2P9GA 4MIOA 4W9NC 4CR7A 1B3RA 3MTGA 3HDJA 4N7RA 1T25A 3VOSA 4MVJM 2A94A 4BNJA 1JQBA 2V6BA 3OIDA 1JLLA 4YJFB 4UVEA 4DYVA 2G76A 1JW9B 1UP6A 4FDAA 3ITDA 4G5HA 4HXYA 3TZCA 4YWJA 5KIAA 1BXGB 4JXKA 1YBMA 1X15A 5LC1A 5L95A 1PZEA 5ENVA 3HN2A 3V2GA 1YQGA 3JQ9C 3JD3A 4BO4A 3NTRA 3FR7A 5A06A 3OQ6A 2B83A 2DBRA 4NBTA 3AK4A 4MVJE 2YDYA 2IYPA 3JYOA 2Z1NA 1MXHA 3F9IA 4KUHA 3ROMA 3RUAA 4CMBA 1P0CA 1GFSA 3DAGA 5F5NA 4I1IA 4RPGA 3RU9A 2GLXA 1DRWA 3ZGYA 2C7VA 4DQXA 3JD0A 1QLJA 4K6FA 1PJBA 3WGIA 3ZDFA 3H3FA 3DAPA 1Q0QA 4XA8A 1F8FA 3PRJA 3TOXA 2H1SA 1ISJA 4BGUA 3PHIA 4LW8A 1PZFA 3ZWVA 1GV0A 2A4KA 1CF2O 4ALMA 4WE3A 4PG8A 2DM6A 1T24A 3I9JA 1LLQA 2QG4A 1YXMA 2VOJA 3TN7A 3C8MA 3R6DA 2V65A 1MXFA 2W2LD 2FRDA 1GD1O 1ZZEA 3WTCA 3P7MA 4CLRA 4BKRA 2AEFA 3L6EA 1CQIA 1MFZA 2E37A 3ADOA 3KSUA 4I9UA 3H65A 4KTVE 2Q2WA 4XQGA 5DBFA 2OXIA 3AJRA 4OYRA 1EVJA 2BH9A 3H7AA 4P8RA 1I0ZA 1SMKA 1LSSA 3PVZA 1X7GA 3T7CA 4ESOA 5IF3A 4YRBA 1NQOA 3RASA 3F4LA 2PTGA 1DJNA 3CE6A 3BMQA 3T4XA 5JO0A 3E1KA 4JP3A 2VT3A 3E18A 3PQFA 3H5AA 4YVFA 5HTOA 1M76A 3BMOB 3F5SA 5EIOA 3S2IA 2PNFA 5H83A 4PZDA 4CLEA 1GTMA 5KWEA 3OMLA 2EIHA 4MP8A 1V3UA 1NVGA 5TJ9A 3B1FA 3DBHA 3U9LA 4XIJA 3UFXA 4BOYA 4DGSA 1U3TA 1HWYA 4QSMA 1NFRA 1O94A 4MOWA 4PLHA 4WOJA 2R6JA 3HDQA 4ZRNA 3QIVA 5KJ6A 3AU8A 2GCGA 3RI3A 2GD1O 2P5UA 4UUPA 2IODA 2ZJ0A 4UULA 2PD3A 3GC6A 4AJ2A 4BMVA 3KEOA 4FGWA 1EZ4A 2CDCA 3NJ4A 1BTOA 1GCOA 3DZJA 4J43A 4NJMB 1ZW1A 1R15A 4MDHA 3M6IA 1BW9B 3KYDA 3MWDB 4JK3A 4F45A 3D7LA 4Z9FA 1QG6A 3UGKA 4NK4A 4WLUA 4FFRA 3PYLA 4Z6KA 3JYNA 3L4SO 4IDGA 5AXAA 1ONOA 3CIFA 5U9CA 1FF9A 1N9GA 4NJOA 2Y67A 4E33A 2AE2A 4L74A 4Z0PA 1DFGA 4QFCA 1P1KA 3ONDA 1VSUA 2AW5A 3RSHA 1O0SA 3DOJA 4PG4A 3G79A 4RF5A 3FR8A 2AG5A 4IGFA 4K6CA 3LSYA 1JWBB 2ZATA 3DL2A 3LT0A 4OKIA 4NQZA 3PK0A 1PGPA 4AVYA 4WLNA 4HFJA 4CLXA 1UUFA 3ETDA 1Y81A 4RZHA 1TA4A 1BDMA 2BHLA 3RC7A 3CMCO 3FNFA 2GN8A 3K96A 3ZWYA 1X0XA 1FDUA 1KEUA 2JKVA 3ZU5A 4CV0A 1YQDA 3IOYA 2DPHA 5L7YA 3NTOA 5U1PA 5DCYA 4RGBA 1B8UA 3AM4A 1MC4A 2PKQO 2UAGA 3FTNA 5F21A 3U62A 3O26A 2VZ0A 1P0FA 5COBA 1N7HA 3CINA 1SB8A 3F3SA 4GBJA 1MFPA 4CQMB 4E13A 2YV3A 4OJNA 3JQGA 2BGLA 4PRLA 1SB9A 3BA1A 5IXSA 1U3VA 1E92A 4ZQEA 1UR5A 1SPXA 3JQ8B 1BRMA 1E77A 2EKLA 2ZJ1A 3BTOA 4DBZA 4TMFA 1PS9A 2P68A 4IUYA 3NUGA 4CR8A 1A4IA 3GH3A 1X0VA 2PKQP 1GQ2A 1VSVA 3RFXA 5KJ1A 4NBUA 3H5RA 3A1NA 3GPDG 2IZ1A 4D43A 3NRCA 4DIOA 4NI5A 4P4GA 4NIMA 5COQA 4BKUA 3WWYA 4FC6A 2Y1EA 5GY7A 4IGEA 3FWNA 4IS3A 4WEQA 5TT1A 2PLAA 2C82A 4CMGA 4LSWA 1PS0A 1RM0A 2O2SA 2OBNA 3UW3A 1DBVO 2DPGA 3A06A 4DBVO 2I6TA 5KKAA 3JQFA 4B7XA 3E48A 3N58A 4N18A 2DFVA 5L4LA 4M89A 4BNHA 1O95A 1CYDA 3RQSA 3CTMA 3Q9NA 4FOOA 4CM6A 3X2EA 3SJ7A 3DONA 3T4EA 3TZ6A 4AJIA 4B7CA 3G17A 1A4UA 1EDOA 2WJPA 5AVOA 1NAHA 3PYXA 1ZJYA 3FSRA 4GQAA 2LDBA 2HMVA 1NWCA 1Q0LA 2NU6A 3DXFA 5C7OO 1LLCA 4MPDA 2R00A 4J49A 1I2ZA 1QP8A 3P2OA 2ET6A 4JCOA 1Z73A 1ZMOA 3RBZA 3PZBA 3WG9A 4Q3NA 2WDZA 4CM9D 3GN1A 3I9NA 5A04A 4GPD1 2FR0A 2Q46A 4D7AA 1NHWA 1HT0A 2ZCUA 1FJHA 3I4FA 2GGSA 1I01A 4A27A 4B3IA 1Y7TA 2OZPA 2LDXA 1I3NA 3IAHA 1K6JA 1CDOA 3DBVO 1EVYA 3PHGA 4GWKA 5JO9A 4H3VA 4AG3A 2V6GA 1G0NA 1DC4A 4BB6A 1C0PA 2GUGA 4LVUA 2Q2QA 3RCBA 4GGOA 3Q9UA 4RF4A 3VDRA 1T2EA 1ZKMA 4CM3A 3A14A 1HZJA 1P74A 2WYVA 3QV1A 4NK5A 4BS9A 2Y0EA 3RBXA 3M1AA 3NKLA 5JDIA 4CL3A 4D42A 5IFLA 2VHWA 4FFLA 4G81A 3BTUA 3E8XA 4NZ9A 4PLVA 4BHTA 1GR0A 2RHCA 4IDFA 1UAYA 3TL2A 1RPNA 1HYGA 5JDCC 4EJ0A 1JAYA 4XD2A 2CVQA 2AA3A 4R1TA 