4LK0M

Crystal structure analysis of the e.coli holoenzyme/t7 gp2 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
51
structure length
51
Chain Sequence
NKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phage T7 Gp2 inhibition of Escherichia coli RNA polymerase involves misappropriation of sigma 70 domain 1.1.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 11
structure length 51
sequence length 51
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF16857 RNA_pol_inhib RNA polymerase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.510 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4lk0M00
2LMCA 2WNMA 4LK0M 4LLGM
chains in the Genus database with same CATH superfamily
4HDOA 1DGJA 1F77A 1XD3B 2W9NA 1WXSA 2RGFA 2QC8A 1JWSD 1VR9A 2WXGA 4BBNF 3IVFA 1TKGA 1WFYA 5IN7A 1T5XD 1YMHE 1D5XC 2PJHA 5E6JA 3AB5A 5MPOA 1WJ4A 1E0ZA 1LQBA 4MH8A 3W5VB 3ZGZA 4ZHOA 3KYDD 3MP9A 4WAFA 3DBHI 1CZPA 1SEBD 1HE8A 1L5PA 1V49A 2KC1A 2L0TA 4BKSA 4HJKA 4ICVA 3NS1A 4LNIA 1YJJA 2GMIC 3VHTC 2IBIB 2W54A 1GOZA 1TT5B 4BBNC 1EWCA 4CHKA 4NJCA 4M8MA 2LRWA 1BXTA 3KLSX 1WYGA 3ZNID 3DPDA 2N9EB 1SGHA 5JXVA 5GMVA 4FLHA 1KLGD 1XT9B 2XK5A 2B76B 1WGYA 4LTUA 4ARCA 4BOSC 4JGHB 1HA5A 3VRAB 3BYTB 2KK8A 2OJWA 2BKFA 5TR5A 2QSDA 1E10A 3A33B 4XC2A 3SDLC 3Q14C 1WE7A 4RM9A 2D3AA 2KVZA 2NTTA 1E5WA 3ALBA 2FCMA 2KXJA 5IAAC 3ZUNA 3L17A 2KN4A 1C9FA 2DYOA 2CU1A 2XNAC 3Q2AC 3B9JA 2HE7A 2V3NA 3NZSA 3ZNHB 2C9WB 1FD6A 2JU6X 2LWPA 1T0SC 1QOBA 1E6EB 2PTLA 3AN1A 5D7GA 3APFA 2DZKA 3DCGA 4AJWA 3IFWB 5H8YE 1ZPSA 3T3NA 4TQ0A 3ONSA 1CK1A 3E9SA 5HHDG 1JROA 2IGGA 1V2YA 2KMCA 3DHIC 4HCNB 2YVCA 2LVPA 2YLMA 2BTEA 4IWOA 3PS6A 2KFJA 4HLEA 1L6UA 2WU2B 1V80A 1E8ZA 2WXNA 3ZIMA 3Q3JA 5L95C 1F1HA 4L1BA 3UIOB 2ZPYA 4XGAB 1E9MA 2WGSA 4EUTA 3H9DA 1JWUD 3CWIA 1Y56A 3KUZA 3KUCB 2DYMA 1QQRA 3ETRA 1NYRA 1SE3A 1DOYA 1WE6A 1LFDA 2BQQA 1UWMA 3D32A 2SAKA 3IHPC 3AMZA 2BS2B 3V61A 3T3OA 3DHGC 3RZFA 4K7WA 2KKCA 4JE3B 3N9YC 4B95A 1JCKB 1C4AA 2D2QA 2WWZA 2D5GA 1GPXA 5H92C 4YSZB 4IM0A 1QOGA 1KFYB 3PHXB 1DOXA 3DBHB 2IO2B 4GN1A 1TZOA 1TS4A 4NY0A 4BOZB 3Q3OC 1I7HA 2RMMA 2WXRA 3P2BA 4MGIE 4PT5A 4USAA 3KQ4A 4XDCA 1ZGUB 1P98A 2LUMA 5EDSA 2FUHB 2BF8B 3VUYA 3LYYA 4NAWA 4JWUC 1PFDA 4QAYA 1WM3A 1FRRA 1L4ZB 1GC6A 3ML9A 2BT6A 2L8JA 3ZO5B 5TSSA 2WLBA 1DOIA 3AM9A 4EKUA 5I4DA 2NS5A 3PVLA 2FCNA 1T0RC 2RPQA 4PYUA 3NZUA 1VCBA 2PVGC 3IT4B 5BO4B 4FJVB 2WXMA 3X23A 3PRMB 1YN3A 1I35A 2N1WA 2INPE 2ZNVC 3GOEA 1N5WA 3L13A 1SF0A 1KOTA 1P9DU 4AOFA 2CR5A 4GOCA 2V1YA 3VUXA 1MJDA 3QARA 2G3QB 2GI9A 3EC8A 3WANA 2K25A 4DHZB 1YQ3B 3AULA 2Z59B 3JYUA 1KF6B 4A8XC 1J7AA 3I3TB 5DPTA 4DBGA 2KLGA 1WR1A 4AQ7A 4RMAA 3U52E 1K51A 1JALA 1YNTE 1MG8A 2O6VA 1WM2A 2PKOA 1L2NA 1D4BA 3VAWA 4WURA 1D5MC 1SIJA 1EF5A 5CHWA 2AWTA 4NJ7A 1TS3A 1XCQL 2K8CA 3P4PB 2JYEA 3V3XA 4FULA 2NPTB 3MHSD 3ZNZB 2M0XA 2UYZB 1TKYA 1XF5L 4MJSB 1K50A 1OGWA 2N9XA 1WRIA 2WX0A 3VTVA 4W9EA 1I4RA 1BUIC 3NHEB 2M0AA 3DBLB 1F9JA 3CF6E 2DLBA 1JQ4A 2JUOA 3KYCD 4KGRA 4TQ1A 3NZ3A 1IUEA 1PYWD 3RZWC 1PDXA 3TEWA 4I6NB 5G5GA 3W1YA 5DPWA 1M94A 3B08A 5L83A 1WSPA 2G45B 3KW5B 4PK1A 4ANVA 3I9V1 3DVNV 1TY2A 1ZKHA 2MEKA 2WDRB 5KHOA 4XWTA 1U4AA 4A55A 1AYFA 1YQBA 2RR9A 1XQQA 4E71A 2J0MA 4MH0E 2AEHA 2R2OA 2O2VB 3EFCA 4H2AA 1R7SA 4EZLA 3ZKJC 2JVCA 2CJOA 1AW7A 2WDVB 3K9OB 1IGCA 2IDYA 2K8BA 2KLCA 2MRPA 5EE3A 2IPKD 2M1MA 4W9FA 3VRBB 5FR3A 4OVZA 2IO3B 4JPSA 1NDDA 2QEJC 2GBKA 1KM7A 2BBCA 2L0FA 4FN2A 3P4QB 1L0VB 3RUIB 2K22A 2ASQA 3FC4A 3VH3B 1WJ6A 2DENB 5DPSA 4MEMA 2N4FA 4YWGG 1J7CA 2BWES 1K52A 4L2YA 1J0GA 1OQRA 1IBXB 1I42A 3NVVA 2RSUA 3UINB 2FCQA 1EM7A 3M63B 1H4RA 1XLPA 1H8CA 4AUQC 3R7RA 2G4SA 2N7JA 3ABVB 4G3XB 2RDGA 1D6EC 2JRIB 2MP2A 2DX5B 5HKHA 2VZKD 3I57A 2X38A 4XDDA 2KX0A 3R2IA 2V9HA 3PLUA 3L16A 4NQKE 1P7FA 2KQ7A 5G2NA 3ZVVA 3NVZA 3V62A 2IJ0A 3H8HA 2TSSA 2LASA 2WXHA 5LXHA 2BWFA 4ZYSA 3QHTA 4IDIA 2LMCA 3O65B 2JY6A 1V1PB 2Y5CA 3K9PB 4YSYB 4AWJA 3N32A 3R8BA 3BK1A 2LXAA 2WNMA 3VR8B 1HTOA 1T6BX 4KGSA 3TUOA 1BT0A 4HWIB 1KJTA 1WGKA 2XBBC 2KT7A 1SJHD 3FILB 1NI2A 2WXKA 5AZFA 3ZNGC 1FNVA 2CJNA 2BVCA 1F2RC 3BK2A 1ZP0B 4N9F4 4HK2A 1MFWA 2BW2A 2KTRB 4HPPA 2MW5A 4DDGD 1ZDXA 1GB1A 2UWQA 1JWMD 2JWUA 1F2RI 1FEHA 3ZTCA 4W9LA 2Z0DB 3RFZB 1FPYA 1L7YA 4ZOHC 1IPGA 1P7EA 3RMKC 2EMTA 4MSQB 3PRPB 4P7IA 4ARIA 2JZPA 2L00B 2A4ZA 3Q8AA 1A5RA 2KDEB 1V8CA 4GSWA 2WXQA 2YEPF 4J3OD 4EZJA 2JX5A 3S2AA 2O6VD 2ZEQA 3W1SC 3H7SA 3E56A 4GIVA 2REXA 1YX6B 1QLBB 3WA0A 4A3OA 3C19A 4K7UA 4MM3B 4NJ6A 1VJKA 4OHJA 2LZ6A 2GBJA 2BS4B 3SFDB 2KVRA 3ZTDA 1Q10A 2WS3B 2AQ2B 2E3TA 5D94A 4HKQA 3IBEA 1PGAA 4K3BA 4RGTA 4M0WB 3UQAA 1RFAA 2KMMA 3W9CB 4WJOA 2O2VA 3ZJVA 5HFYA 1WZ0A 2QDFA 1LM8B 2V4LA 3WAOA 3AU5A 1FFUA 3AE5B 1FNWA 4MGZE 4URKA 4FHJA 3X0WA 4TKNA 2KNBA 4E74A 2ZCCA 4HXDA 2JWZA 1OEYJ 2AYOB 4GLSC 4ZRPA 1R4NI 3AE6B 4B6WA 2MCNB 5EE0A 1OFFA 1TS5A 4A90A 1Q5WB 2D3CA 1SXTA 2VH2A 3RNBC 1TY0A 4K7SA 4GGQA 2ZJDA 3HK0A 3H7PB 3RD2A 3T9LA 4OVUA 3BZDB 1RFKA 3B2FA 3RNCC 2LI5A 1ET6A 1CJEA 1R4MB 5JZEB 2RDBC 2OOBB 1YQ4B 4LJOB 2OEDA 3UF8A 1ISNA 2XK5B 2BB6A 3IAS1 