4LJHA

Crystal structure of pseudomonas aeruginosa lectin leca complexed with 1-methyl-3-indolyl-b-d-galactopyranoside at 1.45 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I galactophilic lectin
publication title CH-pi "T-Shape" Interaction with Histidine Explains Binding of Aromatic Galactosides to Pseudomonas aeruginosa Lectin LecA
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 23
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4ljhA00
1GWLA 2K46A 4YW6A 2O14A 4BQ5A 1WCUA 4CP9B 4BQ2A 2WYFA 1V0AA 1HN0A 1W9FA 1L7LA 3ZYHA 2JWPA 2LROA 4YW7A 1WZXA 1OKOA 1GWMA 4YWAA 1W90A 1W8TA 1UOJA 4BQ4A 2LRPA 3ZYFA 2VXJA 4BQ3A 4A6SA 1GWKA 4AL9A 4LK7A 1W8UA 2Q1FA 3ORJA 4LJHA 3UT0A 4CPBA 4CPBD 4LKDA 2C24A 4LKEA 4LKFA 1W8ZA 5D21A 1OH3A 4CP9A 2KR2A 3F95A 1W8WA 1WMXA 3ZYBA 4LK6A
chains in the Genus database with same CATH superfamily
4QT6A 4XXAA 2BW8A 1NCRC 4XDPA 5FXVA 4LO4B 4WVMB 4XJ8A 3GM8A 5GLVA 3USUB 4JKKA 3HQXA 1BBT3 2ZX1A 1UKRA 2IXIA 4YGDA 1SFNA 2YGMA 1XNTA 4D8MA 1J3RA 3VZMA 5FZ1A 3CIHA 1WW5A 1LAJA 3AL6A 4LHSA 4PIYA 1UY3A 2GP5A 2AR6A 3MLKA 3BKZA 1ENSA 5CVRA 4BJ0A 3NSTA 3T30A 1LEDA 1CWPA 2DV9A 2NQYA 1D4M2 3QACA 4PLMA 1RUH3 1MEC2 1HKDA 3WQ7A 4GB32 4KGQA 3FFQA 2WUHA 3L9JT 2HWF2 3BB6A 3BOPA 2F6BA 3NMBA 5FZ8A 3ZN5A 2QE3A 3O0VA 1UZWA 1RUE3 4P9IA 2A70A 1W2TA 2WO1A 2HWE1 1XE7A 1GUIA 2HWC1 3VD3A 5C5UA 2LS6A 5KXDA 2ORXA 1ZBE2 3MEPA 1U5IA 1COV1 4N7IA 1NY72 3B93A 5LBCA 2CU5A 4JV4A 1WBFA 3FBMA 1ODMA 3T1MA 1R093 3UKNA 1AR91 3K3OA 2DCJA 2HWD3 2VH9A 2QJVA 3CEWA 4BISA 1ULGA 3AKTA 4XC9A 1E5HA 3AMHA 2VW1A 1WLTA 1HW5A 4IEZA 3ZFFC 4XAEA 1AR73 5JI9A 1D4M1 1H1IA 1BK0A 1DQ4A 5FZ7A 1GANA 1MEC1 1TVGA 4G3YC 4GB31 2BYVE 2FHRA 4XILA 2DDUA 3JCIA 2HWB3 4IGQA 4IETA 4UF0B 4XW3A 4BK4A 3EXUA 3FWEA 5CAZA 1JZ3A 4BHPA 1BEV3 1JODA 1WUVA 1GZTA 2RS12 4Y22A 2WINB 4LLFA 2J7MA 3VZJA 5M0TA 4IXLA 2J1RA 4FI9A 4XYXA 4AE2A 4QQOA 4A6OA 2DYCA 2HEYF 1CGPA 2VTFA 2XVGA 1PO22 2VUJA 3BODA 2VQTA 1OBNA 2XL9A 3SKJE 1QH6A 3ZIWA 4J6GA 1AR61 5CU1A 2OVUA 3E6CC 3KQRA 3WUCA 3DKWA 2OXBA 1HDKA 5GLTA 1GP4A 2WNEA 4E2QA 5K0UB 3UNPA 3I49A 1JZ6A 1REEA 5FZOA 2Z69A 3KMHA 1KD7A 2WL1A 3WW1A 4CDQC 1UPSA 3I59A 5I0TA 1UO9A 5HCBA 2VZOA 1N47A 3MFAA 4D0QA 1U12A 3WG3A 3BTZA 4Z2AA 3KHCA 1HB4A 4WM8B 4A6SA 5D1IA 5A7OA 1BQPA 1OT5A 5FUNA 2RS11 4NIAA 3GHMA 3VZLA 4BU2A 1F5FA 3AKSA 3IAPA 1XPWA 3WQ0A 1PVC2 1SG3A 1QU0A 5L19A 3K3NA 2GC3A 1OA2A 5FYCA 1LU2A 4DIQA 4NO4A 3VKMA 3VKLA 4A7KA 1PO21 1UU6A 3J4UH 1E5SA 1W9FA 3OY8A 5FJHA 5JSPA 3T0DA 4BK5A 1J3QA 2YFUA 4QPGA 5K4LA 1TMF2 3RGBA 3PURA 5DG2A 1W6MB 4HVOA 3GZUC 1VALA 2ARAA 1OOPA 2XMLA 3KVBA 1UKGA 4XETA 3VB9A 4AI8A 1F31A 4CRQA 2JDMA 1AYN1 2YMZA 2G19A 1W39A 5FPLA 1FYUA 1C28A 4XACA 5BNQA 2DF7A 1JI6A 5ABJA 5JIUA 2ZEZA 4ATEA 3U78A 3K4ZA 3LPFA 2YC2A 1CQ9A 3N7MA 4OI2A 5A6QA 2QQPA 1O3TA 4LKFA 2F17A 2DCYA 4OHWA 1KQRA 2PAKA 3ZN6B 4M3CE 3C8XA 4ZZ5A 4K9SA 5C8CB 3ZFGC 1ND3A 1LGCA 5KXEA 3N3HA 2R49A 2WYSA 3T2OA 1FXZA 4BDVB 5FYBA 2XJSA 2BNNA 5CFDC 4F3JA 1UXXX 4KMQA 5FTTC 5FMBA 3LKJA 3ABZA 1OF4A 1Y3TA 3NAPC 3QLQA 5DABA 4DMIA 1YFXA 1UL9A 5A3UA 4MH0E 5DDJ1 3E5XA 5DZEA 1VRH3 2IUWA 4MX3A 1OLQA 1W04A 4MVTA 2WSUA 3QD6A 1N3PA 1RHI3 3DYOA 3TEXA 5IVEA 3JB8A 3HR9A 3OSDA 3RMYA 1K5MB 1OURA 4FCAA 4OZOA 1LOAA 3V64A 1F9KA 1LHVA 4B1MA 1U5YA 4XPVA 1B35A 3L2YA 4B4PA 3LE0A 4Y4YA 1WCSA 4JDOA 4AW7A 1POV0 5FMOS 4BXSV 3KV6A 5LZ6A 3AZXA 2RS33 5JDBA 2Y6LA 3NW4A 3ETQA 3HQUA 4I02A 3ZOIA 2B45X 4PI0A 2XBO2 1O3SA 5FPUA 1AL21 1W6PA 1E5IA 1UMHA 4NIDA 4UW6A 1RJ8A 2BGOA 2PQQA 3BPSA 4KU7A 2OS2A 1NLQA 3G7DA 1M06G 3KLSA 4YM2A 4RHV2 1H1AA 4Q4Y2 1JYVA 1RUG2 2ERFA 3ZXGA 2RVAA 3MF9A 3ZX7A 3UJQA 1NXMA 2QQJA 4ASLA 2K9ZA 2VMHA 3RWKX 4AXOA 4NHKA 3T0AA 1Y43B 2HWE3 1DG6A 2K0GA 5A33B 3H8RA 1JYXA 2HWC3 3DN7A 4NOTA 1Q8PA 3ZPOA 4WVZA 3KV5A 3LIGA 4HK8A 4XIKA 1X9TA 4FQZA 1HJFA 3GZTB 5F32A 2YC4A 1COV3 3A4UA 4XBLA 4YW7A 4M0HA 1W90A 4YPJA 1NLSA 3BALA 1W0NA 4M3CA 2NMNA 1AR93 1JW6A 2MEV2 2XJVA 2BDRA 5LB6A 3ZSEA 4E4HA 3VDDB 2JKBA 5A80A 2OPKA 2VZQA 5A6YA 4BPZA 2BEOA 2XBO1 1YYNA 2IVIB 1VBD1 4ZZ8A 2OIIA 2ZA9A 1LODA 1OH3A 3KD4A 5LA9A 1D4M3 1LHNA 1ND2C 4J1WA 2WO3A 1MEC3 2ZGUA 3OPWA 3B3QE 4GB33 2I2SA 3HJRA 1JHNA 4RHV1 3IBMA 4Q4Y1 3RJ2X 2NN8A 3OF1A 2B46X 3OG2A 1G9AA 2XPJA 5CNAA 4GWJA 1W05A 2E6VA 5EJZB 4INDA 1NLRA 1GZ9A 2WNUC 1STMA 1BVVA 1HB1A 2DTYA 5CEHA 2WNOA 1QHDA 3RSJA 1KS5A 1QMJA 3DL3A 3VBUC 3ZFEA 4YM0A 1NX9A 4ASKA 5LY2A 2QQIA 3LCPA 2D6KA 1DYKA 1DCSA 3I2KA 3RYRA 4Y33A 3N9PA 5F8PA 1KXGA 4PLOA 1POQA 1AR63 1X33A 1ULDA 5LATA 2QQWA 3FLRA 1DQ1A 2C4XA 4BQWA 4B29A 4CCKA 1KGYA 3HMYA 3LDKA 2CWSA 1NT0A 2E7TA 2GC2A 4RQPC 3ON7A 3UGFA 3ZYGA 2FDKA 1K12A 2PXJA 3TEWA 4NPRA 1UPIA 1HJGA 2EVXA 1NA1A 2JJ6A 2DU0A 2W1WA 1C8NA 1LKNA 3M70A 5C3PA 1W6OA 5B4XA 1VP6A 4D6SA 4CU7A 5FZOB 1JOPA 2RS13 2XQXA 2QQUA 4NMIA 3D3AA 2YB7A 3A22A 3Q8FA 4RR3A 3FUQA 1H9WA 5FYSA 5EYXA 3PU3A 1G86A 1WCDJ 1UXZA 2FQPA 3S5AA 3KF5A 2AGSA 5FZCA 3NNJA 1PO23 5JXGA 1REFA 4A3XA 1FOD1 4UAPA 2RDSA 2E53A 4QX0A 2ORZA 3WP4A 5GJ6A 2Q8OA 4XFAA 1D7PM 3I2IA 3KT7A 3LDBA 1N1SA 3VBUB 1AYN3 2ZGTA 2W5FA 2TUNA 5I93A 3IIIA 4OI4A 4Q4X2 2A1XA 3C7OA 3OY8B 5FMCA 4XDOA 1OI6A 2YU1A 4OCTA 4QPGB 1MR5A 3PTYA 1PM4A 5ANNA 1OOPB 3ME2A 2VCBA 3CDZB 1OPMA 5IVYA 4KWJA 3MF6A 4D6RA 5HCFA 5JZGA 2VR4A 2V72A 1HB3A 1Z7S1 3ZSMA 5ABJB 3OUHA 5IAXA 5DAWA 5I0SA 4H14A 4A4AA 1UY4A 1XSQA 1CZTA 5KR7A 4OZXA 3WDYA 1W2OA 2AREA 4HSJA 3GZEA 2C9AA 3S30A 1ND3B 2BP6A 3MBWA 4D3WA 1S0EA 4X6RB 2QQLA 4NRMA 3MZHA 5DDJ3 5CISA 2ARBA 1AL0G 4O7XA 5DAPA 3THDA 5DAVA 2B7YA 4N53A 1F5JA 3H7JA 2Q1ZB 4IQPA 4DEQA 5C3QA 3MIBA 1X36A 4KG0A 1T2XA 3DPRC 4Q4X1 1FNZA 1LHOA 1FMD1 1FI2A 1GICA 1RUI2 1T6BX 4YLZA 3TN92 3FBYA 4JGZA 1SCRA 3W21A 1JYNA 4CE8A 2GNTA 1J83A 1HV0A 2RJLA 5FWJA 5HPOA 3M3QA 4XUOA 4XEZA 3VBOA 4C1XA 2VVEA 1JZ4A 2DVFA 3LA7A 1B35B 3HWJA 5FO8B 4HBNA 3ACGA 3E1F1 1AL23 4Q0SA 1QJZA 5J1XA 4FFGA 2NZ9A 2ARXA 4LOTA 1Q5OA 5C5TA 2ZMNA 5E88A 1Z78A 4NHMA 4YW1A 1G9FA 2UYBA 3GXUA 5FZ9A 1V6IA 1S55A 1Q8OA 1W6PB 3GBWA 4XFFA 3CKHA 4XFBA 4XAAA 3T09A 4TLFA 5FY1A 3AVRA 5D21A 3GCWA 5T3NA 3RI8A 3PJYA 3F95A 3KV4A 4DUVA 5A3PA 1RUNA 5I0DA 4FPFA 4RA0A 4RGAA 4XCBA 5JSRA 5CA6A 2EXJA 2R042 1WMEA 2W39A 3ACHA 3D0JA 3MIHA 1BK1A 4NHXA 4Z92B 1S2EA 4WZCA 1SPPB 2Z79A 1OLRA 1IKPA 1KDMA 1UY0A 4AZZA 2JICA 4BH9A 4FPOB 3PVNA 4V2VA 3OBAA 2NMOA 4QQ2A 3H7YA 1G9BA 3VBFC 3WP6A 5F1RA 1ZZ8A 2P3YA 3I7DA 5JR7B 4AI2A 1O3RA 1UX6A 3KM5A 5FYVA 2XBO3 4Q29A 3WINE 1NZIA 3ILFA 1VBD3 4KI5M 3UL2A 3PHMA 4WVVA 2Q1FA 2R32A 2VTXA 4WM7A 2P5BA 4C8DA 4AI0A 3B01A 3VDAA 2XWJB 2Y0OA 3I2FA 2VMDA 2KR2A 4RHV3 4Q8LA 3PUSA 4Q4Y3 3WDTA 4FSJA 4ARXA 2DVGA 1OA3A 3V0AA 4OQ8A 2DWRA 1G6NA 3A0NA 1C5IA 4ZXKA 2BV4A 1HV1A 5FPVA 2ZGSA 4CP1A 5F2WA 1JBCA 2R7EB 2WS91 3WDXA 2JG8A 1DYPA 5FY7A 4AVSA 2E7QA 4I09A 2XDVA 3MW3A 1UCXA 1CPNA 2R041 2Y0IA 2W1QA 5DAXA 2FD8A 3PIJA 1H0BA 2BGPA 2MNGA 1QXPA 4NJ4A 3DXTA 4ZU7A 1VBC2 3PVEA 4LKSA 4JHTA 1W9YA 4K1YA 4Q1PA 1VAMA 2CAUA 1O59A 2OZ6A 2E26A 3MI8A 4KG8A 4UBGA 4QDSA 2RS52 4ZY9A 3A21A 4P9JA 4Q0UA 2RDQA 2WQ8A 1EAH2 4WVMA 1O8SA 3RMXA 5FZAA 1AXZA 2W1UA 2X8KA 1YJKA 1WCUA 1IS6A 1KS4A 2BUKA 2QZ2A 4OULA 5FYMA 3VHNA 4AF9A 4EROA 4PIZA 5LW9A 2QKDA 3LF7A 4Z07A 2VJXA 4CDWC 2QQMA 3HQRA 5C3OA 1US2A 5ACA1 4KWUA 3RQ0A 3VBHA 2RE9A 1H2LA 4URAA 1W8TA 2Q30A 1NA1B 4L8QA 3W5MA 2P2KA 1O4ZA 4LO7A 1UU4A 1H6YA 2ZGOA 2Z2SB 1U0AA 3I3EA 3TNQA 2I45A 4JGYA 1SZBA 2ES3A 2VUDA 4UYBA 1CD3G 1JU3A 3SCGA 2RDRA 3AK0A 5L7OC 1F8VA 1FOD3 5CKNA 3SEEA 4RR3B 1QOOA 4W6XA 4DPNA 1FPN2 3RJRA 4AK3A 4ES9A 5GZFA 1S2BA 2KA3A 3HIFA 5A7WA 2BJSA 3Q8BA 5IFPA 1CIYA 1RUF2 2ZX3A 4LA3A 5C3SA 2IWGB 2BOJA 4CUCA 1EAH1 3O1OA 2RMU2 2WQZC 2BBAA 2L9LA 4CUBA 4QHOA 1MZ5A 5CADA 4QXBA 3AP6A 5AVPA 4CUGA 5E8AA 1F15A 3B00A 3AZWA 5IVJA 1AX2A 1ACCA 2FDJA 2GZWA 4FOVA 4K40A 4XHXA 3SC7X 3NNMA 4QU1A 1IHMA 1Z7S3 2GMEA 3ZN4A 2TEPA 3HAGA 2QUOA 1VE0A 3GDBA 4NWWA 3RFRA 4C1WA 2PN5A 2VG9A 2GNBA 3DXUA 1DZQA 4FOYA 5JZGB 1XE0A 3DEMA 4HSLA 4XZUG 4BQYA 2WN3A 4W50A 4CEYC 2W52A 1F35A 4I2OA 3T2PA 3ZXDA 2NYYA 1VMFA 4UF0A 1WCKA 1I6XA 1NCQA 2R30A 2LALA 4UT5A 4N43A 3ZDVA 5FP8A 5FZEA 3R4DB 4P5YA 4FPGA 3OEBA 4P9XA 4A42A 2VOKA 1OXCA 1WLCA 2QTWB 4C90A 4Q4X3 3SXWA 1FMD3 4NN0A 1JU4A 5EJ3A 4E2GA 1O91A 1QQP2 3W59A 2EIEA 4GJZA 4EJRA 2BPA2 4N53B 3KB5A 1AR82 1EP0A 2D6MA 4Q27A 4DXZA 4EWAA 5C70A 1ZA4A 4IV1B 5C3RA 2VZ1A 4AG4A 4CUAA 5FUIA 1NCRA 5BNOC 2PLV2 1K5JA 4J1XA 1AHSA 4CCLA 1PGW2 4RFT0 5K0UA 2VMGA 4JGZB 2XOMA 1OUSA 1W03A 3GGLA 5T5LA 4XQWA 4XUQA 1MPXA 3FHAA 3FLTA 1W8FA 4IE6A 4PDWC 5TSWA 1UOFA 2W87A 3NJZA 