4YDRA 3QWAA 3ZHXA 3VH2A 2EKPA 1N92A 3JD1A 1O5IA 2D5CA 2ZTVA 4IZIA 1GZ3A 1LC3A 2P4QA 4JN6B 1GL3A 1SBYA 2BF7A 4R9RA 2ILTA 4R3WA 1XYGA 2VTEA 1WZEA 1SNYA 2X9GA 4RPHA 5THKA 2A92A 3RUEA 4UEJA 4ND5A 1AHHA 3IIEA 1EQUA 1TEHA 5K0ZA 3CZMA 1WDMA 3QHAA 3ZWCA 1DAPA 2FY8A 3BAZA 1NR1A 4TZKA 3MTJA 2V6FA 4NPCA 2EP5A 4HY3A 4IDCA 3QSGA 5GZ1A 3HNPA 4P22A 1R12A 3LDHA 1HDGO 2BD0A 3AM3A 4TRMA 3WOHA 4R69A 5KOIA 4BIIA 3LU1A 3PFFA 4YEDA 3LF2A 2Q1SA 1KVRA 4BO5A 1ISFA 1GU7A 2VUTA 1A72A 1T2DA 2WWRA 4WNIA 4FFPA 2NTNA 3W8FA 2X4GA 1NQAO 3DFUA 3GEDA 4LMRA 1NPDA 4S1VA 5L45A 3ZWOA 1U7HA 2X7HA 4HUJA 2GASA 3ICCA 1ADFA 2GPTA 4ONEA 4B79A 3OJOA 3M2PA 5A4DA 1XLTA 3PIIA 4Q3AA 4LRTB 4TRNA 3S8MA 5I8ZA 1Y8RB 5BSGA 5CHEA 3KSDO 3VPHA 3TFOA 1OOEA 2CUKA 2IEBA 3QWFA 5CDTA 4RDHA 2JD2A 2UV8A 3H5NA 3L4BC 2RAFA 3KEQA 1PJQA 1AGNA 2P91A 3WQSB 3WFJA 1PJLA 4CM4B 1NQ5A 2HJRA 2B35A 4ITUA 5BT9A 5A5EA 1FDSA 3ZNPA 4NBVA 2Z1MA 3TQHA 3WB9A 4BO2A 4EYEA 4CUJA 3GDGA 3JQFC 3GFBA 3R1IA 4FBGA 4IINA 5TJHA 1GZ4A 4A7PA 5L4NA 5HS4A 4NFHA 3DHNA 3F46A 1H6BA 4ZRMA 4XR4A 4W7IA 2BFOA 4WJZA 4OKNA 5JSFA 1D4FA 4PVDA 1QYVA 3KSZO 2R00C 3ANNA 1KEPA 4M55A 4E31A 5DP1A 5F1PA 1QXSA 2DVMA 3H9QA 4TQGA 4XDYA 4A2CA 1P1HA 5CG2A 3FTPA 4FC7A 2DFDA 4J91A 4BO9A 2JL1A 2PA3A 4WASA 3VC7A 2NVWA 1EK6A 1HDXA 4EBFA 1PL7A 1VJ0A 4R41A 4RPKA 4WLVA 2FR1A 1ZK0A 4TVBA 3PEFA 4XX0A 3EAGA 2ZCVA 4N5MA 2NTVA 4WLFA 3OBBA 3C3XA 3GNQA 3S1LA 1F12A 4DPKA 2BELA 1EDZA 3NDRA 2AG8A 4E21A 2AQKA 4AJLA 3TL3A 3KBOA 2O7SA 1DLIA 5BSHA 4Y6SA 4GLOA 3KLMX 4U8GA 3KYCB 4OXYA 3JQ7A 1PGOA 3BZUA 1NQTA 4J4TA 4IJUA 1U5AA 3KXDA 2HMUA 3O8QA 3KVOA 3PWSA 4A10A 2DUWA 4YJDA 4QECA 1C1XB 3OFSA 3LT2A 4YBZA 4J2HA 4WCDA 4WLOA 3OA2A 4FJ0A 1LDEA 2OUIA 4ZU3A 4Q39A 4WOKA 1QRRA 4CMEA 5FI5A 1DHRA 2DBZA 3DZHA 4BO8A 1QYCA 1Z74A 4FN4A 3WNVA 1CEQA 4E32A 3Q1LA 1NVMB 2EJWA 1QKIA 3DZKA 5B4VA 2NVBA 1J49A 3NDIA 3CZRA 3GN2A 4PCVA 5CFZA 3R3JA 4QEDA 3SVTA 2G17A 5EQDA 3G49A 3SJUA 5A9SB 3NT5A 2GZ3A 5JDCA 1IULA 5KTKA 4BNZA 1YOVB 3U5TA 1ISMA 3UN1A 4F6CA 2WM3A 3O9ZA 4YT2A 4CLHA 4J7XA 1ULUA 1EE2A 4J1QA 2HRZA 3C1AA 3L0DA 3U4HA 5L51A 5G0UA 4L4XA 1YE3A 1PWZA 3JQAA 3WNQA 5T5QA 1HDYA 4KDFA 1PQUA 1XU7A 4IQGA 4M1QA 4G2NA 4D0RA 2BMAA 1K89A 3MEQA 3NT2A 3AFMA 3RC1A 4HFMA 2QYTA 1KVQA 1W73A 4CUKA 1HLDA 3WYCA 4PGFA 2HRBA 2GSDA 2GYYA 5JC1A 2AQIA 4JROA 4YACA 5ITWA 1D8AA 2PY6A 1ZSNA 2J3HA 5L3ZA 3FPCA 2R2GA 2PV7A 5JW6A 3GLQA 3ZNOA 2O48X 1UH5A 3WMWA 4E5MA 1TT7A 4OXNA 4MVJI 2YHUA 1P1IA 3DHYA 4WKGA 4XYLA 2Y1FA 1U4OA 5T67A 1HDCA 5G4KB 2JJYA 5DDIP 1YDEA 2NSDA 2Q99A 3T7EA 4CPDA 2D0IA 4R16A 2GZ2A 3JYPA 4DPMA 5CG1A 2HCTA 3TSCA 1ZK4A 5F5LA 4EZBA 3SC6A 3F6YA 1C1DB 1P1JA 4PLPA 2TMDA 4AJOA 3OA0A 1WLYA 4EW6A 5CEJA 4DLBA 3CSDA 4J2OA 1O89A 1OZAA 1CJCA 4FW8A 3DMTA 3K8ZA 1I3MA 3UOGA 1V35A 1Z82A 4LISA 1LSOA 2F1KA 2VUUA 1XQ6A 3PTZA 3PLRA 2QRKA 3GEMA 3S2GA 1C0LA 1WVGA 1AHIA 1RM3A 3WWZA 4I9NA 1E3WB 1RM4A 5JNLA 2HK9A 4ZQHA 2UUPA 4DREA 1ZUD1 5FWNA 1U9JA 1A71A 3ZV5A 9LDTA 3Q2KA 1LJ8A 1LDBA 3S2FA 1R4MA 4NFSA 4OXKA 4BUCA 3OEWA 2FHSA 1NXQA 2IE0A 3D3WA 4UUMA 2I66A 1OMOA 3I9LA 3TRIA 1CERA 4A0SA 4PZCA 2CNBA 1E7WA 1PJTA 3ITKA 3GDFA 2OGUA 3ON5A 3OHSX 2HJSA 4JQCA 1IE3A 5BNFA 1TXGA 2D1YA 4GKVA 1KYQA 2JFHA 1V0JA 3OP4A 3GG2A 3GZ4A 3OIGA 2B36A 4Y67A 1ZSYA 4RQUA 1ISIA 1X1EA 4PIVA 3W4JA 1SOVA 2EGHA 1ZK3A 1EQ2A 3ZWAA 4CQLB 4OIMA 4IXWA 1Y8QB 4D3SA 5T64A 4YJHA 3KB6A 4CMIB 1JA9A 3I9KA 3TOZA 3HHPA 4XYGA 2PFGA 3UH1A 4LK3A 2WMDA 1V3VA 5I9NA 2ZB3A 3CUKA 4L73A 