4LK0M

Crystal structure analysis of the e.coli holoenzyme/t7 gp2 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
51
structure length
51
Chain Sequence
b'NKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Phage T7 Gp2 inhibition of Escherichia coli RNA polymerase involves misappropriation of sigma 70 domain 1.1.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 11
structure length 51
sequence length 51
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF16857 RNA_pol_inhib RNA polymerase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.510 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4lk0M00
2LMCA 2WNMA 4LLGM 4LK0M
chains in the Genus database with same CATH superfamily
4M00A 3Q3JA 3T8MA 3MJWA 2AQ2B 3ENEA 3TEYA 2H89B 1P1AA 3DBLI 2WDTB 1L6VA 1FNWA 4XYCA 2M19A 2KQ4X 5E6PA 1HZ5A 1GB4A 1GG3A 1PUTA 4LCDE 4KGSA 1BMLC 1MHHE 2NS5A 1HTOA 5AUIA 1WRDB 1WX9A 5LXHA 1YJIA 1V9JA 2DWQA 3VUYA 1ET6A 1PYWD 2QIEB 3AN1A 2KLGA 3K9PB 2BS2B 2KC2A 3PHWB 1TY0A 3KUCB 1WZ3A 2G45B 4XDDA 1WM3A 1IUEA 4HEA1 3PRPB 2WNMA 1P7EA 2D5GA 2R2QA 3Q14C 4AJWA 4FBJB 3KUDB 4E71A 1YX6B 4C4VB 4DDGD 2ZW0A 3A4RA 1F9JA 3ZUNA 1LGRA 1GOZA 2RD0A 3BVMA 3HVZA 4I6LB 2JYTA 4M8NA 4W9DA 1R4MI 4K3CA 2PPHA 4IC7B 3Q69A 1SIFA 2V3PA 1I42A 2N9XA 4NPNA 4W9CA 3M95A 1NI2A 2EELA 2IY1B 1NYQA 4HCNB 4AOFA 2L7RA 2LEKA 2PVGC 3R66C 5E6NA 1I4HA 3KYCD 3RUIB 2L00B 4EEWA 5D7GA 1JALA 1LFDA 1A5RA 2MLBA 2LD9A 4PYZA 2JZPA 3TEXA 4ASWC 3SFEB 1UWXA 1E6EB 4RH6A 1V80A 3CSFA 1GB1A 2WXNA 5C3JB 4IM3A 4AQ7A 2K22A 2OJRA 1ACCA 3R8BA 1FRDA 2CKHB 4JQWC 2FIFA 3Q3NC 1PGXA 1VZ8A 3ML9A 1ESFA 4GIVA 1OEYA 4A20A 2PE6B 3VQIA 5D6JB 3AEFB 1IP9A 4AUQC 1TY2A 3SHQA 2CHZA 4D2KA 4IDIA 2KXJA 1P3QU 2BQQA 2A5UA 3QCAA 2IGGA 4WJOA 1TS2A 2KVRA 1PDXA 3FKYA 4YTMB 5C23A 1FD6A 3TSSA 4ZYSA 3PRMB 3X0WA 2ZPYA 3KLSX 2KWCA 2LGSA 3PHXB 2TSSA 4KV2A 2KDIA 5JHBA 4LDTD 1IBXB 1E9MA 1V5OA 2CU3A 3DVNU 3ZO5B 1N5XA 3V6CB 3ZTCA 2PE9A 1VD2A 2W3RA 2KD0A 4GN1A 4WQMA 3GB1A 4NY0A 1RLFA 3L13A 3U52E 1D4BA 5C2TB 2MWSB 2LXAA 2JXTA 4M8MA 2KJRA 2MEKA 2IZVB 3RMKC 1VZ6A 1D5MC 3IT6B 5CTRC 2K6QA 4PT5A 1TIFA 3A9JB 1JWMD 4RNAA 1Z2MA 2CS4A 4P7IA 4F8CB 2WQYB 3HK0A 1WI0A 1XO3A 2AX5A 4WJNA 2BGFA 5DPRA 4RGMA 4OVZA 1WXMA 1C4AA 3DWGC 1KFYB 5T8IA 1XCTL 1UELA 3N32A 3NZ3A 2WXFA 4NNJB 2MJ3A 2WLBA 2LZ6A 4W9JA 2YEPB 2O2VA 4HCPB 3ECIA 3EHVA 2DZIA 2LGDA 2C60A 3VRBB 2QCZA 2WXRA 1C3TA 2G1EA 3CF6E 3N9YC 4TQ0A 4CO7A 2EMTA 4ACFA 3AE1B 1BT0A 2WHIA 4KX6B 1FCLA 2L8JA 1ZKHA 3VH4B 1AN8A 4PS8A 2C7NB 1I4PA 2KACA 4HJGE 4ANWA 5EE3A 3WIMA 2K25A 1ZDXA 3A1QA 4AJYB 4GLSC 3Q8AA 2D07B 1C79A 4XX5A 3UIOB 2BB5A 2KAJA 3L17A 3ZNZB 1J19A 2LXCA 2LASA 4KKJA 2ZW1A 2D3CA 2N1VA 2IO0B 1TKYA 3SEBA 1R4MB 4RFBA 2KFKA 2KN5A 1DOXA 3BIID 1TJEA 3P63A 4LK0M 2BKFA 3PREA 1UGMA 1YQ3B 3ETRA 3V05A 1GAQB 3WAPA 4BOZB 3AEEB 5AZHA 2K8CA 2W54A 2GBNA 4A90A 3N30A 2I38A 2UWQA 2RPQA 3M3JA 3I63C 2DZMA 2AL3A 4OZCA 3O65B 1FXAA 1EF1A 1EM7A 4REZA 1PQSA 1TS3A 3J9CA 1MG4A 4W9KA 1FFVA 2GI9A 3R2TA 1WYWB 3ZTDA 3P4SB 1T0SC 1E5WA 1WMHA 3NY5A 3ZRFA 4BBNF 1WR1A 3I5JC 5LNK1 2WWZA 2BYEA 3BWUD 1A70A 1E7PB 2HTHA 3KYDD 1SE2A 2L1AA 4PS7A 2BYFA 3B9JA 1V5TA 1AWDA 2WDQB 2WXLA 2FCQA 4M0WB 4MGYE 3SR6A 2KWUB 4C80A 2WXGA 5JZEB 5FR6A 4A8XC 4W9LA 3H7PA 4EOYA 1VCBA 2JWUA 2G9HD 4JL9A 2KHWB 1NVID 4DWFA 4GU2A 4E3CA 4ANUA 5IKCM 1GUAB 1UZXB 4KIKB 4MGIE 3TL5A 1WY8A 3AEGB 1LO5D 2Z8LA 3P4QB 3ZNHB 2L83A 3DQVA 2ASQA 2WU2B 5FK9C 1FEHA 2XBBC 2NPTA 4LJOB 2DYOA 3AE4B 4WAAA 3R7QA 1KLVA 2KDBA 3RNGC 4J6IA 1XEEA 4K3BA 4DXAB 1WJ6A 4RGTA 4ICUA 4USAA 5DPTA 4YL8A 4YSYB 1SXTA 1B9RA 3PV1A 5C1ZA 3EFCA 4YT0B 3QA8A 4OVVA 2J0MA 2W55A 4K7WA 2KMAA 4C7YA 4XC2A 1J0GA 4MM3B 1WGDA 1SB3C 1XLOA 2M4NA 4I6NB 3A1QB 2E3TA 3W2DA 3W9CB 1CZPA 3KW5B 3RCZA 