4CTEA 4JQRA 5J3UA 1LOCA 2WC2A 3VBOB 4CDXC 2WO7A 1WMDA 3K48A 5T52A 3B02A 4DZGA 2ZAAA 1A34A 4WM8A 2VOWA 2VULA 4IE0A 5FXXA 5C8WA 4QAWA 5L9BA 3UKVA 3ZYFA 2ZHKA 3AMQA 4YGEA 3O1TA 4YVWC 3WNPA 1SBEA 1GBGA 4S2GA 2JEMA 2AYHA 5J98B 3WQ1A 4CDUC 4URTA 3QCWA 4AOCA 4JTNA 1LTEA 2DFBA 4GXLA 1FAYA 5T5JA 1ZYBA 2OPWA 3LWCA 1UMIA 5FBJA 4E9KA 2GN7A 1QQP1 3N35A 1C1FA 4TLGA 5DZFA 2C1FA 1JZ5A 4TTGA 1AR81 4GIQA 1SLCA 4NAOA 2PFWA 2WNVC 5EPAA 3LDRA 4EYUA 3WCSA 3OPZA 2PLV1 4PQQA 3WNLA 3ZSJA 2O1QA 3THCA 3T08A 2ZACA 3HNYM 5F5IA 3VBSC 2YDEA 3BIEA 2J1EA 5FREA 2X5IC 5F39A 1SEFA 5FFOC 4BQ3A 4C91A 3DF0A 2C9KA 3RI9A 3GHNA 5IHRA 1W8UA 2W47A 3ZN6A 4P9GA 5APAA 4KWLA 2ZBJA 2FMDA 3EJKA 3JU9A 1GMMA 3I8TA 1RINA 4WM7B 2WS93 2Z4FA 4GD4A 1YQ8A 1LESA 3M2MA 4NIIA 1DGRA 3I3QA 2UURA 4JRAA 1W99A 1WLDA 2DVBA 2WLQA 3K2OA 3UESA 5BNNA 4QXKA 4YFZA 3V0AB 2VMFA 3MPPG 5A7SA 2R043 3FJSA 3G6JB 4FP2A 2XB6C 4W4ZA 4D7TA 2JG8B 2E9QA 4Y1VA 2ARCA 4IV3C 4M3CF 1QKQA 5C4WC 1H8TA 1YEWA 5FO9B 2WRAA 5IT6A 3I2GA 1SLTA 5LBBA 1PK6A 3RRDA 4META 2XR4A 3AB0A 1ALYA 1RIRA 4QKFA 2MHFA 5HXMA 4NRQA 4IGOA 4XHBA 4XABA 1YFUA 1YXWA 2VZRA 4LBJA 2IFRA 1A3KA 1Y9GA 5IK8A 1GWLA 2G9FA 4X8PA 2K46A 2WZR1 3S7IA 3OUIA 5ACA3 2CTVA 3BTXA 2Q0AA 2VQUA 4JDNA 4ZXEA 2ZJCA 2BWAA 3CJIA 4LTAA 3UKTA 3URFA 3PLQA 3CMGA 2SBAA 3JD72 5A7PA 4XFGA 5FOBB 2RS31 3VBHB 3FHIB 4AGVA 3I2JA 2AACA 3AP7A 3GF6A 4F8AA 2PELA 3JBG1 5FLIA 2UWBA 4XQ4A 2D40A 2R072 5CYYA 3KT1A 3LQCA 4JGYB 2JG9B 5A33A 2VZUA 3VL8A 1TZOA 4ORFA 3MLJA 5F6LB 1F4HA 5F5QA 1YC61 1DZTA 1EAH3 3LEGA 2I74A 2Y6GA 2GC0A 2B4KA 1OFSA 2D93A 4XJWA 4BLJA 2CDOA 5A7WB 5IK5A 5CFCC 1OKOA 4EN8B 4FFFA 1MZEA 4YNIA 2PHWA 4PCRA 3C7FA 1QIQA 3W20A 3I4IA 3S6PA 2ZX0A 3I3MA 2KXLA 3VDDA 2HJIA 1UYPA 1RXGA 3LZZA 3POFA 1GKBA 3NV4A 3PUIA 1DQ2A 4L97A 4EZHA 3FE5A 1C5HA 3NO8A 1WD3A 3U37A 4QPWA 3AZZA 5FK8A 3ZYBA 3OBTA 1ULPA 3OEAA 4QU2A 1OUXA 2UWAA 4IE5A 5F3EA 4AGGA 5FY5A 1VBB2 2R071 4RN5A 4YZ2A 1Q8SA 5J37A 1XU1A 3ILNA 2ZPXA 4K1ZA 2ZGPA 3NAPA 1OF3A 4FPEA 2CYFA 1QF3A 2HWF1 1NCQB 3VBRA 4BYYA 1CONA 1PIV2 3KQ4B 4QXCA 3SMHA 4EN7B 4N43B 3JZVA 4EWEA 5GZEA 4YW3A 4KU8A 1RXFA 3CO2A 5FYIA 2R0HA 1ZBE1 2ATFA 3LA3A 2FMYA 1HX6A 3NV1A 4YRDA 1RUC2 4K3UA 3AC0A 4DUWA 2CGPA 2QBXA 2V4VA 3AKPA 2XJRA 1CESA 1NY71 4XJAA 4N8MA 4OUSA 5HCHA 3HT2A 1KDKA 3PUHA 4FOWA 1FX5A 4CEWC 1HIXA 4MGKE 3SITA 4HMZA 1KJLA 5I8SA 1NCRB 2IFWA 2ZABA 5FMDA 1GV9A 4QQLA 3AMMA 3WZ1A 1RB8G 2VO5A 3EQEA 4AEDA 2B9UA 2VOXA 3ZXJA 1VBB1 4CXYA 1Q3EA 5JOYA 3VLBB 5H9RA 2DBNA 4HZFA 4YG0A 5FZ0A 1AVBA 5F2SA 1UZYA 3K75B 3AXDA 4IEXA 4BXFA 1QQP3 2RJ2A 4XUTA 2WO2A 3CL1A 1AR83 4RFRB 4RS5C 1ODNA 1YNAA 5A1FA 3KCXA 2NLRA 3ZR5A 1IS5A 2GDFA 5FZHA 1APNA 3FHQA 1ULCA 4Q0QA 3AKQA 1RUC1 3BIWE 2PLV3 1HRI2 5FY0A 3TRSB 3V56A 3DECA 4C0BA 2CAVA 4FTSA 4O61A 4QXHA 3MV01 4UFKA 1ONAA 1VAKA 2FCTA 4LORA 3MHZA 1XQNA 1ZZ7A 1W8NA 2AH2A 1EUUA 3WEZA 3ATGA 5IVVA 4Q4V2 3O14A 5LA0A 3R05A 4MXWA 4AFBA 1RVF2 3J7MA 4BIFA 1V6OA 1PNFA 4TXWA 2JDHA 2VXRA 5ERLA 3WF4A 2WKKA 3MW4A 1ND2A 1UY1A 2E51A 1D0HA 4GKXA 4Y24A 2NPIA 3FLPA 4HN1A 4B7KA 2P3KA 5C6CA 4COWA 4NROA 4UOJA 3S0MA 3MIFA 2CNAA 5FYHA 1GSLA 2JDPA 5AFBA 3NL1A 5FZMA 1X8MA 4JCKA 3OJBA 3M4FA 3ZFFB 2XJUA 3LD8A 3HBKA 5FZ6A 1PVC1 5BNNB 1CR7A 1ULEA 1F4AA 2A7AA 4K8RB 4LMFA 1V9U2 2EF6A 3TNPB 2AEYA 1ASJ2 1HRI1 3WF2A 1J84A 2GNMA 1H9PA 1PMIA 3L2HA 3U11A 4XURA 5K9YA 1W3VA 2JD4A 1IPSA 4FXKB 4B8EA 2YROA 1TMF1 1H8TB 4P02B 4LUMA 1QJY2 4TYSA 3WW3A 3HD8B 4KBBA 2WZR3 4Q4V1 4NR1A 1GZCA 1PK6B 1O5LA 1RVF1 4QM8A 4XFCA 3JUUA 3H0OA 3WG1A 3ZXKA 1FV3A 2D97A 2XONA 4FPCA 4LITA 1YI9A 2IXKA 3MIDA 5EYYA 2AEZA 4DS0A 1HXS2 2WIIB 2YUEA 4ES8A 4AQ6A 1BYHA 3VDCA 1IG0A 1Z0HA 2Y33A 1ZBA2 2VNGA 4CXXA 3LA2A 5IVBA 2VBDA 3HPNA 2J22A 2VBPA 3MFCA 2VZSA 3CJIB 3JBG3 4XZPA 5FZBA 1QJU2 3O1VA 4YW2A 1IS4A 1LECA 1J58A 2FDFA 2P34A 2XQRA 2D5FA 1WKYA 1KFXL 3B69A 4XIOA 2JXAA 5F5CA 2GH8A 4LKDA 3O1RA 1LGNA 1E57A 3THPA 1SPPA 2BVVA 1UIJA 2EXKA 1URXA 1WWYA 3KHBA 3N9NA 3EB7A 2W95A 4E4DX 1A8DA 2O8OA 3SLIA 2OZJA 2VBBA 4DQAA 1W8HA 1QGLA 1S0DA 3NJVA 4AFCA 4KGGA 3ASIA 5C33A 1PGL2 1QDCA 4HETA 5KWRA 3NV2A 1ZBA1 4P5HA 5FRAA 2JB8A 2HBUA 2YXSA 1VAVA 5H9SA 1CPMA 1AX1A 1XNAA 3CF6E 2YBPA 3I54A 4AVAA 3ETPA 2ZGRA 2H6CA 4AEJA 4UFHA 3H1MA 1GQPA 4QB6A 1YWKA 2JD9A 2DFCA 2R073 5DMYA 1DQ6A 5LA2A 5I0RA 1AXKA 3IIAA 4OMDA 2TBVA 3NJXA 4BE3A 3ZXEA 4BQ5A 4IERA 3R0RA 3WSOA 1EV12 2HWF3 1G9DA 3POBA 1WGPA 1RUG1 3SCHA 3RS6A 2A3WA 5E16A 4IE4A 5FPBA 5JXJA 3SH4A 3KS7A 4CP2A 1ULFA 2E63A 3LEIA 1V6LA 2XUEA 2ADDA 4HKOA 4HT1T 3NAPB 5IWFA 4MGQA 4A7YA 1ZBE3 3SHRA 3VBRB 3DPRA 4Y3OA 3KZ4C 4DOUA 1VPHA 2B42B 5ABJC 5KHJA 3UK9A 1C1LA 3GALA 4O65A 1OC1A 1S0FA 4JAAA 1YLLA 1W6NA 2MEV1 2IXJA 1OQ1A 3AYDA 4ET7A 4Q1RA 4YW5A 5K7PA 3SNMA 2C26A 3A7QA 2ZX4A 2BOIA 1IKQA 2FZ1A 4AYUA 2VY0A 2WN2A 2P3IA 1H2MA 1MZFA 1VBB3 3OCPA 4LUKA 4F83A 1TEIA 5GLWA 2VZTA 1WLWA 2WDBA 3D6EA 3GBFA 4Q4W2 1EV11 2WWSA 5LRSA 1XB9A 3BOWA 4AEDB 3WNNA 5F7UA 3PMEA 1HN1A 5CIRA 4XDQA 1JMUB 3R4SA 2VUCA 3E6DA 4U2AA 1MS5A 3PJQA 1UOGA 5FY9A 4BMBA 1HRV2 2Y6JA 4FFIA 1JYCA 1WA4A 1RUC3 4H7LA 1MQTC 4Y4RA 1B35C 4D6QA 4OHVA 4ZPIA 1IOAA 1P8JA 3ZMOA 2O0OA 5BUVA 2YG0A 1R1A2 3CQOA 4LOSA 1SLLA 2F4PA 3MGUA 3JQWA 1SLBA 1EY2A 1W6QA 2EXIA 4JKLA 1WMFA 4YGCA 3AYAA 3CBNA 5FV3A 1DQ0A 1DGWX 4AHZA 5JOZA 4IUGA 3T4HB 2UY8A 4JTOA 1W28A 4MXWB 4D7SA 2YU2A 4IEUA 3M1HA 4QHBA 2W1SA 3POWA 1CX1A 1WA6X 2WR9A 4LXLA 4YVSC 4J25A 2ZAHA 4AFDA 2DTWA 3AX4A 4Q0PA 1ND2B 4FPLA 1PVC3 3RVHA 3WNOA 1ZM1A 5I8YA 3RZGA 5FXZA 1N3OA 2FCVA 1L7LA 3RYPA 1SLAA 2LROA 4B7EA 1HRI3 2A71A 3ZYPA 5IFTA 4PBPA 5DZGA 1QOSA 4YWAA 2B5HA 3H8OA 2WABA 4YG6A 3U4XA 1G7YA 1TMF3 4OVEA 2QDRA 5LBEA 5IK7A 3FN9A 3WR0A 2XHNA 3PL0A 3TAYA 3RWNA 3GJAA 4Q4V3 5A3WA 1GWKA 1Y9QA 2A6VA 1TNFA 1M4WA 1G8WA 1ZA7A 2QQOA 1RUJ2 1RVF3 2ZEYA 4FO9A 4IV1A 4M0NA 4W6WA 3OGRA 5AC92 1CAVB 1W9WA 5IVCA 2VOTA 4KBZA 5FAXA 3ZKYA 4AL9A 1WMXA 4BLIA 5EQUA 4CCOA 2BGCA 2ZX2A 5DUWA 1S0BA 5JIAA 2WYFA 2GAUA 1FV2A 3E97A 1GYKA 2BVBA 3AZYA 2J1AA 3MYXA 4OHXA 5J48A 1JOBA 2YPJA 3O7OA 1OD3A 1XC6A 1ZNPA 3NNLA 4XMAA 3VD7A 3WT3A 2G1MA 4QX3A 1QJX2 1UW8A 3ZFEC 3WXPA 5BY5A 4Q8KA 4GWMA 4M01A 5CKQA 4UFMA 5GLZA 4AFAA 3WHTA 2QNKA 3UT0A 4P9LA 1VR3A 2YV8A 3POYA 4HKWA 1ZX5A 2CY6A 1VIWB 1PGSA 2XKOA 3O1SA 2BERA 2XKPA 4FVVA 5H9PA 2LW8A 5FBZA 1RUJ1 4LBLA 3WUDA 4COUA 5A3LA 1Q56A 5AC91 2VQ0A 1V0AA 2ET7A 1RUI1 5IAVA 1IQDC 2OX0A 2R1DA 3LEKA 3TN91 1BKZA 1DZRA 1QXRA 2R16A 5I91A 2GN3A 4YSFA 3U4SA 4I30A 1Q43A 1J1LA 4JVAA 1MS3A 3LFMA 5AVAA 2XLAA 1PX3A 1ZBA3 3K4DA 2HH9A 1D2QA 4FTEA 4GH4C 1BLZA 5GKAC 1X9PA 3BYWA 3EO6A 3RG0A 4A41A 3ES1A 1UMZA 4L99A 1ENRA 3AP4A 5BNPC 1RUG3 3SISA 4CA9A 2DUPA 1UAIA 2Y64A 1V00A 4QGMA 3A23A 3TWIA 3OGVA 4SLIA 5JOWA 3KSCA 2OUJA 4LA2A 3Q8CA 3CZJA 1WD4A 4ZS2A 5CG9A 2EAAA 2UYAA 3ZIXA 4PJYA 5IVFA 3O1MA 2YFZA 3MV11 1K45A 3E6BA 4BOWA 4YZ5A 5LA1A 1QH7A 3ZO0B 2IXLA 2OT7A 3ES4A 4IEWA 1G9CA 4NWVA 2P6HA 3NWKA 2AENA 1JN2P 2VZ3A 4S2FA 5DUXA 3BCWA 4QX1A 4FPHA 2MEV3 3KCYA 4FP3A 4JC1A 5LK5A 3DPRB 5JWPA 5HI0A 5LK7B 1W3XA 1LULA 4QWNA 4MXVA 4AWDA 5BNOA 4QPIC 4LIVA 1H1MA 1XSRA 4OHYA 4R9AA 2AUYA 4Y1UA 1POV3 1W6NB 5FR3A 3GCXA 3AKRA 2JDKA 4FT8A 3VGIA 5FIXA 3MIGA 3O0WA 4D94A 5J09A 4FQ4A 5EP9A 4AAPA 5JMOA 4V2WA 1EV13 1W9TA 3NKGA 1WW7A 2JDNA 1CZSA 1SBFA 1IS3A 1CZVA 3AP9A 4QX2A 3ZMNA 3RZZA 4EQVA 5E1RA 3VD4A 1XU2A 3D4KA 3PMSA 2OKXA 1JZ8A 5LEJA 1PHMA 3P3NA 1N3QA 5BXXA 3ORJA 5LRRA 2JG9A 2R1BA 2G9ZA 5K8SA 1C57A 4CCJA 4LKEA 3Q8EA 3WD5A 2RHPA 1RUE2 2P17A 3AP5A 4LK6A 4IDZA 5FXWA 1VBC1 4AR2A 3HVDA 4JHZA 4HANA 3ACIA 1UD1A 3AYEA 2WZEA 1R082 4I0BA 3MUZ1 1LHUA 4YW4A 3VKNA 5DAQA 1JYWA 1VLNA 2RS51 3ZM8A 5ISLA 2PHRA 5GM0A 4P9WA 4EN6B 3EBRA 4UFIA 4DEVA 4LBNA 1RMU2 3UGHA 1AF9A 3U07A 1GFF2 2NM1A 2ZKLA 2HYXA 3C7GA 4B4QA 1IGOA 2X5IA 3JQXA 5IK4A 3H1WA 2ZHLA 1W6QB 4GJYA 2HWD2 3WF1A 4ZONA 2FBEA 1REDA 2ZCWA 4XE9A 2D6NA 3O1UA 3E5QA 1AUYA 3B9IA 1DQ5A 4P08A 4AQTA 3CNAA 1TQ5A 2H0BA 5DN2A 3DGTA 3J7NA 4AVCA 3OPTA 1GNHA 2XVLA 1I5ZA 4BB3A 1AR72 3GJBA 2FDGA 4MLOA 2FDIA 4GMP1 3LIHA 1U5XA 4GQ7A 4UW5A 2JDUA 1KFUL 1V6MA 1ENXA 4LE4A 2HWB2 4QKNA 5KHIA 1B09A 3CLPA 1BEV2 5FQ0B 3MO4A 4R9DA 4FPYA 4PLNA 2J1VA 1OH4A 1X7NA 5F3CA 2YY1A 5D8AA 4NPMA 1ZRIA 1FPN1 2DU1A 2W3JA 5A70A 4MUVA 2RR12 3AMNA 3WW4A 1PMJX 1HLCA 5C4WA 3FL7A 1R081 2Y6HA 4IEYA 2BFUS 1RUF1 1GNZA 3BN6A 5HXVA 3B5LB 3Q9OA 2RMU1 1LJ7A 1RMU1 1YHFA 3EMRA 4QPYA 1W8OA 4RGKA 5A7NA 1AJOA 1Q8QA 4WM7C 4H3WA 1F2NA 4AFMA 2V73A 2YBSA 5B2GB 5BV6A 3OYWB 5JSOA 4MOAA 4M4PA 5EWSA 3FZ3A 5L73A 2XJPA 3BUCA 1H6XA 4R9BA 3OD4A 5CKMA 4DNYA 3ELNA 4NHLA 3ZXAC 