4WQMA 2JF5A 1SE4A 1V1OA 1T0QC 1RRBA 2GB1A 1WX7A 3SU8X 2AL3A 3GB1A 1E90A 2G1EA 4HVBA 4B0EA 2LGYA 1UELA 3SHQA 2D3GA 4LNFA 4HDQA 1Z2MA 3ML8A 2DAJA 2FCSA 5CHVC 1C79A 3OJ3A 2MX2A 4JL9A 2KFKA 4EE2A 3NUHB 1TYGB 1SIFA 2K3UA 3SEBA 2LRUA 4JQWC 3OWEB 3Q8FA 1NI3A 3AE3B 2L76A 4IM3A 2NBWB 4XE0A 1GB4A 3DBRB 5AZHA 1QT9A 4CYEA 1TJEA 4KZCA 4ZYNA 2KJHB 2ON8A 1TS2A 4YTMB 2KOXA 3DVGX 5IO9A 2INDC 1VLBA 1E7PB 4A6QA 3A4SC 5AEKB 2FIFA 2H88B 2QJLA 2R2QA 2KX3A 1OEYA 4KZ0A 3OG5A 3IG3A 3JW0X 1F52A 3AE9B 4NPNA 3EA6A 2NBVB 4W9KA 2L7RA 5JH5C 2N1VA 1IP9A 1C3TA 1I4PA 4BFRA 2DHZA 5FR6A 4WJQA 1EUVB 2KDMA 3TMPB 4C7ZA 3EUB2 3ZQ4A 4JLCA 1JWBD 5J17A 4ACFA 3W2DA 1STEA 1GUAB 4J6IA 4OW0A 1IBXA 3DOWA 3B1LX 2WXPA 1QILA 4HRSA 1WGDA 1JW9D 4RNAA 2WDQB 3QAQA 1YN4A 1N61A 2L83A 3ZJUA 2I2YA 2IO1B 4TMAB 1AWDA 2MSED 3DWGC 3WIMA 1P3QU 1L0YB 2HD5B 2J4XA 4WH4A 2KDBA 3RI7C 4BZAA 4DXGA 3CSTA 3QQ8B 3LXFA 3P4SB 2KN5A 1P1AA 4M00A 4ZHPA 1ZXHA 3U8ZA 2E6XA 2RPVA 4BKGA 3VFKA 2L52A 2MWSB 2KD0A 2EELA 3HUIA 4FHKA 3NS8A 1UH6A 5D3DA 4ANXA 2KDFB 1K53A 3J9CA 3UI3A 3UIPB 2WX1A 3LB8C 3URYA 3AEDB 4DWFA 4EZKA 4K3CA 2LGXA 2ZVNA 3NVYA 2PW9A 1WGGA 3ZLZA 3AEEB 4XZ4A 4L23A 1UZXB 2G9HD 1HZ5A 3ECIA 3H7PA 3W1SA 4ZDVA 1KH0A 3HIZA 2N9KA 2KTRA 4BAXA 1J19A 1WZ3A 1WJUA 3DWMA 3NVWA 4II3B 4PYZA 4RGOS 1R4MI 2QIEB 4JX1C 4RF0A 1I4XA 1NYQA 1ZE3D 4BKSD 2BYTA 3VTUA 2R61A 4WAAA 2AQ1B 5HG2A 2MLBA 4WWNA 2JZZA 2ZZPB 4ZRKA 4DQOC 1JMLA 4MT5A 1LGRA 3GE3C 4US9A 1HZ6A 5IKCM 3EHVA 3ZJTA 2O6VB 3AXCA 2IY1B 3BVZA 3AU4A 2PVOD 3GS2A 2VZKB 3EGRA 1QF6A 1MI0A 1V86A 3RT3B 3CSFA 2DZJA 2V3SA 2HJ8A 2KWCA 4WIPA 3AI5A 3TL5A 3BVGA 1N5XA 4JIOU 1N62A 3UGBB 3HHMA 2JXTA 2KYWA 5CX3A 5EE1A 1I4HA 2W55A 5BYSA 3H1UA 4GXBA 4LNOA 1HXYD 3BINA 4NZLB 4LDTD 2KANA 2K6QA 1RAXA 2Z8LA 4RGMA 1WX8A 4N58A 3OJ4B 2GOWA 2NVUI 1KRHA 5LLIA 5LNK1 2XN9C 1N6ZA 1YX5B 2KWUB 2G4DB 4MM3A 3DBSA 2KMAA 3MJ5A 1QOFA 2M8SA 1GC7A 1GNUA 5E6PA 2NTSA 3GZNI 2ZVOA 4WQOB 3DVNU 2CHXA 1OQYA 1K8RB 1N60A 2C7HA 2RD0A 4CO7A 1NENB 2BS3B 4NNJB 3B2GA 2OHFA 1L0XB 4F7ZA 1ZDVA 5BMGA 1S3SG 2DZIA 4A9AA 3HVDA 3MC0B 2KHWB 2Y3AA 5KHQA 4R3DA 4KKIA 4YL8A 5BYRA 3L0WB 1V9JA 4TV3A 3ZDTA 1SJED 3WAPA 3QC8B 2L32A 4TUUA 3WALA 2J53A 1SE2A 2LGDA 2WHIA 4HCPB 2HTHA 1I4QA 2DWQA 3Q69A 4C80A 2LGSA 4YT0B 2C60A 1G6JA 2RDHA 4ANWA 4OVVA 4DXFA 4C56C 2HJ1A 4NAMA 3IAM1 2GBMA 2W82A 1XCTL 1ESFA 1WMHA 1FCLA 2K1FA 1D5ZC 1WXMA 5JHBA 1KLVA 4LLGM 3VH4B 2AL6A 2KFKB 3U7DA 4EOYA 1Y8RC 1P0RA 1B1ZA 3HM3A 4FJYA 1WY8A 4US8A 2VRRB 3N3KB 1WJNA 4WWOA 3T8MA 3W5UB 2CS4A 4MSMB 3MHZA 3DBLI 1WGHA 2DBYA 2WQYB 1VZ7A 4YTNB 4KDLB 1AARA 4IC7B 1UUPA 4Q2JA 1EF1A 1FCCC 1L6VA 3L54A 3APDA 2MJEA 3PSEB 2M17A 3CIRB 3DVGY 2C5LC 3Q3MC 3L4PA 1IGDA 1DYQA 3JSVB 5EE9A 4N59A 3KWLA 4YTPB 3EFUA 3AE7B 3RNGC 3HVZA 1E8WA 3PT2B 1WF9A 3MC9A 2WYQA 4KIKA 5CTRC 4C00A 1FNUA 2FNJB 3FILA 2N9PC 3LDZE 4RGNA 2L05A 1NVID 5IA7A 5AZGA 3GE8C 3TCAA 4G11A 5BMIA 3PPAA 3N20C 2J42A 3A9KA 3GZNB 2ZCBA 2GBNA 1C4CA 1FXIA 2MBBB 3NRZA 3H6NA 1T3QA 2WDTB 1PQSA 2JSVX 4FADA 1JRPA 4S17A 3VUWA 1GG3A 4A3PA 4B9KA 4KVGB 4IKGA 2C7MB 3A9JA 3ZXRA 2M19A 1EU3A 1E7UA 4I6PA 2QILA 2LVOA 3VXWA 3SFEB 1WR6E 4ZRQA 3BYYB 1HEZE 3JSVA 1MVKA 1UF0A 3OLMD 4K81A 2CHZA 2FIDA 2QHOA 3MC8A 1ZXIA 5J2RA 2JRHA 2LJIA 3MFGA 2PMVA 3SD5A 4DK5A 5GXGB 2KJ6A 2PIAA 2KACA 3PTFC 1PGBA 1SBBB 2N7EA 3KUDB 3TSSA 4KSLC 3QA8A 2M56B 3A9KB 3PZDA 4LNKA 1OQQA 4NAWB 1F0ZA 2PLPA 1WGRA 5IOIA 2LJ5A 3PREA 2Y5BB 4RH6A 4M8NA 2LXCA 4LCDE 1VZ6A 2MP2B 1E7VA 2FE8A 4P6VF 1PGXA 2I1JA 2J0JA 1V1PA 1MG4A 5BYQA 1SE9A 3O13A 4FBJB 3AH7A 2MBQA 3BWUD 2KWVB 2MJ3A 2V3PA 1WXVA 4IWPA 5E6OA 2FAZA 2LEKA 3FAHA 4GMVA 3NJTA 2IO0B 4HROA 3WAMA 3RN9C 2YEPB 1YOVB 2INNE 1XLOA 1FO4A 2L1AA 3I63C 1FFVA 1OTRB 2H89B 3AEBB 2DYBA 2GLSA 3AECB 4OZBA 1LO5D 4IG7B 3Q6BA 2AX5A 3R66C 4WJPA 3RCZA 4ICUA 3KH0A 4GDLB 4LJPB 1AN8A 4ANUA 1EWYC 2N0SB 2CHWA 3PLVA 3SR6A 5J18A 2PEAA 3N1ZC 2ACZB 1C77A 3AEAB 3EECA 5FK9C 1TIFA 1WXQA 2BGFA 2INCC 4YSXB 1XLNA 5FKAC 3BVMA 2KZRA 1CQVA 3U2SC 2EKEC 4UDUC 4HKZE 4PS7A 2K9XA 2N9LA 1V97A 4P1BC 4XWWA 4G50A 4MGYE 4KGTA 1VZ8A 3ZXVA 4GDKB 3JVZX 2XEWA 1E8YA 3A1QA 4IUMB 4HPMB 4DDID 2Y5PA 3M95A 4W9IA 1FRDA 3AE4B 3PV1A 5C23A 4KX6B 1Q1OA 2DZMA 4KDIC 4ITKA 3RPFC 1EU4A 3V6CB 2KJRA 3TEYA 4IM2A 2J0KA 4MDKE 3DQVA 4P16A 5D3IB 1UBIA 2LUEA 2KAJA 1WYWB 1V81A 3NG0A 4D2KA 4BKTA 2ZPNA 4RFBA 1QKZA 4RCOA 4A20A 4GDKA 1WX9A 3C0RB 5IP4D 5T8IA 1WIAA 3M62B 3M3JA 3U7ZA 1NEKB 3ZDMC 2K5PA 2LVQA 4GU2A 1XO3A 2L3ZA 2EMSA 3OAWA 3FKYA 4XYCA 1UWXA 1FM0D 2BB5A 1SSNA 4DHJB 3N1XC 4S0RA 4YXDB 1QOAA 3A4RA 4DHZE 1ZUD2 5DCNA 4KSKC 3L10B 4EFOA 3VDZA 2HTME 2MJDA 3HRDD 4C4VA 4AS1A 3NOBA 1V5OA 2ZNVB 4LNNA 1FXTB 1I4GA 2WU5B 4FA6A 1MPEA 2UU7A 1TZ1A 1E8XA 2J7QB 1LXDA 1M4VA 1D3ZA 1UD7A 2IYDB 2MBEA 4W9JA 3PRZA 4MELA 5E6NA 2MQJA 3I5JC 4WWMA 2IZVB 3NY5A 1QZEA 3TEZA 2FUG1 3N30A 4KV2A 1V6EA 4PS8A 4HPLB 2WXLA 2JYTA 4MGKE 2MBOA 4AP4C 3WCQA 2NMQA 3AE1B 2KDIA 2KC2A 3HM6X 4RF1A 3RNAC 3BIID 2WP9B 3L08A 4LK0M 4W9HA 4MACA 1ACCA 2JXXA 3R3MA 2DAFA 4PS3A 2ZW1A 2PPHA 1UBQA 4OZCA 1UGMA 4X57B 4P1CC 3DHHC 1TTNA 4DHJD 2WXOA 1PUTA 3Q8CA 