3A33B 1JRPA 5H92C 3DPDA 1XCQL 4NJCA 1VDVA 3AECB 5IP4D 4B9KA 4N59A 2DAJA 4ZRIA 1KLUD 1WJ4A 1SE4A 4L2YA 2ZEQA 4AP4C 4BKGA 2IBIB 1Y8RC 4PK1A 4KSLC 3JYUA 2J42A 2KFKB 2GBMA 3HRDD 4HDOA 2JRIB 3L4PA 4NAWA 4K81A 1V1PA 2PEAA 3L0WB 5HG2A 2IO2B 3DDCB 3E56A 1TKEA 3ZDMC 1Q5WB 1SGHA 2N0SB 1GJZA 2N7EA 3WAOA 2EKEC 1XF5L 3PRZA 1OGWA 1TBEA 2LFIA 4IUMB 3RFZB 3HHMA 2MW5A 1L4DB 4ZOHC 2AYOB 2JXXA 4A9AA 4ZYNA 2LHDA 3N20C 3SD5A 3AEAB 5EDSA 5JHAA 3EC8A 3PGEA 1E7VA 1CK1A 1WMHB 2RMMA 4H2AA 4IW0A 4C00A 3QC8B 2J52A 1NDDA 4N58A 4W9GA 2BWES 3H6NA 2KX3A 4F1SA 3ZIMA 3ONSA 3Q3MC 1WX7A 2G4DB 4G0NB 2BWFA 5LXIB 1HE8A 4K7SA 4HJKA 1UF0A 3CWIA 1MVKA 2PIAA 1YJJA 1JWBD 1N62A 2ZZPB 3CMMB 4XZ4A 2AEHA 4GDLB 5AZFA 1YIWA 3MFGA 2DZJA 3L54A 3ZVVA 1SE9A 4HPPA 1IPGA 2N1WA 2V4LA 3L10B 4N6EB 5IA7A 4OHJA 2KJ6A 1NI3A 3BYYB 1WFYA 1ENFA 1SJHD 1L4ZB 1XT9B 3KVFB 1QILA 3Q3FA 2LVQA 2BW2A 3H7SA 4DXGA 4NJ7A 4UDUC 1R7SA 1UUPA 3GE3C 2NMQA 3O13A 4HROA 4EZJA 4TMAB 4OVUA 1WX8A 2LRUA 4MSQB 3NZSA 5IO9A 2ZCBA 3T3OA 5HKHA 3EECA 2NCNA 2FE8A 1YN5A 1HZ6A 2M0XA 1V2YA 4GB9A 1WXQA 3UGBB 5G2NA 3V3XA 5IN7A 4A3OA 3OAWA 1F77A 2FIDA 1WJNA 3N1XC 4NAMA 1TGZB 1ZP0B 4GDKA 3U2SC 3WA0A 4HK2A 1BXTA 4GXBA 5D3DA 2H88B 2LWPA 3QQ8B 1S3SG 4RF1A 4GSWA 4ICVA 3VAWA 1C76A 1UH6A 2J0KA 1C77A 3Q8CA 1K53A 3ZNID 2CJNA 2VRRB 2BPSA 3ALBA 3ZQ4A 3QK0A 4EKUA 2J53A 1XLNA 3NVZA 3GZNI 1V1PB 2L0TA 1K51A 2BBCA 3L16A 1YD8U 4HPMB 4IKGA 4MACA 1WGKA 2KOXA 3AI5A 2GBRA 2XK5A 3V62A 1ZXIA 1T0QC 2LGXA 3WANA 3DBHI 2INCC 5BYSA 2HJ8A 2L32A 2MBHA 2ZVOA 4LDTB 2I2YA 2ON8A 2K9XA 4FJZA 3W1YA 3ZKJC 2MCNB 2OEDA 1TYGB 4LTUA 4ZRQA 1MFWA 2KT7A 4WIPA 3RN9C 2E6XA 2DBYA 3U8ZA 4C7ZA 2YEPF 1T5XD 4KDIC 2ZVNA 4IWPA 1HEZE 5BMIA 2IGDA 3N3KB 3QAQA 4LNFA 4MT5A 2Q5WD 4XDCA 1VRAB 5EE9A 3VTUA 1UBQA 3HM6X 4TUUA 3VRAB 1YMHE 1LXDA 4ZRJA 3C19A 3DOWA 3QWZB 5BMHA 4WWNA 4MH8A 2UYZB 2KO3A 3P1MA 3Q8EA 5E6OA 2RGFA 3B2GA 2MP2A 2KKCA 1KF6B 1ET9A 3NOBA 3B08A 3VR8B 1XQQA 2N7DA 2RDBC 2UU7A 2WXOA 1L7YA 1E0ZA 4KGRA 3MJ5A 3UINB 3MP9A 2GB1A 3MC9A 3AE7B 1YN4A 4FN2A 3BY4B 1WRIA 3NZUA 4MSMB 1L0VB 2BS4B 2IGHA 2WX1A 4ZRKA 1WXSA 2INNE 3DVNV 2N9KA 4KVGB 3ZYYX 3MHZA 1QZEA 3VDZA 5G55A 4S0RA 3SDLC 3C0RB 1RWSA 4L1BA 3ZNGC 2V3SA 2BS3B 3DBLB 1MHXA 2MBBB 2C7HA 2GLSA 2XN9C 5HI1A 1YX5B 1OQQA 1D3ZA 4DHZE 2KVZA 3DVGX 3OJ3A 3NRZA 1V6EA 4P1CC 2Y5CA 2QEJC 1TZ1A 1T0YA 3RD2A 4NZLB 3TEZA 4RCOA 1N5WA 3APDA 3GP7A 2BB6A 3B2FA 1H4RA 1JW9D 1TS4A 4G50A 4DHJB 2G3QB 3BYTB 2IY0B 3NS1A 2WS3B 1QKZA 2LMCA 1QLBB 3B1LX 1WR6E 3GS2A 3TJPA 1JWAD 1FM0D 2KDFB 2MH7A 4FLHA 2MBOA 3GE8C 1J7BA 1ZDVA 2GOWA 3PZ7A 4JPSA 1NENB 1NBFC 4OW0A 4M02A 3LJ3A 5H8YE 4DHJD 2JZ3B 4FHJA 4II3B 2XK5B 4BKTA 2MJEA 2JYEA 1ZW7A 4XWWA 1P98A 2KX0A 4MEMA 3KUZA 2JPHA 2D10A 2WDRB 3AMZA 2SEBD 1U4AA 2ICIA 4IM2A 3P2BA 5JXVA 1KRHA 2INDC 4URKA 1QOBA 2IO3B 3NVVA 2L76A 4P16A 1YJ1A 1ZXHA 3GZNB 1NYRA 1RYJA 4LNOA 1IGDA 1RAXA 4K7UA 4WH4A 5J18A 1J7CA 3TCAA 2KC1A 1JRUA 1ISNA 5D94A 3W5VB 5FKAC 4PYUA 3DBHB 2DENB 3AU4A 2XEWA 4DQOC 2W82A 5BYQA 1FXTB 2WXPA 3Q6BA 2WXIA 2HE7A 2KDMA 1QOGA 3W5UB 4YWGG 2FCSA 3VUXA 2IYDB 3NJTA 3QHTA 1L6UA 4I6PA 2VH1A 4A6QA 5CHFA 2CHWA 4TKNA 1LM8B 3JVZX 3M63B 3QARA 1XD3B 1XLPA 4RM8A 2ACZB 3Q8FA 1ZE3D 3PO0A 3OG5A 1PFDA 4W9FA 4TQ1A 2DYBA 1PGBA 3M62B 2Z0DB 1EWYC 1P0RA 1SIJA 1KTKA 4MELA 1I4RA 1YQBA 2DX5B 3B0AA 5IAAC 1C4PA 4YSXB 3HM3A 1KM7A 2O2VB 3RYTA 5DPWA 3PZ8A 4EFOA 4ANXA 1I4QA 1FO4A 2ZCCA 1CMXB 5IOIA 3V60A 1E8WA 2PLPA 3SFDB 2DNFA 3URYA 4EZKA 1SE3A 2K8BA 1ZOYB 4BKSA 2OOBB 5TSSA 1UBIA 4M01A 1WE7A 2D3BA 4C4VA 2HJ1A 3HUIA 5AUKA 4IWQA 4LLGM 1MJDA 4NQKE 4HKZE 2QC8A 3T9LA 1FIQA 4II2B 4EE2A 1ZUD2 3RULA 4MJSA 3P4PB 1D5XC 4BFRA 1V81A 4WURA 4OZAA 3K9OB 3ZXVA 1GC7A 4OZBA 3Q3OC 1WGRA 4A3PA 2QHOA 3WCQA 1YNTE 3H1UA 1NEKB 4IOIE 2EKIA 