1VMHA 2EAKA 3WDWA 1HN0A 3O5SA 5DG1A 5C9AC 5HV0A 2A6YA 4CSWA 1NZCA 3RZLA 1UOBA 1V6JA 2YPDA 1UYYA 4CDWB 3LPGA 5G05L 2F4LA 4DUXA 1GU3A 5FDBA 1AXYA 1DP0A 1AZDA 3FMGA 2W46A 4UFLA 3K46A 4I01A 5DXDA 4ASMB 4QB2A 4BQ4A 2XLFA 3T2TA 5KC6A 3BPZA 4WZFA 4XBQA 4YZ3A 5FJKA 3OGGA 3DYPA 4Q5OA 5FLHA 1YIPA 2RR11 3HT1A 1NXD1 4FXGB 1HB2A 3C3VA 1RUJ3 2LUWA 1LOFC 3NRUA 5AC93 1OLMA 2R062 1RUI3 3AZVA 5F37A 5JUVA 4OI1A 4LT5A 1LRHA 3NNGA 1TE1B 3KCCA 4GALA 4OQ9A 3TN93 4QDRA 1UY2A 2ZGKA 3UYJA 2JX9A 4YFWA 3WF0A 5CFCA 5T55A 2HYKA 4RL7A 1WZXA 1KRIA 3QH7A 4Z1VA 2DCZA 4S2DA 4AI9A 5KXBA 4ISRA 2ZGQA 1CAXA 2ZGNA 4MV2A 3AFGA 1PGW1 4IEQA 4K6BA 5A3OA 4IW3A 2JIJA 3OTFA 1QJEA 3ZVXA 3IWZA 1UIKA 4JGYC 4LK7A 2X53S 3D82A 2Q8EA 3AM2A 3K51A 4MG2A 1N1YA 2DBIA 4I3PA 4R52A 3LOBA 5JVVA 1HQWA 5DQ0A 3W58A 5A3NA 1XYNA 2E32A 1UX7A 2EXHA 4IEPA 3ZFFA 4YARA 4LHNA 1J59A 2H0VA 1AX0A 4HN0A 4PT6A 2A5ZA 3RYKA 1GOFA 5EFUA 2V5DA 2Y38A 2YYOA 3RPQA 5FP9A 1XNDA 2A6ZA 5FYTA 2R061 5T5PA 4H2AA 2EALA 3EHKA 4HXCA 1NQDA 3P5BA 1IQAA 4HL0A 4G9SB 1UOJA 1RHI2 1FNYA 2XH6A 5JXIA 4QD2A 4EN9B 2PHLA 4Y1XA 3I2OA 2WFPA 2ZHMA 4V1PA 2W68A 4MO3M 2XJQA 5FPXA 3VD9A 1OMIA 2JE9A 4CEWA 4HK9A 2BNMA 4OMCA 1JS9A 3WG2A 5F6KA 3RDIA 2CGNA 2GP3A 4U36A 5BNOB 1S1AA 1NCQC 2LTNA 4PF1A 2VQAA 2D6OX 2C6SA 5FWEA 3LGRA 4N43C 2P4EA 1MS8A 4CDQA 1W0OA 2D5HA 5IYYA 2ZZJA 4PDWB 4QMAA 4FBFA 1JXNA 2B39A 2VCAA 2Z42A 2VCMA 2FCUA 3ZKUA 2DUQA 4R9CA 4MGTA 5FMOL 3A0KA 2CL2A 1NQJA 3KGLA 5EV7A 1JYTA 1H2KA 1PVXA 2E31A 4O9GA 1NE6A 1OVSA 4A45A 4Y1YA 2HWE2 1VBC3 1RITA 2HWC2 3ALQA 4HKLA 4RGGA 2GSYA 1UYZA 4YYOA 1LEMA 2RS53 2ZTNA 1Y7BA 1LR5A 4MSVA 4PF5A 5T54A 4E4ZA 1COV2 4LBQD 2YC0A 5CZKA 5K0UC 1O8PA 2WLPA 3E5UA 2WFF2 5A1LA 3B94A 1I3HA 2QQNA 2WNVB 4Z8BA 5IUQA 2HBTA 2ZGLA 1ZVFA 2IVJA 4JQTA 1AR92 1ULOA 2BU9A 4I3GA 3GZAA 2J1UA 3T0BA 4WM8C 1AJKA 2JE8A 2VW0A 5FO7B 4AHXA 2BBVA 1CN1A 2Z5WA 4MZUA 4XF3A 2EIDA 1NG0A 3BGAA 2D6LX 2G4IA 3VBSB 2X5IB 4LJHA 4GMP3 1MS1A 1MVEA 4CZSA 2Q8CA 4CU8A 2FDHA 1MS0A 2AC1A 2WJSA 3JD71 4UWDA 5L9RA 2ADEA 1RUD2 3POIA 3ZFGA 1IG3A 4AGRA 3RNSA 2HEWF 5A6ZA 3HBZA 3MLLA 4JDMA 4DFSA 4LR4A 3MDPA 5FZDA 3WQBA 5LY1A 4XTMA 1FPN3 4L0PA 3NQHA 1PMHX 2DCTA 5EXOA 3VZKA 5CFDA 2B9VA 3RZMA 1R083 4XF4A 2J1SA 4EZ4A 1RUF3 3OYWA 5DUVA 3CZUA 3WVJA 4CCMA 2RMU3 5KC5A 1RMU3 2WFF1 4QQHA 5D8AB 4ZKTB 3IM0A 4IV3B 2EICA 1AR62 5C4WB 2VMIA 3AFKA 4X8NA 1UWWA 1GR3A 5FZ3A 4DB5A 1GZWA 2P3JA 5C8CC 4R8HA 3PTRB 5LCWL 2XG3A 1SFPA 3S57A 5FPAA 2H6BA 4OFGA 2OQ6A 2BRTA 4LIUA 4QQPA 3X29B 4CVUA 4P14A 5J96B 1YQCA 1YRZA 5A3MA 2VC9A 3N9LA 4QX7A 4UXAA 5CB7A 5BNNC 2ILMA 5F3IA 1RUOA 2RG4A 3NNFA 1RUD1 2EIBA 3DCQA 1RYYA 1W0PA 4XJZA 1WW4A 4IGPA 1LGBA 1YQ2A 4AHWA 4ONUA 5HCAA 3POJA 1DDLA 4UW3A 2DVDA 2UU8A 2ENRA 2RR13 3IB3A 1W9SA 1H8TC 4BQ1A 4D69A 1TME2 1YQ6A 3INAA 2VTXJ 2XLGA 1GP5A 4MGZE 2XVKA 2JDZA 4XUPA 1NAEA 1PK6C 2WT1A 2WQ4A 3UV9A 3P1IA 1BVP1 4DY5A 3C7HA 2N7GA 3SH5A 1K5MC 4DY3A 3ZXLA 1PIV1 2B8MA 2VMEA 2D3RA 4GKYA 3ROUA 4IE7A 4S2HA 5C7GA 1S0JA 4DO0A 1CJPA 4XFHA 3ST7A 3KT4A 1AYN2 2D3PA 3WNMA 4D7YA 3VZNA 4KWKA 1JH5A 1ZRFA 2WAAA 3CJIC 3VKOA 3T2QA 5CFCB 1S2KA 1D0GA 1R64A 3D5OA 2ET1A 2BQPA 2CV6A 5GZCA 1JZ2A 3WW2A 1PM7A 4ZU4A 4MGYE 1CAXB 3B7MA 1YQ5A 2BZDA 1U5ZA 3OUJA 4HONA 4JX0A 4TZDA 4CU9A 3D0SA 3IN9A 2BWCA 3ZYRA 2JIGA 4B4RA 3J26N 4GWNA 1TME1 4FPKA 3MUY1 3USSA 5JLVA 2WT2A 2D3SA 2J1TA 5GLUA 1BCXA 4AAXA 1MZ6A 3WF3A 3NKTA 2R063 5DDJ2 4LULA 2GALA 1LB2A 2Q5TA 5L36A 3VHPA 2W9XA 4CYDA 3VL9A 2MPFA 1OHFA 3FX3A 5FZLA 2WNUA 1AYM2 2XGXA 3PDQA 4BM8A 2K2SA 5C71A 3R6SA 3U14A 3VBUA 1GLHA 3H8UA 4W6YA 5FYZA 2RM22 2PTMA 3VDDC 1GQGA 5GALA 1DBNA 1R1ZA 5FKCA 1CAVA 4CPBD 4AQSA 4NE9A 4HPKA 2A75A 4XTPA 3C7EA 4E8CA 4GWIA 5ANQA 1LU1A 2WZPP 1PZ7A 2V09A 4C0HA 1DGWA 4MADA 2A73B 2W92A 2IXCA 4LBQA 3POSA 4RQPA 4XF9A 1AL22 4CEWB 4JRLA 4NAMA 3AJZA 4BIOA 4F7ZA 2PYTA 2JWPA 3BVCA 4LHKA 3ZYHA 2GC1A 1QNWA 3LAGA 3VBRC 5FP7A 2VECA 2Y60A 3AYCA 4UW4A 4FOQA 3SQOA 4DXTA 4CDQB 4MHUA 5FUPA 2ZMKA 1DIWA 3UJOA 1Y4WA 2QQKA 4LHLA 1AYM1 4OYUA 4QM9A 1QXJA 4NRPA 5SV5A 3VV1A 3V0BB 1V9U1 3N4MA 5HBAA 2XL7A 1ASJ1 1ZZ9A 1MQTA 2RM21 3WY6A 3DKQA 3KGZA 4XF1A 1A6CA 1WBLA 3ACFA 1W2NA 4RS5B 3FC0A 1QJY1 3LSDA 4CP0A 1SDDB 2RV9A 2PAMA 1MS4A 3T1LA 4HFSA 3V65A 5FP3A 3NVCA 1LNSA 1DF0A 4AEDC 1RTVA 4AEKA 3WDUA 5JI7A 1VBD2 2GMPA 4IL7A 3ZLIA 1OVPA 1UZVA 2PHDA 1XNKA 2ZS6B 3IDBB 3I3DA 1W06A 1HXS1 2BNOA 4UI9L 2X10A 2RJKA 4X6QB 3JD73 3UGGA 4WBBA 3O12A 4YVSA 1UNBA 1UU5A 4L2NA 4R4ZA 4CP9A 1SDWA 5KHGA 4HG6B 1QJU1 3GNEA 3IDAA 4FTBA 3K77A 2Q8DA 2PMWB 1PO12 4Y26A 1XJAA 5DUUA 3ZFGB 4LLOA 1NYWA 4QX5A 5E89A 1VBE2 4XJUA 4BWOA 5FK7A 4RD7A 2WFF3 1GNYA 1GWMA 1TNRA 4QPGC 1OPOA 1O4TA 5KXCA 5CFDB 1OOPC 5CBLA 3THTA 4AHYA 5IATA 4WVWA 5KHHA 1PZ8A 5L9VA 2PHFA 2XXZA 3IPVA 2E33A 2A6WA 5GZDA 1ZZ6A 1ST8A 4GA9A 1O4YA 2J42A 3VD5A 4AI1A 1J1TA 4ISQA 1PGL1 3PIGA 1GZWB 2I07B 4E4SA 1DLLA 2VD7A 4YZ4A 2PHTA 1RUD3 1ND3C 2O14A 5A7QA 2OA2A 1JHJA 4K8FA 3PVBB 5GZGA 1JUIA 3BTYA 2GMMA 2ETEA 2PHXA 2QZ3A 2P6CA 1POV1 1VB4A 3VKFC 3OD0A 3ZR6A 3B9CA 1PO11 4Z82A 3KV9A 3W5NA 4CXWA 1X82A 3PNAA 1VBE1 5EJ1B 4Q0VA 4Y22B 4DINB 1PIV3 1FOD2 5EIYB 4IEOA 4LNVA 1N1TA 1H4HA 4M4RA 4DXSA 3U10A 5A6XA 3W9AA 3PUQA 4LQRA 4RYDA 3OB8A 1YCIA 2O8QA 3GYDA 3WOGA 2DCKA 2ZXQA 1JZ7A 4Y1ZA 4N7UA 4BQXA 5H9QA 1XE8A 2CDPA 4OUEA 1ZRCA 2PA7A 5E6HA 1XBFA 3D8CA 4DRVA 2VAUA 5A32A 1C8M2 1S4CA 2IXHA 1EPWA 2VNRA 1OKQA 1YI7A 1XNBA 3IDEA 2WA3A 3ZYJB 4LPLA 3VBFA 2JDYA 4CCDA 1Z7S2 4QGNA 4GULA 1J3PA 4NHYA 3I59B 1X8EA 2QDNA 2HEVF 3POEA 4GH4A 4IEVA 3PUAA 3JB4C 4NUBA 4L9BA 4PBOA 1TME3 4CPBA 1VBA2 4EN0A 1K3IA 4Q4W1 2WZ8A 3T4VA 4OI0A 1V6KA 1DLCA 4LBKA 1L7QA 1PX4A 2VVFA 4QHZA 4OHZA 3VN4A 5BNPA 1H30A 3ACLA 5A3TA 3M3EA 4XCAA 5FQ0A 1CIWA 1D2SA 2YGLA 3K4AA 1KITA 1V70A 1YFWA 4BQ2A 1SHWB 4KNCA 5T5OA 2VW2A 3HN1A 2WBKA 1HRV1 2JECA 2RDNA 3AJYA 3HNMA 3ZPYA 4ATFA 4EWDA 2KD7A 2OUHA 1FMD2 5JAXA 5CG8A 1LHWA 3IAQA 5LEKA 3MW2A 4HLTA 1C8M1 2WNUB 3CU7A 4FFHA 1A78A 1R1A1 3ILRA 3SEPA 4COZA 2E7AA 2QCSB 3J7LA 4IESA 3SCFA 3TYJA 2Q1MA 2V5YA 2EA7A 1XNCA 2W08A 3AL5A 4LE3A 4Q26A 2JB4A 3IDCB 2VUAA 1BHGA 1GOGA 1V6NA 4P9YA 4QPIA 4TN7A 2Q4SA 2BFUL 3KF3A 1NE4A 4MGSA 4HPKB 1XRUA 2JENA 5FZ4A 4JKMA 1SFYA 2W2IA 1NUKA 2VU9A 5LASA 3H3UA 1LENA 1VBA1 3TEZA 1BXHA 1IPKA 2OQ7A 4CDWA 1VJ2A 1QY4A 2Y26A 3C2UA 4LBQB 4RQPB 3BU7A 4L11A 3KWVA 1JUHA 3HNBM 4TSVA 1C4RA 3I97A 3QBQA 3M3OA 5F5AA 1ZRDA 3MPBA 1MS9A 4W65A 2V4AA 2ZHNA 3DUIA 1AYM3 1V9U3 3PU8A 1ASJ3 4KH9A 2RM23 3F2ZA 3MICA 1CVNA 3ECQA 5L7OA 2D6PA 2QQVA 1YUDA 2Y6FA 5KHKA 2SLIA 5LWBA 4K20A 1CAWA 1QJY3 3MIEA 4NPLA 1H2NA 2CGOA 4TWTA 4A2UA 3SH3A 4A3ZA 2VZVA 1MQTB 4ZU5A 2LM3A 1MVQA 4KL1A 2QVSB 3OBZA 4H55A 5FP4A 3HEIA 1NOVA 2ZZQA 4HVRA 4XQDA 3WDVA 2C0ZA 1CX4A 1XXNA 1NA1C 4E8DA 1HXS3 3M3IA 3ITQA 3AXEA 1XYPA 1QNYA 2UY9A 3OGJA 4Y20A 1VB2A 2WA4A 2P1BA 1RL3A 1GOHA 1UZ0A 4G4FA 4AI3A 1QJU3 4RR3C 2WS92 1YJLA 3I3BA 2G9GA 1H4GA 1QJX1 4YG3A 4QKDA 4QB1A 4K7JA 4GZ9A 4CEYA 4YVSB 4WV8A 4CP9B 2GH2A 4N9HA 4LBMA 1UN1A 3WCRA 1LOEA 5A1AA 2OYZA 4MGIE 1JTZX 2P37A 3ZXFA 4RSUA 3I2DA 5FCCA 4AEMA 5JXHA 2ZEXA 3QOPA 5FY8A 4AQ2A 4BZ4A 2FZ2A 2Y34A 2QFEA 4Q2FA 1S0CA 2D7FA 2Y8KA 4OUMA 1L7RA 5EZWA 3H50A 1HQNA 4P00B 4EV0A 4M3CB 3J8F2 1DFQA 1TG7A 1UZZA 2YHJA 3KVAA 4GMP0 4N9IA 4XOGA 2NP0A 1US3A 1FATA 2C24A 5JZGC 3IPVB 2D98A 1CAUA 4I0WB 1VMJA 5ACA2 5JOXA 4LO5B 1ZZCA 3IMMA 1O5UA 1OA4A 1I1EA 3H8XA 2BTVC 2WAOA 1BBT2 3LOIA 4ZS3A 5C9AA 3WX5A 4HVQA 3ZDSA 1OD5A 3Q8AA 4Z2WA 4M00A 1ZZBA 3AVSA 1PO13 3IZOA 3ZSKA 4PDWA 3M3CA 5FPZA 4CDXA 1LOBA 4GAZA 1VBE3 1EYBA 2VGDA 4NVPA 3WLUA 2AZ5A 5F9TA 5B4NA 3BU0A 2A3YA 1E5RA 2VOVA 4N53C 5FYUA 4QKBA 3ZFEB 4YVWA 1RUH2 4IV1C 3APBA 3WP5A 1NKGA 4BA6A 2X05A 4CDUA 5J36A 3O0XA 5T50A 5JMCA 1LOFA 3M7AA 5JR2A 4NIHA 2JE7A 2GNDA 3OGSA 5HV4A 4E2SA 2D44A 2ZMLA 4XUNA 5I0UA 3USUA 3ENRA 1O3QA 2X29A 3J8F1 4JGZC 4YM1A 5F3GA 2WNVA 1DU3D 2WWJA 4UBHA 3VZOA 3OOXA 1OFNA 3WG4A 3HN3A 1LOGA 4PIXA 2XWBB 4JZRA 1JOJA 1O7FA 1KJRA 3VBOC 1QWRA 4DXRA 2HLEA 2GU9A 1LCLA 1PZ9A 2VCCA 3LSEA 3N9QA 5A32B 1OLME 1BBT1 1WW6A 1X50A 4B3NA 1EUTA 2VNOA 3VBSA 1R092 4LO6B 1W6OB 1SMVA 4CCCA 4CCEA 2Y6KA 2VVDA 2UWCA 3VBFB 4Q4W3 1YFYA 1H8VA 1EPZA 3TOJA 1JYIA 3VHRA 4GH4B 3RZJA 4AVBA 1W8ZA 1SACA 5AFEA 2CSGA 4LBOA 4QGLA 3WP3A 4AVVA 3BI3A 1RUH1 3WHUA 1HRV3 3DYMA 5SV8A 1SBDA 5BNPB 2W94A 2XHKA 4QDQA 3CHXA 3JXSA 2XUMA 4EE2A 1OQDA 5KBFA 3EYPA 3T3YA 1SQ4A 2X09A 5FKBA 3WV6A 1RUE1 1QEXA 1C8M3 2R6QA 5D2AA 2ZOEB 1GQHA 1R1A3 2JKXA 4IV3A 1SCSA 1VRBA 1QOTA 4OLLA 5BPXA 4COYA 1XYOA 2CHHA 3OBRA 1I5PA 3BTAA 1UYXA 3IT8A 3N7LA 2IZWA 