4R51A 3OH8A 1K6IA 3K73O 4TKMA 5CDUA 1T1SA 2FZWA 1HE5A 1E1MA 4DMMA 2TMGA 5ER9A 2JD1A 2A9FA 2DU8A 3WQQA 2CF6A 1QMGA 3BMNA 3ZW9A 1ADCA 5JDIC 1A27A 3PJFA 3D3EA 2C07A 2V6MA 1G6KA 1R4NB 2Q1TA 3PIDA 1GDHA 2C5AA 4IS2A 3PDUA 4JJGA 5MDHA 3GUYA 3RJ9A 3TPCA 3WJAA 1IPFA 1LDYA 1DO8A 3TZKA 3IKVA 2VNAA 1HYEA 3Q3CA 2NADA 4PLYA 1GUZA 5CP8A 1EUZA 3DDNA 1I3LA 3ZN2A 4R1UA 2RHRA 4FFOA 1NASA 3GGGA 3GNSA 4PRKA 4GSLA 2VYND 4B4UA 4D3DA 4CMEC 1VC2A 3F1KA 3R3SA 1QV6A 4IDBA 4DUPA 4E12A 1NNUA 3O38A 3JQBA 4R54A 4UUOA 1JAXA 3GAZA 2ZK7A 3B6ZA 1FDVA 2EP7A 2RIRA 3WMXA 3WICA 4UVHA 5I9MA 4CQMD 1KEWA 3E5RA 1O9BA 3IDSA 2DC1A 4AJJA 3SLGA 2NU9A 4BO1A 1VPDA 4NU5A 4CODB 4AJNA 1PQPA 1X7DA 4J9UE 3ETGA 1NHGA 1SEVA 1ZEJA 5TF4A 1YL6A 3QA9A 4L9RA 1TT5B 4I08A 4A5OA 3DZFA 2ZB8A 1SC6A 3E6AA 1HE4A 1HXHA 3C7AA 3GEGA 4HNGA 3WGQA 3G3EA 2G0TA 2GERA 3ROQA 2GR9A 4YT8A 4PFJA 3G0OA 1GEGA 1QYXA 1X14A 1HDRA 1KVSA 4E2WA 1LQUA 1Q2XA 2HMSA 2JD0A 3C7CB 4BO7A 4DXHA 5JMWA 4BKOA 4CV1A 4R68A 2YDXA 4QFDA 3SBOA 4G65A 4BMNA 2FR8A 5ER6A 4N54A 3FBTA 3PGXA 4KMSA 4B4VA 4F3YA 1XELA 4K1LA 1Y1PA 4K9DA 1E5QA 4DLAA 5B1YA 2F00A 3PJEA 4E3ZA 2FP4A 1H5QA 4BNYA 4JBGA 1YJ8A 1X1TA 1DC6A 4FGSA 3AUUA 2QZZA 1AXGA 4Y6RA 4IDAA 4YYZA 1MLDA 3MWEB 4NR0A 6LDHA 1QR6A 3TWOA 1E1LA 4FPXA 3WGGA 3OM9A 4R4JA 4QQRA 3GVIA 4C7JA 3VDQA 3TZQA 3RFTA 4ZQBA 1FMCA 4E5PA 1DEHA 1PJSA 2BKAA 2RH4A 4XB2A 5I8WA 1JWAB 5TS3A 2EGGA 2X86A 4E5KA 2IRWA 1GV1A 4CLOB 5FFFA 3FF4A 1KY4A 4XYBA 3A4VA 3WGHA 3AUAA 2YQ5A 1KEVA
chains in the Genus database with same CATH superfamily
4FYIA 4JJIA 1Y6GA 4RJ2A 4RQBA 2DR3A 4EW2A 4OGLA 5FAKA 1S7GA 4DIBA 5EIWA 2IYFA 4LF6B 4QYTA 1NXWA 3GPBA 1PKEA 3AL3A 3T3MB 2JIRA 3EF1A 4EJ6A 3ZJTA 3M6FA 2YWJA 3FZQA 4KDEA 3D3QA 4MUMA 1E1RA 3ETEA 3PXEA 1CRPA 3DG9A 2WBLC 5LZ7A 2H2GA 1YONA 1I10A 3OU7A 1U28A 4B73A 4YXWD 3VNUA 3ZGVA 4JY7A 4WBNA 1QP7A 3WWOA 4B2PA 1V25A 5A5FA 3SDBA 1WS6A 1ORRA 1ZX1A 2F3TA 4KACA 2ZSIA 5DIZA 1WXGA 4PANA 1JU3A 5CEFA 1ZBQA 3V7YA 4ND8A 2JIBA 3LOUA 4B4OA 4DJFC 1VA4A 1AQIA 3R7AA 5KKNB 5C8XA 4Q4DA 3EGEA 4EF6A 1D4ZA 4UKDA 4IIBA 3WHPA 4ZAGA 5ESRA 5EJ9A 3GLGE 2L19A 3HB5X 4JNGA 1ADGA 1EM8A 2X5JO 3FSJX 1RXEA 4N5IX 3JVVA 5K20A 1E3SA 2GPYA 4TWZA 2NVUA 2B7CA 1JH8A 2CLSA 1R6BX 4XZ3A 3QFSA 4W1RA 3JQAD 4JUDX 4JYAB 2GCPA 3T99A 3W79A 1Q1QA 2GXUA 5IZCA 1CG6A 1Q7BA 1XDUA 2ZROA 1U7ZA 4XR9A 2XNKA 3HADA 3UAOA 1Q1BA 3C41J 1KH3A 4Y9TA 4RADA 2WF7A 2HNKA 2WMOB 1G3UA 3CX3A 5CDGA 2PSJA 1T8SA 2AZ4A 2GPNA 1YJAA 3SKYA 5DULA 2R6R1 4R8KA 4TPKA 5ALFA 4TV8B 4AZ3B 1FLNA 5IANA 1JX6A 3R3HA 1YZTA 1BHO1 5ESWA 1IN8A 1N6KA 1PL8A 2A59A 2HQOA 1AQYA 4IF6A 4O2BB 3DULA 4OSPA 1JHMA 5BOSA 1S2GA 1UXGA 4JSRA 3HJFA 1E9DA 2GDJA 3D6VA 4NOMA 5B1DA 1RC1A 3HKCA 1B8PA 2BTQA 5B37A 2A1UA 3TJMA 2P7HA 1KQ3A 5ALHA 2PD6A 4JVLA 1GUDA 2IS4A 4RTMA 4EDFA 2WINI 1NLUA 3R6GA 1AURA 2WG2A 3HXPA 4XUDA 1L1RA 1XF1A 3WGTA 2AL7A 5F7XA 3IP1A 5AKXA 3DL4A 5L3VA 4WZAB 1I9CA 1R66A 5EERA 3WL4A 4C06A 5JCZA 1JLRA 4YQZA 1SUIA 3PNVA 2VUSA 3I0NA 4MV6A 2YZ2A 4YRJA 2WWVD 3VPSA 4IV0A 1FUKA 1U2QA 3S2EA 1Z28A 4NOJA 1N0UA 1NVXQ 5H81A 1FA9A 1P2SA 1U2DA 3MJDA 3TEFA 1HNZB 1CB0A 1TK9A 1AZTA 1OT3A 1VJ1A 2DECA 1M2GA 2PUTA 3EZLA 4BASA 4AKGA 4BFLA 3O8CA 3H2HA 2BZ0A 3I30X 5BUZA 2ZUEA 2H5JA 1IY8A 2PR2A 3T7JA 2IZZA 2X9VA 2FFHA 2OM2A 2XUQA 1MRZA 2YWBA 3AW8A 3IQHX 1DEAA 1ODKA 2YWFA 4QASA 2OO5A 4WY8A 4DCMA 5I7EA 3K15A 1GUAA 2DPYA 1TK3A 2W37A 3SHTA 1FDOA 3T9AA 1ACJA 1QOPB 3U4CA 1V9LA 4MI1A 1G38A 5JZOA 4GU5A 1CDZA 