4LIZA

Crystal structure of coactosin from entamoeba histolytica
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
MSGFDLSEVAGPVAEVIDDKNEEVEFVVFGVQTQPNKLVVDAKGKGGLEEVKAALKEDALQFAYYRTISGDEESKRVKFVFISWAGEGIKKPKLRAVMSILKGDVKNVINNFHIELHATSLDDLVEDEIAAKIKLEHHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title EhCoactosin stabilizes actin filaments in the protist parasite Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Structural protein
molecule keywords Actin-binding protein, cofilin/tropomyosin family protein, p
total genus 39
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 4lizA00
1RGIG 1T3XA 1VFQA 1P8XA 2KVKA 1H1VG 1Q8GA 3EGDA 1J72A 2MV2A 4BEX1 4LIZA 1SVQA 3EGXB 1MDUA 2L72A 3A5LS 2VACA 2FH2A 4PKHB 4S10C 5KYNA 1PD1A 5IVUA 5KYUB 1C0FS 1VKKA 3EG9A 3A5NS 4KEEA 1NLVG 1F7SA 1UDMA 2LXXA 5KYWB 1EQYS 5KYYB 1DEJS 2FGHA 2XFAA 4PKGG 1CFYA 2MP4A 3EH1A 2FH4A 3EFOB 1PD0A 5HVKD 5A1MA 1YVNG 2LJ8A 1TVJA 1V6FA 1QPVA 4CBXG 3EGXA 2W0IA 5FAEA 1C0GS 2NUTB 2I2QA 1AHQA 1ESVS 1PCXA 1Q8XA 2VILA 5KYUA 1KCQA 3Q2BA 1T3YA 3A5MS 1HQZ1 1SVYA 4Z94G 5L6WC 5KYYA 1M2VB 1AK6A 4JD2H 1M4JA 1NMDG 1NM1G 3EFOA 3FG7A 3CIPG 1CNUA 1P8ZG 1M2VA 1SVRA 1T2LA 1JHWA 2FF6G 3FFKA 1TMWA 2VIKA 1WNJA 2NUTA 5KYXA 1COFA 2HD7A 1D4XG 2FF3A 2XF1A 4KEDA 3CJBG 4PKIG 2NUPB 3CJCG 2LLFA 3FG6A 2QTVA 2D8BA 3L50A 1YAGG 4CBUG 1NPHA 2NUPA 3EH2A 3A5OS 3EG9B 1D0NA 5FAFA 2FH1A 4KEFA 5KYWA 3DAWB 3FFNA 1AK7A 1X67A 3CI5G 1M2OA 2MOTA 3TU5B 1WFSA 3EGDB 5HVKB 4CBWG 5KYXB 5DD2A 1T44G 2FH3A 1WM4A
chains in the Genus database with same CATH superfamily
1RGIG 1T3XA 1VFQA 1P8XA 2KVKA 1H1VG 1Q8GA 3EGDA 1J72A 2MV2A 4BEX1 4LIZA 1SVQA 3EGXB 1MDUA 2L72A 3A5LS 2VACA 3DA7A 2FH2A 4PKHB 4S10C 5KYNA 1PD1A 5IVUA 5KYUB 1C0FS 1VKKA 3EG9A 3A5NS 4KEEA 1NLVG 1F7SA 1UDMA 2LXXA 5KYWB 1EQYS 5KYYB 1DEJS 2FGHA 2XFAA 4PKGG 1CFYA 2MP4A 3EH1A 2FH4A 3EFOB 1PD0A 5HVKD 5A1MA 1YVNG 2LJ8A 1TVJA 1V6FA 1QPVA 4CBXG 3EGXA 2W0IA 5FAEA 1C0GS 2NUTB 2I2QA 1AHQA 1ESVS 1PCXA 1Q8XA 2VILA 5KYUA 1KCQA 3Q2BA 1T3YA 3A5MS 1HQZ1 1SVYA 4Z94G 5L6WC 5KYYA 1M2VB 1AK6A 4JD2H 1M4JA 1NMDG 1NM1G 3EFOA 3FG7A 3CIPG 1CNUA 1P8ZG 1M2VA 1SVRA 1T2LA 1JHWA 2FF6G 3FFKA 1TMWA 2VIKA 1WNJA 2NUTA 5KYXA 1COFA 2HD7A 1D4XG 2FF3A 2XF1A 4KEDA 3CJBG 4PKIG 2NUPB 3CJCG 2LLFA 3FG6A 2QTVA 2D8BA 3L50A 1YAGG 4CBUG 1NPHA 2NUPA 3EH2A 3A5OS 3EG9B 1D0NA 5FAFA 2FH1A 4KEFA 5KYWA 3DAWB 3FFNA 1AK7A 1X67A 3CI5G 1M2OA 2MOTA 3TU5B 1WFSA 3EGDB 5HVKB 4CBWG 5KYXB 5DD2A 1T44G 2FH3A 1WM4A
chains in the Genus database with same CATH topology