3FUOA 2EIGA 4YM3A 3NV3A 3H9AA 1OQEA 2HKXA 1W2UA 2OW4A 1I9RA 1YO8A 2YBKA 3QH6A 1R091 3HOBA 4XXPA 4LEJA 3TEYA 3CJXA 2VE1A 1VBA3 2HWD1 2VNVA 5FZIA 5I8TA 4KQ7A 5JPNB 2ID4A 2YZ4A 3H3LA 4QPIB 4ZHNA 2TNFA 2KM2A 3SKVA 4XMIA 2WSVA 3N9OA 3NJYA 1QJFA 3DV8A 1AR71 1PNGA 2JG8C 2D43A 2ZGMA 1IPJA 4DRRA 3I2HA 4W8JA 2HWB1 4PHZA 5IW0A 5FZGA 1YIFA 2IC1A 1BEV1 2R0FA 4MYEA 3VHOA 3GBGA 2VXJA 4BMEA 2A3XA 1IZ3A 1UF2C 4MHRA 1SLIA 1BZWA 3H1YA 4XJ9A 2W0XA 4A7ZA 2WWUA 3U1XA 5BYNA 2DVAA 4BCUA 4PI2A 5J7MA 1W8WA 2LRPA 5G04L 2JDAA 1S0GA 4YW6A 2A6XA 5L7OB 4L92A 3P6BA 1XOYA 2PQSA 3ZYIB 1CAWB 5EHDA 3S5QA 3LB9A 4E27A 4XFIA 3WNKA 2ZKNA 4XBNA 3N7JA 1C3HA 2WT0A 2DUOA 2ZEWA 1DHKB 3VBHC 3IMNA 1K42A 1BMV2 1N1VA 4COVA 3ZSLA 2CWMA 4LO8A 1Y9MA 4XF0A 2XJTA 3VUOA 4PQ9A 4NIGA 4R4XA 5FYYA 1MACA 1QJX3 4XVHA 4YGBA 3RZHA 2JG9C 4Y20B 4Y5Z0 1DGLA 1Q8VA 4UFJA 2VL4A 1CJDA 5FLJA 5JPMB 3LEMA 4Y5TA 4O9EA 3UETA 4YZ1A 4FPJA 2VPVA 1D4VB 1W6MA 3TB0A 4FAHA 3H3ZA 5FZKA 4ITCA 4SBVA 1RC6A 4CEYB 3POGA 3N9MA 4A44A 3S7EA 3VDBA 5DPNA 3R4UA 1VRH2 3LFIA 1WCQA 3H42B 2WZR2 5JCTA 2W91A 3J9SA 5C8CA 1OSGA 4QX8A 3J7HA 1ENQA 1W2AX 3FFZA 4Y5SA 1S0IA 1BMV1 1DGRN 2DURA 3PVOA 1QDOA 2VZPA 3P3PA 3U75A 3U0ZA 3RZKA 5IJRA 5FY4A 1ZREA 4HOOA 1CAUB 1DYOA 2C5DA 4N90A 1KEXA 4ARYA 3N7KA 3O1PA 1RGSA 2RS32 4B1LA 5FOJB 1HQLA 1UQXA 2VM9A 5D8AC 5C9AB 1FT9A 2VMCA 3JBG2 5FZFA 3M8LA 1BJQA 2PHUA 4FAGA 1T6GC 4CU6A 1RJ7A 3AMPA 1GP6A 3TBDA 4CDXB 4K21A 1L3JA 1ZRRA 3WNXA 3V0BA 1A8MA 4CCNA 4H7MA 5LBFA 1K5MA 1VRH1 3N36A 3IKWA 4I0AA 4AVTA 2PAEA 3J8F3 4RS5A 4YVWB 1O6UA 4CDUB 1RHI1
chains in the Genus database with same CATH topology
1GWLA 2K46A 4YW6A 2O14A 4BQ5A 1WCUA 4CP9B 4BQ2A 2WYFA 1V0AA 1HN0A 1W9FA 1L7LA 3ZYHA 2JWPA 2LROA 4YW7A 1WZXA 1OKOA 1GWMA 4YWAA 1W90A 1W8TA 1UOJA 4BQ4A 2LRPA 3ZYFA 2VXJA 4BQ3A 4A6SA 1GWKA 4AL9A 4LK7A 1W8UA 2Q1FA 3ORJA 4LJHA 3UT0A 4CPBA 4CPBD 4LKDA 2C24A 4LKEA 4LKFA 1W8ZA 5D21A 1OH3A 4CP9A 2KR2A 3F95A 1W8WA 1WMXA 3ZYBA 4LK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GWL A;  2K46 A;  4YW6 A;  2O14 A;  4BQ5 A;  1WCU A;  4CP9 B;  4BQ2 A;  2WYF A;  1V0A A;  1HN0 A;  1W9F A;  1L7L A;  3ZYH A;  2JWP A;  2LRO A;  4YW7 A;  1WZX A;  1OKO A;  1GWM A;  4YWA A;  1W90 A;  1W8T A;  1UOJ A;  4BQ4 A;  2LRP A;  3ZYF A;  2VXJ A;  4BQ3 A;  4A6S A;  1GWK A;  4AL9 A;  4LK7 A;  1W8U A;  2Q1F A;  3ORJ A;  4LJH A;  3UT0 A;  4CPB A;  4CPB D;  4LKD A;  2C24 A;  4LKE A;  4LKF A;  1W8Z A;  5D21 A;  1OH3 A;  4CP9 A;  2KR2 A;  3F95 A;  1W8W A;  1WMX A;  3ZYB A;  4LK6 A; 
#chains in the Genus database with same CATH topology
 4QT6 A;  4XXA A;  2BW8 A;  1NCR C;  4XDP A;  5FXV A;  4LO4 B;  4WVM B;  4XJ8 A;  3GM8 A;  5GLV A;  3USU B;  4JKK A;  3HQX A;  1BBT 3;  2ZX1 A;  1UKR A;  2IXI A;  4YGD A;  1SFN A;  2YGM A;  1XNT A;  4D8M A;  1J3R A;  3VZM A;  5FZ1 A;  3CIH A;  1WW5 A;  1LAJ A;  3AL6 A;  4LHS A;  4PIY A;  1UY3 A;  2GP5 A;  2AR6 A;  3MLK A;  3BKZ A;  1ENS A;  5CVR A;  4BJ0 A;  3NST A;  3T30 A;  1LED A;  1CWP A;  2DV9 A;  2NQY A;  1D4M 2;  3QAC A;  4PLM A;  1RUH 3;  1MEC 2;  1HKD A;  3WQ7 A;  4GB3 2;  4KGQ A;  3FFQ A;  2WUH A;  3L9J T;  2HWF 2;  3BB6 A;  3BOP A;  2F6B A;  3NMB A;  5FZ8 A;  3ZN5 A;  2QE3 A;  3O0V A;  1UZW A;  1RUE 3;  4P9I A;  2A70 A;  1W2T A;  2WO1 A;  2HWE 1;  1XE7 A;  1GUI A;  2HWC 1;  3VD3 A;  5C5U A;  2LS6 A;  5KXD A;  2ORX A;  1ZBE 2;  3MEP A;  1U5I A;  1COV 1;  4N7I A;  1NY7 2;  3B93 A;  5LBC A;  2CU5 A;  4JV4 A;  1WBF A;  3FBM A;  1ODM A;  3T1M A;  1R09 3;  3UKN A;  1AR9 1;  3K3O A;  2DCJ A;  2HWD 3;  2VH9 A;  2QJV A;  3CEW A;  4BIS A;  1ULG A;  3AKT A;  4XC9 A;  1E5H A;  3AMH A;  2VW1 A;  1WLT A;  1HW5 A;  4IEZ A;  3ZFF C;  4XAE A;  1AR7 3;  5JI9 A;  1D4M 1;  1H1I A;  1BK0 A;  1DQ4 A;  5FZ7 A;  1GAN A;  1MEC 1;  1TVG A;  4G3Y C;  4GB3 1;  2BYV E;  2FHR A;  4XIL A;  2DDU A;  3JCI A;  2HWB 3;  4IGQ A;  4IET A;  4UF0 B;  4XW3 A;  4BK4 A;  3EXU A;  3FWE A;  5CAZ A;  1JZ3 A;  4BHP A;  1BEV 3;  1JOD A;  1WUV A;  1GZT A;  2RS1 2;  4Y22 A;  2WIN B;  4LLF A;  2J7M A;  3VZJ A;  5M0T A;  4IXL A;  2J1R A;  4FI9 A;  4XYX A;  4AE2 A;  4QQO A;  4A6O A;  2DYC A;  2HEY F;  1CGP A;  2VTF A;  2XVG A;  1PO2 2;  2VUJ A;  3BOD A;  2VQT A;  1OBN A;  2XL9 A;  3SKJ E;  1QH6 A;  3ZIW A;  4J6G A;  1AR6 1;  5CU1 A;  2OVU A;  3E6C C;  3KQR A;  3WUC A;  3DKW A;  2OXB A;  1HDK A;  5GLT A;  1GP4 A;  2WNE A;  4E2Q A;  5K0U B;  3UNP A;  3I49 A;  1JZ6 A;  1REE A;  5FZO A;  2Z69 A;  3KMH A;  1KD7 A;  2WL1 A;  3WW1 A;  4CDQ C;  1UPS A;  3I59 A;  5I0T A;  1UO9 A;  5HCB A;  2VZO A;  1N47 A;  3MFA A;  4D0Q A;  1U12 A;  3WG3 A;  3BTZ A;  4Z2A A;  3KHC A;  1HB4 A;  4WM8 B;  4A6S A;  5D1I A;  5A7O A;  1BQP A;  1OT5 A;  5FUN A;  2RS1 1;  4NIA A;  3GHM A;  3VZL A;  4BU2 A;  1F5F A;  3AKS A;  3IAP A;  1XPW A;  3WQ0 A;  1PVC 2;  1SG3 A;  1QU0 A;  5L19 A;  3K3N A;  2GC3 A;  1OA2 A;  5FYC A;  1LU2 A;  4DIQ A;  4NO4 A;  3VKM A;  3VKL A;  4A7K A;  1PO2 1;  1UU6 A;  3J4U H;  1E5S A;  1W9F A;  3OY8 A;  5FJH A;  5JSP A;  3T0D A;  4BK5 A;  1J3Q A;  2YFU A;  4QPG A;  5K4L A;  1TMF 2;  3RGB A;  3PUR A;  5DG2 A;  1W6M B;  4HVO A;  3GZU C;  1VAL A;  2ARA A;  1OOP A;  2XML A;  3KVB A;  1UKG A;  4XET A;  3VB9 A;  4AI8 A;  1F31 A;  4CRQ A;  2JDM A;  1AYN 1;  2YMZ A;  2G19 A;  1W39 A;  5FPL A;  1FYU A;  1C28 A;  4XAC A;  5BNQ A;  2DF7 A;  1JI6 A;  5ABJ A;  5JIU A;  2ZEZ A;  4ATE A;  3U78 A;  3K4Z A;  3LPF A;  2YC2 A;  1CQ9 A;  3N7M A;  4OI2 A;  5A6Q A;  2QQP A;  1O3T A;  4LKF A;  2F17 A;  2DCY A;  4OHW A;  1KQR A;  2PAK A;  3ZN6 B;  4M3C E;  3C8X A;  4ZZ5 A;  4K9S A;  5C8C B;  3ZFG C;  1ND3 A;  1LGC A;  5KXE A;  3N3H A;  2R49 A;  2WYS A;  3T2O A;  1FXZ A;  4BDV B;  5FYB A;  2XJS A;  2BNN A;  5CFD C;  4F3J A;  1UXX X;  4KMQ A;  5FTT C;  5FMB A;  3LKJ A;  3ABZ A;  1OF4 A;  1Y3T A;  3NAP C;  3QLQ A;  5DAB A;  4DMI A;  1YFX A;  1UL9 A;  5A3U A;  4MH0 E;  5DDJ 1;  3E5X A;  5DZE A;  1VRH 3;  2IUW A;  4MX3 A;  1OLQ A;  1W04 A;  4MVT A;  2WSU A;  3QD6 A;  1N3P A;  1RHI 3;  3DYO A;  3TEX A;  5IVE A;  3JB8 A;  3HR9 A;  3OSD A;  3RMY A;  1K5M B;  1OUR A;  4FCA A;  4OZO A;  1LOA A;  3V64 A;  1F9K A;  1LHV A;  4B1M A;  1U5Y A;  4XPV A;  1B35 A;  3L2Y A;  4B4P A;  3LE0 A;  4Y4Y A;  1WCS A;  4JDO A;  4AW7 A;  1POV 0;  5FMO S;  4BXS V;  3KV6 A;  5LZ6 A;  3AZX A;  2RS3 3;  5JDB A;  2Y6L A;  3NW4 A;  3ETQ A;  3HQU A;  4I02 A;  3ZOI A;  2B45 X;  4PI0 A;  2XBO 2;  1O3S A;  5FPU A;  1AL2 1;  1W6P A;  1E5I A;  1UMH A;  4NID A;  4UW6 A;  1RJ8 A;  2BGO A;  2PQQ A;  3BPS A;  4KU7 A;  2OS2 A;  1NLQ A;  3G7D A;  1M06 G;  3KLS A;  4YM2 A;  4RHV 2;  1H1A A;  4Q4Y 2;  1JYV A;  1RUG 2;  2ERF A;  3ZXG A;  2RVA A;  3MF9 A;  3ZX7 A;  3UJQ A;  1NXM A;  2QQJ A;  4ASL A;  2K9Z A;  2VMH A;  3RWK X;  4AXO A;  4NHK A;  3T0A A;  1Y43 B;  2HWE 3;  1DG6 A;  2K0G A;  5A33 B;  3H8R A;  1JYX A;  2HWC 3;  3DN7 A;  4NOT A;  1Q8P A;  3ZPO A;  4WVZ A;  3KV5 A;  3LIG A;  4HK8 A;  4XIK A;  1X9T A;  4FQZ A;  1HJF A;  3GZT B;  5F32 A;  2YC4 A;  1COV 3;  3A4U A;  4XBL A;  4YW7 A;  4M0H A;  1W90 A;  4YPJ A;  1NLS A;  3BAL A;  1W0N A;  4M3C A;  2NMN A;  1AR9 3;  1JW6 A;  2MEV 2;  2XJV A;  2BDR A;  5LB6 A;  3ZSE A;  4E4H A;  3VDD B;  2JKB A;  5A80 A;  2OPK A;  2VZQ A;  5A6Y A;  4BPZ A;  2BEO A;  2XBO 1;  1YYN A;  2IVI B;  1VBD 1;  4ZZ8 A;  2OII A;  2ZA9 A;  1LOD A;  1OH3 A;  3KD4 A;  5LA9 A;  1D4M 3;  1LHN A;  1ND2 C;  4J1W A;  2WO3 A;  1MEC 3;  2ZGU A;  3OPW A;  3B3Q E;  4GB3 3;  2I2S A;  3HJR A;  1JHN A;  4RHV 1;  3IBM A;  4Q4Y 1;  3RJ2 X;  2NN8 A;  3OF1 A;  2B46 X;  3OG2 A;  1G9A A;  2XPJ A;  5CNA A;  4GWJ A;  1W05 A;  2E6V A;  5EJZ B;  4IND A;  1NLR A;  1GZ9 A;  2WNU C;  1STM A;  1BVV A;  1HB1 A;  2DTY A;  5CEH A;  2WNO A;  1QHD A;  3RSJ A;  1KS5 A;  1QMJ A;  3DL3 A;  3VBU C;  3ZFE A;  4YM0 A;  1NX9 A;  4ASK A;  5LY2 A;  2QQI A;  3LCP A;  2D6K A;  1DYK A;  1DCS A;  3I2K A;  3RYR A;  4Y33 A;  3N9P A;  5F8P A;  1KXG A;  4PLO A;  1POQ A;  1AR6 3;  1X33 A;  1ULD A;  5LAT A;  2QQW A;  3FLR A;  1DQ1 A;  2C4X A;  4BQW A;  4B29 A;  4CCK A;  1KGY A;  3HMY A;  3LDK A;  2CWS A;  1NT0 A;  2E7T A;  2GC2 A;  4RQP C;  3ON7 A;  3UGF A;  3ZYG A;  2FDK A;  1K12 A;  2PXJ A;  3TEW A;  4NPR A;  1UPI A;  1HJG A;  2EVX A;  1NA1 A;  2JJ6 A;  2DU0 A;  2W1W A;  1C8N A;  1LKN A;  3M70 A;  5C3P A;  1W6O A;  5B4X A;  1VP6 A;  4D6S A;  4CU7 A;  5FZO B;  1JOP A;  2RS1 3;  2XQX A;  2QQU A;  4NMI A;  3D3A A;  2YB7 A;  3A22 A;  3Q8F