3U3ZA 3A25A 1X80B 1DEKA 4L8YA 4QDTA 4DCSA 5B7PA 1KERA 5J59A 3M7IA 4XKJA 4AECA 5AJWA 5IAEA 1X13A 5J23A 2ZWVA 1C7RA 1JA1A 3A31A 3CPHA 4PSCA 4EA8A 5L3SB 4H35A 3SX2A 1RKBA 1NP6A 1E1KA 1RCFA 2P78A 4S1WA 4QDKA 4Y0AA 5DN6A 4NHOA 1J39A 4UHHA 4DR2B 3ND5A 1PT5A 1Z12A 2B8NA 1U3UA 3G2JA 3L93A 3OPYB 2QP3A 4MRVA 4Q4LA 4B8ZA 3ICQB 3H4VA 4M3NA 3NYQA 3JR7A 5K8LA 5BR8B 4DV2B 4NS4A 2GPWA 3FWZA 1H8HA 5DZSA 3HA3A 3OEHA 1B2LA 4IO0A 4EMUA 1XMJA 4MDEA 3R74A 1M10A 3WLMA 5ES3A 2AOWA 2IPNA 4QPCA 4HNUA 2GN9A 3BX1A 5IWCA 1OB5A 1L5SA 2IYOA 1N1EA 4IQ4A 2XNHA 3IBYA 2WQ7A 3VNBA 3HSKA 4DQKA 4LBZA 5L7TA 2GZ1A 2JDID 1EYZA 4R1MA 2GPAA 2QNIA 4MB6A 2X5XA 4YLEA 5EKUA 3C97A 3ASVA 2Z5GA 3MF4A 4U3JA 3P19A 5BW6B 2Q5CA 4JUAA 1H6DA 1DSSG 1BMFA 1FRVA 1J1ZA 2Q3HA 1D3AA 3DGEC 3NIGB 2IHNA 3MUOA 1RI5A 1EFHA 1MBZA 3EN0A 4DYDA 2GM4A 3OQNA 2N9UA 1TVEA 1VRWA 1C14A 3IXLA 5BW8A 2RKWA 3HS3A 1DWUA 3DV9A 3ESQA 3LZCA 3EVAA 1FLDA 4JP2A 2ZJAA 5IJ0B 5KDDA 1FE8A 2D62A 4GO1A 2IBSA 1RBYA 3FMFA 3IELA 1M2EA 1FS4A 5CFNA 1F6BA 2OA0A 3O73A 3GZNA 2PN1A 2D6FA 4QPJC 1I1HA 1WXXA 2H1LA 2HBYA 3HJGA 3HMQA 4MUBA 4MHSA 1IQPA 4U7GA 4XQ9A 4NCKA 2G0NA 5HRAA 2OMKA 2OBFA 4UBJA 3RUFA 1XFDA 3IPXA 4H1WA 4DXAA 1XMQB 1FDTA 4O8CA 2QYSA 3LT4A 3DB2A 3TTYA 5H3HA 5GIOE 1J9ZA 2PIAA 2XMSA 4WZAA 1YBAA 4GZ3A 5ICCA 3D0RA 3QWIA 1ZGZA 5AWFC 1L8AA 3NANA 5B7NA 4UXHA 4LE0A 2BMEA 3U4IA 3FY4A 4A8JA 3CRNA 4RANA 2G1PA 1PJCA 1J33A 2XF2A 1VE1A 2XQKA 1A5ZA 3JWJA 4FFMA 1CJUC 3AX6A 4FQ8A 5BRNA 2QL7A 4Q3DA 1T5IA 1QDUA 2I6XA 4CCAA 4CTNA 3M6UA 3LHKA 5GAJA 2WF5A 3FSEA 3IP3A 3QVOA 3AP1A 3ZQJA 4EYGA 5JCXA 1H2HA 4JJFA 2RKBA 3WRWA 2I8AA 2IFTA 4RSGA 4TV8A 2BY4A 1WCIA 1BG6A 1GU1A 4YMTA 2VQ3A 4O3FA 3D7MA 1OYVA 2AX3A 2GRAA 4HB3A 4ZI5A 3I2FA 2CVHA 3ZWBA 4IDUA 4J0EA 3BK1A 4Z86A 1L5YA 1L4NA 1VLQA 2W8BB 3CWZA 3MNFA 4C5BA 4YUWA 2CT8A 4F3TA 3W78A 1L1FA 1XPRA 2VHXA 4ZCRA 2FN4A 3B6IA 1TL7C 4PG6A 2DF8A 4RVSA 3PFKA 2YJ5A 2GHTA 2XT9A 1II9A 4GGPA 1UZAA 3UENA 1Y4DE 1KORA 2WUDA 4Q66C 5A3JA 3MT7A 5H8WA 1GYRA 2WP0A 2J85A 2AEEA 3MJFA 5LQNA 1LSJA 1VJTA 1V71A 1C7JA 3PPIA 1NXVA 3PT9A 1QGUA 1NONA 3E5MA 4EB6B 3H99A 5EJ2A 2EDAA 1EM8B 4NESA 2AN9A 3DMHA 1NBMA 3NNNA 3PFNA 2QEQA 4P7BA 3BCHA 3Q1KA 1NJGA 2O6LA 2VT7A 2WIDA 3HXKA 2GJ4A 4C0AC 4OQDA 2G1KA 4K9KA 4XM2A 4BNXA 2G72A 4R2JA 1M66A 1LVGA 1NURA 2QPTA 3AUTA 4D57A 2VXYA 1CV2A 1IH8A 3IPAA 4MH0R 1GRVA 1KK2A 3DW1X 3THYB 2Q45A 4MAAA 2Z2XA 4W1QA 2RGEA 3OWOA 1NW7A 2YOHA 2ZYVX 1Q0ZA 4FMCF 4O0LA 3GLUA 3MXOA 2ZRCA 2FLKA 3N1UA 4BO6A 5KVSA 2H0AA 1F4PA 2JIOA 2OOKA 3KUXA 1OA1A 2QE7A 4RIHA 5AH0A 3A9VA 4GPIB 1NBOA 1U8FO 4TXNA 3CO5A 2R6ZA 1C1YA 3LRTA 3NHJA 4F11A 3FPAA 1Z0JA 2FUG1 2NZYA 3H1BA 1NMSA 1YS6A 1RW4A 1XJCA 2FWJA 2HM7A 4H0FA 4HN4B 1M9NA 3QVTA 1VYHA 3ZDXB 2BGJA 4MKZA 3V7WA 3LZ6A 3K1YA 1QK4A 3JQCA 1UC5B 2EJCA 2FMXA 2GLUA 4A3SA 1UODA 5FHRA 1K8YB 1OILA 2NZVG 2OSVA 3AUFA 1CIPA 5L40A 4EUEA 3DZGA 1IJFA 5DXFA 4U7DA 1W9MA 5LZ5A 3EWAA 3EVDA 3OX1A 1DXYA 1E7QA 3LP8A 1I1NA 2G7MC 1AKNA 3K9LA 1O95D 3ES9A 3O92A 4RF3A 3W77A 3SF8B 2HHJA 4Z7JA 1EQAA 1H0RA 3E3LA 4W63A 1T1JA 2PQ2A 3PI7A 4OL9A 3HKDA 3R0JA 5FLEX 3D0KA 3Q5GA 3V97A 4D6XA 1S8OA 3OJXA 1HI9A 3QUTA 2J6BA 5DNEA 3P9ZA 3HGQA 4X7PA 1RRFA 1TO1E 3EQZA 2FDRA 1E9FA 4UHJA 4RD2A 1F4VA 1K4MA 1SKQA 2QDKA 1IJEA 4HGQA 4HLNA 1O94C 2WKRA 4J0DA 1XEWX 5BSRA 4RKRA 3I45A 2EG9A 4TWRA 4QO8A 3HFSA 3PPYA 4IZ6A 4K6HA 4ZOCA 5KO2A 3U3DA 2JGMA 1LI5A 4CU2A 1J5EB 1NPTO 1BQEA 3GJ8A 4LXQA 2P4HX 3L7IA 5B4TA 2CFSA 1HQCA 1B8NA 