4LISA

Crystal structure of udp-galactose-4-epimerase from aspergillus nidulans
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
364
structure length
364
Chain Sequence
b'PSGSVLVTGGTGYIGSFTTLALLEAGYKVVVADNLYNSSAEALNRIELISGKKAEFAQLDVTDEAAFDKVFEAHPDIDSVIHFAALKAVGESGEKPLDYYHVNVYGTICLLRSMVRHNVTNIVFSSSATVYGDATRFPDMIPIPEHCPLGPTNPYGNTKFAIELAITDVINAQRNNAKKAGNETEAAKWNGALLRYFNPAGAHPSGIMGEDPQGVPYNLLPLLAQVATGKREKLLVFGDDYASHDGTAIRDYIHILDLADGHLKALNYLRANNPGVRAWNLGTGRGSTVYEMIRAFSKAVGRDLPYEVAPRRAGDVLNLTSNPTRANTELGWKAQRTLEQACEDLWLWTKNNPQGYRQQPPAEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-glucose 4-epimerase
publication title Elucidation of Substrate Specificity in Aspergillus nidulans UDP-Galactose-4-Epimerase.
pubmed doi rcsb
source organism Aspergillus nidulans fgsc a4
molecule tags Isomerase
total genus 125
structure length 364
sequence length 364
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lisA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4lisA02
5JS6A 1ULSA 2YQ4A 1PX0A 1CEQA 3LT2A 2HJSA 3LQFA 1MLDA 4BV8A 1GUFA 3IAHA 3H9EO 4GH5A 2Q99A 1SEPA 2IRWA 3U49A 4CM4B 1ORRA 3Q0EA 4RJTA 3FNGA 3L0DA 3ICPA 3KYBA 4BL5A 1VJTA 3U4CA 3IIEA 5IN4A 5IDQA 4CMKA 3RASA 3JQAD 3HFGA 2BGLA 3CZRA 2X0RA 1NPDA 3AU9A 2DC1A 3DXFA 3KM0A 1EUZA 2I3AA 4R1UA 1JVSA 1B26A 3ROQA 1ARZA 2AE1A 4WNCA 1JQBA 2VN8A 4XKJA 4YAGA 3TOXA 1WDLA 3HN7A 4LSMA 3GG9A 3GN1A 2D2IA 1EE9A 4DWVA 2C82A 3HB5X 1XDWA 4DQVA 4A5OA 2X6TA 3NJ8A 1W8DA 2GSDA 4IZHA 4INAA 5JO0A 9LDBA 1GPDG 3QVSA 1TI7A 4WCFB 5GZ6A 4MP6A 2Q2QA 1P9LA 2QZ9A 1KEPA 3IOYA 1WAMA 3X2EA 5TF4A 1HYHA 4D0RA 2EG9A 1JVBA 3EYWA 5HBRA 3RFXA 3LLVA 1A5ZA 2Q3EA 3UOGA 3BIOA 5CP8A 5U4QA 2OP0A 4YAIA 2VWHA 1X7HA 3JCZA 4O6VA 3EAGA 4OSOA 4CR7A 1N5DA 4XX0A 2UYYA 1R0LA 4L74A 4JBHA 4U6SA 1NTOA 3ZCXA 3FCOA 4JXKA 4IGEA 3W8EA 1P1RA 4UEKA 4B8ZA 1OBFO 4ALMA 3DAFA 4CQMB 4KWHA 3QVOA 1C0LA 1HDYA 1X13A 4PLWA 3GFGA 4BMSA 1WXDA 1C3VA 3ORFA 5G0VA 1J0XO 2HMUA 2YY7A 4A10A 4CMAA 4E5NA 2DTXA 1B0AA 2IE0A 2JFGA 2VYND 4CUKA 4NMHA 5JAZA 1FJHA 2C5AA 3MJ4A 3BTSA 5J23A 2C0CA 5DCWA 5ITVA 4CODB 3I3OA 4WEQA 1B3RA 3VTZA 2GGSA 3GFBA 1I3MA 4FFLA 3ZNPA 3ZV5A 1TT5B 3VAZA 3BHIA 1SB8A 3CSDA 2Q2VA 4FGWA 5L4SA 1WNTA 1ML3A 4ALJA 4OSPA 4LVCA 1BHSA 1GL3A 5BNFA 1SC6A 3F3SA 3ZWBA 1GV1A 1Q2XA 3I6QA 3MZ0A 4QXMA 4RLHA 3RD5A 4BKRA 4R01A 1U2DA 4XQGA 3RCBA 3SEFA 4HKTA 1I3NA 4FN4A 1YL7A 3TWOA 3ROPA 2ZK7A 4IINA 4NK4A 2CDBA 3A06A 4L73A 4E0BA 4JNKA 2WSBA 1VJ0A 4E2WA 5IZCA 1ZXBA 3UXYA 4BNYA 1Q1NA 4J7UA 4IMPA 2J3KA 2NWQA 2LDBA 1PZGA 1ZIDA 4BOYA 1CQJA 1WDMA 4UEJA 4OO3A 2WMDA 2D0IA 3TN7A 1C1XA 3D4OA 1S6YA 5L4NA 2NQTA 1X1TA 3P7MA 1DRUA 4CJXA 1KVUA 3PWSA 1G0OA 2HMSA 3W4JA 4BNZA 3ROKA 1CWUA 1LSJA 3IKVA 3QWAA 1GDHA 4GGPA 4PN3A 2Y0CA 5JY1A 3GK3A 5A9RA 2J3IA 3FR7A 2VZ9A 3BYZA 3FWZA 2RH8A 4YJFB 3SVTA 1T4BA 2W90A 1AN9A 1H6DA 1LLCA 4AJPA 1DHRA 1LQTA 1PGNA 2QQ5A 3CPSA 1VRWA 4ZQBA 1SPXA 1UUFA 3UCXA 4BO1A 1OMOA 1LRLA 1OZAA 3ITDA 4MP3A 2HMVA 3WYEA 1GY8A 1JLLA 3T7CA 2H1SA 3OSUA 4OKNA 1HDGO 4IDFA 2NVWA 3VDQA 3EDMA 1LSSA 2ZQYA 2DBRA 3GHYA 1GD1O 1ZMTA 2HLPA 2ZCVA 3OETA 3A9WA 1ADBA 1VM6A 4CM5A 1BRMA 3FBTA 1U5AA 1YJ8A 1IPFA 3AUSA 5A05A 5JCJA 1ZBQA 3GA0A 3L9WA 5F1KA 3RFVA 5KNLA 1PJTA 4AVYA 1VL6A 4XEHA 4GMFA 3FN4A 4YJDA 2VUUA 3X2FA 1DRWA 1KYQA 1MC4A 1KC3A 4EJMA 2EF1A 1OC4A 2ZKLA 1UH5A 2GF2A 1UDBA 3WTCA 4U5QA 4RVFA 4IZIA 4W7HA 3T7EA 1ZSVA 1XLTA 4QUKA 4F6CA 4MIOA 5JXWA 2ZIZA 3DL2A 4NIMA 4DGSA 1BXGB 1D7OA 3AY7A 1XIVA 4ND1A 1JKFA 3JQBC 4NFSA 3UN1A 3WGIA 4FOSA 1S7CA 4W9NA 3RBVA 3K6JA 1YJQA 2JCYA 4CM8B 1KVTA 1YDEA 2O3QA 3DZKA 3JQCA 1MG0A 4R41A 3WOHA 4IJWA 4KQXA 4CM7A 3WLFA 4CQLB 1NAHA 4NNJA 4IUYA 4QFCA 3HJAA 2WD7A 5C3MA 5JDCC 3PHGA 2PD6A 4U8GA 1CJCA 4YQZA 4H16A 4L0QA 3KVOA 4TRRA 1DC6A 4J3FA 3VPGA 2XXJA 4J16A 1D8AA 2BRUA 1EMDA 3VPFA 3PDUA 3QVXA 4R3WA 1LDGA 3PI7A 1GUYA 2NUAA 2ZB8A 2HDHA 4U0JA 1X0VA 1LC3A 1NQAO 3VVBA 1E6EA 4BUCA 4CLXA 4WECA 1NM5A 3H4VA 4J9VA 3JYOA 5TLSA 2VNSA 2RBEA 3I5MA 1A71A 2VT2A 4E5PA 4MP8A 1D1SA 1NVMB 3ONDA 4AICA 3SJ7A 2DM6A 2J3JA 3HFSA 4OQZA 4XYMA 3GNSA 5H83A 4HFMA 4MPDA 2X86A 1ZZEA 3ZW9A 5JPIA 2CUKA 4IIUA 4II2A 4UUMA 4BV9A 3OA2A 4AJIA 1YBMA 2CY0A 2ZQZA 3AM3A 1Y8RB 4LK3A 3H8VA 3GEGA 4MVJH 2NVUB 1UAGA 3DBRB 4TKLA 4EEZA 5KOIA 1PJ2A 3HB4X 4Q3AA 2PWZA 3U9LA 1E0DA 4JP2A 5BT9A 2W2LA 3PGXA 3JD2A 2Y1GA 3R1IA 1RM0A 2C5EA 4CLOB 4OOFA 2VWPA 1PQWA 3NT5A 3V2GA 1PR9A 1U3WA 4P4NA 1UP4A 1WP4A 1BDMA 1GAEO 2X9VA 1A27A 1P31A 4CLRA 5AOVA 2YFHA 4CQMD 3RWBA 1VC2A 5CDYA 1RJWA 3ZI0A 4N5NA 2PY6A 4HNGA 4UUPA 2UDPA 2DBVO 3GZ4A 1XQ6A 1PSDA 2B37A 4GVXA 2YHIA 4XDZA 1PGQA 3ZU3A 4QTZA 1YRLA 4NJMB 1UXHA 3HSKA 4NU6A 5ENVA 4BNNA 4D44A 4ND3A 1ZEMA 2AG8A 2DPHA 3LC7O 4R1NA 3PDJA 4B7UA 3DFUA 5F5NA 3UCFA 3UAGA 4A27A 4MIEA 1HKUA 1TXGA 3B20A 5A9SB 4YJHA 4LRTB 3JQFC 2FSVA 2PKQO 3R3SA 3BMCB 5MGBA 4D46A 3P5SA 4XJTA 3C1TA 1AXGA 2J5QA 2CVQA 5A9TA 3PJGA 3D4PA 1I3KA 4ND4A 4J4TA 4PCVA 3H5RA 2GUGA 1MFZA 2XF8A 3RUCA 4ZD6A 5U9CA 4MIYA 5A5EA 3NTRA 1LNQA 4B79A 3E9MA 1W4ZA 3KEOA 1FDUA 1U4SA 3Q2KA 3HADA 2JL1A 3ZV6A 1I32A 5H81A 3PZBA 3E18A 1N1GA 4NHEA 3V1UA 5JBIA 2Y1EA 4ZA2A 3FBGA 3EVTA 4PG4A 