A;  4RR3 A;  3FUQ A;  1H9W A;  5FYS A;  5EYX A;  3PU3 A;  1G86 A;  1WCD J;  1UXZ A;  2FQP A;  3S5A A;  3KF5 A;  2AGS A;  5FZC A;  3NNJ A;  1PO2 3;  5JXG A;  1REF A;  4A3X A;  1FOD 1;  4UAP A;  2RDS A;  2E53 A;  4QX0 A;  2ORZ A;  3WP4 A;  5GJ6 A;  2Q8O A;  4XFA A;  1D7P M;  3I2I A;  3KT7 A;  3LDB A;  1N1S A;  3VBU B;  1AYN 3;  2ZGT A;  2W5F A;  2TUN A;  5I93 A;  3III A;  4OI4 A;  4Q4X 2;  2A1X A;  3C7O A;  3OY8 B;  5FMC A;  4XDO A;  1OI6 A;  2YU1 A;  4OCT A;  4QPG B;  1MR5 A;  3PTY A;  1PM4 A;  5ANN A;  1OOP B;  3ME2 A;  2VCB A;  3CDZ B;  1OPM A;  5IVY A;  4KWJ A;  3MF6 A;  4D6R A;  5HCF A;  5JZG A;  2VR4 A;  2V72 A;  1HB3 A;  1Z7S 1;  3ZSM A;  5ABJ B;  3OUH A;  5IAX A;  5DAW A;  5I0S A;  4H14 A;  4A4A A;  1UY4 A;  1XSQ A;  1CZT A;  5KR7 A;  4OZX A;  3WDY A;  1W2O A;  2ARE A;  4HSJ A;  3GZE A;  2C9A A;  3S30 A;  1ND3 B;  2BP6 A;  3MBW A;  4D3W A;  1S0E A;  4X6R B;  2QQL A;  4NRM A;  3MZH A;  5DDJ 3;  5CIS A;  2ARB A;  1AL0 G;  4O7X A;  5DAP A;  3THD A;  5DAV A;  2B7Y A;  4N53 A;  1F5J A;  3H7J A;  2Q1Z B;  4IQP A;  4DEQ A;  5C3Q A;  3MIB A;  1X36 A;  4KG0 A;  1T2X A;  3DPR C;  4Q4X 1;  1FNZ A;  1LHO A;  1FMD 1;  1FI2 A;  1GIC A;  1RUI 2;  1T6B X;  4YLZ A;  3TN9 2;  3FBY A;  4JGZ A;  1SCR A;  3W21 A;  1JYN A;  4CE8 A;  2GNT A;  1J83 A;  1HV0 A;  2RJL A;  5FWJ A;  5HPO A;  3M3Q A;  4XUO A;  4XEZ A;  3VBO A;  4C1X A;  2VVE A;  1JZ4 A;  2DVF A;  3LA7 A;  1B35 B;  3HWJ A;  5FO8 B;  4HBN A;  3ACG A;  3E1F 1;  1AL2 3;  4Q0S A;  1QJZ A;  5J1X A;  4FFG A;  2NZ9 A;  2ARX A;  4LOT A;  1Q5O A;  5C5T A;  2ZMN A;  5E88 A;  1Z78 A;  4NHM A;  4YW1 A;  1G9F A;  2UYB A;  3GXU A;  5FZ9 A;  1V6I A;  1S55 A;  1Q8O A;  1W6P B;  3GBW A;  4XFF A;  3CKH A;  4XFB A;  4XAA A;  3T09 A;  4TLF A;  5FY1 A;  3AVR A;  5D21 A;  3GCW A;  5T3N A;  3RI8 A;  3PJY A;  3F95 A;  3KV4 A;  4DUV A;  5A3P A;  1RUN A;  5I0D A;  4FPF A;  4RA0 A;  4RGA A;  4XCB A;  5JSR A;  5CA6 A;  2EXJ A;  2R04 2;  1WME A;  2W39 A;  3ACH A;  3D0J A;  3MIH A;  1BK1 A;  4NHX A;  4Z92 B;  1S2E A;  4WZC A;  1SPP B;  2Z79 A;  1OLR A;  1IKP A;  1KDM A;  1UY0 A;  4AZZ A;  2JIC A;  4BH9 A;  4FPO B;  3PVN A;  4V2V A;  3OBA A;  2NMO A;  4QQ2 A;  3H7Y A;  1G9B A;  3VBF C;  3WP6 A;  5F1R A;  1ZZ8 A;  2P3Y A;  3I7D A;  5JR7 B;  4AI2 A;  1O3R A;  1UX6 A;  3KM5 A;  5FYV A;  2XBO 3;  4Q29 A;  3WIN E;  1NZI A;  3ILF A;  1VBD 3;  4KI5 M;  3UL2 A;  3PHM A;  4WVV A;  2Q1F A;  2R32 A;  2VTX A;  4WM7 A;  2P5B A;  4C8D A;  4AI0 A;  3B01 A;  3VDA A;  2XWJ B;  2Y0O A;  3I2F A;  2VMD A;  2KR2 A;  4RHV 3;  4Q8L A;  3PUS A;  4Q4Y 3;  3WDT A;  4FSJ A;  4ARX A;  2DVG A;  1OA3 A;  3V0A A;  4OQ8 A;  2DWR A;  1G6N A;  3A0N A;  1C5I A;  4ZXK A;  2BV4 A;  1HV1 A;  5FPV A;  2ZGS A;  4CP1 A;  5F2W A;  1JBC A;  2R7E B;  2WS9 1;  3WDX A;  2JG8 A;  1DYP A;  5FY7 A;  4AVS A;  2E7Q A;  4I09 A;  2XDV A;  3MW3 A;  1UCX A;  1CPN A;  2R04 1;  2Y0I A;  2W1Q A;  5DAX A;  2FD8 A;  3PIJ A;  1H0B A;  2BGP A;  2MNG A;  1QXP A;  4NJ4 A;  3DXT A;  4ZU7 A;  1VBC 2;  3PVE A;  4LKS A;  4JHT A;  1W9Y A;  4K1Y A;  4Q1P A;  1VAM A;  2CAU A;  1O59 A;  2OZ6 A;  2E26 A;  3MI8 A;  4KG8 A;  4UBG A;  4QDS A;  2RS5 2;  4ZY9 A;  3A21 A;  4P9J A;  4Q0U A;  2RDQ A;  2WQ8 A;  1EAH 2;  4WVM A;  1O8S A;  3RMX A;  5FZA A;  1AXZ A;  2W1U A;  2X8K A;  1YJK A;  1WCU A;  1IS6 A;  1KS4 A;  2BUK A;  2QZ2 A;  4OUL A;  5FYM A;  3VHN A;  4AF9 A;  4ERO A;  4PIZ A;  5LW9 A;  2QKD A;  3LF7 A;  4Z07 A;  2VJX A;  4CDW C;  2QQM A;  3HQR A;  5C3O A;  1US2 A;  5ACA 1;  4KWU A;  3RQ0 A;  3VBH A;  2RE9 A;  1H2L A;  4URA A;  1W8T A;  2Q30 A;  1NA1 B;  4L8Q A;  3W5M A;  2P2K A;  1O4Z A;  4LO7 A;  1UU4 A;  1H6Y A;  2ZGO A;  2Z2S B;  1U0A A;  3I3E A;  3TNQ A;  2I45 A;  4JGY A;  1SZB A;  2ES3 A;  2VUD A;  4UYB A;  1CD3 G;  1JU3 A;  3SCG A;  2RDR A;  3AK0 A;  5L7O C;  1F8V A;  1FOD 3;  5CKN A;  3SEE A;  4RR3 B;  1QOO A;  4W6X A;  4DPN A;  1FPN 2;  3RJR A;  4AK3 A;  4ES9 A;  5GZF A;  1S2B A;  2KA3 A;  3HIF A;  5A7W A;  2BJS A;  3Q8B A;  5IFP A;  1CIY A;  1RUF 2;  2ZX3 A;  4LA3 A;  5C3S A;  2IWG B;  2BOJ A;  4CUC A;  1EAH 1;  3O1O A;  2RMU 2;  2WQZ C;  2BBA A;  2L9L A;  4CUB A;  4QHO A;  1MZ5 A;  5CAD A;  4QXB A;  3AP6 A;  5AVP A;  4CUG A;  5E8A A;  1F15 A;  3B00 A;  3AZW A;  5IVJ A;  1AX2 A;  1ACC A;  2FDJ A;  2GZW A;  4FOV A;  4K40 A;  4XHX A;  3SC7 X;  3NNM A;  4QU1 A;  1IHM A;  1Z7S 3;  2GME A;  3ZN4 A;  2TEP A;  3HAG A;  2QUO A;  1VE0 A;  3GDB A;  4NWW A;  3RFR A;  4C1W A;  2PN5 A;  2VG9 A;  2GNB A;  3DXU A;  1DZQ A;  4FOY A;  5JZG B;  1XE0 A;  3DEM A;  4HSL A;  4XZU G;  4BQY A;  2WN3 A;  4W50 A;  4CEY C;  2W52 A;  1F35 A;  4I2O A;  3T2P A;  3ZXD A;  2NYY A;  1VMF A;  4UF0 A;  1WCK A;  1I6X A;  1NCQ A;  2R30 A;  2LAL A;  4UT5 A;  4N43 A;  3ZDV A;  5FP8 A;  5FZE A;  3R4D B;  4P5Y A;  4FPG A;  3OEB A;  4P9X A;  4A42 A;  2VOK A;  1OXC A;  1WLC A;  2QTW B;  4C90 A;  4Q4X 3;  3SXW A;  1FMD 3;  4NN0 A;  1JU4 A;  5EJ3 A;  4E2G A;  1O91 A;  1QQP 2;  3W59 A;  2EIE A;  4GJZ A;  4EJR A;  2BPA 2;  4N53 B;  3KB5 A;  1AR8 2;  1EP0 A;  2D6M A;  4Q27 A;  4DXZ A;  4EWA A;  5C70 A;  1ZA4 A;  4IV1 B;  5C3R A;  2VZ1 A;  4AG4 A;  4CUA A;  5FUI A;  1NCR A;  5BNO C;  2PLV 2;  1K5J A;  4J1X A;  1AHS A;  4CCL A;  1PGW 2;  4RFT 0;  5K0U A;  2VMG A;  4JGZ B;  2XOM A;  1OUS A;  1W03 A;  3GGL A;  5T5L A;  4XQW A;  4XUQ A;  1MPX A;  3FHA A;  3FLT A;  1W8F A;  4IE6 A;  4PDW C;  5TSW A;  1UOF A;  2W87 A;  3NJZ A;  4CTE A;  4JQR A;  5J3U A;  1LOC A;  2WC2 A;  3VBO B;  4CDX C;  2WO7 A;  1WMD A;  3K48 A;  5T52 A;  3B02 A;  4DZG A;  2ZAA A;  1A34 A;  4WM8 A;  2VOW A;  2VUL A;  4IE0 A;  5FXX A;  5C8W A;  4QAW A;  5L9B A;  3UKV A;  3ZYF A;  2ZHK A;  3AMQ A;  4YGE A;  3O1T A;  4YVW C;  3WNP A;  1SBE A;  1GBG A;  4S2G A;  2JEM A;  2AYH A;  5J98 B;  3WQ1 A;  4CDU C;  4URT A;  3QCW A;  4AOC A;  4JTN A;  1LTE A;  2DFB A;  4GXL A;  1FAY A;  5T5J A;  1ZYB A;  2OPW A;  3LWC A;  1UMI A;  5FBJ A;  4E9K A;  2GN7 A;  1QQP 1;  3N35 A;  1C1F A;  4TLG A;  5DZF A;  2C1F A;  1JZ5 A;  4TTG A;  1AR8 1;  4GIQ A;  1SLC A;  4NAO A;  2PFW A;  2WNV C;  5EPA A;  3LDR A;  4EYU A;  3WCS A;  3OPZ A;  2PLV 1;  4PQQ A;  3WNL A;  3ZSJ A;  2O1Q A;  3THC A;  3T08 A;  2ZAC A;  3HNY M;  5F5I A;  3VBS C;  2YDE A;  3BIE A;  2J1E A;  5FRE A;  2X5I C;  5F39 A;  1SEF A;  5FFO C;  4BQ3 A;  4C91 A;  3DF0 A;  2C9K A;  3RI9 A;  3GHN A;  5IHR A;  1W8U A;  2W47 A;  3ZN6 A;  4P9G A;  5APA A;  4KWL A;  2ZBJ A;  2FMD A;  3EJK A;  3JU9 A;  1GMM A;  3I8T A;  1RIN A;  4WM7 B;  2WS9 3;  2Z4F A;  4GD4 A;  1YQ8 A;  1LES A;  3M2M A;  4NII A;  1DGR A;  3I3Q A;  2UUR A;  4JRA A;  1W99 A;  1WLD A;  2DVB A;  2WLQ A;  3K2O A;  3UES A;  5BNN A;  4QXK A;  4YFZ A;  3V0A B;  2VMF A;  3MPP G;  5A7S A;  2R04 3;  3FJS A;  3G6J B;  4FP2 A;  2XB6 C;  4W4Z A;  4D7T A;  2JG8 B;  2E9Q A;  4Y1V A;  2ARC A;  4IV3 C;  4M3C F;  1QKQ A;  5C4W C;  1H8T A;  1YEW A;  5FO9 B;  2WRA A;  5IT6 A;  3I2G A;  1SLT A;  5LBB A;  1PK6 A;  3RRD A;  4MET A;  2XR4 A;  3AB0 A;  1ALY A;  1RIR A;  4QKF A;  2MHF A;  5HXM A;  4NRQ A;  4IGO A;  4XHB A;  4XAB A;  1YFU A;  1YXW A;  2VZR A;  4LBJ A;  2IFR A;  1A3K A;  1Y9G A;  5IK8 A;  1GWL A;  2G9F A;  4X8P A;  2K46 A;  2WZR 1;  3S7I A;  3OUI A;  5ACA 3;  2CTV A;  3BTX A;  2Q0A A;  2VQU A;  4JDN A;  4ZXE A;  2ZJC A;  2BWA A;  3CJI A;  4LTA A;  3UKT A;  3URF A;  3PLQ A;  3CMG A;  2SBA A;  3JD7 2;  5A7P A;  4XFG A;  5FOB B;  2RS3 1;  3VBH B;  3FHI B;  4AGV A;  3I2J A;  2AAC A;  3AP7 A;  3GF6 A;  4F8A A;  2PEL A;  3JBG 1;  5FLI A;  2UWB A;  4XQ4 A;  2D40 A;  2R07 2;  5CYY A;  3KT1 A;  3LQC A;  4JGY B;  2JG9 B;  5A33 A;  2VZU A;  3VL8 A;  1TZO A;  4ORF A;  3MLJ A;  5F6L B;  1F4H A;  5F5Q A;  1YC6 1;  1DZT A;  1EAH 3;  3LEG A;  2I74 A;  2Y6G A;  2GC0 A;  2B4K A;  1OFS A;  2D93 A;  4XJW A;  4BLJ A;  2CDO A;  5A7W B;  5IK5 A;  5CFC C;  1OKO A;  4EN8 B;  4FFF A;  1MZE A;  4YNI A;  2PHW A;  4PCR A;  3C7F A;  1QIQ A;  3W20 A;  3I4I A;  3S6P A;  2ZX0 A;  3I3M A;  2KXL A;  3VDD A;  2HJI A;  1UYP A;  1RXG A;  3LZZ A;  3POF A;  1GKB A;  3NV4 A;  3PUI A;  1DQ2 A;  4L97 A;  4EZH A;  3FE5 A;  1C5H A;  3NO8 A;  1WD3 A;  3U37 A;  4QPW A;  3AZZ A;  5FK8 A;  3ZYB A;  3OBT A;  1ULP A;  3OEA A;  4QU2 A;  1OUX A;  2UWA A;  4IE5 A;  5F3E A;  4AGG A;  5FY5 A;  1VBB 2;  2R07 1;  4RN5 A;  4YZ2 A;  1Q8S A;  5J37 A;  1XU1 A;  3ILN A;  2ZPX A;  4K1Z A;  2ZGP A;  3NAP A;  1OF3 