2IP4A 4HCJA 4CMAA 3Q0EA 4BQNA 1MZPA 4C6SA 2HT6A 2E49A 2FF7A 3LCVB 5EPEA 1P4AA 5DHQA 4EHKA 1FMTA 3Q8WA 3AEUA 4R84A 1EX7A 1U9CA 2H7VA 3GRAA 3LS2A 5JAIA 1OWNA 3K0KA 3VSDA 4AICA 2BSAA 2AW3A 2ZYGA 4R8VA 3V8VA 1D7OA 1E1CB 1M7HA 2I65A 3A6ZA 2DMRA 3K5IA 1ZN9A 4DS3A 1LI7A 5KQMA 4HO1X 4JC5A 3E5NA 4BN5A 2CVPA 5T57A 1KJZA 2AR0A 5HZKA 1PZGA 2ST1A 4ZOAA 2Z58A 1VOTA 3QQPA 4MCHA 1TIPA 5EJ7A 3BG5A 1U9YA 4DV3B 1E18A 2P30A 3C39A 1QCCA 2E48A 2VCYA 3KB1A 4YJ3A 5CB4A 1PK9A 1SIUA 3PGKA 3O6VA 4HP8A 3K9GA 4IG9A 4OU5A 5HMMA 3U39A 2M6LA 3HSYA 4PLGA 1NDHA 2EXXA 3GUZA 1YR3A 1DLJA 1UDBA 2WNSA 5LMUB 5AT1A 5JXWA 5IHXA 1UIRA 2OQIA 2Q3JA 1CU1A 1LPBB 1ABEA 3L6UA 4AYXA 4CKEB 5LQCA 2OZEA 4NYIR 4ZT5A 3ETNA 1PFKA 1X77A 1FB5A 5AVVA 1C30B 2PMDA 4BWVA 4DLZA 2ORVA 4QOFA 4LY0A 5CGQB 2XZDA 3QX8A 5JSZA 4MUEA 2QRUA 3G0GA 1OTHA 1P45A 1XZEA 2BRUA 1N5KA 2IWRA 2EHDA 2C8LA 3SC2B 1OZHA 4GR4A 4WZBE 5BSEA 3RUHA 4RVUA 3WQHA 1KWKA 2QTNA 4QBHA 1UFVA 5H4HA 4ZZ2A 1XVIA 1JSCA 4KW7A 1NQXA 2BCJQ 4HLQB 4C0QC 5BNZA 4MX8A 2I1QA 1UAAA 1W88A 1NZDA 4YPOA 2QUZA 2QYHA 1MX3A 3B1KA 2CW5A 5FUVA 3WGOA 5JJBA 4BHHB 5T4HA 3E82A 2PGNA 5HWSA 3N6VA 2OGTA 5G3ZA 1ANKA 4PNZA 2PFKA 4ASUA 4D41A 1Z0FA 4P53A 4RKYA 1BHJA 2C0PA 2NUTB 4PNEA 2H0RA 2M1ZA 4QGGA 4YJ2B 1JG7A 2ZR9A 1EP2B 3DLCA 2B8JA 3KD3A 5HZMA 1PU2A 3N87A 2O3TA 1RWOA 2IE8A 4LDJA 3L9WA 4Y1FA 3HNOA 4IWNA 1D6JA 3AR2A 5C5CA 3LC1O 4IXTA 1H2AS 4AN0A 1CJSA 4QGHA 5BNTA 3U7HB 4KO8A 1M2HA 2QRLA 4DKXA 5BQOA 1LWOA 4BKQA 3DV0A 2CN1A 1I2MA 2YH2A 3IAS1 3VA7A 6Q21A 3EYAA 4HXFB 3QY9A 1WPXA 4HSEA 5AHKA 4YAWA 3AFNA 1NFQA 1DG3A 1G21A 2Z2KA 3EG9A 3GG9A 1A9TA 3MYYA 4A16A 3T5AA 2DQYA 1OX5A 1PGNA 2BI7A 4HPXB 1ZLYA 4DT1B 1MB3A 3VAAA 1KEKA 2Q3DA 3R6TA 5JISA 1I7LA 1Z5UA 2C5EA 3HUFA 4NZNA 1XCBA 2X2EA 3TLGB 1SZCA 1EAYA 4K9PA 4MVJH 2FZEA 4IOJA 3IMKA 5A9TA 1ECLA 1ICEA 5DT9A 5HW0A 1QDLB 5HPYB 4HDQB 3TQOA 4E4RA 2W2PA 4RVDA 1JG1A 3MS7A 1Y8QA 2IV7A 2GVNA 2IYSA 3NT4A 2Y1OA 1N5JA 4G56A 1MPXA 1RSZA 3FPGA 3HDTA 1A7JA 4YMUA 2SHKA 1RWMA 1OWOA 1WD7A 2P2SA 3LM8A 4J0CA 5TQ0A 3QPWA 3EXFA 4WZBB 2JH3A 4QLOA 2O7QA 3GFQA 3LHDA 5DWDA 3OI7A 1V7CA 2B3TA 2Z9DA 4WFQA 4F3KA 4UVGA 1ZVQA 3N53A 4H6PA 4XB6B 3UJCA 4B82A 4OMFG 2E0IA 3CC8A 2HN9A 2W2LA 3FIUA 4DDUA 1DG9A 1UWCA 3PFIA 3TW0A 1CC1S 5DBGA 3OUTA 1JL3A 1UEXC 2R7MA 2HW8A 3AP3A 2VJOA 3LX6A 1U8EA 5BT8A 3KTAB 4QT0A 3UK2A 4Z5XA 2ZITA 3D0QA 4M6WA 2W42A 3HBFA 1N8TA 2BM1A 1C29B 4EFKA 5E6RA 2YNMA 4HH0A 1C8KA 4FGUA 2B8TA 1P9OA 3KSRA 2GMWA 2BWJA 4HEQA 4JI1B 3TX2A 3AF1A 3D3WB 1L8OA 2WY2D 5FO1A 3UG6A 1HQYE 3U2QA 4NBLA 1R0BA 1YCDA 2GN6A 2RGAA 1Q7GA 4Y1EA 5L7WA 2PWZA 3CR8A 3F97A 3Q11A 4GMFA 5KKCA 1RLMA 4MQEA 1I14A 3FM9A 4XXHA 4H2DA 2JJ1A 1LNQA 4LYEA 3E3OA 3A1WA 1I4LD 4MYHA 1DDOA 1X7XA 4OM8A 2J32A 2JANA 1IEQA 4URHA 1YDMA 2VNSA 1ZJ5A 2V4UA 3KM0A 1XI2A 4F4CA 4U00A 3G23A 5K6AC 2CNDA 1XE3A 1YI1A 3UJNA 5LN1A 4AULA 2XSZD 2AB0A 3DKKA 4JJAA 4JQSA 2HJWA 2ZRMA 2DKOA 1GP2A 1P9LA 1UJCA 1DBPA 3NM6B 3X2SA 3KYIB 1ZLXA 1H9BA 3BGSA 5LB4A 2HK6A 4A8HA 1LUAA 3SNHA 1UKVY 1A1SA 2A3RA 4ZKEA 2W22A 4ZJYA 2O5VA 2AN3A 5A6SA 1Z9BA 2RHLA 2CUTA 3EA0A 1R50A 3WK9A 2Z56A 3R24A 3MA0A 4QGAA 1TUBB 2FRDC 1DKMA 2NT3A 3QE0A 4R2KA 5FFMA 5LZ8A 1WHTB 3O03A 1JZTA 1Z8DA 1JXOA 3BHMA 1OZ0A 3GCGA 5CK4A 4PAMA 1C1DA 1P7YA 2X0RA 2Q1XA 1T3GA 1H8HD 1TIBA 1H2WA 4JLAA 2Z04A 1QQ6A 1U90A 4Q1AA 4GPZA 5E8RA 1Z2CA 3RR2A 3Q5EA 3UJ8A 4KX5A 4D99A 5BVGA 1X1QA 1HDOA 1UFQA 4QRDA 2CJWB 3UVEA 1I2DA 1N2OA 3LO8A 2F3SA 1PO7A 3R8CA 1K66A 