1ROEA 4M0WA 3VVWB 3PZ8A 3PO0A 1MHXA 4E3CA 4HEA1 2EKIA 2IY0B 3ENEA 1YJ1A 2V0GA 2D11A 2ONQA 1FMAD 1CMXB 2WXIA 2QCZA 3U30A 4WWPA 4WJNA 5DPRA 2X8XX 3N1YC 1YIWA 1L4DB 4C7YA 1HTQA 3RYTA 2J52A 2K0PA 3IT6B 3Q3NC 3ZRFA 4BVUC 2NBUA 1FXAA 3V60A 5D6JB 4ASWC 3CMMB 1GAQB 2PE9A 1C4PA 2OJRA 3QCAA 4HJGE 2W3RA 5C3JB 1SB3C 1WMHB 4IOIE 1C76A 2K8HA 2WXJA 2Z0EB 1NBFC 3ZW3A 2LD9A 2LHDA 4CQNA 1Q0WB 2M4NA 3QWZB 1KLUD 1TGZB 3A1QB 3P63A 3KWVA 1VRAB 1TBEA 3MTNB 2BKRB 2MH7A 4I6LB 4F8CB 1N63A 4KKJA 1KTKA 2JZ3B 2I38A 1WRDB 2K39A 2KQSA 3Q8EA 1IYFA 3QK0A 1S1QB 2JQRB 4W9GA 4MJSA 4RM8A 2SEBD 1EO6A 3Q3FA 1JRUA 3AEFB 4IWQA 2ICIA 1J7BA 4LDTB 4ZRIA 4C4VB 2LGIA 3AE8B 3RULA 1XEEA 2W3SA 4DXAB 3P1MA 3VTWA 1ENFA 1FIQA 2A5UA 2LHEA 1A70A 1HQRD 1RYJA 3VQIA 1Z5SB 3UQBA 4FJZA 4EEWA 2KO3A 5G55A 2CU3A 1ET9A 1T0YA 4AJYB 3P42A 3DDCB 3C8YA 3PZ7A 2NCNA 5JHAA 1J8CA 4KIKB 1YN5A 4F1SA 2V4IB 3PHWB 5BMHA 3A9JB 5D2MB 3MJWA 3AEGB 1ZOYB 1B9RA 4W9CA 2BPSA 3ZYYX 2B3AA 2LFIA 2GBRA 4XX5A 1UGJA 2JPHA 5AUIA 2D10A 4GDLA 1GJZA 4M01A 4TSSA 1WWTA 1VDVA 2MHJA 4O1NA 3Q8BA 4IW0A 2ZW0A 5G5HA 2D3BA 4W9DA 3IXSA 1TKEA 3QX1A 4GB9A 3V6EB 2D07B 2PE6B 5C1ZA 2GRIA 3KVFB 1RWSA 4II2B 4NQLB 3QJZA 3U4EG 1RM6C 3AV8A 4G0NB 1XLQA 3TEXA 2N7DA 1WI0A 2KQ4X 4B0MA 3QIJA 2BYFA 5HI1A 1BMLC 1C1YB 2VH1A 3R2TA 1VD2A 3VR9B 2IGHA 1R4NB 1C78A 3TJPA 2KWDA 2BYVE 3V05A 1WH3A 4N6EB 5LXIB 1JWAD 1ZW7A 3B0AA 1RLFA 2Q5WD 1X1MA 2JT4B 4M02A 3PGEA 4OZAA 3RNFC 4JWSC 2KTFA 3DBRI 3ZRCA 2MBHA 3LJ3A 3BY4B 1V5TA 2WXFA 3AE2B 4REZA 5C2TB 2K6DB 5AUKA 2FBWB 1YJIA 2I1KA 1MHHE 2IGDA 3P4RB 2NPTA 3APCA 4K1RB 3R7QA 2CKHB 1WXAA 3TBLD 1UNSA 4FXCA 2MA9B 3GP7A 1YD8U 3TIXA 4ZRJA 2QMTA 2AQ3B 1XXGA 3RNEC 5CHFA 2C7NB 2HDEA 2DNFA 2BYEA 2NR2A
chains in the Genus database with same CATH topology
1CQVA 1L0VB 1DGJA 1F77A 2K22A 3U2SC 3FC4A 4UDUC 4HKZE 2K9XA 3DWMA 2N9LA 1V97A 3NVWA 4XWWA 4RGOS 4KGTA 2QIEB 4JX1C 4RF0A 4YWGG 1VZ8A 1JWSD 1J7CA 1I4XA 1NYQA 1VR9A 1ZE3D 2BYTA 2WXGA 1K52A 4L2YA 4GDKB 1TKGA 2R61A 1OQRA 2AQ1B 5HG2A 1T5XD 1YMHE 2Y5PA 1IBXB 4DQOC 1JMLA 1D5XC 3NVVA 4MT5A 4US9A 5E6JA 1FRDA 3AB5A 1EM7A 1HZ6A 3AE4B 5MPOA 1XLPA 3ZJTA 1E0ZA 4KX6B 2N7JA 4ITKA 4MH8A 3RPFC 3W5VB 1EU4A 4ZHOA 3ZGZA 3BVZA 3TEYA 3ABVB 3MP9A 4WAFA 2RDGA 2PVOD 1CZPA 1SEBD 3GS2A 2VZKB 3EGRA 1QF6A 1L5PA 1D6EC 1MI0A 4P16A 5D3IB 2VZKD 2KAJA 3I57A 2X38A 3NS1A 4XDDA 1YJJA 4WIPA 4D2KA 3BVGA 4RFBA 1N5XA 2W54A 1GOZA 1QKZA 4RCOA 1EWCA 1N62A 3R2IA 4NJCA 1BXTA 3KLSX 1WYGA 2JXTA 1P7FA 5JXVA 5T8IA 5EE1A 3NVZA 1I4HA 1KLGD 2W55A 5BYSA 2B76B 2IJ0A 3U7ZA 3H8HA 1NEKB 2TSSA 4LTUA 1HXYD 2K5PA 4ARCA 2WXHA 4NZLB 1XO3A 1HA5A 3VRAB 3BYTB 4ZYSA 4IDIA 1UWXA 1FM0D 2BB5A 1SSNA 2LMCA 1V1PB 4YXDB 2QSDA 2Z8LA 4RGMA 2Y5CA 1E10A 1QOAA 4N58A 4YSYB 1ZUD2 3R8BA 1KRHA 3BK1A 5LNK1 2NTTA 2WNMA 3VR8B 2XN9C 1T6BX 4KGSA 3TUOA 2HTME 1WGKA 2KN4A 2MJDA 3HRDD 2DYOA 1C9FA 1SJHD 2XNAC 4AS1A 3MJ5A 3B9JA 1QOFA 3FILB 2V3NA 2WXKA 1I4GA 2WU5B 1FD6A 2JU6X 1MPEA 1FNVA 2CJNA 1QOBA 1E6EB 2PTLA 1F2RC 3BK2A 2NTSA 1ZP0B 3AN1A 5D7GA 1M4VA 2BW2A 1N60A 5H8YE 1ZDXA 1ZPSA 1NENB 2BS3B 1GB1A 1JWMD 3T3NA 3B2GA 2JWUA 1F2RI 1FEHA 4TQ0A 2OHFA 4WWMA 1CK1A 3E9SA 5HHDG 1JROA 3RFZB 1L0XB 2IGGA 1ZDVA 5BMGA 2BTEA 3TEZA 4ZOHC 2FUG1 4A9AA 1P7EA 3HVDA 3MC0B 2Y3AA 2WXLA 2JYTA 4R3DA 4ARIA 4KKIA 1L6UA 2JZPA 5BYRA 3Q8AA 2WU2B 3WCQA 1SJED 2NMQA 3AE1B 2WXNA 4RF1A 2L32A 3BIID 2WP9B 4LK0M 1V8CA 2J53A 2WXQA 1SE2A 4MACA 1ACCA 2YEPF 4L1BA 1I4QA 2DWQA 3Q69A 4J3OD 2JX5A 4C80A 2ZW1A 4YT0B 1E9MA 3E56A 4OZCA 2RDHA 1JWUD 3CWIA 4DXFA 1Y56A 2DYMA 1QQRA 3ETRA 4C56C 4NAMA 1QLBB 3IAM1 2W82A 1XCTL 1NYRA 2WXOA 1PUTA 1ESFA 1ROEA 1SE3A 3Q8CA 4M0WA 1DOYA 3PZ8A 1FCLA 4MM3B 1UWMA 1D5ZC 1VJKA 3PO0A 4OHJA 1MHXA 2BS4B 3SFDB 2SAKA 3AMZA 4LLGM 2BS2B 1Q10A 2WS3B 4HEA1 2AQ2B 2E3TA 3T3OA 2EKIA 4HKQA 1PGAA 4RGTA 2V0GA 1B1ZA 2ONQA 1FMAD 2WXIA 4JE3B 3N9YC 2KMMA 4US8A 3W9CB 1JCKB 3ZJVA 1C4AA 5HFYA 3W5UB 2D5GA 1FFUA 3AE5B 1GPXA 5H92C 1L4DB 4C7YA 3MHZA 4YSZB 2J52A 2K0PA 3IT6B 1FNWA 1QOGA 2DBYA 2WQYB 1VZ7A 4YTNB 1KFYB 1FXAA 1UUPA 1DOXA 4Q2JA 1L6VA 1FCCC 1TZOA 2MJEA 1TS4A 4GLSC 4ZRPA 1GAQB 1I7HA 2RMMA 1C4PA 3AE6B 2WXRA 5EE0A 1OFFA 1TS5A 4PT5A 3KQ4A 4USAA 3CIRB 1SXTA 4XDCA 4A90A 1TY0A 4HJGE 2W3RA 5C3JB 1SB3C 2LUMA 4IOIE 3L4PA 1C76A 3LYYA 2WXJA 1IGDA 4JWUC 1PFDA 1DYQA 3BZDB 2LHDA 4CQNA 1FRRA 1RFKA 1L4ZB 3B2FA 1ET6A 2BT6A 1CJEA 5EE9A 4N59A 1KLUD 5TSSA 2WLBA 1YQ4B 1DOIA 2OEDA 3AM9A 3KWLA 4YTPB 5I4DA 3P63A 3KWVA 3AE7B 1VRAB 2BB6A 3HVZA 3IAS1 4WQMA 2MH7A 1SE4A 1FNUA 1V1OA 2PVGC 3IT4B 1N63A 2WXMA 3FILA 4KKJA 1KTKA 1YN3A 4RGNA 1NVID 2INPE 2GB1A 1N5WA 2I38A 3Q8EA 3GB1A 1SF0A 2G1EA 2JQRB 4B0EA 5BMIA 2SEBD 3AEFB 2J42A 2GI9A 2ICIA 1C4CA 1FXIA 1J7BA 1C79A 3NRZA 1YQ3B 2LGIA 3AE8B 1T3QA 1XEEA 2W3SA 2JSVX 4EE2A 3NUHB 1JRPA 3P1MA 1TYGB 2K3UA 1ENFA 1KF6B 1J7AA 3SEBA 1FIQA 4A8XC 2LHEA 1A70A 1HQRD 1RYJA 3OWEB 3Q8FA 4IKGA 3VQIA 1NI3A 3AE3B 4XE0A 2M19A 1GB4A 4AQ7A 3U52E 1EU3A 1K51A 1JALA 2QILA 1QT9A 3SFEB 1YNTE 4ZRQA 2CU3A 1ET9A 1TJEA 2PKOA 3BYYB 1HEZE 1D4BA 1MVKA 3P42A 4WURA 1D5MC 1SIJA 3C8YA 2ON8A 3PZ7A 1TS3A 1XCQL 1TS2A 