4RPJA 1BW9B 3OEWA 5I7EA 2DLDA 2BF7A 1QXSA 3DQPA 5CAEA 3SBOA 1O95A 3C3XA 4GX1A 3UFXA 1IHYA 4IDDA 2OHXA 3CH6A 4RPHA 4ZQEA 4LN1A 3ZWMA 4JROA 3RU9A 1F17A 2FPGA 1LRJA 2O2YA 2BFMA 2GD1O 1DFIA 4M49A 4DLAA 2YV1A 3JD4A 2YUTA 1E7MA 4MKZA 5G4LA 3PHJA 3AUAA 5KJ1A 4GMGA 3PJDA 2FRDA 4G5HA 4E32A 3O38A 2HK8A 3GEDA 3LVFO 2GN6A 3FNHA 4RDIA 3I4FA 4WLFA 3H9JA 3S2EA 4EI2A 1H2BA 1YONA 3LSYA 5CPFA 3FNEA 1JTVA 4I5GA 4UAGA 4IY1A 3G1TA 3OJFA 5KJ6A 1TLTA 1Y9AA 5HM8A 5EPOA 3VVCA 5HS4A 5IZCC 2YV2A 3AFMA 4TROA 2W2KB 4YCAA 4KTTE 2JAHA 1GZ3A 3QV1A 3HZZA 3H3JA 1ZH8A 3KSDO 5FI3A 2H9IA 3O4RA 4R1TA 2GRAA 1M66A 2ZATA 1J6UA 1PS8A 7ADHA 2JD1A 4YEDA 4HADA 5BNIA 4DPLA 2BGMA 3NT4A 1LDEA 1WVGA 3Q11A 1FF9A 3L4SO 4FFMA 2HKIA 5CEFA 3I9MA 3ONFA 3F5QA 4I08A 4XYGA 4MVJM 4IDEA 2PTGA 4DA9A 4RF4A 5L53A 4TRJA 1Z45A 5T5QA 3G17A 3E6AA 1H9AA 3CXRA 5G0SA 1EUDA 5HRUA 3ZNQA 4N5LA 5ENDA 3DBVO 1LDMA 3LDHA 3WJAA 4IXWA 1JA9A 2ZB3A 4W6ZA 1HE4A 4BB5A 2POQX 3IJRA 3ZWAA 1W0CA 3MCVA 1NAIA 4BNWA 3HN2A 4IJVA 4ZRNA 3QY9A 5DN9A 2E4AA 4FJ2A 4BGEA 4IQ8A 1R16A 3ETGA 2CF5A 3GGGA 5GZ3A 3QLJA 1TA4A 2X9GA 3L4BC 3G49A 2AHRA 2A9FA 1N7HA 4RVGA 1O8CA 3D64A 4ZJUA 5L51A 2X23A 2CDAA 2G0TA 3ADOA 2BELA 1SAYA 2DAPA 2E6UX 4D79A 1PL7A 4D0SA 4P4LA 2QIOA 5JO9A 1ZK1A 3WGYA 3RJ9A 1PGOA 1PS0A 1SO8A 4JLWA 4CM9A 5F1PA 5A3VA 2CD9A 5EERA 4Z6KA 3OQ6A 2V7PA 4J6FA 3UF0A 1B3BA 1CETA 8LDHA 5GY7A 4HWKA 3D7LA 2OMEA 1C0IA 4BHTA 3VC7A 4YTEA 3KETA 5JCXA 2EJVA 4XIYA 3RUAA 4B3HA 2HK9A 3ETDA 2FR0A 4NI5A 2UV8A 1B15A 4RCVA 3ZNOA 2CZCA 1QYCA 4YJGA 4UVEA 4OQYA 1H6BA 2J3HA 3KB6A 3D4NA 1Y5RA 3ZHYA 3VTFA 1P1FA 3SJUA 4I9NA 2IZZA 3WNQA 4LISA 1HE3A 1DIBA 1T1SA 1RPNA 1MP0A 4EGFA 4D43A 2JKVA 3NTOA 3INRA 1O94A 2X0IA 3TZ6A 2V6BA 4D3FA 1Q0QA 3C1OA 4OHUA 3V1TC 1U9JA 2BMAA 3W8FA 2BFPA 3M6IA 5A1TA 1Y9EA 3SXPA 3DBLA 5EINA 3WSWA 1L7DA 4M86A 4YAJA 1U8FO 1QSGA 4BO4A 3FI9A 4TQGA 3C1AA 4R4JA 3WX0A 5COAA 2G1UA 2W8ZA 4HV4A 5EQFA 4Z0PA 3HUDA 4DBZA 4U6QA 3AWDA 3Q9NA 2G5CA 2QYSA 1BTOA 1R6DA 4R69A 4Z9XA 4JBGA 3ZWOA 4UEOA 4PG8A 1DIGA 4JCOA 5L3ZA 2GERA 4P22A 4QX6A 1I0ZA 1B14A 2YQ5A 5JAMA 2JFHA 1ZW1A 1XG5A 3FD8A 3CMCO 4EJ6A 1QV6A 1DFGA 2PNFA 3JQBA 3PRJA 2EW2A 2O3SA 3I9NA 2CVZA 4KDEA 1ISJA 3A14A 2GN4A 4CMCA 3EW7A 1EFLA 1ZEJA 2EHDA 2ET6A 4XYEA 4BNVA 4CL3A 4YT4A 4QQRA 2ZYDA 3NAQA 5CDUA 4CR8A 1DFHA 3KLPX 3HHPA 3KTDA 4YT8A 4OAQA 2FR1A 2QHXA 1D1TA 3FR8A 3I23A 4B7CA 2O3UA 4M8SA 4YAKA 1PJBA 1DIHA 1PJ4A 3G3EA 2SCUA 3HQ4O 3PHHA 1P74A 7MDHA 2VHXA 3LU1A 5CEEA 1XELA 3KZVA 5KVCA 1DIRA 2PH3A 1O5IA 4LVUA 4E6PA 1U7HA 2P9EA 3TDKA 4TRMA 1R66A 4BNKA 1O89A 3EVNA 1HZZA 3SX2A 1U7TA 4KWIA 4GWKA 4BMNA 3QJ5A 2GLXA 3IL2A 4RQTA 5A06A 3QWHA 4PG6A 3OQBA 4J9UE 3WWZA 5G4KA 1XU9A 1Y1PA 2LDXA 3PQFA 4E12A 4H15A 1KERA 4D3SA 1K6JA 1DXYA 4GKVA 1DSSG 3RUIA 4RPLA 5A5FA 1ISMA 2VYVA 4AJ1A 3AI1A 3OP4A 1GYQA 2C59A 1LBEA 3GNQA 3INGA 4XR9A 4FW8A 4B4UA 4OMUA 1QKIA 4IJKA 2OUIA 1DLIA 3M2PA 2RAFA 3COSA 4J1SA 3WS7A 3ULKA 4QO8A 4B4OA 4BNIA 2AEFA 1HSZA 4XQ9A 2Q50A 2W98A 5KJEA 3VPSA 3C7AA 3OQ1A 2AXQA 1KEVA 3VOSA 3CMMA 2D5AA 2DTDA 4YACA 1IYZA 4K1LA 4BNJA 5ER6A 3I1JA 2YHUA 1MX3A 2QW8A 1IHXA 1LDYA 1CF2O 4D7AA 4ALKA 5HTOA 4WEOA 4YQYA 5I7SA 2P2SA 2EW8A 1E5QA 1FK8A 1WDKA 4ZQFA 3TZQA 2IZ0A 3QQPA 3WR5A 3DHNA 4LCJA 5AQ1A 3F5SA 4OXYA 3KYDA 5TT1A 4KZPA 4Y9DA 1NVGA 5DCYA 1E7SA 3E1KA 1UDCA 1YS4A 1T24A 1E1NA 1XYGA 5L7WA 3NGXA 4IMRA 1DC3A 2Q49A 5DP2A 3OHSX 1ULUA 1C1XB 3B1KA 1YO6A 5G2OA 1TEHA 4J1TA 1QYWA 1MXFA 1SOWA 5ILGA 1SNYA 1E3EA 3GZNB 3GDGA 3JQFA 1DO8A 1UXJA 4CMHA 2D3TA 1IZ0A 4P38A 3RSHA 1ENYA 1ZK3A 2B36A 1DOHA 4CMGA 1OC2A 4HUJA 4FB5A 1JDJA 4YRDA 1A72A 4LW8A 4UVIA 1V8BA 3U5TA 1SBYA 3BHJA 3GDOA 1P3DA 3WGZA 5EN4A 5AXCA 3V8BA 3ASVA 5IN5A 3G79A 3JSAA 1CYDA 3OMLA 3OM9A 4FDAA 3BMQA 3FWNA 2BI7A 4JQCA 1MC5A 1E3WA 2NU6A 4MDHA 3LLSA 1EK5A 1LUAA 3M1AA 4TSKA 4WLOA 1T2AA 6ADHA 2PD4A 1UP6A 4Q3DA 2YYYA 2P4HX 3ANLA 4J7XA 4PLZA 4KUGA 1Q0LA 3V1YA 3IC5A 1PZFA 1PTJA 1VKNA 1SB9A 2O50A 4IS2A 1HE5A 1C0KA 4HXYA 4WE3A 3WGOA 4J0EA 1I36A 4FJ1A 3D3EA 3RI3A 3W6ZA 5H82A 3UCEA 1PS9A 2Z1MA 3ETEA 2I76A 4I8XA 2RCYA 3FSRA 2I65A 4L4SA 3OF2A 4RL6A 3K73O 1ISFA 1JKJA 1WLYA 4MINA 1DBVO 1GEGA 3K9QO 4RVDA 3FHLA 3CINA 3PXXA 4CLEA 1E7YA 3ZWYA 3BXXA 3E8XA 2Q45A 2TMGA 2GO1A 1G1AA 2AG5A 3OIGA 1HETA 4P8RA 3TPCA 4YPOA 1PR3A 1HDZA 2H5LA 3WWYA 5JAIA 5FWNA 2NLOA 3WNVA 1QLHA 5B37A 3GVCA 3PEFA 3U0BA 5JNLA 5JYEA 1H9BA 2RHCA 4R51A 4PLCA 3GZNA 5B4TA 1QORA 1T26A 4XQCA 3SLKA 2EP5A 1LTHR 1QR6A 3WGHA 4Y6RA 2X5JO 1ZNQO 3P2YA 3ZHBA 3JYLA 1HF3A 2WD7B 5KKAA 5AXBA 1O9BA 3ZU4A 2O4CA 4E21A 4KUHA 1JN0A 3NUGA 2EERA 3IMFA 2XXBA 4KTVE 3FNFA 2GPTA 1YL5A 1SEVA 4TKMA 2OBYA 4RVHA 1U8XX 2BLLA 3OA0A 4FSHA 4FQ8A 4GSKA 2AQ8A 3BMOA 4RLSA 3JD1A 1P1HA 3GF4A 4FJ0A 3UVEA 2EJWA 3A4VA 3AUUA 3GNTA 3EC7A 3JYPA 2O23A 2FMUA 4MVJE 4PZEA 1GQYA 1VPDA 4OL9A 3DOCA 5CPBA 3DTYA 3GAFA 2Q4BA 3TRIA 3MJVA 3FPLA 3O8QA 1I8TA 1M6HA 3L4BA 5F3RA 1EDZA 3DTTA 2NU8A 4ND5A 4DVJA 2FOIA 4RGBA 3C24A 1AE1A 4UUNA 4ZQHA 5L7YA 1KOLA 3TFQA 1ZKMA 1NHWA 3BMNA 1ZVMA 2AQHA 2X5KO 4WOKA 3QIVA 3MWDB 2DBZA 3D3WA 1J49A 3AJRA 2CFCA 5T64A 3S8MA 1GYRA 3NGLA 4B8WA 5CFZA 4S1VA 1ONOA 1KEUA 4XGKA 4GSLA 5I7VA 4TZTA 2OXIA 