4DRYA 1CP2A 4WHMA 4CL8A 2ID7A 5G4KA 2PX3A 3NGLA 3EVTA 4QUKA 3TTWA 2DHDA 4RIFA 2HAEA 5EXTA 3TTVA 3BEDA 3NWJA 4QG7A 4AF6A 4AK9A 2BEVB 4Z1MA 5FBVB 3PJDA 1K92A 1GAJA 4ISBA 1U3WA 1EFCA 3PS9A 1JIJA 3HGMA 1SUAA 3QZUA 1A9XB 2WHEA 4GVXA 1PFVA 1VKHA 3AXSA 5KU1A 3NDJA 1PR9A 2WYUA 2P9JA 3H5IA 3KQSA 3RJ5A 4K9OA 1Y9JA 1DIAA 2BE7A 4KB5A 4L72A 3G0HA 2H9IA 2B0JA 3IUNA 5C8YA 1A9ZA 5LU9A 4PG7A 3K4HA 5DO9A 1QH8A 1QR2A 1UEJA 1N7IA 3DT6A 5CFOA 3W0LB 1BJKA 3AIIA 2H4HA 3HDYA 2C58A 5CT6A 1RFLA 5JPDA 3OZ7A 1QUEA 1Q7RA 5GINE 4Y7CA 2AXEA 2D5IA 2II6A 3AI3A 4KO4S 1NUAA 4MS3B 5DBEX 3HLTA 2ZP1A 2I0FA 2ZE7A 2AG6A 3V8BA 3QW2A 3DMNA 1M7BA 2ZB2A 4Q15A 1YHNA 4ZYXA 5BN3B 1VDMA 3QKSA 1AXEA 2VS1A 3CZ5A 2OCYC 4F7WA 5DTJA 5SZJA 4DY6A 5JYEA 5KYYA 4URZR 2DHCA 3RRZA 4W5RA 1QWSA 1IY2A 4YA6A 4TKUB 3THWA 3UT6A 1I4DD 5A9SA 2YRFA 1WWKA 2OE2A 3MOSA 3RUPA 1KDRA 3P9IA 3KWMA 5EMKA 1W0KD 4U63A 4R9SA 3A10A 4PBTA 2WJ4A 3SWWA 1DU4A 4DAOA 1LPAB 3MCUA 2R87A 2C04A 4DIKA 2RHMA 1UQUA 1M3SA 2POCA 3V2UA 4AZTA 1P1BA 3GL9A 3KT6A 5M5BA 3PCTA 4G63A 4GAEA 5EE9A 5JOQA 1CUEA 2A7QA 3OLXA 3OQJA 4ALLA 1GLGA 2HU2A 2OP1A 1V43A 3DQPA 2O4CA 1EJ0A 4K6MA 3HO6A 5ALYA 4EFLA 2OL4A 4D81A 3P9PA 3N8NA 1DJQA 3KKMA 5AJVB 3TTTA 1YFLA 1N0IA 1C1XA 3ZJ4A 4OX9B 1ZA1A 3FLEA 1PEAA 2E4WA 3G02A 5BV2P 3LUAA 5IJ0A 3PGJA 3HWSA 6CHYA 4ARCA 3GLVA 4FSHA 3R9IA 5CA1A 1G41A 1ZNQO 4C4TA 3TJZA 5E95A 5FOSA 5EHZA 2R4TA 3LZDA 1YGYA 4H3SA 1U2EA 2JGRA 2VH5R 3R3ZA 4IHJF 5HK8A 2AXQA 2EF1A 3EZ6A 1T4GA 3ENZA 4G4GA 4B4DA 3KB2A 2ZYAA 2EZTA 5AKZA 1ZK2A 1N3LA 1VCHA 4XDZA 1H93A 1YJQA 2VHJA 3LYUA 4XX0B 3GNTA 2X1VA 1W93A 4WINA 4WWHA 3NRBA 3U7JA 1QKJA 1SD1A 2ZRJA 5EZYA 5IAGA 3RFCA 3RHSA 3NAQA 2YYYA 2NIPA 4LZJA 1D1QA 3JQEA 121PA 4WGGA 4PYRA 3CQ9A 1G8AA 3E9EA 3SMVA 5SZIA 4NMXB 2HO5A 4C29A 4G5YA 4ODIA 3SOPA 1I0IA 2BEJA 2PT9A 3R7FA 3SFZA 1QQAA 1K8RA 4A8PA 3RC8A 1XAIA 3U3XA 1UBSB 3KLOA 4CIBA 1IQUA 3NEYA 3OESA 2YRXA 1YVUA 3EJWA 1D07A 1ULSA 3DMPA 1GIAA 3KKKA 4UBOA 2OBXA 2FOIA 3RS2A 3BVPA 3BFXA 3JSAA 3NG1A 5F1KA 1FTGA 4I8DA 4X45A 3DE5X 5IDWA 2WD8A 3ANMA 2VKQA 3DL7A 4TYPA 1FXUA 1H2BA 1HNXB 4ZCLA 3ML1A 3FTDA 2VDQB 4HDMB 1RXUA 5GTDA 1L5MA 3IAM6 4JI3B 1DNPA 3OU2A 5C31A 1FFSA 5JWOA 2JAUA 2JLAA 3RE1A 3TXXA 4ZJUA 1EBFA 1M8JA 1KKLA 1P6UA 3EBPA 9ABPA 1E9AA 1P75A 1DHTA 4HB0A 1BRTA 2J4CA 1CS0A 2HLPA 1PDOA 3KUKA 2SCUA 3RT7A 1VHQA 4ATNA 1EA5A 4I55B 1BVYF 3K70B 3S0JA 3NOXA 4N0EA 5DOZA 1SBTA 4E09A 4FFBA 3FMVA 1NE2A 4L5JA 2IF0A 5C53B 4A0RA 2C42A 4B74A 5AHWA 4DR3B 4BQFA 3FDIA 4NENA 4YP9A 4KLZA 1QIFA 3ESCA 3OZBA 5LBTA 4EWLA 1X8LA 2O3QA 3I3SR 4J1SA 2X2FA 3RYFB 2AOXA 1J1IA 3BSWA 4KIJA 4DA0A 3RTDA 1NN3A 5GGXA 4V0OA 1YZQA 2HSWA 2IELA 1E6UA 2Q0XA 2VPZA 4UAVA 4CM7A 1P7WA 1TC1A 3IAEA 4R7ZA 2XBUA 3OZAA 3U13A 4B71A 3WL3A 5IDQA 4UU7A 3IR6A 3GJ0A 2PNJA 1AKTA 3SPXA 3COZA 3VGJA 4RQAA 1F8XA 1L4HA 2MMGA 1NNI1 4MWGA 3WRVA 2XTMA 2ODWA 2Q8NA 4LZLA 3ZV3A 3CGWA 1AUOA 3NIFB 1GGFA 1O6BA 3BIWA 2OCDA 5TSDA 5ICEA 2QRJA 4QPZA 1MNAA 1GA1A 2PVCA 3INTA 1B0AA 5ITVA 4L6IA 4Q9NA 2P4EA 1XBTA 2BEKA 1QYDA 4KE9A 5EUCA 3SC4A 4ZDJA 5D3QA 4EB0A 3HHEA 2F1JA 1NUPA 4ZQGA 4IMRA 2QN3A 4DMHA 3R0QA 4U0JA 4B4WA 1YKFA 2WHRA 3A6EA 4A03A 1X92A 4YCMA 2GBCA 1AUPA 2AYZA 3MT9A 4FONA 2Q9BA 3DC7A 3DVSX 4OHBA 2ZUCA 3TH5A 2J48A 4NXMB 1Z7EA 4TSKA 5EWLB 3CNOA 4JLVA 4OUDB 1TEXA 2FSSA 3GBVA 1S7CA 5CH5A 2BM8A 3BHJA 2CLLB 2EW2A 5B57C 4OLBA 5E2BA 4MJ7A 1KDYA 5L3QA 2W5UA 1CUJA 5AUOB 3J81A 2XCRB 1T36A 1X86B 4CN8A 3L0SA 5KHLB 1FW8A 4XGKA 