1ZXIA 4YTMB 1YN5A 2V4IB 5BMHA 3P4PB 2JYEA 3V3XA 1VLBA 1E7PB 4A6QA 2LJIA 3AEGB 1ZOYB 1B9RA 2H88B 2QJLA 2PMVA 3MFGA 3ZYYX 2LFIA 1TKYA 5GXGB 1XF5L 2PIAA 1K50A 2KACA 1UGJA 1WRIA 3AE9B 5AUIA 3EA6A 1PGBA 1SBBB 4TSSA 1WWTA 1VDVA 3TSSA 1I4RA 1BUIC 2M56B 4O1NA 1I4PA 3Q8BA 2M0AA 2ZW0A 1OQQA 5G5HA 4NAWB 1F0ZA 2KDMA 3IXSA 1TKEA 2PLPA 4C7ZA 3EUB2 2DLBA 3ZQ4A 1JQ4A 1JWBD 2GRIA 4KGRA 3W2DA 1STEA 3NZ3A 4TQ1A 1RWSA 1IUEA 1PYWD 4RH6A 3U4EG 4OW0A 1RM6C 1IBXA 1VZ6A 3AV8A 1XLQA 2WXPA 1QILA 2FE8A 4HRSA 3TEXA 1PDXA 4P6VF 1JW9D 1PGXA 2KQ4X 4B0MA 4RNAA 5HI1A 1BMLC 2WDQB 3TEWA 1YN4A 1N61A 2L83A 3R2TA 3ZJUA 1V1PA 3VR9B 5G5GA 2IGHA 2I2YA 1C78A 5BYQA 3O13A 4TMAB 2KWDA 3AH7A 1AWDA 1WSPA 3DWGC 3V05A 3BWUD 3I9V1 4N6EB 1L0YB 1JWAD 2MJ3A 2Q5WD 2J4XA 1TY2A 4WH4A 4OZAA 2V3PA 4JWSC 2LEKA 2MEKA 3FAHA 4DXGA 2WDRB 4XWTA 3LXFA 3P4SB 4HROA 4A55A 1AYFA 2WXFA 2YEPB 2INNE 3AE2B 1XLOA 4REZA 5C2TB 1FO4A 4ZHPA 5AUKA 1ZXHA 2L1AA 2FBWB 2E6XA 1FFVA 2RPVA 1YJIA 2H89B 1MHHE 2L52A 3AEBB 2IGDA 3P4RB 3AECB 4OZBA 2EELA 3HUIA 4H2AA 1LO5D 1R7SA 2AX5A 5D3DA 1K53A 2CJOA 1AW7A 2WDVB 3J9CA 4GDLB 3UI3A 1AN8A 1EWYC 2N0SB 3LB8C 3URYA 1IGCA 2IDYA 3AEDB 1UNSA 4FXCA 5EE3A 3SR6A 3GP7A 2IPKD 2QMTA 2ACZB 1C77A 3NVYA 3VRBB 3AEAB 2AQ3B 2PW9A 4OVZA 5FR3A 5FK9C 1XXGA 3AEEB 4L23A 1WXQA 4JPSA 2G9HD 1HZ5A 2HDEA 2QEJC 4YSXB 3W1SA 1XLNA 1KH0A 5FKAC 2BBCA 3BVMA 2N9KA 3P4QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMC A;  2WNM A;  4LK0 M;  4LLG M; 
#chains in the Genus database with same CATH topology
 4HDO A;  1DGJ A;  1F77 A;  1XD3 B;  2W9N A;  1WXS A;  2RGF A;  2QC8 A;  1JWS D;  1VR9 A;  2WXG A;  4BBN F;  3IVF A;  1TKG A;  1WFY A;  5IN7 A;  1T5X D;  1YMH E;  1D5X C;  2PJH A;  5E6J A;  3AB5 A;  5MPO A;  1WJ4 A;  1E0Z A;  1LQB A;  4MH8 A;  3W5V B;  3ZGZ A;  4ZHO A;  3KYD D;  3MP9 A;  4WAF A;  3DBH I;  1CZP A;  1SEB D;  1HE8 A;  1L5P A;  1V49 A;  2KC1 A;  2L0T A;  4BKS A;  4HJK A;  4ICV A;  3NS1 A;  4LNI A;  1YJJ A;  2GMI C;  3VHT C;  2IBI B;  2W54 A;  1GOZ A;  1TT5 B;  4BBN C;  1EWC A;  4CHK A;  4NJC A;  4M8M A;  2LRW A;  1BXT A;  3KLS X;  1WYG A;  3ZNI D;  3DPD A;  2N9E B;  1SGH A;  5JXV A;  5GMV A;  4FLH A;  1KLG D;  1XT9 B;  2XK5 A;  2B76 B;  1WGY A;  4LTU A;  4ARC A;  4BOS C;  4JGH B;  1HA5 A;  3VRA B;  3BYT B;  2KK8 A;  2OJW A;  2BKF A;  5TR5 A;  2QSD A;  1E10 A;  3A33 B;  4XC2 A;  3SDL C;  3Q14 C;  1WE7 A;  4RM9 A;  2D3A A;  2KVZ A;  2NTT A;  1E5W A;  3ALB A;  2FCM A;  2KXJ A;  5IAA C;  3ZUN A;  3L17 A;  2KN4 A;  1C9F A;  2DYO A;  2CU1 A;  2XNA C;  3Q2A C;  3B9J A;  2HE7 A;  2V3N A;  3NZS A;  3ZNH B;  2C9W B;  1FD6 A;  2JU6 X;  2LWP A;  1T0S C;  1QOB A;  1E6E B;  2PTL A;  3AN1 A;  5D7G A;  3APF A;  2DZK A;  3DCG A;  4AJW A;  3IFW B;  5H8Y E;  1ZPS A;  3T3N A;  4TQ0 A;  3ONS A;  1CK1 A;  3E9S A;  5HHD G;  1JRO A;  2IGG A;  1V2Y A;  2KMC A;  3DHI C;  4HCN B;  2YVC A;  2LVP A;  2YLM A;  2BTE A;  4IWO A;  3PS6 A;  2KFJ A;  4HLE A;  1L6U A;  2WU2 B;  1V80 A;  1E8Z A;  2WXN A;  3ZIM A;  3Q3J A;  5L95 C;  1F1H A;  4L1B A;  3UIO B;  2ZPY A;  4XGA B;  1E9M A;  2WGS A;  4EUT A;  3H9D A;  1JWU D;  3CWI A;  1Y56 A;  3KUZ A;  3KUC B;  2DYM A;  1QQR A;  3ETR A;  1NYR A;  1SE3 A;  1DOY A;  1WE6 A;  1LFD A;  2BQQ A;  1UWM A;  3D32 A;  2SAK A;  3IHP C;  3AMZ A;  2BS2 B;  3V61 A;  3T3O A;  3DHG C;  3RZF A;  4K7W A;  2KKC A;  4JE3 B;  3N9Y C;  4B95 A;  1JCK B;  1C4A A;  2D2Q A;  2WWZ A;  2D5G A;  1GPX A;  5H92 C;  4YSZ B;  4IM0 A;  1QOG A;  1KFY B;  3PHX B;  1DOX A;  3DBH B;  2IO2 B;  4GN1 A;  1TZO A;  1TS4 A;  4NY0 A;  4BOZ B;  3Q3O C;  1I7H A;  2RMM A;  2WXR A;  3P2B A;  4MGI E;  4PT5 A;  4USA A;  3KQ4 A;  4XDC A;  1ZGU B;  1P98 A;  2LUM A;  5EDS A;  2FUH B;  2BF8 B;  3VUY A;  3LYY A;  4NAW A;  4JWU C;  1PFD A;  4QAY A;  1WM3 A;  1FRR A;  1L4Z B;  1GC6 A;  3ML9 A;  2BT6 A;  2L8J A;  3ZO5 B;  5TSS A;  2WLB A;  1DOI A;  3AM9 A;  4EKU A;  5I4D A;  2NS5 A;  3PVL A;  2FCN A;  1T0R C;  2RPQ A;  4PYU A;  3NZU A;  1VCB A;  2PVG C;  3IT4 B;  5BO4 B;  4FJV B;  2WXM A;  3X23 A;  3PRM B;  1YN3 A;  1I35 A;  2N1W A;  2INP E;  2ZNV C;  3GOE A;  1N5W A;  3L13 A;  1SF0 A;  1KOT A;  1P9D U;  4AOF A;  2CR5 A;  4GOC A;  2V1Y A;  3VUX A;  1MJD A;  3QAR A;  2G3Q B;  2GI9 A;  3EC8 A;  3WAN A;  2K25 A;  4DHZ B;  1YQ3 B;  3AUL A;  2Z59 B;  3JYU A;  1KF6 B;  4A8X C;  1J7A A;  3I3T B;  5DPT A;  4DBG A;  2KLG A;  1WR1 A;  4AQ7 A;  4RMA A;  3U52 E;  1K51 A;  1JAL A;  1YNT E;  1MG8 A;  2O6V A;  1WM2 A;  2PKO A;  1L2N A;  1D4B A;  3VAW A;  4WUR A;  1D5M C;  1SIJ A;  1EF5 A;  5CHW A;  2AWT A;  4NJ7 A;  1TS3 A;  1XCQ L;  2K8C A;  3P4P B;  2JYE A;  3V3X A;  4FUL A;  2NPT B;  3MHS D;  3ZNZ B;  2M0X A;  2UYZ B;  1TKY A;  1XF5 L;  4MJS B;  1K50 A;  1OGW A;  2N9X A;  1WRI A;  2WX0 A;  3VTV A;  4W9E A;  1I4R A;  1BUI C;  3NHE B;  2M0A A;  3DBL B;  1F9J A;  3CF6 E;  2DLB A;  1JQ4 A;  2JUO A;  3KYC D;  4KGR A;  4TQ1 A;  3NZ3 A;  1IUE A;  1PYW D;  3RZW C;  1PDX A;  3TEW A;  4I6N B;  5G5G A;  3W1Y A;  5DPW A;  1M94 A;  3B08 A;  5L83 