3U7DA 3VR9B 1ZPSA 1AYFA 2PKOA 2KWDA 2FBWB 4P6VF 4DHZB 4S17A 1JQ4A 3P42A 3PS6A 1J7AA 2NVUI 1WGHA 1QT9A 3I57A 5TR5A 1VR9A 1GC6A 1F52A 2CU1A 3E9SA 4GMVA 1V1OA 2R2OA 2L52A 1VLBA 4FADA 1WGYA 3RNAC 1MG8A 1E90A 1FXIA 1I7HA 4HRSA 1F1HA 5J17A 3PZDA 3ZRCA 2N9LA 4HKQA 2K6DB 1FRRA 2O6VA 1N60A 4JIOU 2EMSA 1VZ7A 3VH3B 1FCCC 3ML8A 4G11A 4J3OD 3RNFC 1AARA 2RR9A 2K39A 3FILA 2FUG1 3U30A 2QDFA 3VXWA 2I1KA 3EFUA 2WP9B 4GGQA 4QAYA 1K50A 3H7PB 2JT4B 1IBXA 1MI0A 5G5HA 3DWMA 5EE0A 2R61A 4O1NA 2KFJA 4A55A 1Q1OA 2V9HA 2KLCA 4KZCA 1E7UA 3UQBA 1IGCA 3V6EB 2N4FA 3IVFA 4US8A 3BVZA 2I1JA 2V4IB 1EU3A 2M8SA 2NPTB 2QJLA 1WM2A 3ABVB 5AEKB 2PW9A 3IG3A 2GRIA 3HIZA 3EA6A 3HVDA 3APCA 3AE5B 3AV8A 1V86A 1OQRA 3A9JA 2KQ7A 1ROEA 3NVYA 1TKGA 2KYWA 2DAFA 2KMMA 2DYMA 2CJOA 4C56C 1Y56A 3GOEA 4ZDVA 4CHKA 2MQJA 2HDEA 4HDQA 2RPVA 5D2MB 4W9EA 2Y5PA 1UD7A 2WGSA 2QSDA 2NR2A 2DHZA 1JROA 3R2IA 4JGHB 2AWTA 2BKRB 4WWMA 1JMLA 2REXA 1YOVB 3MHSD 1SSNA 2W9NA 2LVOA 3VFKA 5AZGA 4L23A 2RDGA 4LNIA 4LNKA 2NTTA 3LYYA 2WDVB 3DHHC 1QOFA 3MC8A 2B3AA 2KWVB 2LRWA 3A9KA 1STEA 4TSSA 2LGYA 2OHFA 4MJSB 4YSZB 4IWOA 4KGTA 4MGKE 2GMIC 3UF8A 4BKSD 4EZLA 4JX1C 3KWLA 3DVGY 3RPFC 1C4CA 3X23A 3RI7C 4NAWB 4BOSC 4XE0A 4FJYA 4WJPA 2FCMA 2KNBA 3WALA 1WF9A 2CR5A 4WWOA 1EWCA 2LI5A 2IJ0A 3BZDB 2JUOA 4JWUC 3I3TB 5JH5C 1QF6A 2C7MB 2LGIA 2LHEA 3ZW3A 1L0YB 2M1MA 4JWSC 3AM9A 3AE2B 3IAM1 3IT4B 3ZDTA 1C78A 4W9HA 2JQRB 3DCGA 1KH0A 1WE6A 2MX2A 3PLUA 3UQAA 1C1YB 2VZKB 2AL6A 3NUHB 4RGNA 1OFFA 2J0JA 3FAHA 1RFAA 3N1ZC 1P9DU 1QOAA 2JF5A 2O6VB 2IPKD 5BMGA 2IO1B 1S1QB 2D2QA 3NS8A 4ANVA 1R4NI 3JW0X 1WH3A 1M94A 2K5PA 2KTRA 3QIJA 1CQVA 3FILB 3ZXRA 5MPOA 2X8XX 3AE9B 2VZKD 2WX0A 3T3NA 2QMTA 4EUTA 3IAS1 3PSEB 3AE6B 2L05A 4KDLB 2K0PA 4XWTA 5GMVA 3RZWC 3VVWB 4HLEA 2M0AA 2O6VD 1YQ4B 3PTFC 5CHVC 1XXGA 2MHJA 1SBBB 5E6JA 2NBUA 1HA5A 2KZRA 3DBRI 3JSVA 3VTWA 2JRHA 2INPE 1DYQA 2ZNVC 1I35A 2DLBA 1RM6C 4WQOB 5EE1A 1SF0A 1TTNA 3QJZA 1EF5A 3I9V1 3OWEB 4M0WA 4HWIB 2HD5B 2HTME 2K8HA 2LJIA 2RDHA 4ARCA 4RM9A 1F2RI 1Q0WB 2FUHB 2KDEB 3VUWA 5J2RA 1WXAA 1L2NA 2WXMA 4FHKA 2JY6A 4K1RB 4KIKA 2LUEA 3SU8X 3BINA 2JVCA 3RT3B 2V0GA 2AQ1B 1K8RB 2YVCA 3IXSA 2J4XA 3KH0A 4RMAA 2LJ5A 2ZNVB 2ONQA 4G3XB 4MH0E 2KANA 4DDID 3DHIC 4BVUC 2BT6A 3AE8B 2Z0EB 3AB5A 2MA9B 1N61A 3PT2B 3OJ4B 2L0FA 1I4GA 1TS5A 5DCNA 4B95A 4GDKB 2JZZA 5BYRA 2BF8B 2AQ3B 3KWVA 3A9KB 2C9WB 1WXVA 2PJHA 2JU6X 2N7JA 1I4XA 1V8CA 1WZ0A 2LVPA 1JWUD 2NBWB 1P7FA 2MBEA 4E74A 1B1ZA 1N63A 1V49A 4MM3A 4TV3A 1X1MA 3L08A 4IG7B 1AW7A 2KJHB 1L0XB 3Q2AC 3FC4A 4RGOS 5GXGB 1OEYJ 1UNSA 2BYVE 4US9A 3ZGZA 4NQLB 2BYTA 3BK2A 1M4VA 2JSVX 4FULA 2K3UA 2B76B 2FAZA 3C8YA 2V1YA 2N9PC 4ZRPA 1FPYA 1K52A 2V3NA 4ITKA 2N9EB 3AULA 3P4RB 2M56B 4MDKE 2FNJB 5G5GA 1GPXA 4YXDB 1SJED 2ZJDA 3Q8BA 1UWMA 2GBKA 1FNVA 5BO4B 3H8HA 2VH2A 3EUB2 5KHOA 4PS3A 3LB8C 1KJTA 3WAMA 4ZHPA 1OTRB 2Z59B 3U4EG 2KTRB 2WXJA 3UIPB 1WIAA 2MJDA 3EGRA 2PVOD 2MP2B 4WWPA 2LUMA 4Q2JA 2ZPNA 3VTVA 1N6ZA 1FFUA 2FCNA 2G4SA 1Q10A 1WGGA 3TIXA 2DZKA 2W3SA 3TUOA 4WJQA 1SEBD 3V61A 2QILA 1LQBA 1Z5SB 3JSVB 1TT5B 2WXQA 3W1SA 5I4DA 1JCKB 2D3GA 1L5PA 4BAXA 1CJEA 4CQNA 3VHTC 2KTFA 1R4NB 5HHDG 1F2RC 1HTQA 2K1FA 4ARIA 1EU4A 1MPEA 1T6BX 3IBEA 3RNEC 3TMPB 2XNAC 3DHGC 3RNCC 2BTEA 1V97A 3BK1A 4LNNA 5LLIA 4KZ0A 4YTNB 4GDLA 1KOTA 3N1YC 4BBNC 1D5ZC 4AS1A 4P1BC 5DPSA 1QQRA 2MBQA 3TEWA 1VJKA 5CX3A 3DBRB 3APFA 3PVLA 3UI3A 4CYEA 3AE3B 5D3IB 3AEDB 3RNBC 1DGJA 3RZFA 4WAFA 2KQSA 1HQRD 1G6JA 3MC0B 4KKIA 4FJVB 2IDYA 2WYQA 4DXFA 1GNUA 5FR3A 3U7ZA 4AWJA 4ZHOA 1T3QA 2WXKA 2PMVA 1E8YA 1BUIC 3NVWA 1T0RC 4IM0A 4FXCA 1EUVB 3D32A 4DBGA 2A4ZA 1WYGA 4R3DA 2JWZA 1OQYA 1JWSD 4B0MA 1FNUA 4N9F4 1HXYD 1ZGUB 2NTSA 2SAKA 3R7RA 1EO6A 4HVBA 3ZJVA 2M17A 2CHXA 2MRPA 4X57B 2C5LC 3CSTA 3IFWB 3R3MA 