4YAEA 4BO8A 5EIOA 3EUWA 4XCVA 3JV7A 2OOSA 4ROSA 5BSHA 3K2BA 2P91A 4YDRA 1YKFA 1GQQA 1I2ZA 1D3AA 1Z7EA 5ICMA 3OIFA 5TC4A 3UHAA 5IF3A 3KYCA 2HSDA 3O9ZA 4LRSB 2PGDA 2VHVA 4CLRB 3VH1A 3RKRA 2PZJA 1C1DA 2HQ1A 3GH3A 3HDJA 4PG5A 1YE3A 4YRAA 1JWAB 3P2OA 1JWBB 4BO2A 1RM4A 4GBJA 3STHA 1V3TA 4M54A 4WNIA 2V6MA 1ADGA 3TSCA 1HZJA 1AHIA 4ZICA 4RF3A 2YHIB 1KVQA 1GZ4A 1E6WA 2RH4A 5FI5A 4DQXA 3LK7A 3K30A 4I1IA 5FF9A 2CNBA 1YQXA 3R0IA 2PZKA 1KY5A 1T25A 5TJHA 3ZZNA 4NU5A 1O0SA 4NPCA 3GPIA 4EDFA 2UUOA 1OOEA 1NBOA 3O26A 2ZB4A 1UR5A 2JCVA 2Y1OA 3OJOA 3PLRA 4QT0A 4YJHB 3V2HA 4JK3A 1WMBA 3ENNA 3DAPA 3PGJA 4LSWA 1E1KA 4KDFA 5C7LO 5A03A 2HMTA 2ZTUA 2CSUA 3H2SA 3E48A 3PK0A 1P1IA 4DUPA 5IFLA 4BKUA 3I83A 3ABIA 1YL6A 3AI2A 3C85A 1EK6A 4E2XA 2A35A 2G17A 1DHTA 4QFDA 1GR0A 1HDRA 1LXCA 3GVHA 4FD3A 3SC4A 3PLNA 3KRTA 4MO2A 2X22A 1SCUA 5TX7A 3F1KA 3RUEA 1UXIA 4BNTA 3DZHA 2IDZA 3I6IA 3MJEA 1Y81A 5LCXA 1YWGO 3H65A 2AEMA 4WOJA 4CV1A 1UJMA 3F47A 4NFHA 2HJRA 3LC1O 1F14A 1GV0A 3GHHA 4BNMA 4YB8A 1U2GA 2Q4EA 3D5TA 3IUSA 4A26A 2QX7A 4IDCA 2VRCA 3AW9A 1E3JA 4MOWA 1EZ4A 1MXHA 2VCYA 4WLNA 5CG2A 3P19A 2O3JA 2P68A 4XYBA 1K6XA 2IXBA 4Q3CA 4AJ2A 5TGDA 4Q39A 4W99A 1H6CA 3H7AA 2WYVA 2PD3A 4XA8A 1OFGA 4J1QA 3TL3A 1D4FA 2FR8A 2Z95A 5JMPA 5L40A 1E3LA 2C2YA 1BG6A 1HEUA 1XCBA 2Y1FA 3M2TA 4E30A 2C54A 3DZIA 2QRLA 2HUNA 3INTA 2NTNA 4W7IA 5DF1A 5A3JA 1NQTA 5JDIC 2I9PA 3FPCA 2IYOA 2OBNA 1EUCA 3NYWA 5TQVA 1MFPA 1N9GA 4YXFA 2NU9A 5JCJD 3WQRA 4QO7A 2Y05A 2FN7A 4MVJA 3GUYA 3S2FA 3DBHA 1QV7A 4YRBA 4XDYA 2QRJA 4JJFA 4CMIA 4BO7A 2EP7A 3T4EA 1F12A 4HFRA 3RUHA 3KLMX 5DBIA 4ALIA 4LCEA 3ICCA 3KXDA 5KJCA 3DWFA 4R54A 5FEUA 1RM3A 3GY0A 1E5LA 4AJHA 5DULA 1BSVA 3PFWO 1I2BA 2XPCA 4E5MA 5IXYA 1PQPA 4MKXA 1I3LA 1R4MA 2J6IA 2NU7A 2VUSA 4PGFA 4R5MA 4O0LA 1TT7A 1UZMA 4PLHA 4A03A 4RVSA 3W6UA 2R00C 4UVGA 4I9HA 4OM8A 2J8ZA 5LC1A 4CUJA 4XJSA 2W4QA 4XYLA 2OFPA 6LDHA 2AMFA 2AA3A 1BVRA 1LJ8A 3C7CB 4J4HA 1R0SA 3JQ7A 3QVTA 3GMSA 2BHLA 3IJPA 4IS3A 5ER9A 4XR4A 1GCOA 1K5HA 1U5CA 4JJIA 4RF2A 2DFDA 4U7WA 2VWGA 1PGPA 5DZSA 1XKQA 3JQ8A 1HSOA 4MKRA 4O5OA 3CZMA 2JCXA 1BXZA 3JQGA 2O2SA 1VKOA 3DR3A 5GMOA 4XGNA 2HK7A 1BDBA 3H5NA 3TZKA 4GX2A 5IDXA 1M75A 3DDNA 2EKQA 5IG2A 1PJLA 5T8KC 4RF5A 2A4KA 3IP3A 2E49A 4YJGB 2PA3A 4BGVA 1IPEA 4BKPA 1NP3A 4AG3A 1NWCA 1P44A 3AY3A 4KUEA 5K6AA 4MVJG 3W1VA 3IKTA 5JC1A 3GMDA 2CDCA 1MG5A 2WYWA 4CLHA 3BA1A 2DKNA 3DEYX 1PZHA 5KVQA 5BSEA 4A7PA 3JYQA 5BSGA 1MB4A 3OH8A 4RVUA 4XB1A 1PWZA 1FDWA 5TSDA 3F46A 4F6LA 3ZHXA 3DBLB 3DMTA 2AEJA 2Q1SA 4WPGA 2EKPA 3QWBA 5THKA 2W2LD 3VZQA 2X0JA 3PYLA 1HDOA 1HT0A 3I9KA 4XB2A 1GU7A 3TF5A 2VHWA 4B4WA 1A9YA 1LDBA 4IQGA 3MTGA 4NBVA 3H2ZA 2Y1DA 1XHLA 4YWJA 4O1MA 4II3A 2C7GA 5DP1A 1C0PA 2I66A 2PKRA 3U3XA 3ZW8A 4BNFA 4A0SA 2Y0DA 4Z9YA 1EVJA 3VZPA 4DPMA 4GWGA 3ZWPA 4JX8A 2D8AA 1UXKA 1R15A 1ZK2A 2Z1NA 3NEPX 1Y7TA 5I7FA 4DRYA 1HDXA 4IDAA 2DPGA 1ZK4A 1GEEA 4LMPA 1DJNA 4OKIA 5LDGA 2YV3A 5ADHA 5BR7A 1VJ1A 1W73A 2Y67A 1JW9B 1FMCA 1R0KA 2Q2WA 1ZSNA 1M67A 3B1FA 3OEYA 4ND2A 1QP8A 1NHGA 3HDQA 2CMDA 1YB4A 4J49A 3AY6A 3JQAA 1VLLA 2WDZA 3KV3O 1PL6A 3E9NA 4DPKA 1HL3A 3DZBA 4ZU3A 4PLGA 3OICA 4IDGA 2PGJA 4BO5A 2RHRA 2X58A 3BAZA 1ONPA 2VQ3A 1PJ3A 3PZRA 1PIWA 3VKUA 2O3RA 3PJFA 1VSUA 3GEMA 3VZRA 4Y6SA 3S2GA 3WSVA 1FDTA 5IJZA 3ZWNA 4ID9A 5L4LA 1Q7GA 4UUOA 1BVUA 5JAQA 2BFAA 3GVIA 1IB6A 4RO0A 4ALNA 4GVLA 4Z0HO 5G4KB 1IL0A 3RUFA 3PIDA 4D42A 3ADPA 3G0OA 4M89A 4E2YA 3GGPA 2B5WA 3VH2A 3GN2A 4IM7A 1NFRA 4CMEC 2UVDA 2IXAA 4IDBA 1H93A 2B83A 3NDIA 3V2UA 2NTVA 1NYTA 2EWMA 4A73A 4I5EA 2ZJ1A 4XRRA 1QYXA 1NQ5A 5ES3A 3TNLA 3F9IA 4IPTA 2AQIA 1BWSA 1I33A 4PZDA 3E03A 3EZLA 3PHIA 5G0UA 1ZJZA 4G2NA 2BH9A 4BO0A 5U1PA 5A4DA 2BKAA 2DUUA 3QSGA 3WBBA 1WPQA 4YR9A 5C37A 3OJLA 2B0JA 5EL0A 1KEWA 3LZ6A 2P5YA 5JMWA 2YFQA 3AK4A 4TVBA 3Q3CA 4P4GA 4CLDA 1XGKA 2VYNA 4AJOA 1WWKA 4Q3EA 2BGKA 4ILKA 4XQEA 2D59A 4RV9A 3QRWA 5I8WA 4DYDA 1Z74A 4N54A 3KYDB 1AUPA 1U1IA 5L7TA 1VE9A 1U3UA 4K28A 2VZ8A 1R4NA 1GUZA 1P33A 2EV9A 4NFYA 2ZCUA 3I9OA 5F21A 3RKUA 2Y99A 2WE8A 4J0FA 3M1LA 1L7EA 2DFVA 3L6EA 1XA0A 3I9LA 1Q7BA 3UH1A 1PGJA 1GFSA 2FPPA 2YZ7A 3W4KA 4QSMA 3AOGA 1UZNA 4G81A 2QYTA 1NPYA 2IEDA 1A4IA 1UP7A 1N8KA 1YGYA 3OJEA 1HLDA 1K3TA 3PHLA 3CKYA 1PJQA 1Z7BA 4I5DA 5DDIP 1I24A 4E3ZA 2ZTLA 2IEBA 4ZGWA 5IXSA 2FP4A 5L45A 3AM5A 4YYZA 1B8PA 3MWEB 1QRRA 3BMQB 3V5NA 1E3WB 4E5KA 4XWYA 3TFOA 1E3IA 3GPDG 1I30A 3EGOA 4MVJI 3GAZA 4JIGA 1MGOA 4BNHA 4EYEA 1RKXA 4FCCA 3AOEC 3I9JA 1H94A 1T2EA 1YVEI 5DBFA 2IZ1A 1WZEA 5DOVA 2RIRA 3OBBA 2R6JA 3WYBA 3ZHZA 4DLLA 3BTOA 1XSEA 1GTMA 4E13A 2X5OA 2Y1CA 4DIBA 4YT2A 1P45A 5TNXA 4E5YA 4BIIA 3GUCA 3N7UA 5COBA 5F5LA 1ZFNA 3WTBA 1B8UA 4AJ4A 4KQWA 1NFFA 4CM9D 3DZJA 1BMDA 3E9QA 4R9SA 5IDWA 1E77A 1QG6A 5B4UA 4AFNA 2VZ0A 3LT1A 5COQA 4PG7A 3ON5A 3K2EA 2WE7A 4FS3A 4HNHA 4FBGA 4R16A 3TQHA 1Y8QA 1GADO 1IUKA 5FFFA 1LLDA 1FXSA 2X4GA 3S1LA 1BGVA 3VDRA 2PH5A 1EQ2A 4I9UA 5TJ9A 1YOVA 2D1YA 4XD2A 2OL4A 3H9UA 1ZXLA 5JDIA 4NZ9A 5C5IA 1I01A 4ONEA 3ROMA 1AXEA 2Y93A 1E3SA 1DRVA 1E7WA 5I8ZA 3SC6A 5B4VA 2NACA 3NTQA 3CTMA 5IZ4A 1E7RA 4FFOA 3DONA 3ZV3A 1ADCA 2GDZA 4EZBA 1KVSA 5JFOA 3Q6IA 4C4OA 1EDOA 1LDNA 