A;  4FPE A;  2CYF A;  1QF3 A;  2HWF 1;  1NCQ B;  3VBR A;  4BYY A;  1CON A;  1PIV 2;  3KQ4 B;  4QXC A;  3SMH A;  4EN7 B;  4N43 B;  3JZV A;  4EWE A;  5GZE A;  4YW3 A;  4KU8 A;  1RXF A;  3CO2 A;  5FYI A;  2R0H A;  1ZBE 1;  2ATF A;  3LA3 A;  2FMY A;  1HX6 A;  3NV1 A;  4YRD A;  1RUC 2;  4K3U A;  3AC0 A;  4DUW A;  2CGP A;  2QBX A;  2V4V A;  3AKP A;  2XJR A;  1CES A;  1NY7 1;  4XJA A;  4N8M A;  4OUS A;  5HCH A;  3HT2 A;  1KDK A;  3PUH A;  4FOW A;  1FX5 A;  4CEW C;  1HIX A;  4MGK E;  3SIT A;  4HMZ A;  1KJL A;  5I8S A;  1NCR B;  2IFW A;  2ZAB A;  5FMD A;  1GV9 A;  4QQL A;  3AMM A;  3WZ1 A;  1RB8 G;  2VO5 A;  3EQE A;  4AED A;  2B9U A;  2VOX A;  3ZXJ A;  1VBB 1;  4CXY A;  1Q3E A;  5JOY A;  3VLB B;  5H9R A;  2DBN A;  4HZF A;  4YG0 A;  5FZ0 A;  1AVB A;  5F2S A;  1UZY A;  3K75 B;  3AXD A;  4IEX A;  4BXF A;  1QQP 3;  2RJ2 A;  4XUT A;  2WO2 A;  3CL1 A;  1AR8 3;  4RFR B;  4RS5 C;  1ODN A;  1YNA A;  5A1F A;  3KCX A;  2NLR A;  3ZR5 A;  1IS5 A;  2GDF A;  5FZH A;  1APN A;  3FHQ A;  1ULC A;  4Q0Q A;  3AKQ A;  1RUC 1;  3BIW E;  2PLV 3;  1HRI 2;  5FY0 A;  3TRS B;  3V56 A;  3DEC A;  4C0B A;  2CAV A;  4FTS A;  4O61 A;  4QXH A;  3MV0 1;  4UFK A;  1ONA A;  1VAK A;  2FCT A;  4LOR A;  3MHZ A;  1XQN A;  1ZZ7 A;  1W8N A;  2AH2 A;  1EUU A;  3WEZ A;  3ATG A;  5IVV A;  4Q4V 2;  3O14 A;  5LA0 A;  3R05 A;  4MXW A;  4AFB A;  1RVF 2;  3J7M A;  4BIF A;  1V6O A;  1PNF A;  4TXW A;  2JDH A;  2VXR A;  5ERL A;  3WF4 A;  2WKK A;  3MW4 A;  1ND2 A;  1UY1 A;  2E51 A;  1D0H A;  4GKX A;  4Y24 A;  2NPI A;  3FLP A;  4HN1 A;  4B7K A;  2P3K A;  5C6C A;  4COW A;  4NRO A;  4UOJ A;  3S0M A;  3MIF A;  2CNA A;  5FYH A;  1GSL A;  2JDP A;  5AFB A;  3NL1 A;  5FZM A;  1X8M A;  4JCK A;  3OJB A;  3M4F A;  3ZFF B;  2XJU A;  3LD8 A;  3HBK A;  5FZ6 A;  1PVC 1;  5BNN B;  1CR7 A;  1ULE A;  1F4A A;  2A7A A;  4K8R B;  4LMF A;  1V9U 2;  2EF6 A;  3TNP B;  2AEY A;  1ASJ 2;  1HRI 1;  3WF2 A;  1J84 A;  2GNM A;  1H9P A;  1PMI A;  3L2H A;  3U11 A;  4XUR A;  5K9Y A;  1W3V A;  2JD4 A;  1IPS A;  4FXK B;  4B8E A;  2YRO A;  1TMF 1;  1H8T B;  4P02 B;  4LUM A;  1QJY 2;  4TYS A;  3WW3 A;  3HD8 B;  4KBB A;  2WZR 3;  4Q4V 1;  4NR1 A;  1GZC A;  1PK6 B;  1O5L A;  1RVF 1;  4QM8 A;  4XFC A;  3JUU A;  3H0O A;  3WG1 A;  3ZXK A;  1FV3 A;  2D97 A;  2XON A;  4FPC A;  4LIT A;  1YI9 A;  2IXK A;  3MID A;  5EYY A;  2AEZ A;  4DS0 A;  1HXS 2;  2WII B;  2YUE A;  4ES8 A;  4AQ6 A;  1BYH A;  3VDC A;  1IG0 A;  1Z0H A;  2Y33 A;  1ZBA 2;  2VNG A;  4CXX A;  3LA2 A;  5IVB A;  2VBD A;  3HPN A;  2J22 A;  2VBP A;  3MFC A;  2VZS A;  3CJI B;  3JBG 3;  4XZP A;  5FZB A;  1QJU 2;  3O1V A;  4YW2 A;  1IS4 A;  1LEC A;  1J58 A;  2FDF A;  2P34 A;  2XQR A;  2D5F A;  1WKY A;  1KFX L;  3B69 A;  4XIO A;  2JXA A;  5F5C A;  2GH8 A;  4LKD A;  3O1R A;  1LGN A;  1E57 A;  3THP A;  1SPP A;  2BVV A;  1UIJ A;  2EXK A;  1URX A;  1WWY A;  3KHB A;  3N9N A;  3EB7 A;  2W95 A;  4E4D X;  1A8D A;  2O8O A;  3SLI A;  2OZJ A;  2VBB A;  4DQA A;  1W8H A;  1QGL A;  1S0D A;  3NJV A;  4AFC A;  4KGG A;  3ASI A;  5C33 A;  1PGL 2;  1QDC A;  4HET A;  5KWR A;  3NV2 A;  1ZBA 1;  4P5H A;  5FRA A;  2JB8 A;  2HBU A;  2YXS A;  1VAV A;  5H9S A;  1CPM A;  1AX1 A;  1XNA A;  3CF6 E;  2YBP A;  3I54 A;  4AVA A;  3ETP A;  2ZGR A;  2H6C A;  4AEJ A;  4UFH A;  3H1M A;  1GQP A;  4QB6 A;  1YWK A;  2JD9 A;  2DFC A;  2R07 3;  5DMY A;  1DQ6 A;  5LA2 A;  5I0R A;  1AXK A;  3IIA A;  4OMD A;  2TBV A;  3NJX A;  4BE3 A;  3ZXE A;  4BQ5 A;  4IER A;  3R0R A;  3WSO A;  1EV1 2;  2HWF 3;  1G9D A;  3POB A;  1WGP A;  1RUG 1;  3SCH A;  3RS6 A;  2A3W A;  5E16 A;  4IE4 A;  5FPB A;  5JXJ A;  3SH4 A;  3KS7 A;  4CP2 A;  1ULF A;  2E63 A;  3LEI A;  1V6L A;  2XUE A;  2ADD A;  4HKO A;  4HT1 T;  3NAP B;  5IWF A;  4MGQ A;  4A7Y A;  1ZBE 3;  3SHR A;  3VBR B;  3DPR A;  4Y3O A;  3KZ4 C;  4DOU A;  1VPH A;  2B42 B;  5ABJ C;  5KHJ A;  3UK9 A;  1C1L A;  3GAL A;  4O65 A;  1OC1 A;  1S0F A;  4JAA A;  1YLL A;  1W6N A;  2MEV 1;  2IXJ A;  1OQ1 A;  3AYD A;  4ET7 A;  4Q1R A;  4YW5 A;  5K7P A;  3SNM A;  2C26 A;  3A7Q A;  2ZX4 A;  2BOI A;  1IKQ A;  2FZ1 A;  4AYU A;  2VY0 A;  2WN2 A;  2P3I A;  1H2M A;  1MZF A;  1VBB 3;  3OCP A;  4LUK A;  4F83 A;  1TEI A;  5GLW A;  2VZT A;  1WLW A;  2WDB A;  3D6E A;  3GBF A;  4Q4W 2;  1EV1 1;  2WWS A;  5LRS A;  1XB9 A;  3BOW A;  4AED B;  3WNN A;  5F7U A;  3PME A;  1HN1 A;  5CIR A;  4XDQ A;  1JMU B;  3R4S A;  2VUC A;  3E6D A;  4U2A A;  1MS5 A;  3PJQ A;  1UOG A;  5FY9 A;  4BMB A;  1HRV 2;  2Y6J A;  4FFI A;  1JYC A;  1WA4 A;  1RUC 3;  4H7L A;  1MQT C;  4Y4R A;  1B35 C;  4D6Q A;  4OHV A;  4ZPI A;  1IOA A;  1P8J A;  3ZMO A;  2O0O A;  5BUV A;  2YG0 A;  1R1A 2;  3CQO A;  4LOS A;  1SLL A;  2F4P A;  3MGU A;  3JQW A;  1SLB A;  1EY2 A;  1W6Q A;  2EXI A;  4JKL A;  1WMF A;  4YGC A;  3AYA A;  3CBN A;  5FV3 A;  1DQ0 A;  1DGW X;  4AHZ A;  5JOZ A;  4IUG A;  3T4H B;  2UY8 A;  4JTO A;  1W28 A;  4MXW B;  4D7S A;  2YU2 A;  4IEU A;  3M1H A;  4QHB A;  2W1S A;  3POW A;  1CX1 A;  1WA6 X;  2WR9 A;  4LXL A;  4YVS C;  4J25 A;  2ZAH A;  4AFD A;  2DTW A;  3AX4 A;  4Q0P A;  1ND2 B;  4FPL A;  1PVC 3;  3RVH A;  3WNO A;  1ZM1 A;  5I8Y A;  3RZG A;  5FXZ A;  1N3O A;  2FCV A;  1L7L A;  3RYP A;  1SLA A;  2LRO A;  4B7E A;  1HRI 3;  2A71 A;  3ZYP A;  5IFT A;  4PBP A;  5DZG A;  1QOS A;  4YWA A;  2B5H A;  3H8O A;  2WAB A;  4YG6 A;  3U4X A;  1G7Y A;  1TMF 3;  4OVE A;  2QDR A;  5LBE A;  5IK7 A;  3FN9 A;  3WR0 A;  2XHN A;  3PL0 A;  3TAY A;  3RWN A;  3GJA A;  4Q4V 3;  5A3W A;  1GWK A;  1Y9Q A;  2A6V A;  1TNF A;  1M4W A;  1G8W A;  1ZA7 A;  2QQO A;  1RUJ 2;  1RVF 3;  2ZEY A;  4FO9 A;  4IV1 A;  4M0N A;  4W6W A;  3OGR A;  5AC9 2;  1CAV B;  1W9W A;  5IVC A;  2VOT A;  4KBZ A;  5FAX A;  3ZKY A;  4AL9 A;  1WMX A;  4BLI A;  5EQU A;  4CCO A;  2BGC A;  2ZX2 A;  5DUW A;  1S0B A;  5JIA A;  2WYF A;  2GAU A;  1FV2 A;  3E97 A;  1GYK A;  2BVB A;  3AZY A;  2J1A A;  3MYX A;  4OHX A;  5J48 A;  1JOB A;  2YPJ A;  3O7O A;  1OD3 A;  1XC6 A;  1ZNP A;  3NNL A;  4XMA A;  3VD7 A;  3WT3 A;  2G1M A;  4QX3 A;  1QJX 2;  1UW8 A;  3ZFE C;  3WXP A;  5BY5 A;  4Q8K A;  4GWM A;  4M01 A;  5CKQ A;  4UFM A;  5GLZ A;  4AFA A;  3WHT A;  2QNK A;  3UT0 A;  4P9L A;  1VR3 A;  2YV8 A;  3POY A;  4HKW A;  1ZX5 A;  2CY6 A;  1VIW B;  1PGS A;  2XKO A;  3O1S A;  2BER A;  2XKP A;  4FVV A;  5H9P A;  2LW8 A;  5FBZ A;  1RUJ 1;  4LBL A;  3WUD A;  4COU A;  5A3L A;  1Q56 A;  5AC9 1;  2VQ0 A;  1V0A A;  2ET7 A;  1RUI 1;  5IAV A;  1IQD C;  2OX0 A;  2R1D A;  3LEK A;  3TN9 1;  1BKZ A;  1DZR A;  1QXR A;  2R16 A;  5I91 A;  2GN3 A;  4YSF A;  3U4S A;  4I30 A;  1Q43 A;  1J1L A;  4JVA A;  1MS3 A;  3LFM A;  5AVA A;  2XLA A;  1PX3 A;  1ZBA 3;  3K4D A;  2HH9 A;  1D2Q A;  4FTE A;  4GH4 C;  1BLZ A;  5GKA C;  1X9P A;  3BYW A;  3EO6 A;  3RG0 A;  4A41 A;  3ES1 A;  1UMZ A;  4L99 A;  1ENR A;  3AP4 A;  5BNP C;  1RUG 3;  3SIS A;  4CA9 A;  2DUP A;  1UAI A;  2Y64 A;  1V00 A;  4QGM A;  3A23 A;  3TWI A;  3OGV A;  4SLI A;  5JOW A;  3KSC A;  2OUJ A;  4LA2 A;  3Q8C A;  3CZJ A;  1WD4 A;  4ZS2 A;  5CG9 A;  2EAA A;  2UYA A;  3ZIX A;  4PJY A;  5IVF A;  3O1M A;  2YFZ A;  3MV1 1;  1K45 A;  3E6B A;  4BOW A;  4YZ5 A;  5LA1 A;  1QH7 A;  3ZO0 B;  2IXL A;  2OT7 A;  3ES4 A;  4IEW A;  1G9C A;  4NWV A;  2P6H A;  3NWK A;  2AEN A;  1JN2 P;  2VZ3 A;  4S2F A;  5DUX A;  3BCW A;  4QX1 A;  4FPH A;  2MEV 3;  3KCY A;  4FP3 A;  4JC1 A;  5LK5 A;  3DPR B;  5JWP A;  5HI0 A;  5LK7 B;  1W3X A;  1LUL A;  4QWN A;  4MXV A;  4AWD A;  5BNO A;  4QPI C;  4LIV A;  1H1M A;  1XSR A;  4OHY A;  4R9A A;  2AUY A;  4Y1U A;  1POV 3;  1W6N B;  5FR3 A;  3GCX A;  3AKR A;  2JDK A;  4FT8 A;  3VGI A;  5FIX A;  3MIG A;  3O0W A;  4D94 A;  5J09 A;  4FQ4 A;  5EP9 A;  4AAP A;  5JMO A;  4V2W A;  1EV1 3;  1W9T A;  3NKG A;  1WW7 A;  2JDN A;  1CZS A;  1SBF A;  1IS3 A;  1CZV A;  3AP9 A;  4QX2 A;  3ZMN A;  3RZZ A;  4EQV A;  5E1R A;  3VD4 A;  1XU2 A;  3D4K A;  3PMS A;  2OKX A;  1JZ8 A;  5LEJ A;  1PHM A;  3P3N A;  1N3Q A;  5BXX A;  3ORJ A;  5LRR A;  2JG9 A;  2R1B A;  2G9Z A;  5K8S A;  1C57 A;  4CCJ A;  4LKE A;  3Q8E A;  3WD5 A;  2RHP A;  1RUE 2;  2P17 A;  3AP5 A;  4LK6 A;  4IDZ A;  5FXW A;  1VBC 1;  4AR2 A;  3HVD A;  4JHZ A;  4HAN A;  3ACI A;  1UD1 A;  3AYE A;  2WZE A;  1R08 2;  4I0B A;  3MUZ 1;  1LHU A;  4YW4 A;  3VKN A;  5DAQ A;  1JYW A;  1VLN A;  2RS5 1;  3ZM8 A;  5ISL A;  2PHR A;  5GM0 A;  4P9W A;  4EN6 B;  3EBR A;  4UFI A;  4DEV A;  4LBN A;  1RMU 2;  3UGH A;  1AF9 A;  3U07 A;  