1WWTA 3S2AA 1E8XA 4JE3B 4B6WA 4MGZE 2KN4A 3PLVA 3KQ4A 3MTNB 2J7QB 4RF0A 2L3ZA 4KSKC 2MSED 2BVCA 1RRBA 3LDZE 3BVGA 1WJUA 2D3AA 3PPAA 4NJ6A 1IYFA 3LXFA 1E10A 1FMAD 4GOCA 5CHWA 1J8CA 2GBJA 2RSUA 3ZJUA 1C9FA 2PTLA 3ZLZA 3ZJTA 3W1SC 4BZAA 4JLCA 1PGAA 1UGJA 2WU5B 4YTPB 1XLQA 3OLMD 2Y5BB 3NHEB 1H8CA 4F7ZA 2D11A 3IHPC 3H9DA 3NG0A 4XGAB 3A4SC 4LJPB 2KK8A 3QX1A 1D6EC 3AU5A 2YLMA 5HFYA 1KLGD 1F0ZA 4B0EA 3AXCA 2OJWA 1DOIA 1WSPA 2KMCA 4HXDA 3AEBB 5L95C 1E8ZA 1TZOA 1YN3A 2NBVB 2JX5A 4FA6A 2WXHA 3TBLD 3DBSA 4DK5A 3CIRB 1DOYA 5KHQA 5L83A 4HPLB 2X38A 4W9IA 1RFKA 3AH7A 2Y3AA
chains in the Genus database with same CATH topology
3PZ7A 4YSYB 1SXTA 2IPKD 5BMGA 4JPSA 2AQ2B 3TEYA 1NENB 2H89B 1B9RA 4OW0A 1L6VA 5H8YE 2K5PA 1FNWA 4YT0B 2M19A 1CQVA 2KQ4X 3FILB 5MPOA 2W55A 3AE9B 1HZ5A 2JYEA 2MJEA 4XWWA 4C7YA 1GB4A 2VZKD 1PUTA 4MM3B 4KGSA 1SB3C 1XLOA 3T3NA 2QMTA 3IAS1 1BMLC 1MHHE 5AUIA 3AE6B 2WDRB 3AMZA 2E3TA 3W2DA 2K0PA 1YJIA 2SEBD 2DWQA 4XWTA 3W9CB 1CZPA 2M0AA 2ICIA 1ET6A 1YQ4B 1PYWD 1JRPA 1XXGA 5H92C 5JXVA 2QIEB 3AN1A 1KRHA 1XCQL 4NJCA 1SBBB 2BS2B 5E6JA 1VDVA 1HA5A 3AECB 1QOBA 1TY0A 3NVVA 2INPE 1DYQA 4P16A 4XDDA 4N59A 1IUEA 1KLUD 4HEA1 1SE4A 1ZXHA 2DLBA 1NYRA 1RYJA 2WNMA 1RM6C 4L2YA 5EE1A 1P7EA 1IGDA 1SF0A 4WH4A 3I9V1 2D5GA 1J7CA 2J42A 3OWEB 4M0WA 3HRDD 3L4PA 2HTME 2LJIA 2RDHA 4ARCA 2ZW0A 1F2RI 3W5VB 5FKAC 1V1PA 1GOZA 3BVMA 3HVZA 2JYTA 5HG2A 4DQOC 3E56A 2W82A 1TKEA 5BYQA 2WXPA 2WXMA 2N0SB 3Q69A 2V3PA 1XF5L 2WXIA 2LFIA 2KDMA 3RFZB 1QOGA 2EELA 1L4DB 1NYQA 4ZOHC 3W5UB 4YWGG 2V0GA 2AQ1B 2LEKA 2PVGC 4A9AA 1I4HA 1L6UA 4A6QA 3IXSA 2J4XA 2LHDA 5D7GA 1JALA 2ONQA 2BT6A 3AE8B 3AEAB 3AB5A 1XLPA 1CK1A 2JZPA 3TEXA 1N61A 2ACZB 3Q8FA 1ZE3D 2RMMA 1UWXA 3SFEB 3PO0A 1I4GA 1E6EB 1TS5A 4RH6A 1PFDA 4H2AA 4GDKB 5BYRA 2J52A 2AQ3B 1GB1A 2WXNA 4TQ1A 4N58A 1PGBA 3KWVA 5C3JB 1EWYC 4AQ7A 2JU6X 1SIJA 1KTKA 2K22A 1I4XA 2N7JA 1I4RA 1V8CA 1JWUD 1ACCA 1P7FA 1C4PA 4YSXB 3R8BA 1FRDA 1PGXA 1B1ZA 1N63A 1VZ8A 3CWIA 1ESFA 3PZ8A 1MVKA 3VQIA 3AEFB 1AW7A 1I4QA 2PIAA 1FO4A 1YJJA 1JWBD 1TY2A 1N62A 4D2KA 1L0XB 4IDIA 3FC4A 4RGOS 2PLPA 5GXGB 3SFDB 4GDLB 1UNSA 2IGGA 3MFGA 4US9A 3ZGZA 1TS2A 3URYA 1PDXA 2BYTA 3BK2A 1SE3A 4YTMB 1FD6A 1M4VA 1ZOYB 2JSVX 3TSSA 5TSSA 4ZYSA 2K3UA 2B76B 3KLSX 4N6EB 3C8YA 2TSSA 4OHJA 1IBXB 1NI3A 3BYYB 1ENFA 1E9MA 1SJHD 4ZRPA 3HUIA 1L4ZB 5AUKA 4LLGM 1QILA 1K52A 2CU3A 2BW2A 1N5XA 2V3NA 4HKZE 4ITKA 3P4RB 4DXGA 2M56B 1FIQA 5G5GA 4UDUC 4EE2A 1ZUD2 1R7SA 2W3RA 3P4PB 1D5XC 1UUPA 1GPXA 4YXDB 1SJED 2NMQA 3O13A 3Q8BA 4WQMA 4OZAA 3GB1A 1UWMA 4WURA 1FNVA 3H8HA 4OZBA 3EUB2 4HROA 3LB8C 4TMAB 3WCQA 3U52E 4ZHPA 1D4BA 5C2TB 1YNTE 1NEKB 3U4EG 3T3OA 2JXTA 2WXJA 2EKIA 2MEKA 4IOIE 3VR9B 1VZ6A 2MJDA 3EGRA 1ZPSA 2FE8A 2PVOD 1D5MC 1YN5A 3IT6B 4PT5A 1AYFA 1HZ6A 2PKOA 1JWMD 2LUMA 4Q2JA 4RNAA 1WXQA 2KWDA 2FBWB 3V3XA 4P6VF 1FFUA 2WQYB 1XO3A 1JQ4A 2AX5A 1F77A 3P42A 1Q10A 1J7AA 4NAMA 1QT9A 1ZP0B 2W3SA 3TUOA 3U2SC 4RGMA 1BXTA 3I57A 1SEBD 1VR9A 4OVZA 5D3DA 2QILA 1C4AA 2H88B 3E9SA 1V1OA 2L52A 1VLBA 2WXQA 3DWGC 3W1SA 1KFYB 5I4DA 1JCKB 5T8IA 1XCTL 1L5PA 4RF1A 3NZ3A 1FXIA 1I7HA 2WXFA 1CJEA 4HRSA 2MJ3A 1C76A 4CQNA 1C77A 2WLBA 1K53A 3Q8CA 5HHDG 2CJNA 2YEPB 1F2RC 4ARIA 1EU4A 2N9LA 1MPEA 1T6BX 4HKQA 3ZQ4A 1FRRA 2J53A 1XLNA 3NVZA 2XNAC 1N60A 3VRBB 2BTEA 1V1PB 1V97A 1K51A 2BBCA 3BK1A 2WXRA 1VZ7A 1FCCC 4J3OD 4IKGA 4MACA 4YTNB 1WGKA 2G1EA 3N9YC 4TQ0A 3FILA 2FUG1 1D5ZC 1ZXIA 3AE1B 4KX6B 1FCLA 4AS1A 1AN8A 5BYSA 1I4PA 1QQRA 2L32A 2KACA 4HJGE 3TEWA 1VJKA 5EE3A 2WP9B 1ZDXA 2I2YA 2ON8A 1K50A 2K9XA 3UI3A 4GLSC 1IBXA 3Q8AA 1MI0A 1C79A 5G5HA 3DWMA 2OEDA 1TYGB 4LTUA 2BB5A 3AE3B 5D3IB 5EE0A 2KAJA 4ZRQA 3AEDB 4WIPA 2E6XA 1DGJA 2DBYA 2R61A 4WAFA 4O1NA 1HQRD 4A55A 4C7ZA 3MC0B 2YEPF 4KKIA 1T5XD 2IDYA 