1N1EA 2OZPA 3WIEA 1DC4A 1LRKA 1V3UA 3H9GA 5AXAA 2HRBA 3T4XA 2JD0A 3ANMA 4GLOA 3ZNNA 4Z0TA 2GN9A 1B2LA 2VTDA 5KWEA 4ZRMA 3TOZA 1EBFA 2VHZA 4Z3KA 2E82A 2XAAA 3PPIA 2X1HA 5KKCA 1PJSA 2FZEA 3ASUA 1AGNA 4EUHA 1U4OA 3IUPA 3L77A 4UULA 1UAYA 4RQUA 4BO3A 3QWIA 4W4TA 3MEQA 4TWRA 2WTBA 2ZTMA 3BMOB 3I4CA 5I9LA 3FTPA 4B7XA 1N2SA 1EFKA 4BMVA 4H7PA 3UICA 2GZ2A 3ZU2A 1X14A 3WLEA 5K6AC 3WGGA 5T6BA 2X7HA 2AW5A 3IS3A 2GCGA 4KP7A 3WMXA 2R00A 1IZ9A 4DIOA 2GN8A 3PWZA 4BNLA 4AJJA 4CM4A 1NXQA 3O8QB 4NBWA 4NBUA 3OFSA 4NH4A 4O63O 3BHMA 2GYYA 2VT3A 4WCDA 1UXGA 3DMTC 4HBGA 2O7QA 5GZ1A 1P0FA 1ISIA 2Q46A 3I52A 3DZFA 2A94A 2O7SA 3WIDA 3EY4A 3ZU5A 3TL2A 2B35A 3BMNB 3KEQA 1ZO8A 4JBIA 4X54A 3W8DA 3JQEA 3D3WB 3QW2A 2NQ8A 2YDXA 3AFNA 3RC9A 3TZCA 3UKOA 5AYVA 4C7JA 4BGIA 4DL9A 4NQZA 2VTEA 1R37A 1Y6JA 4FOOA 4GKBA 3CUKA 2CVOA 1HLPA 1KIFA 4QECA 3F4LA 3H5AA 4L4XA 5T8KA 1QYVA 2HRZA 3RBZA 1YXMA 1W6UA 3RU7A 4ZVVA 3KYCB 3DOOA 3RFTA 2Y68A 4RORA 4WCFA 3RQSA 3WGTA 5BQFA 1ENOA 2V65A 2P5UA 3K92A 1AHHA 3EHEA 3ONEA 3FF4A 2QZZA 1C1DB 2ZB7A 1M76A 4O59O 2GZ3A 4BQRA 4GPD1 2VYVD 1GPJA 5C7IO 1DIAA 2I99A 1GYPA 2EXXA 2TMDA 4J7CA 4PZCA 3A28A 5TRTA 4BNXA 4XRGA 2VHYA 3PQEA 2GASA 4AJNA 4CV2A 4EUEA 2DT5A 4FFRA 1HE2A 1ONNA 3AM4A 4CM3A 3D0OA 4WUVA 1HYEA 1YH3A 3NV9A 2EKLA 1XQ1A 2B69A 4K26A 5LDHA 1LX6A 2O3TA 3QVWA 4J2OA 4N7RA 3FTNA 1P77A 1K6IA 3N74A 1CQIA 2NVBA 4HFNA 4CQMA 3ZV4A 5IDYA 2X8LA 5I9NA 3H9QA 1J5PA 1H5QA 1WW8A 5F1OA 4WASA 4GGOA 1UDAA 3ZDFA 1T2FA 3HDHA 2GR9A 2O48X 1DDOA 4XGIA 3UGKA 2J5KA 2PKQP 3RIHA 2V6FA 4PLFA 2Y66A 4W82A 2HU2A 3ZH2A 3PJEA 4ZHSA 4E2ZA 3H3FA 4IJUA 3VPHA 9LDTA 1X1EA 2ZJ0A 4NK5A 1RYEA 5A04A 1QLJA 4DMLA 5JY6A 1TT5A 4FFPA 1ADFA 1ZCJA 1ENZA 3RJ5A 2WJPA 4I5FA 3NDJA 3PIIA 3WQQA 3MJCA 4RDHA 3MOGA 3NX4A 4KOAA 1E6UA 3ZWWA 4F3YA 4MVJP 1HYGA 3ANNA 3K31A 4DYVA 1X0XA 2OORA 5TIIA 4EUFA 1DPGA 4YA6A 4WLUA 1MA0A 5EESA 2E37A 1K0UA 4KMSA 4GI2A 1P1JA 4DC1A 3WICA 2FZWA 1ID1A 1F06A 3NJ4A 3B1JA 2DTEA 1EEHA 1E1MA 1HRDA 1NVTA 3WBFA 4RZHA 4NBRA 2JJYA 1EE2A 2NSDA 1EVIA 1NWHA 3JQ9C 4JGBA 2PV7A 4OGWA 5DBGA 3WFIA 4EBFA 1G0NA 3LF2A 3O03A 3E5MA 3U4IA 1LI4A 4F45A 4N18A 3DFZA 1KVRA 4WKGA 1LSUA 5CEJA 4CMEA 2EEZA 1ISGA 1R12A 4BNUA 1NX6A 1YBAA 3PFFA 4FC6A 4OOEA 3WG9A 3EK2A 3GGOA 5KJFA 5KTKA 5L9AA 3DZGA 4J91A 1T2CA 4CV3A 2I5PO 4E33A 2JHGA 1N9GB 2WYUA 3OIDA 1IY8A 4YJFA 5JE8A 3VH3A 4BGUA 1K89A 2HMWA 1H2HA 4IIVA 3WMWA 1LSOA 3JD3A 4C7KA 2VWQA 3A1NA 4WLEA 1E7QA 3N58A 3NKLA 4L4RA 3AUTA 3DBHB 4EITA 4CMIB 4M87A 1B16A 4OXNA 4DXHA 1IOLA 2FWMX 3GC6A 3EZYA 3HDYA 3VPXA 4PRLA 4IQ0A 2YJZA 3LYLA 8ADHA 4Y6PA 5K0ZA 1JAXA 5G0WA 3WXBA 2UUPA 3L9XA 1JKIA 4UVHA 1FDVA 1SMKA 1GCUA 2EGGA 2EGHA 2C29D 4F46A 1R4MB 3DHEA 2JD2A 2C07A 4DTIA 4LMRA 2E48A 2ZTVA 5DCUA 5JLAA 3RBXA 4ITUA 1E92A 4BKOA 1QYDA 4PVDA 2V6GA 4CV0A 4EW6A 3WQSB 2XOXA 5I9MA 1V3VA 3WFJA 3IP1A 2ZYGA 2A92A 1V35A 2D5CA 2VRBA 4R68A 3NT2A 3LC2O 1BXGA 1KS9A 2X0NA 2C7VA 1ZSYA 4HX5A 3JQ7B 1EQUA 3L6DA 2B4RO 2I6TA 5K9ZA 3PVZA 3K5PA 1LLQA 4CMJA 4K6CA 2O4UX 2NTJA 2P9CA 4CM8A 3DHYA 5T67A 4DIFA 3JQ8B 4IXTA 1LQUA 4J43A 3G1UA 4BO6A 3JQGB 3WGQA 4CQLA 3S2IA 2NADA 3QHAA 1A9ZA 3E5RA 1VI2A 3MOIA 4UVDA 5EJ2A 4CM1A 3C7DB 4DBVO 2JAPA 2QG4A 3R6DA 4IGFA 4OJNA 5BSFA 3RVDA 4R5HA 1DJQA 4GQAA 4DLBA 1U3TA 5L95A 3MJTA 4J1NA 4J4BA 1H6AA 4AJKA 3PQDA 2D4AA 3AOEA 1A7KA 5CG1A 2PGLA 2FY8A 4K9DA 3HWRA 1KY4A 1JU9A 5KVVA 3ZWCA 4YVFA 3PYXA 4E31A 1U3VA 1WZIA 3VHRA 1CIVA 1A4UA 1DLJA 3GR6A 3CEAA 4M55A 1DEHA 1SOVA 4GAEA 4FFNA 2DBQA 1NNUA 3LT4A 4B3IA 4H3VA 4TMFA 5B1YA 2I67A 4AL4A 1YDWA 4BNGA 1P1KA 4MJLA 4TVOA 1HXHA 2DU8A 4RPKA 3F1LA 3IQDB 4NJOA 4EEXA 1QMGA 5G0TA 2YW9A 2NNLD 4Q3BA 4DQUA 3GG2A 3JQ6A 3U09A 3QE3A 5JW6A 1HWYA 3GLQA 3OJ0A 3HE3A 1YBVA 1Y8RA 3PP8A 3K8ZA 3RC1A 1DAPA 2NVUA 5HS6A 3VKVA 5KIAA 1SZJG 3EMKA 4OIMA 3F4BA 3JQDA 3DBRA 5C7OO 5B12A 4YT5A 4B4VA 1YQDA 3RC7A 2F1KA 3ITKA 4CM6A 5JYDA 3ZWXA 2VUTA 4BO9A 4CLOA 3R3JA 1Z73A 4NDNE 4ZQGA 4ESOA 3GRKA 1LEHA 5CDTA 2QRKA 1NASA 3LT0A 3HNPA 4Y67A 2B5VA 1XU7A 3L07A 2CF6A 1PL8A 3BZUA 1Q0HA 4TZKA 1F8FA 4WK6A 4PLYA 3JQAB 4MVJF 3QP9A 4FC7A 2HO5A 1X7GA 3GOHA 1CDOA 3WJ7A 3QWFA 3WYCA 1N7GA 3JTMA 3TZHA 1OAAA 4LGVA 4L76A 4J90A 1MUUA 3DMYA 4WCFC 1Q7CA 3ENKA 3DOJA 1VL0A 1M2WA 4FGSA 1ZMOA 3WDSA 1ZUD1 4BS9A 4S3MA 3B6ZA 3GQVA 1DC5A 4L75A 1E1LA 4NJMA 3VZSA 4XIJA 5AXDA 3E82A 1V6AA 5EMHA 2R2GA 4PIVA 4A2CA 4HP8A 3D5QA 2NM0A 4JJGA 4R3NA 5DNAA 3AI3A 2P4QA 4PRKA 5A9SA 3RC2A 1A7AA 2IODA 4WLVA 5HWSA 4BB6A 3GT0A 4RZIA 1PEDA 3BMCA 4L8VA 2F00A 3Q1LA 3ZWVA 4AJEA 4BQPA 3KOUA 3W4IA 4TRNA 3MJSA 2X9NA 1CRWG 1XEAA 5MDHA 1P0CA 1PZEA 1YQGA 5KVSA 4URFA 1YB1A 2WD8A 2WWRA 3DB2A 1Y5MA 3OECA 2VRCD 4PVCA 2I3GA 1RWBA 4DC0A 4GLLA 3GRPA 1Z6ZA 3RAJA 3RROA 3B70A 2PZLA 2Z5LA 1PWXA 4Y8VA 1BW9A 2ZYAA 2H6EA 4GX5A 4Z9FA 5KCZA 1M6WA 5JC8A 1H0KA 3U4DA 3UUWA 4PFJA 3SLGA 2GNAA 3KSZO 1FDSA 3BTUA 1X15A 4YBZA 1ZJYA 2B4QA 2AQKA 3Q2IA 4G65A 1HDCA 2EIHA 2J5RA 4OXKA 4OH1A 1O6ZA 3ZN2A 1YB5A 2BI8A 2PZMA 3ST7A 1IE3A 1VL8A 5CHEA 4B3JA 2G82A 3KSUA 4DMMA 2VOEA 4Q3NA 1F8GA 4E4YA 3TJRA 4FR5A 4WGGA 1R4NB 3DAGA 4NBTA 3K96A 2JHFA 1V9LA 4XZ3A 3Q9UA 3ZGYA 5ILOA 5DT9A 1C14A 4D3DA 4CR6A 5IAAA 4MVJD 