1GFF 2;  2NM1 A;  2ZKL A;  2HYX A;  3C7G A;  4B4Q A;  1IGO A;  2X5I A;  3JQX A;  5IK4 A;  3H1W A;  2ZHL A;  1W6Q B;  4GJY A;  2HWD 2;  3WF1 A;  4ZON A;  2FBE A;  1RED A;  2ZCW A;  4XE9 A;  2D6N A;  3O1U A;  3E5Q A;  1AUY A;  3B9I A;  1DQ5 A;  4P08 A;  4AQT A;  3CNA A;  1TQ5 A;  2H0B A;  5DN2 A;  3DGT A;  3J7N A;  4AVC A;  3OPT A;  1GNH A;  2XVL A;  1I5Z A;  4BB3 A;  1AR7 2;  3GJB A;  2FDG A;  4MLO A;  2FDI A;  4GMP 1;  3LIH A;  1U5X A;  4GQ7 A;  4UW5 A;  2JDU A;  1KFU L;  1V6M A;  1ENX A;  4LE4 A;  2HWB 2;  4QKN A;  5KHI A;  1B09 A;  3CLP A;  1BEV 2;  5FQ0 B;  3MO4 A;  4R9D A;  4FPY A;  4PLN A;  2J1V A;  1OH4 A;  1X7N A;  5F3C A;  2YY1 A;  5D8A A;  4NPM A;  1ZRI A;  1FPN 1;  2DU1 A;  2W3J A;  5A70 A;  4MUV A;  2RR1 2;  3AMN A;  3WW4 A;  1PMJ X;  1HLC A;  5C4W A;  3FL7 A;  1R08 1;  2Y6H A;  4IEY A;  2BFU S;  1RUF 1;  1GNZ A;  3BN6 A;  5HXV A;  3B5L B;  3Q9O A;  2RMU 1;  1LJ7 A;  1RMU 1;  1YHF A;  3EMR A;  4QPY A;  1W8O A;  4RGK A;  5A7N A;  1AJO A;  1Q8Q A;  4WM7 C;  4H3W A;  1F2N A;  4AFM A;  2V73 A;  2YBS A;  5B2G B;  5BV6 A;  3OYW B;  5JSO A;  4MOA A;  4M4P A;  5EWS A;  3FZ3 A;  5L73 A;  2XJP A;  3BUC A;  1H6X A;  4R9B A;  3OD4 A;  5CKM A;  4DNY A;  3ELN A;  4NHL A;  3ZXA C;  1VMH A;  2EAK A;  3WDW A;  1HN0 A;  3O5S A;  5DG1 A;  5C9A C;  5HV0 A;  2A6Y A;  4CSW A;  1NZC A;  3RZL A;  1UOB A;  1V6J A;  2YPD A;  1UYY A;  4CDW B;  3LPG A;  5G05 L;  2F4L A;  4DUX A;  1GU3 A;  5FDB A;  1AXY A;  1DP0 A;  1AZD A;  3FMG A;  2W46 A;  4UFL A;  3K46 A;  4I01 A;  5DXD A;  4ASM B;  4QB2 A;  4BQ4 A;  2XLF A;  3T2T A;  5KC6 A;  3BPZ A;  4WZF A;  4XBQ A;  4YZ3 A;  5FJK A;  3OGG A;  3DYP A;  4Q5O A;  5FLH A;  1YIP A;  2RR1 1;  3HT1 A;  1NXD 1;  4FXG B;  1HB2 A;  3C3V A;  1RUJ 3;  2LUW A;  1LOF C;  3NRU A;  5AC9 3;  1OLM A;  2R06 2;  1RUI 3;  3AZV A;  5F37 A;  5JUV A;  4OI1 A;  4LT5 A;  1LRH A;  3NNG A;  1TE1 B;  3KCC A;  4GAL A;  4OQ9 A;  3TN9 3;  4QDR A;  1UY2 A;  2ZGK A;  3UYJ A;  2JX9 A;  4YFW A;  3WF0 A;  5CFC A;  5T55 A;  2HYK A;  4RL7 A;  1WZX A;  1KRI A;  3QH7 A;  4Z1V A;  2DCZ A;  4S2D A;  4AI9 A;  5KXB A;  4ISR A;  2ZGQ A;  1CAX A;  2ZGN A;  4MV2 A;  3AFG A;  1PGW 1;  4IEQ A;  4K6B A;  5A3O A;  4IW3 A;  2JIJ A;  3OTF A;  1QJE A;  3ZVX A;  3IWZ A;  1UIK A;  4JGY C;  4LK7 A;  2X53 S;  3D82 A;  2Q8E A;  3AM2 A;  3K51 A;  4MG2 A;  1N1Y A;  2DBI A;  4I3P A;  4R52 A;  3LOB A;  5JVV A;  1HQW A;  5DQ0 A;  3W58 A;  5A3N A;  1XYN A;  2E32 A;  1UX7 A;  2EXH A;  4IEP A;  3ZFF A;  4YAR A;  4LHN A;  1J59 A;  2H0V A;  1AX0 A;  4HN0 A;  4PT6 A;  2A5Z A;  3RYK A;  1GOF A;  5EFU A;  2V5D A;  2Y38 A;  2YYO A;  3RPQ A;  5FP9 A;  1XND A;  2A6Z A;  5FYT A;  2R06 1;  5T5P A;  4H2A A;  2EAL A;  3EHK A;  4HXC A;  1NQD A;  3P5B A;  1IQA A;  4HL0 A;  4G9S B;  1UOJ A;  1RHI 2;  1FNY A;  2XH6 A;  5JXI A;  4QD2 A;  4EN9 B;  2PHL A;  4Y1X A;  3I2O A;  2WFP A;  2ZHM A;  4V1P A;  2W68 A;  4MO3 M;  2XJQ A;  5FPX A;  3VD9 A;  1OMI A;  2JE9 A;  4CEW A;  4HK9 A;  2BNM A;  4OMC A;  1JS9 A;  3WG2 A;  5F6K A;  3RDI A;  2CGN A;  2GP3 A;  4U36 A;  5BNO B;  1S1A A;  1NCQ C;  2LTN A;  4PF1 A;  2VQA A;  2D6O X;  2C6S A;  5FWE A;  3LGR A;  4N43 C;  2P4E A;  1MS8 A;  4CDQ A;  1W0O A;  2D5H A;  5IYY A;  2ZZJ A;  4PDW B;  4QMA A;  4FBF A;  1JXN A;  2B39 A;  2VCA A;  2Z42 A;  2VCM A;  2FCU A;  3ZKU A;  2DUQ A;  4R9C A;  4MGT A;  5FMO L;  3A0K A;  2CL2 A;  1NQJ A;  3KGL A;  5EV7 A;  1JYT A;  1H2K A;  1PVX A;  2E31 A;  4O9G A;  1NE6 A;  1OVS A;  4A45 A;  4Y1Y A;  2HWE 2;  1VBC 3;  1RIT A;  2HWC 2;  3ALQ A;  4HKL A;  4RGG A;  2GSY A;  1UYZ A;  4YYO A;  1LEM A;  2RS5 3;  2ZTN A;  1Y7B A;  1LR5 A;  4MSV A;  4PF5 A;  5T54 A;  4E4Z A;  1COV 2;  4LBQ D;  2YC0 A;  5CZK A;  5K0U C;  1O8P A;  2WLP A;  3E5U A;  2WFF 2;  5A1L A;  3B94 A;  1I3H A;  2QQN A;  2WNV B;  4Z8B A;  5IUQ A;  2HBT A;  2ZGL A;  1ZVF A;  2IVJ A;  4JQT A;  1AR9 2;  1ULO A;  2BU9 A;  4I3G A;  3GZA A;  2J1U A;  3T0B A;  4WM8 C;  1AJK A;  2JE8 A;  2VW0 A;  5FO7 B;  4AHX A;  2BBV A;  1CN1 A;  2Z5W A;  4MZU A;  4XF3 A;  2EID A;  1NG0 A;  3BGA A;  2D6L X;  2G4I A;  3VBS B;  2X5I B;  4LJH A;  4GMP 3;  1MS1 A;  1MVE A;  4CZS A;  2Q8C A;  4CU8 A;  2FDH A;  1MS0 A;  2AC1 A;  2WJS A;  3JD7 1;  4UWD A;  5L9R A;  2ADE A;  1RUD 2;  3POI A;  3ZFG A;  1IG3 A;  4AGR A;  3RNS A;  2HEW F;  5A6Z A;  3HBZ A;  3MLL A;  4JDM A;  4DFS A;  4LR4 A;  3MDP A;  5FZD A;  3WQB A;  5LY1 A;  4XTM A;  1FPN 3;  4L0P A;  3NQH A;  1PMH X;  2DCT A;  5EXO A;  3VZK A;  5CFD A;  2B9V A;  3RZM A;  1R08 3;  4XF4 A;  2J1S A;  4EZ4 A;  1RUF 3;  3OYW A;  5DUV A;  3CZU A;  3WVJ A;  4CCM A;  2RMU 3;  5KC5 A;  1RMU 3;  2WFF 1;  4QQH A;  5D8A B;  4ZKT B;  3IM0 A;  4IV3 B;  2EIC A;  1AR6 2;  5C4W B;  2VMI A;  3AFK A;  4X8N A;  1UWW A;  1GR3 A;  5FZ3 A;  4DB5 A;  1GZW A;  2P3J A;  5C8C C;  4R8H A;  3PTR B;  5LCW L;  2XG3 A;  1SFP A;  3S57 A;  5FPA A;  2H6B A;  4OFG A;  2OQ6 A;  2BRT A;  4LIU A;  4QQP A;  3X29 B;  4CVU A;  4P14 A;  5J96 B;  1YQC A;  1YRZ A;  5A3M A;  2VC9 A;  3N9L A;  4QX7 A;  4UXA A;  5CB7 A;  5BNN C;  2ILM A;  5F3I A;  1RUO A;  2RG4 A;  3NNF A;  1RUD 1;  2EIB A;  3DCQ A;  1RYY A;  1W0P A;  4XJZ A;  1WW4 A;  4IGP A;  1LGB A;  1YQ2 A;  4AHW A;  4ONU A;  5HCA A;  3POJ A;  1DDL A;  4UW3 A;  2DVD A;  2UU8 A;  2ENR A;  2RR1 3;  3IB3 A;  1W9S A;  1H8T C;  4BQ1 A;  4D69 A;  1TME 2;  1YQ6 A;  3INA A;  2VTX J;  2XLG A;  1GP5 A;  4MGZ E;  2XVK A;  2JDZ A;  4XUP A;  1NAE A;  1PK6 C;  2WT1 A;  2WQ4 A;  3UV9 A;  3P1I A;  1BVP 1;  4DY5 A;  3C7H A;  2N7G A;  3SH5 A;  1K5M C;  4DY3 A;  3ZXL A;  1PIV 1;  2B8M A;  2VME A;  2D3R A;  4GKY A;  3ROU A;  4IE7 A;  4S2H A;  5C7G A;  1S0J A;  4DO0 A;  1CJP A;  4XFH A;  3ST7 A;  3KT4 A;  1AYN 2;  2D3P A;  3WNM A;  4D7Y A;  3VZN A;  4KWK A;  1JH5 A;  1ZRF A;  2WAA A;  3CJI C;  3VKO A;  3T2Q A;  5CFC B;  1S2K A;  1D0G A;  1R64 A;  3D5O A;  2ET1 A;  2BQP A;  2CV6 A;  5GZC A;  1JZ2 A;  3WW2 A;  1PM7 A;  4ZU4 A;  4MGY E;  1CAX B;  3B7M A;  1YQ5 A;  2BZD A;  1U5Z A;  3OUJ A;  4HON A;  4JX0 A;  4TZD A;  4CU9 A;  3D0S A;  3IN9 A;  2BWC A;  3ZYR A;  2JIG A;  4B4R A;  3J26 N;  4GWN A;  1TME 1;  4FPK A;  3MUY 1;  3USS A;  5JLV A;  2WT2 A;  2D3S A;  2J1T A;  5GLU A;  1BCX A;  4AAX A;  1MZ6 A;  3WF3 A;  3NKT A;  2R06 3;  5DDJ 2;  4LUL A;  2GAL A;  1LB2 A;  2Q5T A;  5L36 A;  3VHP A;  2W9X A;  4CYD A;  3VL9 A;  2MPF A;  1OHF A;  3FX3 A;  5FZL A;  2WNU A;  1AYM 2;  2XGX A;  3PDQ A;  4BM8 A;  2K2S A;  5C71 A;  3R6S A;  3U14 A;  3VBU A;  1GLH A;  3H8U A;  4W6Y A;  5FYZ A;  2RM2 2;  2PTM A;  3VDD C;  1GQG A;  5GAL A;  1DBN A;  1R1Z A;  5FKC A;  1CAV A;  4CPB D;  4AQS A;  4NE9 A;  4HPK A;  2A75 A;  4XTP A;  3C7E A;  4E8C A;  4GWI A;  5ANQ A;  1LU1 A;  2WZP P;  1PZ7 A;  2V09 A;  4C0H A;  1DGW A;  4MAD A;  2A73 B;  2W92 A;  2IXC A;  4LBQ A;  3POS A;  4RQP A;  4XF9 A;  1AL2 2;  4CEW B;  4JRL A;  4NAM A;  3AJZ A;  4BIO A;  4F7Z A;  2PYT A;  2JWP A;  3BVC A;  4LHK A;  3ZYH A;  2GC1 A;  1QNW A;  3LAG A;  3VBR C;  5FP7 A;  2VEC A;  2Y60 A;  3AYC A;  4UW4 A;  4FOQ A;  3SQO A;  4DXT A;  4CDQ B;  4MHU A;  5FUP A;  2ZMK A;  1DIW A;  3UJO A;  1Y4W A;  2QQK A;  4LHL A;  1AYM 1;  4OYU A;  4QM9 A;  1QXJ A;  4NRP A;  5SV5 A;  3VV1 A;  3V0B B;  1V9U 1;  3N4M A;  5HBA A;  2XL7 A;  1ASJ 1;  1ZZ9 A;  1MQT A;  2RM2 1;  3WY6 A;  3DKQ A;  3KGZ A;  4XF1 A;  1A6C A;  1WBL A;  3ACF A;  1W2N A;  4RS5 B;  3FC0 A;  1QJY 1;  3LSD A;  4CP0 A;  1SDD B;  2RV9 A;  2PAM A;  1MS4 A;  3T1L A;  4HFS A;  3V65 A;  5FP3 A;  3NVC A;  1LNS A;  1DF0 A;  4AED C;  1RTV A;  4AEK A;  3WDU A;  5JI7 A;  1VBD 2;  2GMP A;  4IL7 A;  3ZLI A;  1OVP A;  1UZV A;  2PHD A;  1XNK A;  2ZS6 B;  3IDB B;  3I3D A;  1W06 A;  1HXS 1;  2BNO A;  4UI9 L;  2X10 A;  2RJK A;  4X6Q B;  3JD7 3;  3UGG A;  4WBB A;  3O12 A;  4YVS A;  1UNB A;  1UU5 A;  4L2N A;  4R4Z A;  4CP9 A;  1SDW A;  5KHG A;  4HG6 B;  1QJU 1;  3GNE A;  3IDA A;  4FTB A;  3K77 A;  2Q8D A;  2PMW B;  1PO1 2;  4Y26 A;  1XJA A;  5DUU A;  3ZFG B;  4LLO A;  1NYW A;  4QX5 A;  5E89 A;  1VBE 2;  4XJU A;  4BWO A;  5FK7 A;  4RD7 A;  2WFF 3;  1GNY A;  1GWM A;  1TNR A;  4QPG C;  1OPO A;  1O4T A;  5KXC A;  5CFD B;  1OOP C;  5CBL A;  3THT A;  4AHY A;  5IAT A;  4WVW A;  5KHH A;  1PZ8 A;  5L9V A;  2PHF A;  2XXZ A;  3IPV A;  2E33 A;  2A6W A;  5GZD A;  1ZZ6 A;  1ST8 A;  4GA9 A;  1O4Y A;  2J42 A;  3VD5 A;  4AI1 A;  1J1T A;  4ISQ A;  1PGL 1;  3PIG A;  1GZW B;  