4LIZA

Crystal structure of coactosin from entamoeba histolytica
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
MSGFDLSEVAGPVAEVIDDKNEEVEFVVFGVQTQPNKLVVDAKGKGGLEEVKAALKEDALQFAYYRTISGDEESKRVKFVFISWAGEGIKKPKLRAVMSILKGDVKNVINNFHIELHATSLDDLVEDEIAAKIKLEHHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title EhCoactosin stabilizes actin filaments in the protist parasite Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Structural protein
molecule keywords Actin-binding protein, cofilin/tropomyosin family protein, p
total genus 39
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 4lizA00
1DEJS 1NPHA 3CJBG 5HVKD 1F7SA 4PKHB 5HVKB 1CNUA 4PKGG 1P8XA 2KVKA 1UDMA 1H1VG 1AK7A 2XFAA 3EH2A 1T3XA 1ESVS 3CIPG 4KEFA 5A1MA 3EG9B 2MOTA 3A5NS 2FF6G 3EH1A 1KCQA 2FH1A 4KEEA 3FG7A 3EFOA 2MV2A 5KYYA 1M2OA 5KYUA 1D0NA 2FH2A 1P8ZG 2NUTA 3A5MS 2NUPA 1COFA 1V6FA 3FFKA 1D4XG 1T2LA 5KYXA 3A5LS 2HD7A 5IVUA 1JHWA 1NM1G 1TVJA 2NUPB 1C0FS 1WFSA 5KYXB 3EGDA 5DD2A 2LXXA 4LIZA 3EGDB 2FH4A 2LJ8A 3L50A 4JD2H 1VFQA 2FF3A 1TMWA 1CFYA 1T3YA 3FG6A 1M2VB 5KYWA 3EG9A 1WNJA 1WM4A 1YAGG 4CBXG 2I2QA 1Q8GA 2L72A 3CJCG 5KYUB 2VACA 1QPVA 1SVRA 1J72A 1HQZ1 4PKIG 5L6WC 3Q2BA 1T44G 1X67A 5KYWB 2QTVA 1C0GS 4Z94G 1MDUA 4CBWG 3CI5G 2VILA 3EGXA 2FGHA 4KEDA 1AK6A 1PCXA 1EQYS 1M4JA 1YVNG 4CBUG 5FAEA 2FH3A 1AHQA 1PD1A 1RGIG 2W0IA 5FAFA 1M2VA 1NMDG 3TU5B 1VKKA 3A5OS 5KYYB 1SVQA 1Q8XA 1SVYA 2NUTB 3FFNA 3EGXB 5KYNA 3EFOB 1PD0A 4S10C 2XF1A 3DAWB 2LLFA 2D8BA 4BEX1 1NLVG 2VIKA 2MP4A
chains in the Genus database with same CATH superfamily
1DEJS 1NPHA 3CJBG 5HVKD 1F7SA 4PKHB 5HVKB 1CNUA 4PKGG 1P8XA 2KVKA 1UDMA 1H1VG 1AK7A 2XFAA 3EH2A 1T3XA 1ESVS 3CIPG 4KEFA 5A1MA 3EG9B 2MOTA 3A5NS 2FF6G 3EH1A 1KCQA 2FH1A 4KEEA 3FG7A 3EFOA 2MV2A 5KYYA 1M2OA 5KYUA 1D0NA 2FH2A 1P8ZG 2NUTA 3A5MS 2NUPA 1COFA 1V6FA 3FFKA 1D4XG 1T2LA 5KYXA 3A5LS 2HD7A 5IVUA 1JHWA 1NM1G 1TVJA 2NUPB 1C0FS 1WFSA 5KYXB 3EGDA 5DD2A 2LXXA 4LIZA 3EGDB 2FH4A 2LJ8A 3L50A 4JD2H 1VFQA 2FF3A 1TMWA 1CFYA 1T3YA 3FG6A 1M2VB 5KYWA 3EG9A 1WNJA 1WM4A 1YAGG 4CBXG 2I2QA 1Q8GA 2L72A 3CJCG 5KYUB 2VACA 1QPVA 1SVRA 1J72A 3DA7A 1HQZ1 4PKIG 5L6WC 3Q2BA 1T44G 1X67A 5KYWB 2QTVA 1C0GS 4Z94G 1MDUA 4CBWG 3CI5G 2VILA 3EGXA 2FGHA 4KEDA 1AK6A 1PCXA 1EQYS 1M4JA 1YVNG 4CBUG 5FAEA 2FH3A 1AHQA 1PD1A 1RGIG 2W0IA 5FAFA 1M2VA 1NMDG 3TU5B 1VKKA 3A5OS 5KYYB 1SVQA 1Q8XA 1SVYA 2NUTB 3FFNA 3EGXB 5KYNA 3EFOB 1PD0A 4S10C 2XF1A 3DAWB 2LLFA 2D8BA 4BEX1 1NLVG 2VIKA 2MP4A
chains in the Genus database with same CATH topology