4DXFA 1HEZE 5FR3A 5BMIA 2IGDA 3U7ZA 4MT5A 4KKJA 2Q5WD 2ZW1A 1VRAB 4XDCA 4ZHOA 1T3QA 2WXKA 2PMVA 1IGCA 5EE9A 3NVWA 1BUIC 4US8A 1TKYA 3SEBA 3BVZA 3VRAB 1YMHE 2V4IB 1EU3A 4RFBA 1DOXA 2QJLA 3ABVB 3BIID 1TJEA 5BMHA 4FXCA 2PW9A 2GRIA 3P63A 4MH8A 4LK0M 3EA6A 3P1MA 3Q8EA 1YQ3B 3ETRA 3HVDA 3V05A 3B2GA 1GAQB 3AE5B 3AV8A 1OQRA 1WYGA 1ROEA 4R3DA 3AEEB 1KF6B 1JWSD 1ET9A 3NVYA 2W54A 4B0MA 1FNUA 1TKGA 4A90A 2KMMA 1HXYD 2NTSA 2I38A 2SAKA 3VR8B 2DYMA 3ZJVA 2CJOA 4C56C 1Y56A 4OZCA 2HDEA 1FXAA 1WWTA 2WXOA 1EM7A 4REZA 2RPVA 4JE3B 1E0ZA 4KGRA 3MJ5A 2Y5PA 2QSDA 1JROA 1TS3A 3J9CA 3MP9A 3R2IA 4WWMA 1FFVA 1JMLA 2GB1A 2KN4A 2GI9A 3KQ4A 3AE7B 4RF0A 3R2TA 1YN4A 3P4SB 3BVGA 1SSNA 1WRIA 4L23A 2RDGA 1L0VB 3LXFA 2BS4B 2NTTA 3LYYA 1FMAD 1E10A 2IGHA 2WDVB 1QOFA 5LNK1 3ZJUA 1C9FA 2PTLA 2INNE 3ZJTA 3BWUD 1A70A 1STEA 2N9KA 1E7PB 1PGAA 1UGJA 4TSSA 2OHFA 3ZYYX 3MHZA 2WU5B 1SE2A 4YSZB 2L1AA 4YTPB 4KGTA 1RWSA 4L1BA 1XLQA 3B9JA 2BS3B 1MHXA 1AWDA 4JX1C 2WDQB 2WXLA 3KWLA 3SR6A 3RPFC 4C80A 1C4CA 2WXGA 2XN9C 1OQQA 5HI1A 4NAWB 4A8XC 4XE0A 3NRZA 1D6EC 2JWUA 1EWCA 2G9HD 2IJ0A 2Y5CA 5HFYA 1NVID 1KLGD 3BZDB 1F0ZA 4JWUC 4B0EA 1QF6A 2QEJC 2LGIA 1DOIA 1WSPA 3AEBB 2LHEA 4NZLB 3TEZA 1L0YB 4RCOA 1N5WA 4JWSC 3AEGB 1LO5D 2Z8LA 3AM9A 3GP7A 2BB6A 3B2FA 3P4QB 3AE2B 2L83A 3IAM1 3IT4B 2WU2B 1C78A 1JW9D 1TS4A 1TZOA 5FK9C 1FEHA 1YN3A 2JX5A 2JQRB 3BYTB 2DYOA 3AE4B 1KH0A 2WXHA 3NS1A 2WS3B 1QKZA 2LMCA 1QLBB 3CIRB 2VZKB 1DOYA 3GS2A 3NUHB 1XEEA 1JWAD 4RGNA 2X38A 1FM0D 1OFFA 1RFKA 3AH7A 2MH7A 3FAHA 2Y3AA 1J7BA 1ZDVA 4RGTA 1QOAA 4USAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMC A;  2WNM A;  4LLG M;  4LK0 M; 
#chains in the Genus database with same CATH topology
 4M00 A;  3Q3J A;  3T8M A;  3MJW A;  2AQ2 B;  3ENE A;  3TEY A;  2H89 B;  1P1A A;  3DBL I;  2WDT B;  1L6V A;  1FNW A;  4XYC A;  2M19 A;  2KQ4 X;  5E6P A;  1HZ5 A;  1GB4 A;  1GG3 A;  1PUT A;  4LCD E;  4KGS A;  1BML C;  1MHH E;  2NS5 A;  1HTO A;  5AUI A;  1WRD B;  1WX9 A;  5LXH A;  1YJI A;  1V9J A;  2DWQ A;  3VUY A;  1ET6 A;  1PYW D;  2QIE B;  3AN1 A;  2KLG A;  3K9P B;  2BS2 B;  2KC2 A;  3PHW B;  1TY0 A;  3KUC B;  1WZ3 A;  2G45 B;  4XDD A;  1WM3 A;  1IUE A;  4HEA 1;  3PRP B;  2WNM A;  1P7E A;  2D5G A;  2R2Q A;  3Q14 C;  4AJW A;  4FBJ B;  3KUD B;  4E71 A;  1YX6 B;  4C4V B;  4DDG D;  2ZW0 A;  3A4R A;  1F9J A;  3ZUN A;  1LGR A;  1GOZ A;  2RD0 A;  3BVM A;  3HVZ A;  4I6L B;  2JYT A;  4M8N A;  4W9D A;  1R4M I;  4K3C A;  2PPH A;  4IC7 B;  3Q69 A;  1SIF A;  2V3P A;  1I42 A;  2N9X A;  4NPN A;  4W9C A;  3M95 A;  1NI2 A;  2EEL A;  2IY1 B;  1NYQ A;  4HCN B;  4AOF A;  2L7R A;  2LEK A;  2PVG C;  3R66 C;  5E6N A;  1I4H A;  3KYC D;  3RUI B;  2L00 B;  4EEW A;  5D7G A;  1JAL A;  1LFD A;  1A5R A;  2MLB A;  2LD9 A;  4PYZ A;  2JZP A;  3TEX A;  4ASW C;  3SFE B;  1UWX A;  1E6E B;  4RH6 A;  1V80 A;  3CSF A;  1GB1 A;  2WXN A;  5C3J B;  4IM3 A;  4AQ7 A;  2K22 A;  2OJR A;  1ACC A;  3R8B A;  1FRD A;  2CKH B;  4JQW C;  2FIF A;  3Q3N C;  1PGX A;  1VZ8 A;  3ML9 A;  1ESF A;  4GIV A;  1OEY A;  4A20 A;  2PE6 B;  3VQI A;  5D6J B;  3AEF B;  1IP9 A;  4AUQ C;  1TY2 A;  3SHQ A;  2CHZ A;  4D2K A;  4IDI A;  2KXJ A;  1P3Q U;  2BQQ A;  2A5U A;  3QCA A;  2IGG A;  4WJO A;  1TS2 A;  2KVR A;  1PDX A;  3FKY A;  4YTM B;  5C23 A;  1FD6 A;  3TSS A;  4ZYS A;  3PRM B;  3X0W A;  2ZPY A;  3KLS X;  2KWC A;  2LGS A;  3PHX B;  2TSS A;  4KV2 A;  2KDI A;  5JHB A;  4LDT D;  1IBX B;  1E9M A;  1V5O A;  2CU3 A;  3DVN U;  3ZO5 B;  1N5X A;  3V6C B;  3ZTC A;  2PE9 A;  1VD2 A;  2W3R A;  2KD0 A;  4GN1 A;  4WQM A;  3GB1 A;  4NY0 A;  1RLF A;  3L13 A;  3U52 E;  1D4B A;  5C2T B;  2MWS B;  2LXA A;  2JXT A;  4M8M A;  2KJR A;  2MEK A;  2IZV B;  3RMK C;  1VZ6 A;  1D5M C;  