3AU8A 3PTZA 2Q1TA 5THQA 2C2XA 4D41A 2JFFA 1T2DA 1X7DA 2W2KA 1UZLA 1T4DA 1U28A 1PJCA 1F0YA 2HCTA 3H6KA 4HY3A 4EJ0A 4ZN6A 4GL4A 4U0KA 4FIZA 5ITWA 4W9NC 2YDYA 2PK3A 4ALLA 1I5RA 3RUDA 3C8MA 2AE2A 1I2CA 2FSSA 3U4HA 3FRJA 5EQDA 1XWFA 2OGUA 2DVMA 5HA5A 3UW3A 1L1FA 3IDSA 2B4TO 4J2HA 2VNAA 4CMBA 3F6YA 1T1RA 2NV6A 3JYNA 4OYRA 3KO8A 1LLUA 1NPTO 1RM5A 1IULA 1NQOA 5ICSA 2Q1UA 3KUXA 1NR7A 1LA2A 1XR3A 4Q9NA 1GZ6A 1EVYA 4QEDA 3PWKA 1CERA 4HFJA 4AJLA 2DQ4A 4PLVA 5CDSA 5CDGA 2H63A 4BKQA 1VSVA 2BD0A 3DC2A 3WB9A 5BNTA 3LF1A 2WM3A 4JN6B 3CE6A 3L6OO 3BTVA 2OP1A 3GDFA 1B7GO 1KETA 1TB4A 1WMAA 2Y0EA 3D1LA 4WJZA 1OI7A 5T57A 2DUWA 3PYMA 4L9RA 2ILTA 4DREA 4PLTA 3JQ9A 5DOZA 4UREA 1N92A 2PFGA 1Y8QB 2HAEA 1J4AA 1G6KA 1V0JA 1ENPA 2PR2A 1TVEA 4PLPA 4D45A 1YOVB 1JAYA 1Z75A 5AVOA 3KBOA 1EBUA 4JP3A 4M1QA 2IYPA 4K6FA 1LU9A 4CPDA 3CIFA 4CL8A 5JDCA 1MV8A 1DB3A 5TT0A 4FPXA 2OO5A 4GX0A 2C20A 2WEKA 2FHSA 4R9RA 1DAOA 1PQUA 2BFOA 3NRCA 1KC1A 1EVZA 2VOJA 3JD0A 3VH4A 4Y98A 2P9GA 1LC0A 4NG5A 2Q1WA 5TS3A 1NR1A 3QA9A 1HTBA 4Z3DA 3S55A 1BXKA 5FYDA 5JSFA 1GQ2A 3MTJA 4CUZA 1KBZA 1Z82A 1PU2A 2UAGA 3DO5A 1B8VA 2G76A 3HG7A 1I10A 1ZK0A 1NFQA 3GVXA 1RYDA 5A02A 3GVPA 4R1SA 1ISHA 3KHUA 2FPIA 3NDRA 4N5MA 3U62A 1K2WA 4IBOA 4BVAA 2PLAA 4RPGA 4NR0A 2GZ1A
chains in the Genus database with same CATH superfamily
4HEA1 1RQXA 1ULSA 3N6RA 4V02A 1HT2E 3IEVA 3LT2A 3O8CA 3LUAA 1MLDA 5D1NA 5D3KA 1GUFA 3BQ9A 4GH5A 2HA7A 4G0QA 3PNBA 4MAAA 4Q3KA 3G2IA 5BPHA 1M0WA 1S3IA 2HQOA 3NO4A 1U3FA 2I4TA 4Q1CA 4EOGA 5DM60 4YQFA 4CGZA 3ICPA 3KYBA 4KQ2A 2VHCA 3O0TA 4Y6QA 4DV3B 3RAEC 4BL5A 2O5RA 3M5CA 4C07A 3IIEA 5IN4A 5KNCH 2QZSA 3ZX4A 1FSFA 4KVZA 3OTHA 1PD0A 4LRUA 4WNAB 2WNHA 3HFGA 2QP9X 1XLWA 3COJA 1H22A 1IN6A 3P0IA 4PAQA 4XFJA 2XCIA 4BQOA 5DTRA 3RSSA 2DC1A 4E15A 2ZWAA 3KHSA 3U3KA 3KM0A 1EUZA 3ROQA 4TLBA 3AC0A 1XRMA 2O6LA 4OQEA 4XKJA 1P62B 1AB5A 1X7XA 4J1JA 4DEYA 5F51A 4LSMA 5IT5A 5DEOA 3DMGA 3GG9A 4RYLA 2D2IA 1F7UA 3MQFA 1L4FA 1A0OA 4FXOA 1A8PA 2BGIA 1VG9B 3ZCVA 1N7JA 3EA4A 1VMAA 3K09C 3IODA 3RTDA 2GSDA 1YC2A 3N7AA 3MS7A 4IZHA 5EE9A 1Q6YA 3BT7A 2G5GX 3ESZA 3OOEA 4BCCA 4NC9A 1KEPA 3DEIA 4A4DA 1PV4A 1WAMA 3E3AA 1XZAA 1QHNA 1F8YA 1SK8A 1Y7PA 1EXNA 2GHRA 4H6VA 5FFNA 3AP2A 4KXVA 2EG9A 3JU3A 3D02A 3HXPA 4MMYB 3LLVA 4DS3A 3ZVRA 2W00A 1OWPA 2Z58A 3OWOA 2YOHA 3E8SA 5CXSA 3WXMA 2VWHA 4YAIA 4V0MA 1X7HA 2VG8A 4G36A 2OENG 2J1LA 1JE1A 1DP4A 1R0LA 2UYYA 2YC2C 4F4IA 4L74A 4R0MA 1TIPA 5HFNA 4ASUD 2B92A 1CUAA 2PG3A 3DR5A 3LD9A 2PFKA 2ODWA 5C1IA 2JZNA 3RT1A 4D9KA 1GU1A 3H5LA 4F3RA 4UEKA 1GCIA 4ALMA 3DAFA 4CQMB 4GRIA 3MUEA 4KO2S 3QVOA 4W5OA 3MERA 3CVUA 2BEWA 3GFGA 3LUFA 1WXDA 3PXDA 4FGLA 1E2LA 5CHYA 4GYKA 3UJ3X 2PVCA 3TTYA 3U80A 3RS3A 1OROA 2ATXA 2R65A 4PSVA 3MWKA 4UM7A 4AT1A 2CXNA 3ZHTA 1E1YA 4MVXA 4D9NA 3DZDA 3IYLW 2QJTA 5JAZA 1IN5A 1BHJA 4X5OA 4MUHA 5LLTA 4CNBA 1KDRA 1L5MA 1PZXA 2C0CA 3A6HA 2VP4A 4CODB 2R7MA 4WEQA 2QR5A 5DHFA 3QBJA 4LK2A 4LRYA 4C4RA 5HZKA 3CCFA 1XTTA 2LIPA 2G9RA 3T3EA 1EH5A 4BX3A 3ZV5A 3HCPA 2ES4A 4G86A 4M88A 2DHCA 3CSDA 2ID4A 2WF6A 3EIEA 3MF4A 4FGWA 1AG9A 4TS4A 4ALJA 5KYUB 1NNI1 2NX2A 2AJLI 1B43A 1KI6B 2IKQA 3UM9A 3RVPA 4DG8A 5JYCA 3LP8A 1OPXA 4G1CA 4QWMA 3I6QA 4RLHA 3NDPA 1FMFA 3TLZA 3QFFA 3RT9A 1F1BA 5E95A 1JFFB 3PDWA 3EUEA 5FJJA 1EKXA 3RCBA 5BYAA 6NULA 4YNBA 3JATB 3DT8A 5DNYB 1C9EA 2DWQA 3ROPA 3KCQA 2ZK7A 1J39A 1LLFA 3NFRA 3QVUA 3A06A 5D87A 5FTJA 3U7QB 5G1NA 2PXAA 3GLGB 1BCSA 2R97A 1E2FA 1IWPB 2XKJE 1E2UA 4GZ6A 2CUTA 3UXYA 4BFVA 1NN0A 1QAOA 1Z2CA 2IOYA 2QF7A 2X3FA 3C74A 1EWYA 4BGDA 1AMNA 2B8JA 1RRPA 5F9FA 1ZIDA 2FQXA 4UEJA 4AB1A 3Q3EA 3KOYA 4LY6A 5ALUA 3FZQA 1C1XA 1S6YA 5L4NA 2NQTA 5IKMA 1FP1D 3MS2A 5DGCA 1Q0UA 2ONYA 2AOTB 4MVYA 4CIVA 3PWSA 5D8DA 2HHCA 1U6JA 1GCGA 4JR2A 3ROKA 1LSJA 1VHWA 3IKVA 2XYHA 3QWAA 1IIBA 2I80A 2RONA 2Y0CA 3GJ0A 2FE1A 2ZWOA 4HDNB 2QBYB 3BYZA 4RLQA 4D99A 5AFSA 4YIKA 5DHPA 3V7YA 5JWRA 2C96A 1TAHA 1YR7A 2W90A 4AJPA 1PGNA 2F9MA 3IAS1 2H7CA 3K6KA 1OGYA 5BSUA 1SPXA 2CNWA 1UUFA 2P3OA 3IPRA 3JZMA 5ELMA 4NBKA 3EWSA 4IV8A 5IANA 2O1WA 3ITDA 1SVOA 1WHSB 1OIWA 2HMVA 3GJYA 4I4IA 2H1SA 4E2FA 4P80A 2HIAA 4OKNA 1SUWA 1WMSA 2XKAA 1HDGO 5DK6A 4BLWA 4IDFA 2NVWA 3EGEA 3M49A 4FWTA 2RIPA 3KZKA 1DX4A 4ARIA 1D9XA 1VDZA 5HPYB 1P72A 1PJRA 1GD1O 1ZMTA 2ZCVA 2WJGA 3LGAA 3QKWA 2HWUA 3GJTA 3QA3E 1CS0B 1FFXA 4U7TB 1ADBA 3EZ2A 1VM6A 5IAJA 1U5AA 2QD4A 1RRGA 3OIVA 2DQYA 2B82A 3GP5A 4I1YA 3RRYA 4MHSA 1WBDA 2ECFA 2V54A 2XNCA 5JCJA 1ZBQA 1DRKA 1O87A 3OQIB 4OHZA 1C7ZA 3IAM6 1D6SA 3BBPA 3C15C 3F7MA 3GGCA 3MAGA 1MIOA 3QM1A 4P2BA 3T4PA 2G8LA 3FN4A 3M3PA 4IP0A 4YJDA 3X2FA 1WXHA 2PX3A 2NO7A 4S05A 3NLLA 4ILEA 3UWOA 1GKIA 1P61B 1OC4A 2ZU0C 4ARSA 3HA3A 1KPHA 4TLEA 5E8RA 3DLCA 4G4SP 4AMVA 4KMRA 1INLA 1L4UA 2PWYA 4GXTA 2HJHA 3T7EA 1ZSVA 1FTGA 3V46A 2G28A 4OQDA 2XQVA 4D9IA 1Q19A 1E79D 5IYZB 4NIMA 1ODFA 1EXVA 1O6BA 1CQWA 2WHRA 3D8NA 4KE8A 1OXXK 1E61A 1DU4A 1SFRA 3RRBA 3WYFA 4CCAA 3RBVA 4IHJB 2JCYA 2FX5A 4JDUA 2WTNA 3D7RA 3FG9A 1USVA 5SZJA 3AKDA 3TZBA 1ADJA 1Y98A 3DZKA 1NZJA 3LZDA 3JQCA 4HQNA 2CYAA 2H2AA 2B3DA 3HY6A 1ZQ1A 5F4ZA 4URXR 3L8FA 3FWHA 3MXOA 1QCZA 4KQXA 4TUYF 5T7BA 2O0KA 2CN1A 3HZOA 