1DEJS 1NPHA 3CJBG 5HVKD 1F7SA 4PKHB 5HVKB 1CNUA 4PKGG 1P8XA 2KVKA 1UDMA 1H1VG 1AK7A 2XFAA 3EH2A 1T3XA 1ESVS 3CIPG 4KEFA 5A1MA 3EG9B 2MOTA 3A5NS 2FF6G 3EH1A 1KCQA 2FH1A 4KEEA 3FG7A 3EFOA 2MV2A 5KYYA 1M2OA 5KYUA 1D0NA 2FH2A 1P8ZG 2NUTA 3A5MS 2NUPA 1COFA 1V6FA 3FFKA 1D4XG 1T2LA 5KYXA 3A5LS 2HD7A 5IVUA 1JHWA 1NM1G 1TVJA 2NUPB 1C0FS 1WFSA 5KYXB 3EGDA 5DD2A 2LXXA 4LIZA 3EGDB 2FH4A 2LJ8A 3L50A 4JD2H 1VFQA 2FF3A 1TMWA 1CFYA 1T3YA 3FG6A 1M2VB 5KYWA 3EG9A 1WNJA 1WM4A 1YAGG 4CBXG 2I2QA 1Q8GA 2L72A 3CJCG 5KYUB 2VACA 1QPVA 1SVRA 1J72A 3DA7A 1HQZ1 4PKIG 5L6WC 3Q2BA 1T44G 1X67A 5KYWB 2QTVA 1C0GS 4Z94G 1MDUA 4CBWG 3CI5G 2VILA 3EGXA 2FGHA 4KEDA 1AK6A 1PCXA 1EQYS 1M4JA 1YVNG 4CBUG 5FAEA 2FH3A 1AHQA 1PD1A 1RGIG 2W0IA 5FAFA 1M2VA 1NMDG 3TU5B 1VKKA 3A5OS 5KYYB 1SVQA 1Q8XA 1SVYA 2NUTB 3FFNA 3EGXB 5KYNA 3EFOB 1PD0A 4S10C 2XF1A 3DAWB 2LLFA 2D8BA 4BEX1 1NLVG 2VIKA 2MP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DEJ S;  1NPH A;  3CJB G;  5HVK D;  1F7S A;  4PKH B;  5HVK B;  1CNU A;  4PKG G;  1P8X A;  2KVK A;  1UDM A;  1H1V G;  1AK7 A;  2XFA A;  3EH2 A;  1T3X A;  1ESV S;  3CIP G;  4KEF A;  5A1M A;  3EG9 B;  2MOT A;  3A5N S;  2FF6 G;  3EH1 A;  1KCQ A;  2FH1 A;  4KEE A;  3FG7 A;  3EFO A;  2MV2 A;  5KYY A;  1M2O A;  5KYU A;  1D0N A;  2FH2 A;  1P8Z G;  2NUT A;  3A5M S;  2NUP A;  1COF A;  1V6F A;  3FFK A;  1D4X G;  1T2L A;  5KYX A;  3A5L S;  2HD7 A;  5IVU A;  1JHW A;  1NM1 G;  1TVJ A;  2NUP B;  1C0F S;  1WFS A;  5KYX B;  3EGD A;  5DD2 A;  2LXX A;  4LIZ A;  3EGD B;  2FH4 A;  2LJ8 A;  3L50 A;  4JD2 H;  1VFQ A;  2FF3 A;  1TMW A;  1CFY A;  1T3Y A;  3FG6 A;  1M2V B;  5KYW A;  3EG9 A;  1WNJ A;  1WM4 A;  1YAG G;  4CBX G;  2I2Q A;  1Q8G A;  2L72 A;  3CJC G;  5KYU B;  2VAC A;  1QPV A;  1SVR A;  1J72 A;  1HQZ 1;  4PKI G;  5L6W C;  3Q2B A;  1T44 G;  1X67 A;  5KYW B;  2QTV A;  1C0G S;  4Z94 G;  1MDU A;  4CBW G;  3CI5 G;  2VIL A;  3EGX A;  2FGH A;  4KED A;  1AK6 A;  1PCX A;  1EQY S;  1M4J A;  1YVN G;  4CBU G;  5FAE A;  2FH3 A;  1AHQ A;  1PD1 A;  1RGI G;  2W0I A;  5FAF A;  1M2V A;  1NMD G;  3TU5 B;  1VKK A;  3A5O S;  5KYY B;  1SVQ A;  1Q8X A;  1SVY A;  2NUT B;  3FFN A;  3EGX B;  5KYN A;  3EFO B;  1PD0 A;  4S10 C;  2XF1 A;  3DAW B;  2LLF A;  2D8B A;  4BEX 1;  1NLV G;  2VIK A;  2MP4 A; 
#chains in the Genus database with same CATH topology