A;  1WSP A;  2G45 B;  3KW5 B;  4PK1 A;  4ANV A;  3I9V 1;  3DVN V;  1TY2 A;  1ZKH A;  2MEK A;  2WDR B;  5KHO A;  4XWT A;  1U4A A;  4A55 A;  1AYF A;  1YQB A;  2RR9 A;  1XQQ A;  4E71 A;  2J0M A;  4MH0 E;  2AEH A;  2R2O A;  2O2V B;  3EFC A;  4H2A A;  1R7S A;  4EZL A;  3ZKJ C;  2JVC A;  2CJO A;  1AW7 A;  2WDV B;  3K9O B;  1IGC A;  2IDY A;  2K8B A;  2KLC A;  2MRP A;  5EE3 A;  2IPK D;  2M1M A;  4W9F A;  3VRB B;  5FR3 A;  4OVZ A;  2IO3 B;  4JPS A;  1NDD A;  2QEJ C;  2GBK A;  1KM7 A;  2BBC A;  2L0F A;  4FN2 A;  3P4Q B;  1L0V B;  3RUI B;  2K22 A;  2ASQ A;  3FC4 A;  3VH3 B;  1WJ6 A;  2DEN B;  5DPS A;  4MEM A;  2N4F A;  4YWG G;  1J7C A;  2BWE S;  1K52 A;  4L2Y A;  1J0G A;  1OQR A;  1IBX B;  1I42 A;  3NVV A;  2RSU A;  3UIN B;  2FCQ A;  1EM7 A;  3M63 B;  1H4R A;  1XLP A;  1H8C A;  4AUQ C;  3R7R A;  2G4S A;  2N7J A;  3ABV B;  4G3X B;  2RDG A;  1D6E C;  2JRI B;  2MP2 A;  2DX5 B;  5HKH A;  2VZK D;  3I57 A;  2X38 A;  4XDD A;  2KX0 A;  3R2I A;  2V9H A;  3PLU A;  3L16 A;  4NQK E;  1P7F A;  2KQ7 A;  5G2N A;  3ZVV A;  3NVZ A;  3V62 A;  2IJ0 A;  3H8H A;  2TSS A;  2LAS A;  2WXH A;  5LXH A;  2BWF A;  4ZYS A;  3QHT A;  4IDI A;  2LMC A;  3O65 B;  2JY6 A;  1V1P B;  2Y5C A;  3K9P B;  4YSY B;  4AWJ A;  3N32 A;  3R8B A;  3BK1 A;  2LXA A;  2WNM A;  3VR8 B;  1HTO A;  1T6B X;  4KGS A;  3TUO A;  1BT0 A;  4HWI B;  1KJT A;  1WGK A;  2XBB C;  2KT7 A;  1SJH D;  3FIL B;  1NI2 A;  2WXK A;  5AZF A;  3ZNG C;  1FNV A;  2CJN A;  2BVC A;  1F2R C;  3BK2 A;  1ZP0 B;  4N9F 4;  4HK2 A;  1MFW A;  2BW2 A;  2KTR B;  4HPP A;  2MW5 A;  4DDG D;  1ZDX A;  1GB1 A;  2UWQ A;  1JWM D;  2JWU A;  1F2R I;  1FEH A;  3ZTC A;  4W9L A;  2Z0D B;  3RFZ B;  1FPY A;  1L7Y A;  4ZOH C;  1IPG A;  1P7E A;  3RMK C;  2EMT A;  4MSQ B;  3PRP B;  4P7I A;  4ARI A;  2JZP A;  2L00 B;  2A4Z A;  3Q8A A;  1A5R A;  2KDE B;  1V8C A;  4GSW A;  2WXQ A;  2YEP F;  4J3O D;  4EZJ A;  2JX5 A;  3S2A A;  2O6V D;  2ZEQ A;  3W1S C;  3H7S A;  3E56 A;  4GIV A;  2REX A;  1YX6 B;  1QLB B;  3WA0 A;  4A3O A;  3C19 A;  4K7U A;  4MM3 B;  4NJ6 A;  1VJK A;  4OHJ A;  2LZ6 A;  2GBJ A;  2BS4 B;  3SFD B;  2KVR A;  3ZTD A;  1Q10 A;  2WS3 B;  2AQ2 B;  2E3T A;  5D94 A;  4HKQ A;  3IBE A;  1PGA A;  4K3B A;  4RGT A;  4M0W B;  3UQA A;  1RFA A;  2KMM A;  3W9C B;  4WJO A;  2O2V A;  3ZJV A;  5HFY A;  1WZ0 A;  2QDF A;  1LM8 B;  2V4L A;  3WAO A;  3AU5 A;  1FFU A;  3AE5 B;  1FNW A;  4MGZ E;  4URK A;  4FHJ A;  3X0W A;  4TKN A;  2KNB A;  4E74 A;  2ZCC A;  4HXD A;  2JWZ A;  1OEY J;  2AYO B;  4GLS C;  4ZRP A;  1R4N I;  3AE6 B;  4B6W A;  2MCN B;  5EE0 A;  1OFF A;  1TS5 A;  4A90 A;  1Q5W B;  2D3C A;  1SXT A;  2VH2 A;  3RNB C;  1TY0 A;  4K7S A;  4GGQ A;  2ZJD A;  3HK0 A;  3H7P B;  3RD2 A;  3T9L A;  4OVU A;  3BZD B;  1RFK A;  3B2F A;  3RNC C;  2LI5 A;  1ET6 A;  1CJE A;  1R4M B;  5JZE B;  2RDB C;  2OOB B;  1YQ4 B;  4LJO B;  2OED A;  3UF8 A;  1ISN A;  2XK5 B;  2BB6 A;  3IAS 1;  4WQM A;  2JF5 A;  1SE4 A;  1V1O A;  1T0Q C;  1RRB A;  2GB1 A;  1WX7 A;  3SU8 X;  2AL3 A;  3GB1 A;  1E90 A;  2G1E A;  4HVB A;  4B0E A;  2LGY A;  1UEL A;  3SHQ A;  2D3G A;  4LNF A;  4HDQ A;  1Z2M A;  3ML8 A;  2DAJ A;  2FCS A;  5CHV C;  1C79 A;  3OJ3 A;  2MX2 A;  4JL9 A;  2KFK A;  4EE2 A;  3NUH B;  1TYG B;  1SIF A;  2K3U A;  3SEB A;  2LRU A;  4JQW C;  3OWE B;  3Q8F A;  1NI3 A;  3AE3 B;  2L76 A;  4IM3 A;  2NBW B;  4XE0 A;  1GB4 A;  3DBR B;  5AZH A;  1QT9 A;  4CYE A;  1TJE A;  4KZC A;  4ZYN A;  2KJH B;  2ON8 A;  1TS2 A;  4YTM B;  2KOX A;  3DVG X;  5IO9 A;  2IND C;  1VLB A;  1E7P B;  4A6Q A;  3A4S C;  5AEK B;  2FIF A;  2H88 B;  2QJL A;  2R2Q A;  2KX3 A;  1OEY A;  4KZ0 A;  3OG5 A;  3IG3 A;  3JW0 X;  1F52 A;  3AE9 B;  4NPN A;  3EA6 A;  2NBV B;  4W9K A;  2L7R A;  5JH5 C;  2N1V A;  1IP9 A;  1C3T A;  1I4P A;  4BFR A;  2DHZ A;  5FR6 A;  4WJQ A;  1EUV B;  2KDM A;  3TMP B;  4C7Z A;  3EUB 2;  3ZQ4 A;  4JLC A;  1JWB D;  5J17 A;  4ACF A;  3W2D A;  1STE A;  1GUA B;  4J6I A;  4OW0 A;  1IBX A;  3DOW A;  3B1L X;  2WXP A;  1QIL A;  4HRS A;  1WGD A;  1JW9 D;  4RNA A;  2WDQ B;  3QAQ A;  1YN4 A;  1N61 A;  2L83 A;  3ZJU A;  2I2Y A;  2IO1 B;  4TMA B;  1AWD A;  2MSE D;  3DWG C;  3WIM A;  1P3Q U;  1L0Y B;  2HD5 B;  2J4X A;  4WH4 A;  2KDB A;  3RI7 C;  4BZA A;  4DXG A;  3CST A;  3QQ8 B;  3LXF A;  3P4S B;  2KN5 A;  1P1A A;  4M00 A;  4ZHP A;  1ZXH A;  3U8Z A;  2E6X A;  2RPV A;  4BKG A;  3VFK A;  2L52 A;  2MWS B;  2KD0 A;  2EEL A;  3HUI A;  4FHK A;  3NS8 A;  1UH6 A;  5D3D A;  4ANX A;  2KDF B;  1K53 A;  3J9C A;  3UI3 A;  3UIP B;  2WX1 A;  3LB8 C;  3URY A;  3AED B;  4DWF A;  4EZK A;  4K3C A;  2LGX A;  2ZVN A;  3NVY A;  2PW9 A;  1WGG A;  3ZLZ A;  3AEE B;  4XZ4 A;  4L23 A;  1UZX B;  2G9H D;  1HZ5 A;  3ECI A;  3H7P A;  3W1S A;  4ZDV A;  1KH0 A;  3HIZ A;  2N9K A;  2KTR A;  4BAX A;  1J19 A;  1WZ3 A;  1WJU A;  3DWM A;  3NVW A;  4II3 B;  4PYZ A;  4RGO S;  1R4M I;  2QIE B;  4JX1 C;  4RF0 A;  1I4X A;  1NYQ A;  1ZE3 D;  4BKS D;  2BYT A;  3VTU A;  2R61 A;  4WAA A;  2AQ1 B;  5HG2 A;  2MLB A;  4WWN A;  2JZZ A;  2ZZP