2J5XA 4YK7A 1AO3A 2QAGA 2WD7A 2F3RA 4K9NA 5C3MA 3L7LA 2JIZD 2A6PA 3BK2A 1XZJA 3HS3A 1CNFA 4L0QA 2ZUWA 2AR7A 1DC6A 1M73E 5KSZA 3V6LA 2FCAA 4QBGB 3CIOA 2W83A 4CEHA 4XIFA 1EMDA 5HIJA 2FEWB 3E0XA 3PDUA 3QVXA 2J4FA 4DDVA 4ND8A 4NV1A 5K0BA 1MOSA 1GUYA 4G5SA 2NUAA 2WWTA 2EATA 2HDHA 1IWBB 1X0VA 2ZB8A 4TYWA 1LC3A 3N8NA 4DY6A 1JVNA 5D6NA 3WLIA 2HLDD 3X1YA 4BUCA 4CLXA 4WECA 5LBUA 2JI4A 5TLSA 1JQAA 4C3ZA 3OZGA 2YXDA 3K7EA 2C4KA 2FA9A 2VT2A 4E5PA 1TKBA 3GFSA 4MP8A 2FWNA 3DE6X 3VC3A 1M6YA 2GRUA 2J3JA 5LQMA 1G5IA 1QIKA 2X8BA 4EF4A 5ADUS 2IPOA 2VHJA 2ZVQX 3GNSA 4UBOA 4Q7QA 2Q6LA 5HKLA 3ZW9A 2CMGA 5BN3A 1K88A 1YB2A 2A9RA 2BSAA 2B1JA 2G1AA 3KAPA 2NSHA 5E8JA 3MAJA 2KLHA 1M1NB 3OA2A 1KJWA 3SYNA 5EJ9A 1YBMA 2ZQZA 4RD4A 1Y8RB 2LV8A 2X9LA 3RU2A 2PWPA 4Y2RA 3VR5A 4C2TA 3GEGA 4Y1EA 3CX3A 4S1NA 4YROA 4P31A 1PKEA 4I5IA 5NULA 2WA1A 3DLHA 1G20E 1FOEB 1P6XA 2KB0A 3B13B 4XJVA 4BMXA 4YCLA 1UANA 4BZXA 3H2JA 1RM0A 2C5EA 1NBEA 4R1QA 1DT3A 1RC1A 2PZAA 1M7HA 5BRJA 3HKDB 5JD4A 1CZKA 1XTUA 3A4NA 1YVPA 1RJ9B 1PQWA 2CUNA 1G5HA 2O2GA 1UODA 1YF3A 4B46A 2X13A 2OFXA 1XPJA 3E2IA 2A14A 4P4NA 1ZH6A 5DE3A 2VXBA 1L4MA 3CNQS 4JBLA 3WDKA 4F5ZA 2CZGA 5JROA 1DJMA 2UYQA 4BFLA 4FYPA 4EL5A 1RYYA 3TSAA 2V3CC 4G4JA 5AKLA 5IFKA 1OAOC 3GT3A 2DFPA 1N6HA 1T9CA 2ZJAA 4IMIB 2VSQA 4N5NA 3R7SA 1VIMA 3DNPA 4UUPA 3UANA 2ZAYA 1Z18A 3NRBA 1WOMA 2ZRFA 1P0MA 3UAWA 3U4AA 1XQ6A 1PSDA 3AY0A 2RGWA 4GVXA 3WQHA 3BGIA 4JUCA 3DGEC 1RQNA 1PGQA 1V4VA 4HH0A 3VZBA 2C9YA 4AWBA 3QEAZ 2C9MA 1QRSA 4V0SA 5TVGA 1GZ7A 4Q1FA 2BDEA 3UJAA 4NU6A 4P3OA 2VJAA 2PNJA 4BNNA 1I2AA 3A6JA 1ZEMA 2AG8A 1XI2A 2QVXX 3AFOA 5ALNA 4EWLA 3PDJA 5ERYA 5SICE 1RHJA 3CSUA 1RJDA 2AR9A 2HB6A 2HCBA 3MNFA 3VR6A 4PSDA 5JLJA 1TXGA 1QWSA 3MGKA 5C8XA 4RTPA 2XQJA 2YFYA 4LRTB 2YOGA 4EW1A 5JZ9A 2OD2A 3HNRA 4AMGA 4O2AA 4AZ0A 4JUAA 4DDTA 5B2FA 1UMCA 2J5QA 4Y6LA 1SH7A 3TLEA 1Y7HA 2DHRA 4WDRA 1JHUA 4N4AA 3WGNA 3U7HB 1SHKA 1T43A 2B2XA 3K0HA 3FMOB 4ND4A 4PCVA 3HRKA 4HEQA 4C0QC 1S3GA 4ZD6A 2VRWA 2JJ8A 1LNQA 3E9MA 3Q2KA 3OLWA 2VT7A 2J4CA 5J4LA 1I32A 5H81A 1U0LA 3M6AA 1TYZA 1N1GA 3E18A 3IEPA 1HOXA 5KTTA 4RPJA 3EVTA 2IPNA 3I6MA 3T99A 4GRDA 4PV7A 2I6FA 2ZR9A 3DQPA 1TEXA 3K09A 3BPSA 3GAMA 3IE1A 1VPWA 3IDAA 1DGQA 5FWDA 3ED5A 2GEBA 4ZQEA 1NUQA 3ZE8A 4LN1A 4CDRA 1ICIA 4JROA 3QE0A 2WPDD 4MB2A 3GBPA 2TYSB 2GD1O 2XHZA 2YUTA 3OTWA 4QUIA 3WSTA 1JPNA 5GONB 5CH5A 2ZSBA 4PX3A 3W2IA 4BPRA 1C9NA 1LCIA 3MJDA 3QMPA 1SUSA 5A5VA 3AUAA 1J8DA 1XN4A 2JGDA 1B1CA 3EEIA 4G3XA 5DSTA 5KJ1A 3EDOA 1CFZA 4O2BA 3H4MA 1U2DC 1TECE 1NDQA 3GEDA 4H17A 3LVFO 4YJ3B 5AJHA 4WLFA 1OX5A 4JXJA 2BFDB 5CPFA 5AJXA 1JTVA 4I5GA 4NCKA 4PR3A 1JAZA 3S81A 1SY7A 2CLEB 5KJ6A 4UHBA 3U48A 1QF6A 1TLTA 1Y9AA 2DQZA 3SLRA 4DHEA 4F04A 1THZA 4BEJA 2HM7A 3DFKA 3OWXA 4EEKA 2V4MA 3T3HA 2I7VA 1JH8A 5HGJA 1J56A 2WW8A 821PA 4Z4IA 2GBLA 4KTTE 2JAHA 3AP3A 3QV1A 5KOJB 4LQCA 1PQYA 1N34B 1QLWA 3GLUA 2H9IA 5FI3A 2A5YB 2C8KA 2OWDA 2EZ8A 3C3PA 3HCEA 3O4RA 5ADVA 4PPYA 1M66A 2HTFA 2ZATA 4R1LA 1J6UA 1R9MA 3EMBA 1RAHA 4HADA 5EZQA 5BNIA 1V8ZA 1SC9A 4PR0A 5F12A 2C78A 3UK1A 1G8HA 1GDDA 3T7DA 1OX4A 2BGMA 3BD6A 4REOA 4CG3A 1WZ2A 5IAEA 1J8FA 4PANA 5AR1A 3I9MA 1RMYA 3OZUA 3FFWA 2J48A 2FEAA 3CB2A 4NYIQ 1KAGA 2AJTA 3F5QA 1TCBA 3QV2A 4I08A 4MVJM 4ZVQA 4YAUA 2EBHX 2GXAA 3I2JA 4ZGBA 1N78A 4RF4A 5K6TA 1J42A 1ZINA 1Z45A 2NP6A 3E6AA 3GCDA 4FHZA 5LZ9A 5G0SA 2Q0SA 1W1UA 3DBVO 1LDMA 3LDHA 3RWOA 2BM9A 1NUTA 1OZHA 1QANA 1UC5B 1ZESA 2TSYB 3OZAA 4W6ZA 5F35A 1E4VA 1IXSB 2MR5A 5AW8A 2Z6QA 1GITA 2J0SA 4ZRNA 4X45A 1O2DA 1G20A 5DN9A 2B99A 2E4AA 1OLUB 3KXKA 4FJ2A 2DFNA 4IQ8A 4WOBA 4S1WA 3WWCA 2JAUA 2WM9B 1JAHA 3I9V1 2PSJA 5EUBA 5GZ3A 5CCXA 1KQPA 1KZ1A 2X9GA 3DOIA 5GPBA 2GM4A 3ETCA 5H4HA 3L4BC 4DLYA 2ZRQA 4WOCA 5T6MA 1O8CA 2VNKA 3D64A 1XMJA 3IV9A 2HWXA 2QMZA 3ADOA 3I2HA 5FTWA 4A1OA 4F1JA 1CKEA 5TE9A 4B82A 4ZZ3A 2A4MA 4DNPA 3FWYA 1J2EA 5AVQA 2P6UA 1KRXA 4JR1A 2BELA 1Z6TA 2DAPA 4UU0A 1PL7A 5BMVA 2Z2JA 3WGYA 4QQKA 4F8JA 2ORED 5J3JA 3EVEA 1PS0A 3G02A 1E20A 2PCLA 3UPUA 4IFBA 5F1PA 1PWEA 3QVGB 4XSVA 5EERA 5A3VA 3IXMA 3RUPA 4JC8A 4LS3A 3CY6A 2WINI 4JL6A 2I4RA 5M04A 1PVDA 2Q29A 4UXIA 3KQLA 2ZJ7A 3D2CA 2AX3A 1E9FA 2GPAA 2DE0X 3D7LA 2OMEA 1C0IA 2GAAA 3ETHA 4ZK2A 3F78A 4JL5A 3ABZA 3KETA 2EJVA 4B3HA 4G0UA 2RC5A 2FR0A 3ETDA 1A04A 5CVDA 3FDIA 3H99A 5JH7A 1DT5A 4UQPA 4LYAA 2CZCA 3LUKA 3ZNOA 3AFIA 5EKTA 2JKZA 4MITA 2ARKA 4S35A 2J3HA 5D84A 3KB6A 3V55A 1THGA 5LP1A 1YCGA 1Y4SA 4LV6A 5A5DA 2IZZA 5CYPA 4LISA 1SXJD 1T1SA 2I2FA 2XD9A 1E9CA 3CZ5A 4Y2JA 1KKLA 1JU3A 4JUIA 4D43A 3SXUB 3QXCA 4HTAA 1DAIA 1VLVA 3HH8A 3HDGA 1MKYA 3FZNA 4QYWA 4OG2A 1K6EA 2AMJA 1U9JA 2BMAA 2FX3A 3M6IA 4YRQA 3AHGA 4QOJA 4RVNA 1XQ9A 2I54A 3HJNA 2FPLA 4LEIA 4M86A 3J7AC 2WSYB 3T94A 1XJWA 2WYOA 4TQGA 3VVMA 4R4JA 4M8IA 1R6UA 4C87A 3P0EA 4Z0PA 1P7CA 5JXJA 5LQSA 5EHGA 1IJBA 1NM5C 2G5CA 2QYSA 4Z9XA 8AT1A 3EPHA 2Y2UA 5I5EA 1M72A 1DIGA 1DQYA 2H48A 2GERA 2I6QA 3M6MD 4HSEA 5CLLA 5LD2C 1TTTA 1LS6A 2YQ5A 3M33A 4OK5A 3DVQX 3PA6A 2BKVA 4EJ6A 5IVPA 3PLAE 2QLLA 4KO8A 5AKKA 2WM8A 3OE1A 1QV6A 1ZD8A 2EW2A 1JHRA 2PL9A 3I9NA 2VP0A 4KGDA 3IHLA 3UYLA 2C7OA 1UFRA 2YXEA 2FZVA 2ZWPA 5JHGB 2ET6A 