3EDYA 1J9GA 3I23A 4P3OA 5I7AA 4KQ2A 2QNBA 4YR7A 2JIMA 1V95A 4KNYA 1IJBA 2ABWA 3A4YA 1AN0A 3HLKA 2DFKB 1VHTA 3MUEA 2B1JA 1X2BA 4ZCQA 3I3OA 3HPQA 3H8SA 3I2IA 3EUWA 3MZ0A 1KAMA 2G9RA 5UKDA 1KJ8A 4ANFA 1KZ9A 1TZJA 2J0UB 4G5QA 3WLKX 3MQFA 2WWIA 4P7FA 5A7HA 5FA5A 2AIRA 5DNVA 4J4HA 5KX5A 3L46A 4Z49A 3KKLA 4W6ZA 1FIUA 3UMMA 1NY6A 2A86A 3ROPA 1DJOA 4LPSA 4BE7B 1I7NA 1N9ZA 4XGRA 1W29A 2H63A 3G7SA 1W48A 2P0EA 3CEAA 5CB8A 4J1NA 5CVTA 5IF9A 4PSKA 4II2A 2RHJA 1M8GA 3OZXA 1QONA 1PTJA 3HMKA 3CLKA 2PZLA 4UEWA 1CF9A 4J0KA 2WIBA 3IMFA 5EIBD 3SJZA 4C6TB 1T5HX 1TQ4A 2QN8A 1UMDB 2W2MA 1UXOA 3O7WA 1XEAA 3IQZA 2JASA 3EDCA 3FSGD 3QOFA 4WFJA 4WK4B 3HABA 1G3QA 2Z9BA 2V3VA 4X20B 2M9MA 5HZGA 4MYCA 3QEMA 5FWXB 2QR3A 1JQ3A 5CNKA 2EFJA 5DEIA 5KVCA 4P7GA 1MP0A 4IMJB 5ESXA 1BEEA 2M2IA 3N6RA 4N3GA 3LF1A 3I01M 3TX6A 4C4OA 2J3DA 5P8WA 3U48A 1I7QB 2B2CA 2FWMX 3R5SA 5JAMA 2QRVA 1KP3A 2XX3A 4PYJA 4S1NA 1BS1A 4B32A 1U4SA 1RJGA 4GEKA 4MIKA 2PSFA 1EGAA 2AC2A 4TLLB 3SEFA 5AW4A 1ISHA 3M8KA 5DB4A 2BMDA 5EG5A 3TAXA 3PR2B 3ICPA 3BXFA 3RBAA 4CTMA 5FNVF 1XN1A 3REQB 4ZK2A 5JZMA 1ZK1A 2C7QA 5WRFA 1T2AA 4L16A 4O63O 4ESEA 3WL8A 1HO3A 1H8ED 4PN3A 2AOUB 1WQ3A 3IA7A 2ZDQA 4HX5A 4KDRA 3MINA 1WUJS 1WKBA 4NNJA 2QX6A 4MR7B 4RHTA 4YP5A 4BQEA 3T3NA 4QLAA 3AILA 1N0HA 1L4MA 2H3HA 2NO9A 4IRXA 4TMWA 2BT4A 1O0BA 4JOCA 1J5PA 1N5DA 1KS9A 3VNAA 3GGJA 3UATA 2VP0A 2JS7A 3PC7A 4OQNA 1Z38A 1Y6ZA 3GLSA 3M83A 1SELA 4LPKA 1D03A 1ZCJA 4BNUA 3KKNA 4U2DA 3KXKA 2F90A 4IFTA 1XP8A 1PE0A 2B94A 3UZUA 3ZHQA 4K9LA 4GDFA 3P2YA 4KPFC 3UTCA 2JKZA 1YZKA 3O4GA 4JBYA 5A5DA 1AVTA 2ZT7A 5LIPA 3T5CA 1JQJC 3ZW7A 1GZSA 4C2AA 4CR6A 1SVNA 2JBHA 2DB3A 3FUVA 3OIWA 1XJQA 1RYEA 5E6UB 5AW0A 2J3LA 2PT7A 3FDJA 1IAVA 3UTDA 1GQQA 1XTJA 1IB6A 1SCJA 3PNKA 4IKOA 3W4KA 5FI1B 5K8JB 1ZJ6A 1Y63A 3EHEA 3GGOA 3GLFE 3CLUC 3WIEA 2C4KA 3C6QA 1Q3KA 4CMCA 3TMKA 3D5QA 2XODA 3PQ8A 3SR4A 2QAGC 2HWXA 1TVCA 2OBLA 2YN0A 2ZUBA 3IDOA 4KMMA 1N3IA 3GVHA 4OAQA 4X97A 3AETA 2PRZA 2E82A 2QD2A 1ZH6A 3JQGB 3L5OA 1YRLA 3RT1A 1K63A 1YK1A 4HEA6 4B81A 1ML3A 1O08A 4R01A 2KQUA 2CHFA 3L79A 4NE9A 5BMVF 3ZJUA 3K9CA 2DERA 1MV8A 5IM4A 5ADHA 1DX9A 5J2TF 2IW3A 4Z0TA 1V6CA 5LIRA 1QB8A 5BUCA 4H1VA 2DUMA 2VPWA 4IXDA 2FMTA 1QIGA 3Q40A 1AGRA 2POQX 3WGKA 2WWFA 5FDFA 1KR5A 4HKTA 3AF6A 2AZDA 3RKRA 3RAEC 4DA9A 5FF9A 4BCCA 3DC2A 3I28A 1R6VA 2R8ZA 3KHKA 1XD2A 3O5AA 4JT4A 2BZGA 2PPVA 4AIIA 3HV2A 4KR2A 3VVLA 4PQEA 2BYTA 1DXOA 1QHIA 4MDFA 4MS4A 2D2EA 3IVMA 4NE7A 3GFPA 1T0PA 4JDPA 2DFTA 3UXYA 5C32A 5KMGB 3E7PA 1KAGA 3DW3X 4PQRA 1CFJA 3G6KA 2QW8A 1KMHB 4ZVSA 1MT3A 3SHFA 1UJNA 3I53A 5M34A 4X24A 3N59A 3C5VA 1WOMA 1Z4NA 1RYYA 3TCNA 5KJFA 1GUYA 3GJ3A 3RV3A 3CJRA 1QH9A 1V3QE 2CNNA 1LDMA 1E1RD 2GRUA 3T7RA 3GJ4A 3G0IA 5B1IA 2ATIA 4CUZA 2YWXA 2IIVA 4L75A 4KPUA 4P3YA 2JZOA 1BNCA 2KW5A 2EJUA 2D5AA 1OFGA 1VPEA 4QHYA 2ZS8A 2NU8A 2CJPA 3BSFA 4O2AA 1QLWA 5CPFA 3TOSA 1ZRNA 3VZQA 4C5AA 1IOLA 3UMBA 1X1CA 5B64A 4TTAA 5JBIA 1FYDA 1PJAA 2Q4TA 2N75A 3BK2A 4H16A 1CK4A 1T1RA 2CLMB 1E6CA 2BF4A 3CB4A 1FFBA 4NJMA 1P62B 1YZUA 3H9JA 2AHRA 3JRXA 3SU8A 4D9IA 4HQFA 2QRZA 3D4PA 4XD7A 2OO7A 3W6OA 1WTCA 2ZWPA 3BGIA 3OZRA 4LCJA 3ZCPA 2FCRA 3P52A 2PSDA 1ISPA 4J8PA 4LOIA 4NJEA 2I67A 2Y0DA 3RC9A 2VA8A 2A14A 4BRWA 4GKKB 1ZH0A 1H1LA 2R8BA 2VA9A 2J46A 5DXJA 3TE6A 3P4YA 2WF6A 5DI3A 4ZYYA 4RK7A 3DS8A 5C9ZA 3ITNA 1ZIDA 1RHQA 2QLFA 4RMGA 5LNK6 2V0CA 3JTMA 5BRAA 4JV5B 3DV2A 1TM2A 4MEAA 3LC2O 5KUTA 1EHIA 2P8JA 1NBIA 5K3SA 1UBNA 5EJIA 