B;  4ZRK A;  4DQO C;  1JML A;  4MT5 A;  1LGR A;  3GE3 C;  4US9 A;  1HZ6 A;  5IKC M;  3EHV A;  3ZJT A;  2O6V B;  3AXC A;  2IY1 B;  3BVZ A;  3AU4 A;  2PVO D;  3GS2 A;  2VZK B;  3EGR A;  1QF6 A;  1MI0 A;  1V86 A;  3RT3 B;  3CSF A;  2DZJ A;  2V3S A;  2HJ8 A;  2KWC A;  4WIP A;  3AI5 A;  3TL5 A;  3BVG A;  1N5X A;  4JIO U;  1N62 A;  3UGB B;  3HHM A;  2JXT A;  2KYW A;  5CX3 A;  5EE1 A;  1I4H A;  2W55 A;  5BYS A;  3H1U A;  4GXB A;  4LNO A;  1HXY D;  3BIN A;  4NZL B;  4LDT D;  2KAN A;  2K6Q A;  1RAX A;  2Z8L A;  4RGM A;  1WX8 A;  4N58 A;  3OJ4 B;  2GOW A;  2NVU I;  1KRH A;  5LLI A;  5LNK 1;  2XN9 C;  1N6Z A;  1YX5 B;  2KWU B;  2G4D B;  4MM3 A;  3DBS A;  2KMA A;  3MJ5 A;  1QOF A;  2M8S A;  1GC7 A;  1GNU A;  5E6P A;  2NTS A;  3GZN I;  2ZVO A;  4WQO B;  3DVN U;  2CHX A;  1OQY A;  1K8R B;  1N60 A;  2C7H A;  2RD0 A;  4CO7 A;  1NEN B;  2BS3 B;  4NNJ B;  3B2G A;  2OHF A;  1L0X B;  4F7Z A;  1ZDV A;  5BMG A;  1S3S G;  2DZI A;  4A9A A;  3HVD A;  3MC0 B;  2KHW B;  2Y3A A;  5KHQ A;  4R3D A;  4KKI A;  4YL8 A;  5BYR A;  3L0W B;  1V9J A;  4TV3 A;  3ZDT A;  1SJE D;  3WAP A;  3QC8 B;  2L32 A;  4TUU A;  3WAL A;  2J53 A;  1SE2 A;  2LGD A;  2WHI A;  4HCP B;  2HTH A;  1I4Q A;  2DWQ A;  3Q69 A;  4C80 A;  2LGS A;  4YT0 B;  2C60 A;  1G6J A;  2RDH A;  4ANW A;  4OVV A;  4DXF A;  4C56 C;  2HJ1 A;  4NAM A;  3IAM 1;  2GBM A;  2W82 A;  1XCT L;  1ESF A;  1WMH A;  1FCL A;  2K1F A;  1D5Z C;  1WXM A;  5JHB A;  1KLV A;  4LLG M;  3VH4 B;  2AL6 A;  2KFK B;  3U7D A;  4EOY A;  1Y8R C;  1P0R A;  1B1Z A;  3HM3 A;  4FJY A;  1WY8 A;  4US8 A;  2VRR B;  3N3K B;  1WJN A;  4WWO A;  3T8M A;  3W5U B;  2CS4 A;  4MSM B;  3MHZ A;  3DBL I;  1WGH A;  2DBY A;  2WQY B;  1VZ7 A;  4YTN B;  4KDL B;  1AAR A;  4IC7 B;  1UUP A;  4Q2J A;  1EF1 A;  1FCC C;  1L6V A;  3L54 A;  3APD A;  2MJE A;  3PSE B;  2M17 A;  3CIR B;  3DVG Y;  2C5L C;  3Q3M C;  3L4P A;  1IGD A;  1DYQ A;  3JSV B;  5EE9 A;  4N59 A;  3KWL A;  4YTP B;  3EFU A;  3AE7 B;  3RNG C;  3HVZ A;  1E8W A;  3PT2 B;  1WF9 A;  3MC9 A;  2WYQ A;  4KIK A;  5CTR C;  4C00 A;  1FNU A;  2FNJ B;  3FIL A;  2N9P C;  3LDZ E;  4RGN A;  2L05 A;  1NVI D;  5IA7 A;  5AZG A;  3GE8 C;  3TCA A;  4G11 A;  5BMI A;  3PPA A;  3N20 C;  2J42 A;  3A9K A;  3GZN B;  2ZCB A;  2GBN A;  1C4C A;  1FXI A;  2MBB B;  3NRZ A;  3H6N A;  1T3Q A;  2WDT B;  1PQS A;  2JSV X;  4FAD A;  1JRP A;  4S17 A;  3VUW A;  1GG3 A;  4A3P A;  4B9K A;  4KVG B;  4IKG A;  2C7M B;  3A9J A;  3ZXR A;  2M19 A;  1EU3 A;  1E7U A;  4I6P A;  2QIL A;  2LVO A;  3VXW A;  3SFE B;  1WR6 E;  4ZRQ A;  3BYY B;  1HEZ E;  3JSV A;  1MVK A;  1UF0 A;  3OLM D;  4K81 A;  2CHZ A;  2FID A;  2QHO A;  3MC8 A;  1ZXI A;  5J2R A;  2JRH A;  2LJI A;  3MFG A;  2PMV A;  3SD5 A;  4DK5 A;  5GXG B;  2KJ6 A;  2PIA A;  2KAC A;  3PTF C;  1PGB A;  1SBB B;  2N7E A;  3KUD B;  3TSS A;  4KSL C;  3QA8 A;  2M56 B;  3A9K B;  3PZD A;  4LNK A;  1OQQ A;  4NAW B;  1F0Z A;  2PLP A;  1WGR A;  5IOI A;  2LJ5 A;  3PRE A;  2Y5B B;  4RH6 A;  4M8N A;  2LXC A;  4LCD E;  1VZ6 A;  2MP2 B;  1E7V A;  2FE8 A;  4P6V F;  1PGX A;  2I1J A;  2J0J A;  1V1P A;  1MG4 A;  5BYQ A;  1SE9 A;  3O13 A;  4FBJ B;  3AH7 A;  2MBQ A;  3BWU D;  2KWV B;  2MJ3 A;  2V3P A;  1WXV A;  4IWP A;  5E6O A;  2FAZ A;  2LEK A;  3FAH A;  4GMV A;  3NJT A;  2IO0 B;  4HRO A;  3WAM A;  3RN9 C;  2YEP B;  1YOV B;  2INN E;  1XLO A;  1FO4 A;  2L1A A;  3I63 C;  1FFV A;  1OTR B;  2H89 B;  3AEB B;  2DYB A;  2GLS A;  3AEC B;  4OZB A;  1LO5 D;  4IG7 B;  3Q6B A;  2AX5 A;  3R66 C;  4WJP A;  3RCZ A;  4ICU A;  3KH0 A;  4GDL B;  4LJP B;  1AN8 A;  4ANU A;  1EWY C;  2N0S B;  2CHW A;  3PLV A;  3SR6 A;  5J18 A;  2PEA A;  3N1Z C;  2ACZ B;  1C77 A;  3AEA B;  3EEC A;  5FK9 C;  1TIF A;  1WXQ A;  2BGF A;  2INC C;  4YSX B;  1XLN A;  5FKA C;  3BVM A;  2KZR A;  1CQV A;  3U2S C;  2EKE C;  4UDU C;  4HKZ E;  4PS7 A;  2K9X A;  2N9L A;  1V97 A;  4P1B C;  4XWW A;  4G50 A;  4MGY E;  4KGT A;  1VZ8 A;  3ZXV A;  4GDK B;  3JVZ X;  2XEW A;  1E8Y A;  3A1Q A;  4IUM B;  4HPM B;  4DDI D;  2Y5P A;  3M95 A;  4W9I A;  1FRD A;  3AE4 B;  3PV1 A;  5C23 A;  4KX6 B;  1Q1O A;  2DZM A;  4KDI C;  4ITK A;  3RPF C;  1EU4 A;  3V6C B;  2KJR A;  3TEY A;  4IM2 A;  2J0K A;  4MDK E;  3DQV A;  4P16 A;  5D3I B;  1UBI A;  2LUE A;  2KAJ A;  1WYW B;  1V81 A;  3NG0 A;  4D2K A;  4BKT A;  2ZPN A;  4RFB A;  1QKZ A;  4RCO A;  4A20 A;  4GDK A;  1WX9 A;  3C0R B;  5IP4 D;  5T8I A;  1WIA A;  3M62 B;  3M3J A;  3U7Z A;  1NEK B;  3ZDM C;  2K5P A;  2LVQ A;  4GU2 A;  1XO3 A;  2L3Z A;  2EMS A;  3OAW A;  3FKY A;  4XYC A;  1UWX A;  1FM0 D;  2BB5 A;  1SSN A;  4DHJ B;  3N1X C;  4S0R A;  4YXD B;  1QOA A;  3A4R A;  4DHZ E;  1ZUD 2;  5DCN A;  4KSK C;  3L10 B;  4EFO A;  3VDZ A;  2HTM E;  2MJD A;  3HRD D;  4C4V A;  4AS1 A;  3NOB A;  1V5O A;  2ZNV B;  4LNN A;  1FXT B;  1I4G A;  2WU5 B;  4FA6 A;  1MPE A;  2UU7 A;  1TZ1 A;  1E8X A;  2J7Q B;  1LXD A;  1M4V A;  1D3Z A;  1UD7 A;  2IYD B;  2MBE A;  4W9J A;  3PRZ A;  4MEL A;  5E6N A;  2MQJ A;  3I5J C;  4WWM A;  2IZV B;  3NY5 A;  1QZE