3IT6 B;  5CTR C;  2K6Q A;  4PT5 A;  1TIF A;  3A9J B;  1JWM D;  4RNA A;  1Z2M A;  2CS4 A;  4P7I A;  4F8C B;  2WQY B;  3HK0 A;  1WI0 A;  1XO3 A;  2AX5 A;  4WJN A;  2BGF A;  5DPR A;  4RGM A;  4OVZ A;  1WXM A;  1C4A A;  3DWG C;  1KFY B;  5T8I A;  1XCT L;  1UEL A;  3N32 A;  3NZ3 A;  2WXF A;  4NNJ B;  2MJ3 A;  2WLB A;  2LZ6 A;  4W9J A;  2YEP B;  2O2V A;  4HCP B;  3ECI A;  3EHV A;  2DZI A;  2LGD A;  2C60 A;  3VRB B;  2QCZ A;  2WXR A;  1C3T A;  2G1E A;  3CF6 E;  3N9Y C;  4TQ0 A;  4CO7 A;  2EMT A;  4ACF A;  3AE1 B;  1BT0 A;  2WHI A;  4KX6 B;  1FCL A;  2L8J A;  1ZKH A;  3VH4 B;  1AN8 A;  4PS8 A;  2C7N B;  1I4P A;  2KAC A;  4HJG E;  4ANW A;  5EE3 A;  3WIM A;  2K25 A;  1ZDX A;  3A1Q A;  4AJY B;  4GLS C;  3Q8A A;  2D07 B;  1C79 A;  4XX5 A;  3UIO B;  2BB5 A;  2KAJ A;  3L17 A;  3ZNZ B;  1J19 A;  2LXC A;  2LAS A;  4KKJ A;  2ZW1 A;  2D3C A;  2N1V A;  2IO0 B;  1TKY A;  3SEB A;  1R4M B;  4RFB A;  2KFK A;  2KN5 A;  1DOX A;  3BII D;  1TJE A;  3P63 A;  4LK0 M;  2BKF A;  3PRE A;  1UGM A;  1YQ3 B;  3ETR A;  3V05 A;  1GAQ B;  3WAP A;  4BOZ B;  3AEE B;  5AZH A;  2K8C A;  2W54 A;  2GBN A;  4A90 A;  3N30 A;  2I38 A;  2UWQ A;  2RPQ A;  3M3J A;  3I63 C;  2DZM A;  2AL3 A;  4OZC A;  3O65 B;  1FXA A;  1EF1 A;  1EM7 A;  4REZ A;  1PQS A;  1TS3 A;  3J9C A;  1MG4 A;  4W9K A;  1FFV A;  2GI9 A;  3R2T A;  1WYW B;  3ZTD A;  3P4S B;  1T0S C;  1E5W A;  1WMH A;  3NY5 A;  3ZRF A;  4BBN F;  1WR1 A;  3I5J C;  5LNK 1;  2WWZ A;  2BYE A;  3BWU D;  1A70 A;  1E7P B;  2HTH A;  3KYD D;  1SE2 A;  2L1A A;  4PS7 A;  2BYF A;  3B9J A;  1V5T A;  1AWD A;  2WDQ B;  2WXL A;  2FCQ A;  4M0W B;  4MGY E;  3SR6 A;  2KWU B;  4C80 A;  2WXG A;  5JZE B;  5FR6 A;  4A8X C;  4W9L A;  3H7P A;  4EOY A;  1VCB A;  2JWU A;  2G9H D;  4JL9 A;  2KHW B;  1NVI D;  4DWF A;  4GU2 A;  4E3C A;  4ANU A;  5IKC M;  1GUA B;  1UZX B;  4KIK B;  4MGI E;  3TL5 A;  1WY8 A;  3AEG B;  1LO5 D;  2Z8L A;  3P4Q B;  3ZNH B;  2L83 A;  3DQV A;  2ASQ A;  2WU2 B;  5FK9 C;  1FEH A;  2XBB C;  2NPT A;  4LJO B;  2DYO A;  3AE4 B;  4WAA A;  3R7Q A;  1KLV A;  2KDB A;  3RNG C;  4J6I A;  1XEE A;  4K3B A;  4DXA B;  1WJ6 A;  4RGT A;  4ICU A;  4USA A;  5DPT A;  4YL8 A;  4YSY B;  1SXT A;  1B9R A;  3PV1 A;  5C1Z A;  3EFC A;  4YT0 B;  3QA8 A;  4OVV A;  2J0M A;  2W55 A;  4K7W A;  2KMA A;  4C7Y A;  4XC2 A;  1J0G A;  4MM3 B;  1WGD A;  1SB3 C;  1XLO A;  2M4N A;  4I6N B;  3A1Q B;  2E3T A;  3W2D A;  3W9C B;  1CZP A;  3KW5 B;  3RCZ A;  3A33 B;  1JRP A;  5H92 C;  3DPD A;  1XCQ L;  4NJC A;  1VDV A;  3AEC B;  5IP4 D;  4B9K A;  4N59 A;  2DAJ A;  4ZRI A;  1KLU D;  1WJ4 A;  1SE4 A;  4L2Y A;  2ZEQ A;  4AP4 C;  4BKG A;  2IBI B;  1Y8R C;  4PK1 A;  4KSL C;  3JYU A;  2J42 A;  2KFK B;  2GBM A;  3HRD D;  4HDO A;  2JRI B;  3L4P A;  4NAW A;  4K81 A;  1V1P A;  2PEA A;  3L0W B;  5HG2 A;  2IO2 B;  3DDC B;  3E56 A;  1TKE A;  3ZDM C;  1Q5W B;  1SGH A;  2N0S B;  1GJZ A;  2N7E A;  3WAO A;  2EKE C;  1XF5 L;  3PRZ A;  1OGW A;  1TBE A;  2LFI A;  4IUM B;  3RFZ B;  3HHM A;  2MW5 A;  1L4D B;  4ZOH C;  2AYO B;  2JXX A;  4A9A A;  4ZYN A;  2LHD A;  3N20 C;  3SD5 A;  3AEA B;  5EDS A;  5JHA A;  3EC8 A;  3PGE A;  1E7V A;  1CK1 A;  1WMH B;  2RMM A;  4H2A A;  4IW0 A;  4C00 A;  3QC8 B;  2J52 A;  1NDD A;  4N58 A;  4W9G A;  2BWE S;  3H6N A;  2KX3 A;  4F1S A;  3ZIM A;  3ONS A;  3Q3M C;  1WX7 A;  2G4D B;  4G0N B;  2BWF A;  5LXI B;  1HE8 A;  4K7S A;  4HJK A;  1UF0 A;  3CWI A;  1MVK A;  2PIA A;  1YJJ A;  1JWB D;  1N62 A;  2ZZP B;  3CMM B;  4XZ4 A;  2AEH A;  4GDL B;  5AZF A;  1YIW A;  3MFG A;  2DZJ A;  3L54 A;  3ZVV A;  1SE9 A;  4HPP A;  1IPG A;  2N1W A;  2V4L A;  3L10 B;  4N6E B;  5IA7 A;  4OHJ A;  2KJ6 A;  1NI3 A;  3BYY B;  1WFY A;  1ENF A;  1SJH D;  1L4Z B;  