4IUDS 3N7UA 3VR6A 4C4ZA 4C7XA 3T3OA 4KITB 4IDPA 2H17A 1JJBA 2F48A 3LYAA 1Y8AA 4AJEA 1EAMA 1Q44A 5AVUA 3IHLA 1IXRC 4OCZA 2B0CA 4QUDA 2DPXA 1N36B 1TJ3A 1XP5A 1GNLA 2ZI6A 3WLLA 4US2R 4JYMA 4WOPA 1Q5PA 1TUEA 5EKTA 2HFJA 1IUKA 5CM9C 3E1SA 3TLXA 4DA7A 3BMQB 4EAAA 4MWCA 4N47A 3QRWA 1TTPB 3SK0A 5CFQA 2CHGA 4H7FA 3ZCVA 4DC1A 4C04A 3KSBC 1SQ6A 3W34A 2ES4A 3CRRA 5ALEA 2W4MA 1LK0A 5EKSA 3TG8A 2BHRA 2VNIA 2ENUA 3NHAA 3HCFA 4WIAA 4R6XA 1CUIA 3RODA 2Q9CA 3KZCA 4BVGA 4ZA2A 1QBGA 1PJ4A 5EYPA 5HM8A 2CE7A 1PJ3A 4JUBA 3KBBA 2QUHA 5JEDA 3WFZA 2J59A 3CUSA 1RAHA 4WKNA 4Q1VA 5G1OA 4V0LA 1PK7A 3OZUA 3FZEA 3RIGA 1Z6ZA 2BIFA 1NOKA 2VUIB 3L5KA 1MVOA 3RVNA 4CDMA 2VIIA 4PZ0A 3BRQA 4PIMA 1H2RS 4HS4A 4L4ZA 1QO7A 1PW7A 2JFWA 2BEUA 2B98A 5TLSA 2JAHA 4BMOB 5AK0A 1MQ9A 2RBEA 1TU3A 4ZOLA 2V98A 3LPLA 2VRCA 3K94A 4Y9DA 4E5YA 1W8DA 1JEYA 1ZXBA 4I5IA 4L4SA 3K2QA 1LJUA 4B7ZA 1AKMA 1AO0A 2SKCA 2BVNA 2W8ZA 3DEJA 2E5WA 1QPZA 1YRYE 3MWLA 2OFXA 3DP7A 5B4UA 5LP1A 1S6YA 3H9UA 3LCJA 4UQPA 1BMFD 2LR0A 2DTEA 5BURA 1CR6A 3G9ZA 3QJ5A 4O5OA 2QENA 1JU4A 3ZLJA 4KWIA 4HFRA 4DTCA 1ZOPA 2CL6X 5JU6A 4WN3A 2IDZA 5K05A 3H8VA 1RBMA 4B7UA 4F97A 2NP7A 1JHAA 1G3RA 3DDWA 1UWVA 2EGUA 2J3IA 3IALA 3TLYA 3VR3D 2JJQA 1NBME 3WLNA 4AJ9A 4UJ5A 4EFDA 4FOLA 3K9QO 1VM6A 4OK5A 4F21A 3IOBA 1TKAA 3AT1A 4NFYA 3VH4A 1VBKA 4E11A 1OGYA 1WO8A 5FP0A 4GL4A 1YFJA 4XGIA 4DLRA 4ENWA 3ADDA 4DN6A 1JJIA 2ASEA 1CETA 2FXVA 4RD4A 2I4IA 1TECE 2IU4A 3BF8A 3EARA 4G0PA 2QI9F 2IS1A 1I5RA 1BDBA 1XJ0A 4YJFA 2H1FA 5EOVA 1NGSA 5LQKA 2WJAA 5FEUA 2WRZA 1DG1G 3NBMA 5LQMA 4I1UA 1F48A 4RVFA 4QYMA 2VXCA 1SR8A 4KLCA 1P60A 5FOVA 5H3CA 4CT4B 1Z0SA 2YJZA 2ZIZA 4EL5A 4AZWA 3IQWA 4BEWA 1R9MA 2NUBA 1EKXA 2HA4A 4Y7DA 3R0IA 4D0SA 3FCYA 4Q16A 4I2VA 2W43A 2E21A 3FN4A 2ZJFA 5CIYA 1EE1A 3PRHA 4RABA 2WFLB 1QKKA 4MRRA 3CEJA 2IUUA 3VZDA 1U8XX 1KOFA 3ER8A 2X6TA 3T9DA 4W9NC 2CC2A 4TLCA 5A7GA 1B3RA 1COWA 2JDIA 4N7RA 4OHCA 1T25A 1E2EA 1UPUA 2A94A 4I4CA 4MVJM 3OIDA 3KR9A 4YJFB 4UVEA 5DBHX 2SNIE 4MUJA 3RYIB 3Q87B 1WX1A 4JB8A 3VMFA 5AR1A 5EQTA 4AU1A 3ITDA 5NLLA 1ND6A 5KOYA 4YWJA 4WZAE 1IWPB 1YBMA 2EFEB 3UHFA 3BKWA 1ZITA 5ENVA 5DLQC 3HN2A 3REFA 2AKEA 3V2GA 1UADA 2OCLA 2PRSA 3QPVA 3JD3A 1X94A 1HLGA 4BO4A 5AVWA 3EXEB 1Z2PX 2AHOA 3FR7A 2VJCA 3DKIA 4KQ1A 1HUQA 1CZLA 2DBRA 2ZYSA 4LHVA 4EY8A 5KPDA 2CK3A 4B3RB 4KI7A 1AV6A 4MVWA 4FR2A 1C41A 4MVJE 2YDYA 2GLTA 3JX9A 2IH4A 5HQJA 4X5OA 3A1DA 1GTSA 4R31A 4DUZB 3RUAA 4NECA 5AP9A 2PUGA 1J8YF 1XCOA 1GFSA 5FHQA 1MEOA 4JEHA 1H2YA 5F5NA 2VRWA 3W9BA 1F9AA 4KYIB 5LZ9A 5HILA 5BYJA 4B6FA 4EI8A 2GLXA 1JJVA 3H8WA 1UKEA 2C7VA 1XDBA 4ZO8A 1QLJA 2PLFA 4K6FA 1WP9A 3DP9A 4ZOLB 2WK1A 2FMFA 5FOXA 2VCEA 4IJ5A 3HACA 1Y4AE 3AKDA 3PKJA 4XA8A 4IVRA 2NO0A 2H1SA 3TOXA 5CNJA 4D8WA 4BGUA 2VPQA 3PNYA 5B58C 1Z4IA 4PF1A 1M1UA 1A2OA 4WVFA 2V97A 2QMHA 2QUBA 2FB9A 4GLFA 1ZJ4A 2DM6A 1N6IA 2I1WA 1SK8A 2XV1A 3UMGA 3AINA 1JVNA 2GJKA 3O4VA 3EQ6A 3WJ2A 1MXFA 3KD2A 2NZXA 4D02A 3WTCA 4CLRA 4LOJA 2C9BA 1CB7A 2AEFA 4KTVE 1XMOB 1E2QA 2E37A 2PO7A 4PGAA 4LV6A 5DBFA 2OXIA 3PIRA 5EZQA 1CLEA 2CNWA 2IPMA 1SMKA 3PVZA 3T7CA 1M1NB 1L5KA 2HJVA 3UGQA 1ATIA 5IF3A 3EDOA 2Z08A 3F4LA 2PTGA 4MV1A 1M0SA 5K3CA 1IIBA 4GI7A 2QQEA 3BQ9A 1J23A 1MD9A 3CE6A 3T4XA 3FAKA 4XIIA 3E1KA 4R81A 1XNRB 2IXFA 1KA9H 2W00A 3H5AA 4EPXA 3QVVA 5EIXA 5HTOA 1MORA 5JRDS 2K5UA 3S2IA 3RH0A 4A2QA 1J0DA 2ETVA 4C3VA 1R8JA 2WW8A 5KWEA 3T7DA 3FTFA 1ZD8A 2EBFX 2VFAA 3NKVA 1E2BA 2R9VA 2VPPA 3EGCA 4YS6A 2COKA 3F8TA