A;  3TEZ A;  2FUG 1;  3N30 A;  4KV2 A;  1V6E A;  4PS8 A;  4HPL B;  2WXL A;  2JYT A;  4MGK E;  2MBO A;  4AP4 C;  3WCQ A;  2NMQ A;  3AE1 B;  2KDI A;  2KC2 A;  3HM6 X;  4RF1 A;  3RNA C;  3BII D;  2WP9 B;  3L08 A;  4LK0 M;  4W9H A;  4MAC A;  1ACC A;  2JXX A;  3R3M A;  2DAF A;  4PS3 A;  2ZW1 A;  2PPH A;  1UBQ A;  4OZC A;  1UGM A;  4X57 B;  4P1C C;  3DHH C;  1TTN A;  4DHJ D;  2WXO A;  1PUT A;  3Q8C A;  1ROE A;  4M0W A;  3VVW B;  3PZ8 A;  3PO0 A;  1MHX A;  4E3C A;  4HEA 1;  2EKI A;  2IY0 B;  3ENE A;  1YJ1 A;  2V0G A;  2D11 A;  2ONQ A;  1FMA D;  1CMX B;  2WXI A;  2QCZ A;  3U30 A;  4WWP A;  4WJN A;  5DPR A;  2X8X X;  3N1Y C;  1YIW A;  1L4D B;  4C7Y A;  1HTQ A;  3RYT A;  2J52 A;  2K0P A;  3IT6 B;  3Q3N C;  3ZRF A;  4BVU C;  2NBU A;  1FXA A;  3V60 A;  5D6J B;  4ASW C;  3CMM B;  1GAQ B;  2PE9 A;  1C4P A;  2OJR A;  3QCA A;  4HJG E;  2W3R A;  5C3J B;  1SB3 C;  1WMH B;  4IOI E;  1C76 A;  2K8H A;  2WXJ A;  2Z0E B;  1NBF C;  3ZW3 A;  2LD9 A;  2LHD A;  4CQN A;  1Q0W B;  2M4N A;  3QWZ B;  1KLU D;  1TGZ B;  3A1Q B;  3P63 A;  3KWV A;  1VRA B;  1TBE A;  3MTN B;  2BKR B;  2MH7 A;  4I6L B;  4F8C B;  1N63 A;  4KKJ A;  1KTK A;  2JZ3 B;  2I38 A;  1WRD B;  2K39 A;  2KQS A;  3Q8E A;  1IYF A;  3QK0 A;  1S1Q B;  2JQR B;  4W9G A;  4MJS A;  4RM8 A;  2SEB D;  1EO6 A;  3Q3F A;  1JRU A;  3AEF B;  4IWQ A;  2ICI A;  1J7B A;  4LDT B;  4ZRI A;  4C4V B;  2LGI A;  3AE8 B;  3RUL A;  1XEE A;  2W3S A;  4DXA B;  3P1M A;  3VTW A;  1ENF A;  1FIQ A;  2A5U A;  2LHE A;  1A70 A;  1HQR D;  1RYJ A;  3VQI A;  1Z5S B;  3UQB A;  4FJZ A;  4EEW A;  2KO3 A;  5G55 A;  2CU3 A;  1ET9 A;  1T0Y A;  4AJY B;  3P42 A;  3DDC B;  3C8Y A;  3PZ7 A;  2NCN A;  5JHA A;  1J8C A;  4KIK B;  1YN5 A;  4F1S A;  2V4I B;  3PHW B;  5BMH A;  3A9J B;  5D2M B;  3MJW A;  3AEG B;  1ZOY B;  1B9R A;  4W9C A;  2BPS A;  3ZYY X;  2B3A A;  2LFI A;  2GBR A;  4XX5 A;  1UGJ A;  2JPH A;  5AUI A;  2D10 A;  4GDL A;  1GJZ A;  4M01 A;  4TSS A;  1WWT A;  1VDV A;  2MHJ A;  4O1N A;  3Q8B A;  4IW0 A;  2ZW0 A;  5G5H A;  2D3B A;  4W9D A;  3IXS A;  1TKE A;  3QX1 A;  4GB9 A;  3V6E B;  2D07 B;  2PE6 B;  5C1Z A;  2GRI A;  3KVF B;  1RWS A;  4II2 B;  4NQL B;  3QJZ A;  3U4E G;  1RM6 C;  3AV8 A;  4G0N B;  1XLQ A;  3TEX A;  2N7D A;  1WI0 A;  2KQ4 X;  4B0M A;  3QIJ A;  2BYF A;  5HI1 A;  1BML C;  1C1Y B;  2VH1 A;  3R2T A;  1VD2 A;  3VR9 B;  2IGH A;  1R4N B;  1C78 A;  3TJP A;  2KWD A;  2BYV E;  3V05 A;  1WH3 A;  4N6E B;  5LXI B;  1JWA D;  1ZW7 A;  3B0A A;  1RLF A;  2Q5W D;  1X1M A;  2JT4 B;  4M02 A;  3PGE A;  4OZA A;  3RNF C;  4JWS C;  2KTF A;  3DBR I;  3ZRC A;  2MBH A;  3LJ3 A;  3BY4 B;  1V5T A;  2WXF A;  3AE2 B;  4REZ A;  5C2T B;  2K6D B;  5AUK A;  2FBW B;  1YJI A;  2I1K A;  1MHH E;  2IGD A;  3P4R B;  2NPT A;  3APC A;  4K1R B;  3R7Q A;  2CKH B;  1WXA A;  3TBL D;  1UNS A;  4FXC A;  2MA9 B;  3GP7 A;  1YD8 U;  3TIX A;  4ZRJ A;  2QMT A;  2AQ3 B;  1XXG A;  3RNE C;  5CHF A;  2C7N B;  2HDE A;  2DNF A;  2BYE A;  2NR2 A; 
#chains in the Genus database with same CATH homology
 1CQV A;  1L0V B;  1DGJ A;  1F77 A;  2K22 A;  3U2S C;  3FC4 A;  4UDU C;  4HKZ E;  2K9X A;  3DWM A;  2N9L A;  1V97 A;  3NVW A;  4XWW A;  4RGO S;  4KGT A;  2QIE B;  4JX1 C;  4RF0 A;  4YWG G;  1VZ8 A;  1JWS D;  1J7C A;  1I4X A;  1NYQ A;  1VR9 A;  1ZE3 D;  2BYT A;  2WXG A;  1K52 A;  4L2Y A;  4GDK B;  1TKG A;  2R61 A;  1OQR A;  2AQ1 B;  5HG2 A;  1T5X D;  1YMH E;  2Y5P A;  1IBX B;  4DQO C;  1JML A;  1D5X C;  3NVV A;  4MT5 A;  4US9 A;  5E6J A;  1FRD A;  3AB5 A;  1EM7 A;  1HZ6 A;  3AE4 B;  5MPO A;  1XLP A;  3ZJT A;  1E0Z A;  4KX6 B;  2N7J A;  4ITK A;  4MH8 A;  3RPF C;  3W5V B;  1EU4 A;  4ZHO A;  3ZGZ A;  3BVZ A;  3TEY A;  3ABV B;  3MP9 A;  4WAF A;  2RDG A;  2PVO D;  1CZP A;  1SEB D;  3GS2 A;  2VZK B;  3EGR A;  1QF6 A;  1L5P A;  1D6E C;  1MI0 A;  4P16 A;  5D3I B;  2VZK D;  2KAJ A;  3I57 A;  2X38 A;  3NS1 A;  4XDD A;  1YJJ A;  4WIP A;  4D2K A;  3BVG A;  4RFB A;  1N5X A;  2W54 A;  1GOZ A;  1QKZ A;  4RCO A;  1EWC A;  1N62 A;  3R2I A;  4NJC A;  1BXT A;  3KLS X;  1WYG A;  2JXT A;  1P7F A;  5JXV A;  5T8I A;  5EE1 A;  3NVZ A;  1I4H A;  1KLG D;  2W55 A;  5BYS A;  2B76 B;  2IJ0 A;  3U7Z A;  3H8H A;  1NEK B;  2TSS A;  4LTU A;  1HXY D;  2K5P A;  4ARC A;  2WXH A;  4NZL B;  1XO3 A;  1HA5 A;  3VRA B;  3BYT B;  4ZYS A;  4IDI A;  1UWX A;  1FM0 D;  2BB5 A;  1SSN A;  2LMC A;  1V1P B;  4YXD B;  2QSD A;  2Z8L A;  4RGM A;  2Y5C A;  1E10 A;  1QOA A;  4N58 A;  4YSY B;  1ZUD 2;  3R8B A;  1KRH A;  3BK1 A;  5LNK 1;  2NTT A;  2WNM A;  3VR8 B;  2XN9 C;  1T6B X;  4KGS A;  3TUO A;  2HTM E;  1WGK A;  2KN4 A;  2MJD A;  3HRD D;  2DYO A;  1C9F A;  1SJH D;  2XNA C;  4AS1 A;  3MJ5 A;  3B9J A;  1QOF A;  3FIL B;  2V3N A;  2WXK A;  1I4G A;  2WU5 B;  1FD6 A;  2JU6 X;  1MPE A;  1FNV A;  2CJN A;  1QOB A;  1E6E B;  2PTL A;  1F2R C;  3BK2 A;  2NTS A;  1ZP0 B;  3AN1 A;  5D7G A;  1M4V A;  2BW2 A;  1N60 A;  5H8Y E;  1ZDX A;  1ZPS A;  1NEN B;  2BS3 B;  1GB1 A;  1JWM D;  3T3N A;  3B2G A;  2JWU A;  1F2R I;  1FEH A;  4TQ0 