1XT9 B;  3KVF B;  1QIL A;  3Q3F A;  2LVQ A;  2BW2 A;  3H7S A;  4DXG A;  4NJ7 A;  4UDU C;  1R7S A;  1UUP A;  3GE3 C;  2NMQ A;  3O13 A;  4HRO A;  4EZJ A;  4TMA B;  4OVU A;  1WX8 A;  2LRU A;  4MSQ B;  3NZS A;  5IO9 A;  2ZCB A;  3T3O A;  5HKH A;  3EEC A;  2NCN A;  2FE8 A;  1YN5 A;  1HZ6 A;  2M0X A;  1V2Y A;  4GB9 A;  1WXQ A;  3UGB B;  5G2N A;  3V3X A;  5IN7 A;  4A3O A;  3OAW A;  1F77 A;  2FID A;  1WJN A;  3N1X C;  4NAM A;  1TGZ B;  1ZP0 B;  4GDK A;  3U2S C;  3WA0 A;  4HK2 A;  1BXT A;  4GXB A;  5D3D A;  2H88 B;  2LWP A;  3QQ8 B;  1S3S G;  4RF1 A;  4GSW A;  4ICV A;  3VAW A;  1C76 A;  1UH6 A;  2J0K A;  1C77 A;  3Q8C A;  1K53 A;  3ZNI D;  2CJN A;  2VRR B;  2BPS A;  3ALB A;  3ZQ4 A;  3QK0 A;  4EKU A;  2J53 A;  1XLN A;  3NVZ A;  3GZN I;  1V1P B;  2L0T A;  1K51 A;  2BBC A;  3L16 A;  1YD8 U;  4HPM B;  4IKG A;  4MAC A;  1WGK A;  2KOX A;  3AI5 A;  2GBR A;  2XK5 A;  3V62 A;  1ZXI A;  1T0Q C;  2LGX A;  3WAN A;  3DBH I;  2INC C;  5BYS A;  2HJ8 A;  2L32 A;  2MBH A;  2ZVO A;  4LDT B;  2I2Y A;  2ON8 A;  2K9X A;  4FJZ A;  3W1Y A;  3ZKJ C;  2MCN B;  2OED A;  1TYG B;  4LTU A;  4ZRQ A;  1MFW A;  2KT7 A;  4WIP A;  3RN9 C;  2E6X A;  2DBY A;  3U8Z A;  4C7Z A;  2YEP F;  1T5X D;  4KDI C;  2ZVN A;  4IWP A;  1HEZ E;  5BMI A;  2IGD A;  3N3K B;  3QAQ A;  4LNF A;  4MT5 A;  2Q5W D;  4XDC A;  1VRA B;  5EE9 A;  3VTU A;  1UBQ A;  3HM6 X;  4TUU A;  3VRA B;  1YMH E;  1LXD A;  4ZRJ A;  3C19 A;  3DOW A;  3QWZ B;  5BMH A;  4WWN A;  4MH8 A;  2UYZ B;  2KO3 A;  3P1M A;  3Q8E A;  5E6O A;  2RGF A;  3B2G A;  2MP2 A;  2KKC A;  1KF6 B;  1ET9 A;  3NOB A;  3B08 A;  3VR8 B;  1XQQ A;  2N7D A;  2RDB C;  2UU7 A;  2WXO A;  1L7Y A;  1E0Z A;  4KGR A;  3MJ5 A;  3UIN B;  3MP9 A;  2GB1 A;  3MC9 A;  3AE7 B;  1YN4 A;  4FN2 A;  3BY4 B;  1WRI A;  3NZU A;  4MSM B;  1L0V B;  2BS4 B;  2IGH A;  2WX1 A;  4ZRK A;  1WXS A;  2INN E;  3DVN V;  2N9K A;  4KVG B;  3ZYY X;  3MHZ A;  1QZE A;  3VDZ A;  5G55 A;  4S0R A;  3SDL C;  3C0R B;  1RWS A;  4L1B A;  3ZNG C;  2V3S A;  2BS3 B;  3DBL B;  1MHX A;  2MBB B;  2C7H A;  2GLS A;  2XN9 C;  5HI1 A;  1YX5 B;  1OQQ A;  1D3Z A;  4DHZ E;  2KVZ A;  3DVG X;  3OJ3 A;  3NRZ A;  1V6E A;  4P1C C;  2Y5C A;  2QEJ C;  1TZ1 A;  1T0Y A;  3RD2 A;  4NZL B;  3TEZ A;  4RCO A;  1N5W A;  3APD A;  3GP7 A;  2BB6 A;  3B2F A;  1H4R A;  1JW9 D;  1TS4 A;  4G50 A;  4DHJ B;  2G3Q B;  3BYT B;  2IY0 B;  3NS1 A;  2WS3 B;  1QKZ A;  2LMC A;  1QLB B;  3B1L X;  1WR6 E;  3GS2 A;  3TJP A;  1JWA D;  1FM0 D;  2KDF B;  2MH7 A;  4FLH A;  2MBO A;  3GE8 C;  1J7B A;  1ZDV A;  2GOW A;  3PZ7 A;  4JPS A;  1NEN B;  1NBF C;  4OW0 A;  4M02 A;  3LJ3 A;  5H8Y E;  4DHJ D;  2JZ3 B;  4FHJ A;  4II3 B;  2XK5 B;  4BKT A;  2MJE A;  2JYE A;  1ZW7 A;  4XWW A;  1P98 A;  2KX0 A;  4MEM A;  3KUZ A;  2JPH A;  2D10 A;  2WDR B;  3AMZ A;  2SEB D;  1U4A A;  2ICI A;  4IM2 A;  3P2B A;  5JXV A;  1KRH A;  2IND C;  4URK A;  1QOB A;  2IO3 B;  3NVV A;  2L76 A;  4P16 A;  1YJ1 A;  1ZXH A;  3GZN B;  1NYR A;  1RYJ A;  4LNO A;  1IGD A;  1RAX A;  4K7U A;  4WH4 A;  5J18 A;  1J7C A;  3TCA A;  2KC1 A;  1JRU A;  1ISN A;  5D94 A;  3W5V B;  5FKA C;  4PYU A;  3DBH B;  2DEN B;  3AU4 A;  2XEW A;  4DQO C;  2W82 A;  5BYQ A;  1FXT B;  2WXP A;  3Q6B A;  2WXI A;  2HE7 A;  2KDM A;  1QOG A;  3W5U B;  4YWG G;  2FCS A;  3VUX A;  2IYD B;  3NJT A;  3QHT A;  1L6U A;  4I6P A;  2VH1 A;  4A6Q A;  5CHF A;  2CHW A;  4TKN A;  1LM8 B;  3JVZ X;  3M63 B;  3QAR A;  1XD3 B;  1XLP A;  4RM8 A;  2ACZ B;  3Q8F A;  1ZE3 D;  3PO0 A;  3OG5 A;  1PFD A;  4W9F A;  4TQ1 A;  2DYB A;  1PGB A;  3M62 B;  2Z0D B;  1EWY C;  1P0R A;  1SIJ A;  1KTK A;  4MEL A;  1I4R A;  1YQB A;  2DX5 B;  3B0A A;  5IAA C;  1C4P A;  4YSX B;  3HM3 A;  1KM7 A;  2O2V B;  3RYT A;  