3MJRA 2CFOA 5HOEA 2BHTA 4PQGA 2QY6A 2WHPB 3N07A 4BFCA 2RE8A 1M3SA 3NAQA 5FWAA 2JAWA 2QW1A 2A5GA 2J07A 2WU8A 3EXG1 5C1BA 1DFHA 1KI1A 2PX8A 3GLTA 3KLPX 5EXSA 5EHXA 5H4GA 3H11B 3KTDA 1GPNA 3CXUA 4PPQA 4BEWA 4YT8A 5BSWA 2ICAA 2VL7A 2HA0A 3LWZA 3QBTA 4Z9AA 1PR0A 1GFZA 4LJSA 3V9AA 5CVTA 3P52A 1T9GR 1ABEA 1UPUA 4YAKA 1U3CA 3T3IA 3T5PA 2SCUA 5GOZA 3Q7IA 4EA9A 5BUZA 3VAYA 2AFVA 1XELA 4O8ZA 2P75A 5FCDA 4MVCA 4P0TA 4YN3A 3TBKA 4TWIA 5BSVA 4TXNA 1TW2A 1V7QA 1YR2A 2A88A 4D1YA 2P9EA 1YB6A 4L15A 4TRMA 4DZRA 1WUKS 1R66A 3FLAA 4QRIA 1O89A 4EAQA 4CU2A 1OTYA 4ESHA 1U7TA 4KWIA 3S6JA 2Q9BA 4OP1A 3CLUD 2ZS8A 1N3BA 4FT2A 3AQ4A 4RQTA 5BORA 5IJ0B 4IRXA 4PG6A 3OQBA 4RM2A 3BF7A 4A0GA 2OXEA 5G4KA 1JEOA 4DJAA 2Z98A 1QO9A 2QT9A 3HJFA 4H15A 3L92A 4YCNA 1K6JA 4POOA 3FHOA 4INZA 2X2EA 4OHRA 4ZVUA 3R0VA 3ORHA 2FDCA 3AZQA 4NWIA 1DSSG 2XH8A 4KCGA 1FFYA 1YFZA 1ISMA 1KZHA 4BN0A 1XLVA 3OM0A 4EQ6A 1EFVB 3SHVA 1L5HA 4FW8A 1HFEL 2RC6A 4IJKA 1KAEA 1DLIA 3M2PA 1D09A 4DA7A 2RAFA 3JVIA 3H4IA 1R5NA 3O3CA 2PRIA 4YMWA 2UVPB 4QO8A 5DHRA 4N6OA 1LX7A 3MPOA 1SQ0A 2PR7A 3AONB 4MYSA 1O0BA 4C20A 4G09A 1EB8A 4XQ9A 1L7QA 2GA8A 1SQSA 3O4IA 1KEVA 3CMMA 3B6EA 3BS4A 3KU1A 2YN4A 1IYZA 3CH4B 3L8YA 4R05A 1GRQA 5CR9A 4ZKEA 5C9ZA 4DSOA 1X6VA 4AF8A 4JLDA 2L69A 4WADA 2YHUA 3S8EA 1E2NA 2IA5A 4LDPA 4JLJA 2AKEA 4OREX 3MUFA 1YFKA 3VTKA 4D9JA 3EVAA 3VYWA 4CFYA 2E4ZA 5SZHB 4AS1A 2ORIA 1E1CB 1C4XA 4H35A 4PICA 1J24A 1Y6QA 1YAJA 2Q3BA 2ISCA 2MR6A 1UQRA 3ICVA 1U2RA 4N8EA 4K9MA 1GRRA 3MB5A 3MLBA 4UC0A 4ZQFA 3R7AA 2AX4A 1W48A 1JHZA 1Y6ZA 1V1RB 2CW5A 2HRCA 2R6R1 4KSBA 1TJ4A 4KI0A 3QQPA 4WCVA 4ZYWA 5FULA 3B5JA 3M4ZA 3DHNA 3WR5A 3MRSA 2ZUCA 1P2VA 3UK2A 4OXYA 1Y1QA 1G2IA 3UT5B 3VOTA 5DCYA 221PA 5FPSA 1E7SA 2QQEA 3H9BA 4LE0A 4W5JA 1YS4A 2A59A 3N6VA 3L93A 3TVYA 5ELLA 4A2PA 4NCAA 1E5TA 1KDTA 3BSFA 2VRNA 3F90A 3NGXA 5K3SA 2H4HA 3ZEIA 1NIJA 1M2VA 3K6RA 1Z47A 1XKLA 3A3PA 3B1KA 3CF4G 1ZD1A 4MR8A 4BJHB 1RT9A 3E35A 3UGJA 4C6RA 3GZNB 4QELA 1NVDA 4QYTA 2HF2A 1UPXA 4P38A 1JB1A 1ZK3A 2G8NA 2B36A 1DOHA 3Q8KA 2QN6A 3LAWA 4HUJA 1OU4A 2W6JA 1JDJA 5EZYB 2G88A 1A72A 4HB3A 2PX5A 4OLHA 4EMSA 3TZLA 3UZUA 4YXWD 1AS0A 5DYGA 3E7DA 1SUPA 2DSNA 5IN5A 4GLBA 1D1PA 1RPJA 2AKYA 3JSAA 3OMLA 4O4IA 1NTRA 1D2NA 1DAGA 1MCZA 2Y2VA 3BMQA 4PBSA 2GEFA 3AL3A 1MC5A 1E3WA 4A1FA 1GGMA 3UJBA 1P9OA 3DE5X 4MDHA 3G7NA 3LLSA 4HMPA 4TWRA 5B1DA 4ZOEA 1LUAA 3KTAA 4NXMB 1M1YE 4I4TB 1B23P 1MQ8B 4WLOA 1T2AA 1TFUA 4Q3DA 3RTAA 3CUEF 3CUYA 4LF7B 3ZCSA 3HBFA 2YYYA 5G1OA 4PLZA 4J7XA 2O0MA 3THSA 1PV1A 3E7WA 1Q0LA 3KKQA 1RRCA 4JL8A 4LQLA 5EVJA 4EGAA 2C4WA 1VKNA 2BT4A 2O50A 1NATA 2WJWA 3IAUA 3OZTA 2HIMA 4WE3A 4C5CA 3WGOA 3EDYA 3L7MA 1ACMA 1I36A 2MWMA 3M6FA 4GD3Q 4TTQA 4CG1A 2QG9A 2ZRGA 1TKAA 3NVDA 5ICCA 1NOIA 2BMFA 4V0RA 3NWJA 4AG5A 1RWPA 3WWDA 4EJSC 3L7KA 2RCYA 2C77A 2I65A 1HG1A 4V03A 5AKYA 5J4VA 5JAHA 1JSLA 4BVFA 2IUEA 2H8KA 4JEMA 4RL6A 2DWPA 4IGAA 2X5NA 4YI5A 4OQFA 3DE2X 1A9XA 3I92A 1K7CA 4GPAA 3ZHUA 4ZEVA 2D2XA 4JVSB 4PXYA 4KXYA 3PXXA 2ZBQA 3ND9A 3MTQA 2ZIFA 3SJCA 2Q45A 3TQOA 3OIGA 4R6XA 5DN6A 5FO1A 5KDLA 5KYYB 1ODKA 3B85A 3NV7A 4GOLD 4R1OA 3TE6A 4C21A 3EMDA 1XD8A 5JAIA 3GFTA 3I5UA 2ZWVA 1C3OB 4JHLA 1QP7A 5B37A 1EDEA 3R3HA 3U0BA 3GCZA 4L07A 3K6SB 3R7WA 1H9BA 4DCUA 2PYDA 2UUBB 5I01A 4BJ5A 1PQ4A 1RRVA 2OV3A 3L1JA 3PUIA 5B4TA 2FXVA 4LSZA 5JD6A 1D4AA 4NH0A 2JC3A 2JW5A 5E7MA 2EP5A 4HLQB 3WGHA 4Y6RA 2O2IA 2QTMA 3P2YA 5FUXA 3JYLA 4IIJA 2OK8A 5HEKA 1JHYA 1D2RA 1JNYA 2XRYA 3AR6A 3L04A 4KKVA 1JDSA 1SKYB 3OAAD 5JZSA 2XY4A 2VI5A 4KUHA 1JN0A 2EJBA 3MINB 4HZUA 3NUGA 2EX4A 4I2NA 4O1HA 1QNFA 2RFLA 1IK4A 1KI7A 3Q10A 4KTVE 2F1RA 2GPTA 4F4CA 1NXXA 1SEVA 2QN1A 3HJUA 5DIFA 4BZPA 2EZTA 4C30A 3B9PA 4IDOA 3F6BX 4FQ8A 4GSKA 5A0TA 1JR6A 4JYAB 4K1XA 4ZO9A 5KX5A 3HKCA 4L4UA 4IIXA 3HK2A 4DNQA 3SFVA 4AY3A 3AT1A 3UVEA 1L3CA 1QH8B 4YRFA 2AH5A 2R11A 2EJWA 2NMVA 4ZI7A 3EC7A 3KKNA 1RDFA 4EB6A 1G60A 4MVJE 3MS4A 4G0YA 4O08A 1DUIA 4P0PB 1DKLA 1VPDA 3DDOA 3VHXB 3DOCA 2G06A 3DCNA 5ALRA 4HTFB 2RHMA 2QS9A 2XCOA 3AP1A 4QXAA 3M3HA 1G7SA 2XNSA 1YRHA 3DEFA 2XHEA 2WICA 1YHNA 3FPLA 1BEZA 1I8TA 4U39A 3L4BA 1PJZA 2YVKA 4Q7LA 5ALEA 2PJRA 1GILA 1ZGCA 3DTTA 3SJAA 1H1TA 1QX4A 3V4RA 4M0MA 1OR8A 2NU8A 1ZA1A 3BDAA 4RGBA 2ZVDA 3UV3A 1B0ZA 1AE1A 4B33A 2H4WA 2B25A 3EZXA 4TKVA 3ZL9A 3TFQA 2GZDA 2VBIA 2QUAA 4Q21A 1PFWA 4ZDJA 4JVMA 1JDPA 3ECCA 4DDMA 1QQTA 3ECSA 4QXQA 4WDQA 4YCDA 2R86A 3PD1A 5D00A 2DBZA 2I1QA 3Q6MA 3AJRA 3L0OA 1CRPA 1MIHA 2HA2A 2CFCA 2Q4OA 2ZCJA 1GYRA 5CFZA 1KEUA 2H2HA 4ZO8A 4BX0A 4TZTA 4KV7A 5I7VA 5TDHA 3EUWA 1W35A 2ENWA 5F2OA 5BR1A 2I3BA 4D57A 1CQZA 10MHA 3HLKA 3K2BA 2P91A 4YDRA 2F1HA 4IZ6A 4UE2A 3R9XB 1I2ZA 2CXQA 1ZM9A 4UU1A 3H4TA 3WZMA 4Z7OB 1A8QA 4Q1VA 5I5GA 3F0TA 2HSDA 5G3YA 3WHIA 2A7XA 3SJZA 3GJRA 5SY9A 5K3BA 5K3AA 2VHVA 3O47A 5AVUA 4IDXA 1WRBA 5LB2A 2KPOA 4QYSA 3TCKA 3P2OA 2O07A 1JWBB 4I6JA 2DRIA 3CLRD 1N6PA 3I28A 1UJ2A 3BIXA 1ADGA 3EAFA 4Q01A 3ELYA 3QF7A 1M8FA 2WAMA 4IWYA 1NY6A 2Y3IA 4GZ3A 4RF3A 3TQIA 4AG6A 4RLFA 1RMTA 5FI5A 4M0KA 3ZDXB 4DQXA 1Q44A 3HYNA 3K30A 5L3SA 2IHJA 4WT7A 5FF9A 3L0CA 2PZKA 4MNTA 1FJGB 1U04A 5TJHA 3OTGA 3GT4A 4PINA 1XCLA 2P7HA 3DDCA 