1RGIG 1T3XA 1VFQA 1P8XA 2KVKA 1H1VG 1Q8GA 3EGDA 1J72A 2MV2A 4BEX1 4LIZA 1SVQA 3EGXB 1MDUA 2L72A 3A5LS 2VACA 3DA7A 2FH2A 4PKHB 4S10C 5KYNA 1PD1A 5IVUA 5KYUB 1C0FS 1VKKA 3EG9A 3A5NS 4KEEA 1NLVG 1F7SA 1UDMA 2LXXA 5KYWB 1EQYS 5KYYB 1DEJS 2FGHA 2XFAA 4PKGG 1CFYA 2MP4A 3EH1A 2FH4A 3EFOB 1PD0A 5HVKD 5A1MA 1YVNG 2LJ8A 1TVJA 1V6FA 1QPVA 4CBXG 3EGXA 2W0IA 5FAEA 1C0GS 2NUTB 2I2QA 1AHQA 1ESVS 1PCXA 1Q8XA 2VILA 5KYUA 1KCQA 3Q2BA 1T3YA 3A5MS 1HQZ1 1SVYA 4Z94G 5L6WC 5KYYA 1M2VB 1AK6A 4JD2H 1M4JA 1NMDG 1NM1G 3EFOA 3FG7A 3CIPG 1CNUA 1P8ZG 1M2VA 1SVRA 1T2LA 1JHWA 2FF6G 3FFKA 1TMWA 2VIKA 1WNJA 2NUTA 5KYXA 1COFA 2HD7A 1D4XG 2FF3A 2XF1A 4KEDA 3CJBG 4PKIG 2NUPB 3CJCG 2LLFA 3FG6A 2QTVA 2D8BA 3L50A 1YAGG 4CBUG 1NPHA 2NUPA 3EH2A 3A5OS 3EG9B 1D0NA 5FAFA 2FH1A 4KEFA 5KYWA 3DAWB 3FFNA 1AK7A 1X67A 3CI5G 1M2OA 2MOTA 3TU5B 1WFSA 3EGDB 5HVKB 4CBWG 5KYXB 5DD2A 1T44G 2FH3A 1WM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGI G;  1T3X A;  1VFQ A;  1P8X A;  2KVK A;  1H1V G;  1Q8G A;  3EGD A;  1J72 A;  2MV2 A;  4BEX 1;  4LIZ A;  1SVQ A;  3EGX B;  1MDU A;  2L72 A;  3A5L S;  2VAC A;  2FH2 A;  4PKH B;  4S10 C;  5KYN A;  1PD1 A;  5IVU A;  5KYU B;  1C0F S;  1VKK A;  3EG9 A;  3A5N S;  4KEE A;  1NLV G;  1F7S A;  1UDM A;  2LXX A;  5KYW B;  1EQY S;  5KYY B;  1DEJ S;  2FGH A;  2XFA A;  4PKG G;  1CFY A;  2MP4 A;  3EH1 A;  2FH4 A;  3EFO B;  1PD0 A;  5HVK D;  5A1M A;  1YVN G;  2LJ8 A;  1TVJ A;  1V6F A;  1QPV A;  4CBX G;  3EGX A;  2W0I A;  5FAE A;  1C0G S;  2NUT B;  2I2Q A;  1AHQ A;  1ESV S;  1PCX A;  1Q8X A;  2VIL A;  5KYU A;  1KCQ A;  3Q2B A;  1T3Y A;  3A5M S;  1HQZ 1;  1SVY A;  4Z94 G;  5L6W C;  5KYY A;  1M2V B;  1AK6 A;  4JD2 H;  1M4J A;  1NMD G;  1NM1 G;  3EFO A;  3FG7 A;  3CIP G;  1CNU A;  1P8Z G;  1M2V A;  1SVR A;  1T2L A;  1JHW A;  2FF6 G;  3FFK A;  1TMW A;  2VIK A;  1WNJ A;  2NUT A;  5KYX A;  1COF A;  2HD7 A;  1D4X G;  2FF3 A;  2XF1 A;  4KED A;  3CJB G;  4PKI G;  2NUP B;  3CJC G;  2LLF A;  3FG6 A;  2QTV A;  2D8B A;  3L50 A;  1YAG G;  4CBU G;  1NPH A;  2NUP A;  3EH2 A;  3A5O S;  3EG9 B;  1D0N A;  5FAF A;  2FH1 A;  4KEF A;  5KYW A;  3DAW B;  3FFN A;  1AK7 A;  1X67 A;  3CI5 G;  1M2O A;  2MOT A;  3TU5 B;  1WFS A;  3EGD B;  5HVK B;  4CBW G;  5KYX B;  5DD2 A;  1T44 G;  2FH3 A;  1WM4 A; 
#chains in the Genus database with same CATH topology