 1DEJ S;  1NPH A;  3CJB G;  5HVK D;  1F7S A;  4PKH B;  5HVK B;  1CNU A;  4PKG G;  1P8X A;  2KVK A;  1UDM A;  1H1V G;  1AK7 A;  2XFA A;  3EH2 A;  1T3X A;  1ESV S;  3CIP G;  4KEF A;  5A1M A;  3EG9 B;  2MOT A;  3A5N S;  2FF6 G;  3EH1 A;  1KCQ A;  2FH1 A;  4KEE A;  3FG7 A;  3EFO A;  2MV2 A;  5KYY A;  1M2O A;  5KYU A;  1D0N A;  2FH2 A;  1P8Z G;  2NUT A;  3A5M S;  2NUP A;  1COF A;  1V6F A;  3FFK A;  1D4X G;  1T2L A;  5KYX A;  3A5L S;  2HD7 A;  5IVU A;  1JHW A;  1NM1 G;  1TVJ A;  2NUP B;  1C0F S;  1WFS A;  5KYX B;  3EGD A;  5DD2 A;  2LXX A;  4LIZ A;  3EGD B;  2FH4 A;  2LJ8 A;  3L50 A;  4JD2 H;  1VFQ A;  2FF3 A;  1TMW A;  1CFY A;  1T3Y A;  3FG6 A;  1M2V B;  5KYW A;  3EG9 A;  1WNJ A;  1WM4 A;  1YAG G;  4CBX G;  2I2Q A;  1Q8G A;  2L72 A;  3CJC G;  5KYU B;  2VAC A;  1QPV A;  1SVR A;  1J72 A;  3DA7 A;  1HQZ 1;  4PKI G;  5L6W C;  3Q2B A;  1T44 G;  1X67 A;  5KYW B;  2QTV A;  1C0G S;  4Z94 G;  1MDU A;  4CBW G;  3CI5 G;  2VIL A;  3EGX A;  2FGH A;  4KED A;  1AK6 A;  1PCX A;  1EQY S;  1M4J A;  1YVN G;  4CBU G;  5FAE A;  2FH3 A;  1AHQ A;  1PD1 A;  1RGI G;  2W0I A;  5FAF A;  1M2V A;  1NMD G;  3TU5 B;  1VKK A;  3A5O S;  5KYY B;  1SVQ A;  1Q8X A;  1SVY A;  2NUT B;  3FFN A;  3EGX B;  5KYN A;  3EFO B;  1PD0 A;  4S10 C;  2XF1 A;  3DAW B;  2LLF A;  2D8B A;  4BEX 1;  1NLV G;  2VIK A;  2MP4 A; 
#chains in the Genus database with same CATH homology
 1DEJ S;  1NPH A;  3CJB G;  5HVK D;  1F7S A;  4PKH B;  5HVK B;  1CNU A;  4PKG G;  1P8X A;  2KVK A;  1UDM A;  1H1V G;  1AK7 A;  2XFA A;  3EH2 A;  1T3X A;  1ESV S;  3CIP G;  4KEF A;  5A1M A;  3EG9 B;  2MOT A;  3A5N S;  2FF6 G;  3EH1 A;  1KCQ A;  2FH1 A;  4KEE A;  3FG7 A;  3EFO A;  2MV2 A;  5KYY A;  1M2O A;  5KYU A;  1D0N A;  2FH2 A;  1P8Z G;  2NUT A;  3A5M S;  2NUP A;  1COF A;  1V6F A;  3FFK A;  1D4X G;  1T2L A;  5KYX A;  3A5L S;  2HD7 A;  5IVU A;  1JHW A;  1NM1 G;  1TVJ A;  2NUP B;  1C0F S;  1WFS A;  5KYX B;  3EGD A;  5DD2 A;  2LXX A;  4LIZ A;  3EGD B;  2FH4 A;  2LJ8 A;  3L50 A;  4JD2 H;  1VFQ A;  2FF3 A;  1TMW A;  1CFY A;  1T3Y A;  3FG6 A;  1M2V B;  5KYW A;  3EG9 A;  1WNJ A;  1WM4 A;  1YAG G;  4CBX G;  2I2Q A;  1Q8G A;  2L72 A;  3CJC G;  5KYU B;  2VAC A;  1QPV A;  1SVR A;  1J72 A;  3DA7 A;  1HQZ 1;  4PKI G;  5L6W C;  3Q2B A;  1T44 G;  1X67 A;  5KYW B;  2QTV A;  1C0G S;  4Z94 G;  1MDU A;  4CBW G;  3CI5 G;  2VIL A;  3EGX A;  2FGH A;  4KED A;  1AK6 A;  1PCX A;  1EQY S;  1M4J A;  1YVN G;  4CBU G;  5FAE A;  2FH3 A;  1AHQ A;  1PD1 A;  1RGI G;  2W0I A;  5FAF A;  1M2V A;  1NMD G;  3TU5 B;  1VKK A;  3A5O S;  5KYY B;  1SVQ A;  1Q8X A;  1SVY A;  2NUT B;  3FFN A;  3EGX B;  5KYN A;  3EFO B;  1PD0 A;  4S10 C;  2XF1 A;  3DAW B;  2LLF A;  2D8B A;  4BEX 1;  1NLV G;  2VIK A;  2MP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...