3GPIA 1X2EA 1OXUA 1WU8A 4EDFA 4EO7A 3FLBA 3ANTA 3WYGA 4C7OA 3A7DA 1NBOA 3QYFA 2ZB4A 1NURA 4JASB 4K81B 3SQLA 3DAPA 1EB9A 1I0IA 1SIWA 3PGJA 1A4XA 3RFUA 4LYDA 3HA5A 4F2DA 4QOSA 2QTCA 1TMYA 4JB3A 2HMTA 3IQHX 4B6RA 1BX0A 4BQIA 5LDDC 3ZHQA 4HLUA 2QX9A 1T0PA 2W48A 4N82A 4Q9HA 4DUPA 2ZZKA 1OKKA 3I83A 4PZLA 2Q8NA 4FMCB 1DQZA 2BGRA 1GG5A 2V7BA 2MDTA 4A8HA 3C85A 5EQTA 1OQAA 5AK6A 4ZO6A 1DHTA 4QFDA 3ZCUA 2PM8A 5M3BA 3SC4A 4FD3A 1MO2A 3CSSA 2GPNA 4CDNA 2YVUA 4EFKA 2HDNB 5KB3A 4MO2A 1MQ9A 4F8YA 2RSLA 1PNQA 5TX7A 1YA8A 3PDCA 5I6DA 3IA7A 3VR3A 3ED1A 1WKVA 3UJ9A 1UDWA 1TVCA 5CAEB 1T9BA 1QM5A 3RIXA 3NXSA 3MJEA 3Q7QA 4HAIA 5AVZA 1WSBA 3H65A 4DV1B 2B1IA 2H1OA 3F47A 3ZCTA 2WRZA 5LP6A 1H05A 2AN4A 1W36B 4UD6A 2Q4EA 4A26A 5AT1A 1VBMA 3R4VA 3L43A 3F98A 3PL5A 2FH5B 2IH5A 3DBIA 3AO0B 1MXHA 1K4MA 4CW7A 1YI0A 1ORIA 1RAFA 3EBPA 1GSOA 3P19A 4MRNA 3RG8A 4DA8A 5EJ8A 4R9UC 1OXSC 2O6HA 4LCBA 4AUNA 2IXBA 2PT9A 1NNLA 4YY3B 5HIMA 3BCRA 2WQ7A 2HRRA 3H7AA 1XALA 2WYVA 1SG6A 2ZS9A 2I91A 3ZVKA 1MC8A 1QUEA 2ZAOA 3CBGA 4J1QA 5JQGB 1MHTA 1ZM4A 5JMPA 4JLBA 2V7EA 5K99A 2PGOA 1NC3A 2GCIA 5JXGA 4HGNA 1GZSA 1XZDA 2VPIA 1T15A 1WQ3A 3M5DA 3M2TA 4PAGA 5K0JA 3TECE 1QCDA 2C54A 4NJEB 3VYUB 2BBSA 3INTA 4KDCA 1NZFA 5AVSA 4I8DA 4AN1A 4G0XA 4V3CA 4MW4A 5CB4A 1XT6A 4U2FA 2QY9A 3NYWA 1MFPA 1N9GA 1JQEA 4J1TC 1B8OA 1WPXA 2J0UB 2Q6TA 4H7HA 4Y2GA 3A25A 3VZCA 3EIQA 3TG2A 1I4TD 2F55A 3PX3A 3IV7A 4EGSA 3H2BA 1F1JA 1BFUA 3SP1A 2RAVA 3VU9A 4MVJA 2RGYA 2VBFA 4BEVA 3FTCA 3DCIA 1EINA 1GRCA 1W1WA 5K4GA 5TMEA 3A6KA 4JJFA 4C2AA 3ZBUA 1VYUA 4C4AA 3Q3IA 5LA6B 1X2BA 3T4EA 2BW0A 2P1DA 2IEYA 1SQGA 4HFRA 2ZQ5A 1QPBA 5DBIA 1FDRA 1YHZA 1I5OA 3DV0A 4NULA 3ICCA 3KXDA 2UXDB 5KJCA 3DWFA 2WWIA 4KX5A 3O2JA 1R0YA 1PR2A 2A9OA 4RABA 2R62A 4AJHA 1XZPA 3OPYA 2P79A 2R4UA 3WK4A 4O4HF 1BSVA 1A69A 4URUR 3VKWA 4DB4A 5IXYA 4DIUA 2X14A 4ROTA 4AXBA 2CYBA 1MB0A 1R4MA 3HU5A 2NU7A 4MKXA 2VUSA 4G4SO 4MYTA 3ZJ4A 1XD2A 4PGFA 4J29A 4Z4HA 2OXCA 4YH1A 4EYOA 1HH4A 1UZMA 5AVJA 1PFUA 3HLYA 4HO1X 1W34A 4RVSA 1II8B 5CX4A 2F43A 1Z22A 4UHCA 2VLIA 4PC3A 2WFLA 5LC1A 4CUJA 3Q0IA 4B47A 1JR3E 4Q7EA 1XZBA 3OLQA 4XJSA 4C7MA 5HGXA 1CY1A 1JA1A 3KWMA 2AMFA 5BR4A 6LDHA 3LUPA 2GI4A 1ULAA 1OI4A 3MT0A 1E94E 2VK4A 1LJ8A 3SZRA 2ZRLA 1H4VB 1R0SA 3I8SA 1ZD4A 4GEGA 1CR2A 3Q41A 5FV4A 2BHLA 4AXXA 4EY6A 3AL2A 3W7BA 4ZQIA 3QLVC 3EPLA 4Y7DA 1AN0A 1K5HA 2J9GA 4CI9A 3EA0A 4KEAA 2G67A 1E69A 1GN9A 5FB3A 4NCNA 1XP5A 2D00A 2D54A 3L8MA 4W1RA 4CF5A 2A5JA 1BXZA 3TH5A 1IHUA 3JQGA 4JB8A 1CR4A 5GMOA 2NVOA 4H7KA 1LW7A 2V9CA 4TV8F 3FFTA 2EKQA 5CM2Z 2C0QA 5H7XA 3VGJA 4O4JA 1P2UA 2P78A 4G0PA 5JI2E 2XUZA 4E11A 2P1ZA 1ZJJA 1M2NA 4YJGB 4LJ6A 1ESDA 4TSFD 1WBJB 4G0OA 4AG3A 5E1MA 4MV5A 4KUEA 1FX0B 1Q11A 2GFQA 5BV2P 1B41A 2VH2A 1RSZA 2FOLA 5D5HA 3CA8A 2WYWA 3LUHA 3C7KA 2PO7A 2XT9A 2DKNA 3ND8A 5BSEA 3QOFA 3ZJ5A 4R2KA 1OY1A 1PT8A 2XNDA 1T36A 4NV3A 2X3UA 4RQAA 3II6X 1EP1B 2KLBA 4EYQA 1KAMA 1XBTA 4HR7A 3ZH9B 2QUZA 3BFXA 1OFTA 1N2EA 3HYTA 4URHA 1VPLA 4LTDA 1F20A 1T3TA 3JX9A 1MPTA 5EWMB 4D6YA 5KOIA 1QZXA 3E9ZA 3V48A 2I6SA 4JJEA 1HDOA 3ZLTA 3IRVA 3PUXA 3NASA 4PWZA 1BD4A 2VHWA 4IQGA 2OXFA 4Y9SA 1MC1A 3PFHA 4G67A 3W3AH 1NVFA 2OZLB 4MQ4A 1G3RA 2PQ6A 4EB3A 3F9RA 2XECA 3A2NA 1R0XA 1ZCAA 2ZBEA 4II3A 1C0PA 2I66A 4O1MA 5DP1A 4YWJA 3B2EA 3U3XA 1J8VA 3UY4A 3WHPA 4A0SA 4C22A 1EVJA 1QDEA 3H5TA 4JX8A 2J9XB 2D8AA 2W6MA 4KQ1A 5BWCA 1CUIA 4BVHA 4QU5A 1ZK2A 2O5EA 2Z1NA 4NZOA 5I7FA 2I9KA 1UBUS 4E4RA 1U65A 2P35A 4YRJA 1XEXB 1K4KA 5JISA 2YV3A 3M1IA 5ADHA 1XN1A 2ZE6A 5BR7A 5JTTA 2Y67A 1VL2A 1RADA 3TIFA 1AKUA 2ETVA 4LTMA 1UFVA 1R0KA 2Q2WA 3CLKA 3S5UA 3N87A 1CVLA 1Z4PX 2QRQA 1TW3A 3HDQA 2OBLA 5REQA 1YB4A 1ZM7A 1VLLA 2WDZA 3F3KA 3E9NA 2CHVA 3K0AB 4XCXA 4ZU3A 4PPNA 1LPNA 4WESA 4DPKA 3V1LA 2J3EA 3TSYA 1CS4C 2PGJA 1DVRA 2RHRA 4M1OA 1Q14A 1N6NA 4LYYA 2C9DA 2VQ3A 3HI4A 3G8BA 3PJFA 2XMRA 5ELXA 3O21A 3G2QA 4TT3D 1U9CA 1T1GA 2IYEA 3A0RB 5L4LA 4RW0A 4IVQA 2BFCB 2GJSA 1PYGA 3WL8A 1G8JA 1L1EA 3K70C 3OLXA 3FVQA 3GVIA 1IB6A 4MYRA 1VCHA 4JU8A 4GVLA 2P4SA 3NC0C 2MSDB 5T4BA 4DIEA 3CVXA 3AVPA 3RUFA 3VR0A 2X6QA 2YN0A 4IOMA 5EMJA 4D42A 3T5TA 3IUEA 3ADPA 3D6FA 3G0OA 5DEIA 2XWBF 1T4CB 4E2YA 2YKGA 2OHVA 2JASA 1PD1A 1LF5A 2VQ6A 2XBLA 3GGPA 4F1KA 2GFHA 2BKLA 5TXGA 2Q5JA 3SY8A 1NFRA 3I04A 5AI4A 3PDHA 3VSDA 1LWOA 4OMFG 1I1OA 4YPFA 2B83A 4CL0A 2NXWA 5FP0A 1Q0TA 1O95D 4A73A 1C3EA 4MWZA 3X1ZA 1IN8A 1GPBA 4GVPA 4K9PA 4PNZA 3A6DA 5ES3A 6PFKA 4OHYA 3F9IA 2TECE 4PZDA 3QXSA 3EZLA 4X00A 3PHIA 2IL1A 4OHXA 2F1IA 1VIAA 5IK2D 4JITA 4G2NA 3RS7A 3KQYA 4JNCA 2BH9A 1KJ9A 1VMEA 1U8YA 4BC1A 1KH2A 5A4DA 3SVLA 1NN3A 4S1OA 2HR1A 5HNKA 2CB9A 4YCMA 1WPQA 1E4YA 5C37A 3OJLA 1TGVA 3AETA 1KEWA 4X3PA 1A5BB 2J67A 4JJ4A 4UZFA 4PHCA 2J09A 1JR3A 1R7RA 3A36A 5JMWA 2CLMB 1A9PA 3AK4A 2OO7A 3A6FA 4KPUA 4B45A 2OFFA 4CKBA 3O74A 4OHKA 3NWEA 1XFDA 2H7YA 4GOXA 5KYXA 1GGKA 1I4OA 3C1UA 3H6GA 4NCXA 1SBHA 2O2CA 1XGKA 4BNUA 3LKDA 4AJOA 4L16A 2PYIA 2VDJA 3PNVA 4D4GA 1RQRA 3GEHA 3ZKAA 1XJ0A 5LQUA 2XXAA 2FXIA 5ALZA 4ILKA 3NWBA 4RV9A 3WA7A 3ZQ6A 2FWPA 3B89A 3QEKA 4UDOA 4F4DA 4PXAA 4ZAGA 4ZYYA 1W5SA 4WY8A 4Y18A 2WOOA 3B1VA 3L7NA 4Q00A 5FWXB 3FFBA 3WRYC