A;  2OHF A;  4WWM A;  1CK1 A;  3E9S A;  5HHD G;  1JRO A;  3RFZ B;  1L0X B;  2IGG A;  1ZDV A;  5BMG A;  2BTE A;  3TEZ A;  4ZOH C;  2FUG 1;  4A9A A;  1P7E A;  3HVD A;  3MC0 B;  2Y3A A;  2WXL A;  2JYT A;  4R3D A;  4ARI A;  4KKI A;  1L6U A;  2JZP A;  5BYR A;  3Q8A A;  2WU2 B;  3WCQ A;  1SJE D;  2NMQ A;  3AE1 B;  2WXN A;  4RF1 A;  2L32 A;  3BII D;  2WP9 B;  4LK0 M;  1V8C A;  2J53 A;  2WXQ A;  1SE2 A;  4MAC A;  1ACC A;  2YEP F;  4L1B A;  1I4Q A;  2DWQ A;  3Q69 A;  4J3O D;  2JX5 A;  4C80 A;  2ZW1 A;  4YT0 B;  1E9M A;  3E56 A;  4OZC A;  2RDH A;  1JWU D;  3CWI A;  4DXF A;  1Y56 A;  2DYM A;  1QQR A;  3ETR A;  4C56 C;  4NAM A;  1QLB B;  3IAM 1;  2W82 A;  1XCT L;  1NYR A;  2WXO A;  1PUT A;  1ESF A;  1ROE A;  1SE3 A;  3Q8C A;  4M0W A;  1DOY A;  3PZ8 A;  1FCL A;  4MM3 B;  1UWM A;  1D5Z C;  1VJK A;  3PO0 A;  4OHJ A;  1MHX A;  2BS4 B;  3SFD B;  2SAK A;  3AMZ A;  4LLG M;  2BS2 B;  1Q10 A;  2WS3 B;  4HEA 1;  2AQ2 B;  2E3T A;  3T3O A;  2EKI A;  4HKQ A;  1PGA A;  4RGT A;  2V0G A;  1B1Z A;  2ONQ A;  1FMA D;  2WXI A;  4JE3 B;  3N9Y C;  2KMM A;  4US8 A;  3W9C B;  1JCK B;  3ZJV A;  1C4A A;  5HFY A;  3W5U B;  2D5G A;  1FFU A;  3AE5 B;  1GPX A;  5H92 C;  1L4D B;  4C7Y A;  3MHZ A;  4YSZ B;  2J52 A;  2K0P A;  3IT6 B;  1FNW A;  1QOG A;  2DBY A;  2WQY B;  1VZ7 A;  4YTN B;  1KFY B;  1FXA A;  1UUP A;  1DOX A;  4Q2J A;  1L6V A;  1FCC C;  1TZO A;  2MJE A;  1TS4 A;  4GLS C;  4ZRP A;  1GAQ B;  1I7H A;  2RMM A;  1C4P A;  3AE6 B;  2WXR A;  5EE0 A;  1OFF A;  1TS5 A;  4PT5 A;  3KQ4 A;  4USA A;  3CIR B;  1SXT A;  4XDC A;  4A90 A;  1TY0 A;  4HJG E;  2W3R A;  5C3J B;  1SB3 C;  2LUM A;  4IOI E;  3L4P A;  1C76 A;  3LYY A;  2WXJ A;  1IGD A;  4JWU C;  1PFD A;  1DYQ A;  3BZD B;  2LHD A;  4CQN A;  1FRR A;  1RFK A;  1L4Z B;  3B2F A;  1ET6 A;  2BT6 A;  1CJE A;  5EE9 A;  4N59 A;  1KLU D;  5TSS A;  2WLB A;  1YQ4 B;  1DOI A;  2OED A;  3AM9 A;  3KWL A;  4YTP B;  5I4D A;  3P63 A;  3KWV A;  3AE7 B;  1VRA B;  2BB6 A;  3HVZ A;  3IAS 1;  4WQM A;  2MH7 A;  1SE4 A;  1FNU A;  1V1O A;  2PVG C;  3IT4 B;  1N63 A;  2WXM A;  3FIL A;  4KKJ A;  1KTK A;  1YN3 A;  4RGN A;  1NVI D;  2INP E;  2GB1 A;  1N5W A;  2I38 A;  3Q8E A;  3GB1 A;  1SF0 A;  2G1E A;  2JQR B;  4B0E A;  5BMI A;  2SEB D;  3AEF B;  2J42 A;  2GI9 A;  2ICI A;  1C4C A;  1FXI A;  1J7B A;  1C79 A;  3NRZ A;  1YQ3 B;  2LGI A;  3AE8 B;  1T3Q A;  1XEE A;  2W3S A;  2JSV X;  4EE2 A;  3NUH B;  1JRP A;  3P1M A;  1TYG B;  2K3U A;  1ENF A;  1KF6 B;  1J7A A;  3SEB A;  1FIQ A;  4A8X C;  2LHE A;  1A70 A;  1HQR D;  1RYJ A;  3OWE B;  3Q8F A;  4IKG A;  3VQI A;  1NI3 A;  3AE3 B;  4XE0 A;  2M19 A;  1GB4 A;  4AQ7 A;  3U52 E;  1EU3 A;  1K51 A;  1JAL A;  2QIL A;  1QT9 A;  3SFE B;  1YNT E;  4ZRQ A;  2CU3 A;  1ET9 A;  1TJE A;  2PKO A;  3BYY B;  1HEZ E;  1D4B A;  1MVK A;  3P42 A;  4WUR A;  1D5M C;  1SIJ A;  3C8Y A;  2ON8 A;  3PZ7 A;  1TS3 A;  1XCQ L;  1TS2 A;  1ZXI A;  4YTM B;  1YN5 A;  2V4I B;  5BMH A;  3P4P B;  2JYE A;  3V3X A;  1VLB A;  1E7P B;  4A6Q A;  2LJI A;  3AEG B;  1ZOY B;  1B9R A;  2H88 B;  2QJL A;  2PMV A;  3MFG A;  3ZYY X;  2LFI A;  1TKY A;  5GXG B;  1XF5 L;  2PIA A;  1K50 A;  2KAC A;  1UGJ A;  1WRI A;  3AE9 B;  5AUI A;  3EA6 A;  1PGB A;  1SBB B;  4TSS A;  1WWT A;  1VDV A;  3TSS A;  1I4R A;  1BUI C;  2M56 B;  4O1N A;  1I4P A;  3Q8B A;  2M0A A;  2ZW0 A;  1OQQ A;  5G5H A;  4NAW B;  1F0Z A;  2KDM A;  3IXS A;  1TKE A;  2PLP A;  4C7Z A;  3EUB 2;  2DLB A;  3ZQ4 A;  1JQ4 A;  1JWB D;  2GRI A;  4KGR A;  3W2D A;  1STE A;  3NZ3 A;  4TQ1 A;  1RWS A;  1IUE A;  1PYW D;  4RH6 A;  3U4E G;  4OW0 A;  1RM6 C;  1IBX A;  1VZ6 A;  3AV8 A;  1XLQ A;  2WXP A;  1QIL A;  2FE8 A;  4HRS A;  3TEX A;  1PDX A;  4P6V F;  1JW9 D;  1PGX A;  2KQ4 X;  4B0M A;  4RNA A;  5HI1 A;  1BML C;  2WDQ B;  3TEW A;  1YN4 A;  1N61 A;  2L83 A;  3R2T A;  3ZJU A;  1V1P A;  3VR9 B;  5G5G A;  2IGH A;  2I2Y A;  1C78 A;  5BYQ A;  3O13 A;  4TMA B;  2KWD A;  3AH7 A;  1AWD A;  1WSP A;  3DWG C;  3V05 A;  3BWU D;  3I9V 1;  4N6E B;  1L0Y B;  1JWA D;  2MJ3 A;  2Q5W D;  2J4X A;  1TY2 A;  4WH4 A;  4OZA A;  2V3P A;  4JWS C;  2LEK A;  2MEK A;  3FAH A;  4DXG A;  2WDR B;  4XWT A;  3LXF A;  3P4S B;  4HRO A;  4A55 A;  1AYF A;  2WXF A;  2YEP B;  2INN E;  3AE2 B;  1XLO A;  4REZ A;  5C2T B;  1FO4 A;  4ZHP A;  5AUK A;  1ZXH A;  2L1A A;  2FBW B;  2E6X A;  1FFV A;  2RPV A;  1YJI A;  2H89 B;  1MHH E;  2L52 A;  3AEB B;  2IGD A;  3P4R B;  3AEC B;  4OZB A;  2EEL A;  3HUI A;  4H2A A;  1LO5 D;  1R7S A;  2AX5 A;  5D3D A;  1K53 A;  2CJO A;  1AW7 A;  2WDV B;  3J9C A;  4GDL B;  3UI3 A;  1AN8 A;  1EWY C;  2N0S B;  3LB8 C;  3URY A;  1IGC A;  2IDY A;  3AED B;  1UNS A;  4FXC A;  5EE3 A;  3SR6 A;  3GP7 A;  2IPK D;  2QMT A;  2ACZ B;  1C77 A;  3NVY A;  3VRB B;  3AEA B;  2AQ3 B;  2PW9 A;  4OVZ A;  5FR3 A;  5FK9 C;  1XXG A;  3AEE B;  4L23 A;  1WXQ A;  4JPS A;  2G9H D;  1HZ5 A;  2HDE A;  2QEJ C;  4YSX B;  3W1S A;  1XLN A;  1KH0 A;  5FKA C;  2BBC A;  3BVM A;  2N9K A;  3P4Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...