 1RGI G;  1T3X A;  1VFQ A;  1P8X A;  2KVK A;  1H1V G;  1Q8G A;  3EGD A;  1J72 A;  2MV2 A;  4BEX 1;  4LIZ A;  1SVQ A;  3EGX B;  1MDU A;  2L72 A;  3A5L S;  2VAC A;  3DA7 A;  2FH2 A;  4PKH B;  4S10 C;  5KYN A;  1PD1 A;  5IVU A;  5KYU B;  1C0F S;  1VKK A;  3EG9 A;  3A5N S;  4KEE A;  1NLV G;  1F7S A;  1UDM A;  2LXX A;  5KYW B;  1EQY S;  5KYY B;  1DEJ S;  2FGH A;  2XFA A;  4PKG G;  1CFY A;  2MP4 A;  3EH1 A;  2FH4 A;  3EFO B;  1PD0 A;  5HVK D;  5A1M A;  1YVN G;  2LJ8 A;  1TVJ A;  1V6F A;  1QPV A;  4CBX G;  3EGX A;  2W0I A;  5FAE A;  1C0G S;  2NUT B;  2I2Q A;  1AHQ A;  1ESV S;  1PCX A;  1Q8X A;  2VIL A;  5KYU A;  1KCQ A;  3Q2B A;  1T3Y A;  3A5M S;  1HQZ 1;  1SVY A;  4Z94 G;  5L6W C;  5KYY A;  1M2V B;  1AK6 A;  4JD2 H;  1M4J A;  1NMD G;  1NM1 G;  3EFO A;  3FG7 A;  3CIP G;  1CNU A;  1P8Z G;  1M2V A;  1SVR A;  1T2L A;  1JHW A;  2FF6 G;  3FFK A;  1TMW A;  2VIK A;  1WNJ A;  2NUT A;  5KYX A;  1COF A;  2HD7 A;  1D4X G;  2FF3 A;  2XF1 A;  4KED A;  3CJB G;  4PKI G;  2NUP B;  3CJC G;  2LLF A;  3FG6 A;  2QTV A;  2D8B A;  3L50 A;  1YAG G;  4CBU G;  1NPH A;  2NUP A;  3EH2 A;  3A5O S;  3EG9 B;  1D0N A;  5FAF A;  2FH1 A;  4KEF A;  5KYW A;  3DAW B;  3FFN A;  1AK7 A;  1X67 A;  3CI5 G;  1M2O A;  2MOT A;  3TU5 B;  1WFS A;  3EGD B;  5HVK B;  4CBW G;  5KYX B;  5DD2 A;  1T44 G;  2FH3 A;  1WM4 A; 
#chains in the Genus database with same CATH homology
 1RGI G;  1T3X A;  1VFQ A;  1P8X A;  2KVK A;  1H1V G;  1Q8G A;  3EGD A;  1J72 A;  2MV2 A;  4BEX 1;  4LIZ A;  1SVQ A;  3EGX B;  1MDU A;  2L72 A;  3A5L S;  2VAC A;  3DA7 A;  2FH2 A;  4PKH B;  4S10 C;  5KYN A;  1PD1 A;  5IVU A;  5KYU B;  1C0F S;  1VKK A;  3EG9 A;  3A5N S;  4KEE A;  1NLV G;  1F7S A;  1UDM A;  2LXX A;  5KYW B;  1EQY S;  5KYY B;  1DEJ S;  2FGH A;  2XFA A;  4PKG G;  1CFY A;  2MP4 A;  3EH1 A;  2FH4 A;  3EFO B;  1PD0 A;  5HVK D;  5A1M A;  1YVN G;  2LJ8 A;  1TVJ A;  1V6F A;  1QPV A;  4CBX G;  3EGX A;  2W0I A;  5FAE A;  1C0G S;  2NUT B;  2I2Q A;  1AHQ A;  1ESV S;  1PCX A;  1Q8X A;  2VIL A;  5KYU A;  1KCQ A;  3Q2B A;  1T3Y A;  3A5M S;  1HQZ 1;  1SVY A;  4Z94 G;  5L6W C;  5KYY A;  1M2V B;  1AK6 A;  4JD2 H;  1M4J A;  1NMD G;  1NM1 G;  3EFO A;  3FG7 A;  3CIP G;  1CNU A;  1P8Z G;  1M2V A;  1SVR A;  1T2L A;  1JHW A;  2FF6 G;  3FFK A;  1TMW A;  2VIK A;  1WNJ A;  2NUT A;  5KYX A;  1COF A;  2HD7 A;  1D4X G;  2FF3 A;  2XF1 A;  4KED A;  3CJB G;  4PKI G;  2NUP B;  3CJC G;  2LLF A;  3FG6 A;  2QTV A;  2D8B A;  3L50 A;  1YAG G;  4CBU G;  1NPH A;  2NUP A;  3EH2 A;  3A5O S;  3EG9 B;  1D0N A;  5FAF A;  2FH1 A;  4KEF A;  5KYW A;  3DAW B;  3FFN A;  1AK7 A;  1X67 A;  3CI5 G;  1M2O A;  2MOT A;  3TU5 B;  1WFS A;  3EGD B;  5HVK B;  4CBW G;  5KYX B;  5DD2 A;  1T44 G;  2FH3 A;  1WM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...