2I07 B;  4E4S A;  1DLL A;  2VD7 A;  4YZ4 A;  2PHT A;  1RUD 3;  1ND3 C;  2O14 A;  5A7Q A;  2OA2 A;  1JHJ A;  4K8F A;  3PVB B;  5GZG A;  1JUI A;  3BTY A;  2GMM A;  2ETE A;  2PHX A;  2QZ3 A;  2P6C A;  1POV 1;  1VB4 A;  3VKF C;  3OD0 A;  3ZR6 A;  3B9C A;  1PO1 1;  4Z82 A;  3KV9 A;  3W5N A;  4CXW A;  1X82 A;  3PNA A;  1VBE 1;  5EJ1 B;  4Q0V A;  4Y22 B;  4DIN B;  1PIV 3;  1FOD 2;  5EIY B;  4IEO A;  4LNV A;  1N1T A;  1H4H A;  4M4R A;  4DXS A;  3U10 A;  5A6X A;  3W9A A;  3PUQ A;  4LQR A;  4RYD A;  3OB8 A;  1YCI A;  2O8Q A;  3GYD A;  3WOG A;  2DCK A;  2ZXQ A;  1JZ7 A;  4Y1Z A;  4N7U A;  4BQX A;  5H9Q A;  1XE8 A;  2CDP A;  4OUE A;  1ZRC A;  2PA7 A;  5E6H A;  1XBF A;  3D8C A;  4DRV A;  2VAU A;  5A32 A;  1C8M 2;  1S4C A;  2IXH A;  1EPW A;  2VNR A;  1OKQ A;  1YI7 A;  1XNB A;  3IDE A;  2WA3 A;  3ZYJ B;  4LPL A;  3VBF A;  2JDY A;  4CCD A;  1Z7S 2;  4QGN A;  4GUL A;  1J3P A;  4NHY A;  3I59 B;  1X8E A;  2QDN A;  2HEV F;  3POE A;  4GH4 A;  4IEV A;  3PUA A;  3JB4 C;  4NUB A;  4L9B A;  4PBO A;  1TME 3;  4CPB A;  1VBA 2;  4EN0 A;  1K3I A;  4Q4W 1;  2WZ8 A;  3T4V A;  4OI0 A;  1V6K A;  1DLC A;  4LBK A;  1L7Q A;  1PX4 A;  2VVF A;  4QHZ A;  4OHZ A;  3VN4 A;  5BNP A;  1H30 A;  3ACL A;  5A3T A;  3M3E A;  4XCA A;  5FQ0 A;  1CIW A;  1D2S A;  2YGL A;  3K4A A;  1KIT A;  1V70 A;  1YFW A;  4BQ2 A;  1SHW B;  4KNC A;  5T5O A;  2VW2 A;  3HN1 A;  2WBK A;  1HRV 1;  2JEC A;  2RDN A;  3AJY A;  3HNM A;  3ZPY A;  4ATF A;  4EWD A;  2KD7 A;  2OUH A;  1FMD 2;  5JAX A;  5CG8 A;  1LHW A;  3IAQ A;  5LEK A;  3MW2 A;  4HLT A;  1C8M 1;  2WNU B;  3CU7 A;  4FFH A;  1A78 A;  1R1A 1;  3ILR A;  3SEP A;  4COZ A;  2E7A A;  2QCS B;  3J7L A;  4IES A;  3SCF A;  3TYJ A;  2Q1M A;  2V5Y A;  2EA7 A;  1XNC A;  2W08 A;  3AL5 A;  4LE3 A;  4Q26 A;  2JB4 A;  3IDC B;  2VUA A;  1BHG A;  1GOG A;  1V6N A;  4P9Y A;  4QPI A;  4TN7 A;  2Q4S A;  2BFU L;  3KF3 A;  1NE4 A;  4MGS A;  4HPK B;  1XRU A;  2JEN A;  5FZ4 A;  4JKM A;  1SFY A;  2W2I A;  1NUK A;  2VU9 A;  5LAS A;  3H3U A;  1LEN A;  1VBA 1;  3TEZ A;  1BXH A;  1IPK A;  2OQ7 A;  4CDW A;  1VJ2 A;  1QY4 A;  2Y26 A;  3C2U A;  4LBQ B;  4RQP B;  3BU7 A;  4L11 A;  3KWV A;  1JUH A;  3HNB M;  4TSV A;  1C4R A;  3I97 A;  3QBQ A;  3M3O A;  5F5A A;  1ZRD A;  3MPB A;  1MS9 A;  4W65 A;  2V4A A;  2ZHN A;  3DUI A;  1AYM 3;  1V9U 3;  3PU8 A;  1ASJ 3;  4KH9 A;  2RM2 3;  3F2Z A;  3MIC A;  1CVN A;  3ECQ A;  5L7O A;  2D6P A;  2QQV A;  1YUD A;  2Y6F A;  5KHK A;  2SLI A;  5LWB A;  4K20 A;  1CAW A;  1QJY 3;  3MIE A;  4NPL A;  1H2N A;  2CGO A;  4TWT A;  4A2U A;  3SH3 A;  4A3Z A;  2VZV A;  1MQT B;  4ZU5 A;  2LM3 A;  1MVQ A;  4KL1 A;  2QVS B;  3OBZ A;  4H55 A;  5FP4 A;  3HEI A;  1NOV A;  2ZZQ A;  4HVR A;  4XQD A;  3WDV A;  2C0Z A;  1CX4 A;  1XXN A;  1NA1 C;  4E8D A;  1HXS 3;  3M3I A;  3ITQ A;  3AXE A;  1XYP A;  1QNY A;  2UY9 A;  3OGJ A;  4Y20 A;  1VB2 A;  2WA4 A;  2P1B A;  1RL3 A;  1GOH A;  1UZ0 A;  4G4F A;  4AI3 A;  1QJU 3;  4RR3 C;  2WS9 2;  1YJL A;  3I3B A;  2G9G A;  1H4G A;  1QJX 1;  4YG3 A;  4QKD A;  4QB1 A;  4K7J A;  4GZ9 A;  4CEY A;  4YVS B;  4WV8 A;  4CP9 B;  2GH2 A;  4N9H A;  4LBM A;  1UN1 A;  3WCR A;  1LOE A;  5A1A A;  2OYZ A;  4MGI E;  1JTZ X;  2P37 A;  3ZXF A;  4RSU A;  3I2D A;  5FCC A;  4AEM A;  5JXH A;  2ZEX A;  3QOP A;  5FY8 A;  4AQ2 A;  4BZ4 A;  2FZ2 A;  2Y34 A;  2QFE A;  4Q2F A;  1S0C A;  2D7F A;  2Y8K A;  4OUM A;  1L7R A;  5EZW A;  3H50 A;  1HQN A;  4P00 B;  4EV0 A;  4M3C B;  3J8F 2;  1DFQ A;  1TG7 A;  1UZZ A;  2YHJ A;  3KVA A;  4GMP 0;  4N9I A;  4XOG A;  2NP0 A;  1US3 A;  1FAT A;  2C24 A;  5JZG C;  3IPV B;  2D98 A;  1CAU A;  4I0W B;  1VMJ A;  5ACA 2;  5JOX A;  4LO5 B;  1ZZC A;  3IMM A;  1O5U A;  1OA4 A;  1I1E A;  3H8X A;  2BTV C;  2WAO A;  1BBT 2;  3LOI A;  4ZS3 A;  5C9A A;  3WX5 A;  4HVQ A;  3ZDS A;  1OD5 A;  3Q8A A;  4Z2W A;  4M00 A;  1ZZB A;  3AVS A;  1PO1 3;  3IZO A;  3ZSK A;  4PDW A;  3M3C A;  5FPZ A;  4CDX A;  1LOB A;  4GAZ A;  1VBE 3;  1EYB A;  2VGD A;  4NVP A;  3WLU A;  2AZ5 A;  5F9T A;  5B4N A;  3BU0 A;  2A3Y A;  1E5R A;  2VOV A;  4N53 C;  5FYU A;  4QKB A;  3ZFE B;  4YVW A;  1RUH 2;  4IV1 C;  3APB A;  3WP5 A;  1NKG A;  4BA6 A;  2X05 A;  4CDU A;  5J36 A;  3O0X A;  5T50 A;  5JMC A;  1LOF A;  3M7A A;  5JR2 A;  4NIH A;  2JE7 A;  2GND A;  3OGS A;  5HV4 A;  4E2S A;  2D44 A;  2ZML A;  4XUN A;  5I0U A;  3USU A;  3ENR A;  1O3Q A;  2X29 A;  3J8F 1;  4JGZ C;  4YM1 A;  5F3G A;  2WNV A;  1DU3 D;  2WWJ A;  4UBH A;  3VZO A;  3OOX A;  1OFN A;  3WG4 A;  3HN3 A;  1LOG A;  4PIX A;  2XWB B;  4JZR A;  1JOJ A;  1O7F A;  1KJR A;  3VBO C;  1QWR A;  4DXR A;  2HLE A;  2GU9 A;  1LCL A;  1PZ9 A;  2VCC A;  3LSE A;  3N9Q A;  5A32 B;  1OLM E;  1BBT 1;  1WW6 A;  1X50 A;  4B3N A;  1EUT A;  2VNO A;  3VBS A;  1R09 2;  4LO6 B;  1W6O B;  1SMV A;  4CCC A;  4CCE A;  2Y6K A;  2VVD A;  2UWC A;  3VBF B;  4Q4W 3;  1YFY A;  1H8V A;  1EPZ A;  3TOJ A;  1JYI A;  3VHR A;  4GH4 B;  3RZJ A;  4AVB A;  1W8Z A;  1SAC A;  5AFE A;  2CSG A;  4LBO A;  4QGL A;  3WP3 A;  4AVV A;  3BI3 A;  1RUH 1;  3WHU A;  1HRV 3;  3DYM A;  5SV8 A;  1SBD A;  5BNP B;  2W94 A;  2XHK A;  4QDQ A;  3CHX A;  3JXS A;  2XUM A;  4EE2 A;  1OQD A;  5KBF A;  3EYP A;  3T3Y A;  1SQ4 A;  2X09 A;  5FKB A;  3WV6 A;  1RUE 1;  1QEX A;  1C8M 3;  2R6Q A;  5D2A A;  2ZOE B;  1GQH A;  1R1A 3;  2JKX A;  4IV3 A;  1SCS A;  1VRB A;  1QOT A;  4OLL A;  5BPX A;  4COY A;  1XYO A;  2CHH A;  3OBR A;  1I5P A;  3BTA A;  1UYX A;  3IT8 A;  3N7L A;  2IZW A;  3FUO A;  2EIG A;  4YM3 A;  3NV3 A;  3H9A A;  1OQE A;  2HKX A;  1W2U A;  2OW4 A;  1I9R A;  1YO8 A;  2YBK A;  3QH6 A;  1R09 1;  3HOB A;  4XXP A;  4LEJ A;  3TEY A;  3CJX A;  2VE1 A;  1VBA 3;  2HWD 1;  2VNV A;  5FZI A;  5I8T A;  4KQ7 A;  5JPN B;  2ID4 A;  2YZ4 A;  3H3L A;  4QPI B;  4ZHN A;  2TNF A;  2KM2 A;  3SKV A;  4XMI A;  2WSV A;  3N9O A;  3NJY A;  1QJF A;  3DV8 A;  1AR7 1;  1PNG A;  2JG8 C;  2D43 A;  2ZGM A;  1IPJ A;  4DRR A;  3I2H A;  4W8J A;  2HWB 1;  4PHZ A;  5IW0 A;  5FZG A;  1YIF A;  2IC1 A;  1BEV 1;  2R0F A;  4MYE A;  3VHO A;  3GBG A;  2VXJ A;  4BME A;  2A3X A;  1IZ3 A;  1UF2 C;  4MHR A;  1SLI A;  1BZW A;  3H1Y A;  4XJ9 A;  2W0X A;  4A7Z A;  2WWU A;  3U1X A;  5BYN A;  2DVA A;  4BCU A;  4PI2 A;  5J7M A;  1W8W A;  2LRP A;  5G04 L;  2JDA A;  1S0G A;  4YW6 A;  2A6X A;  5L7O B;  4L92 A;  3P6B A;  1XOY A;  2PQS A;  3ZYI B;  1CAW B;  5EHD A;  3S5Q A;  3LB9 A;  4E27 A;  4XFI A;  3WNK A;  2ZKN A;  4XBN A;  3N7J A;  1C3H A;  2WT0 A;  2DUO A;  2ZEW A;  1DHK B;  3VBH C;  3IMN A;  1K42 A;  1BMV 2;  1N1V A;  4COV A;  3ZSL A;  2CWM A;  4LO8 A;  1Y9M A;  4XF0 A;  2XJT A;  3VUO A;  4PQ9 A;  4NIG A;  4R4X A;  5FYY A;  1MAC A;  1QJX 3;  4XVH A;  4YGB A;  3RZH A;  2JG9 C;  4Y20 B;  4Y5Z 0;  1DGL A;  1Q8V A;  4UFJ A;  2VL4 A;  1CJD A;  5FLJ A;  5JPM B;  3LEM A;  4Y5T A;  4O9E A;  3UET A;  4YZ1 A;  4FPJ A;  2VPV A;  1D4V B;  1W6M A;  3TB0 A;  4FAH A;  3H3Z A;  5FZK A;  4ITC A;  4SBV A;  1RC6 A;  4CEY B;  3POG A;  3N9M A;  4A44 A;  3S7E A;  3VDB A;  5DPN A;  3R4U A;  1VRH 2;  3LFI A;  1WCQ A;  3H42 B;  2WZR 2;  5JCT A;  2W91 A;  3J9S A;  5C8C A;  1OSG A;  4QX8 A;  3J7H A;  1ENQ A;  1W2A X;  3FFZ A;  4Y5S A;  1S0I A;  1BMV 1;  1DGR N;  2DUR A;  3PVO A;  1QDO A;  2VZP A;  3P3P A;  3U75 A;  3U0Z A;  3RZK A;  5IJR A;  5FY4 A;  1ZRE A;  4HOO A;  1CAU B;  1DYO A;  2C5D A;  4N90 A;  1KEX A;  4ARY A;  3N7K A;  3O1P A;  1RGS A;  2RS3 2;  4B1L A;  5FOJ B;  1HQL A;  1UQX A;  2VM9 A;  5D8A C;  5C9A B;  1FT9 A;  2VMC A;  3JBG 2;  5FZF A;  3M8L A;  1BJQ A;  2PHU A;  4FAG A;  1T6G C;  4CU6 A;  1RJ7 A;  3AMP A;  1GP6 A;  3TBD A;  4CDX B;  4K21 A;  1L3J A;  1ZRR A;  3WNX A;  3V0B A;  1A8M A;  4CCN A;  4H7M A;  5LBF A;  1K5M A;  1VRH 1;  3N36 A;  3IKW A;  4I0A A;  4AVT A;  2PAE A;  3J8F 3;  4RS5 A;  4YVW B;  1O6U A;  4CDU B;  1RHI 1; 
#chains in the Genus database with same CATH homology
 1GWL A;  2K46 A;  4YW6 A;  2O14 A;  4BQ5 A;  1WCU A;  4CP9 B;  4BQ2 A;  2WYF A;  1V0A A;  1HN0 A;  1W9F A;  1L7L A;  3ZYH A;  2JWP A;  2LRO A;  4YW7 A;  1WZX A;  1OKO A;  1GWM A;  4YWA A;  1W90 A;  1W8T A;  1UOJ A;  4BQ4 A;  2LRP A;  3ZYF A;  2VXJ A;  4BQ3 A;  4A6S A;  1GWK A;  4AL9 A;  4LK7 A;  1W8U A;  2Q1F A;  3ORJ A;  4LJH A;  3UT0 A;  4CPB A;  4CPB D;  4LKD A;  2C24 A;  4LKE A;  4LKF A;  1W8Z A;  5D21 A;  1OH3 A;  4CP9 A;  2KR2 A;  3F95 A;  1W8W A;  1WMX A;  3ZYB A;  4LK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...