5DPW A;  3PZ8 A;  4EFO A;  4ANX A;  1I4Q A;  1FO4 A;  2ZCC A;  1CMX B;  5IOI A;  3V60 A;  1E8W A;  2PLP A;  3SFD B;  2DNF A;  3URY A;  4EZK A;  1SE3 A;  2K8B A;  1ZOY B;  4BKS A;  2OOB B;  5TSS A;  1UBI A;  4M01 A;  1WE7 A;  2D3B A;  4C4V A;  2HJ1 A;  3HUI A;  5AUK A;  4IWQ A;  4LLG M;  1MJD A;  4NQK E;  4HKZ E;  2QC8 A;  3T9L A;  1FIQ A;  4II2 B;  4EE2 A;  1ZUD 2;  3RUL A;  4MJS A;  3P4P B;  1D5X C;  4BFR A;  1V81 A;  4WUR A;  4OZA A;  3K9O B;  3ZXV A;  1GC7 A;  4OZB A;  3Q3O C;  1WGR A;  4A3P A;  2QHO A;  3WCQ A;  1YNT E;  3H1U A;  1NEK B;  4IOI E;  2EKI A;  3U7D A;  3VR9 B;  1ZPS A;  1AYF A;  2PKO A;  2KWD A;  2FBW B;  4P6V F;  4DHZ B;  4S17 A;  1JQ4 A;  3P42 A;  3PS6 A;  1J7A A;  2NVU I;  1WGH A;  1QT9 A;  3I57 A;  5TR5 A;  1VR9 A;  1GC6 A;  1F52 A;  2CU1 A;  3E9S A;  4GMV A;  1V1O A;  2R2O A;  2L52 A;  1VLB A;  4FAD A;  1WGY A;  3RNA C;  1MG8 A;  1E90 A;  1FXI A;  1I7H A;  4HRS A;  1F1H A;  5J17 A;  3PZD A;  3ZRC A;  2N9L A;  4HKQ A;  2K6D B;  1FRR A;  2O6V A;  1N60 A;  4JIO U;  2EMS A;  1VZ7 A;  3VH3 B;  1FCC C;  3ML8 A;  4G11 A;  4J3O D;  3RNF C;  1AAR A;  2RR9 A;  2K39 A;  3FIL A;  2FUG 1;  3U30 A;  2QDF A;  3VXW A;  2I1K A;  3EFU A;  2WP9 B;  4GGQ A;  4QAY A;  1K50 A;  3H7P B;  2JT4 B;  1IBX A;  1MI0 A;  5G5H A;  3DWM A;  5EE0 A;  2R61 A;  4O1N A;  2KFJ A;  4A55 A;  1Q1O A;  2V9H A;  2KLC A;  4KZC A;  1E7U A;  3UQB A;  1IGC A;  3V6E B;  2N4F A;  3IVF A;  4US8 A;  3BVZ A;  2I1J A;  2V4I B;  1EU3 A;  2M8S A;  2NPT B;  2QJL A;  1WM2 A;  3ABV B;  5AEK B;  2PW9 A;  3IG3 A;  2GRI A;  3HIZ A;  3EA6 A;  3HVD A;  3APC A;  3AE5 B;  3AV8 A;  1V86 A;  1OQR A;  3A9J A;  2KQ7 A;  1ROE A;  3NVY A;  1TKG A;  2KYW A;  2DAF A;  2KMM A;  2DYM A;  2CJO A;  4C56 C;  1Y56 A;  3GOE A;  4ZDV A;  4CHK A;  2MQJ A;  2HDE A;  4HDQ A;  2RPV A;  5D2M B;  4W9E A;  2Y5P A;  1UD7 A;  2WGS A;  2QSD A;  2NR2 A;  2DHZ A;  1JRO A;  3R2I A;  4JGH B;  2AWT A;  2BKR B;  4WWM A;  1JML A;  2REX A;  1YOV B;  3MHS D;  1SSN A;  2W9N A;  2LVO A;  3VFK A;  5AZG A;  4L23 A;  2RDG A;  4LNI A;  4LNK A;  2NTT A;  3LYY A;  2WDV B;  3DHH C;  1QOF A;  3MC8 A;  2B3A A;  2KWV B;  2LRW A;  3A9K A;  1STE A;  4TSS A;  2LGY A;  2OHF A;  4MJS B;  4YSZ B;  4IWO A;  4KGT A;  4MGK E;  2GMI C;  3UF8 A;  4BKS D;  4EZL A;  4JX1 C;  3KWL A;  3DVG Y;  3RPF C;  1C4C A;  3X23 A;  3RI7 C;  4NAW B;  4BOS C;  4XE0 A;  4FJY A;  4WJP A;  2FCM A;  2KNB A;  3WAL A;  1WF9 A;  2CR5 A;  4WWO A;  1EWC A;  2LI5 A;  2IJ0 A;  3BZD B;  2JUO A;  4JWU C;  3I3T B;  5JH5 C;  1QF6 A;  2C7M B;  2LGI A;  2LHE A;  3ZW3 A;  1L0Y B;  2M1M A;  4JWS C;  3AM9 A;  3AE2 B;  3IAM 1;  3IT4 B;  3ZDT A;  1C78 A;  4W9H A;  2JQR B;  3DCG A;  1KH0 A;  1WE6 A;  2MX2 A;  3PLU A;  3UQA A;  1C1Y B;  2VZK B;  2AL6 A;  3NUH B;  4RGN A;  1OFF A;  2J0J A;  3FAH A;  1RFA A;  3N1Z C;  1P9D U;  1QOA A;  2JF5 A;  2O6V B;  2IPK D;  5BMG A;  2IO1 B;  1S1Q B;  2D2Q A;  3NS8 A;  4ANV A;  1R4N I;  3JW0 X;  1WH3 A;  1M94 A;  2K5P A;  2KTR A;  3QIJ A;  1CQV A;  3FIL B;  3ZXR A;  5MPO A;  2X8X X;  3AE9 B;  2VZK D;  2WX0 A;  3T3N A;  2QMT A;  4EUT A;  3IAS 1;  3PSE B;  3AE6 B;  2L05 A;  4KDL B;  2K0P A;  4XWT A;  5GMV A;  3RZW C;  3VVW B;  4HLE A;  2M0A A;  2O6V D;  1YQ4 B;  3PTF C;  5CHV C;  1XXG A;  2MHJ A;  1SBB B;  5E6J A;  2NBU A;  1HA5 A;  2KZR A;  3DBR I;  3JSV A;  3VTW A;  2JRH A;  2INP E;  1DYQ A;  2ZNV C;  1I35 A;  2DLB A;  1RM6 C;  4WQO B;  5EE1 A;  1SF0 A;  1TTN A;  3QJZ A;  1EF5 A;  3I9V 1;  3OWE B;  4M0W A;  4HWI B;  2HD5 B;  2HTM E;  2K8H A;  2LJI A;  2RDH A;  4ARC A;  4RM9 A;  1F2R I;  1Q0W B;  2FUH B;  2KDE B;  3VUW A;  5J2R A;  1WXA A;  1L2N A;  2WXM A;  4FHK A;  2JY6 A;  4K1R B;  4KIK A;  2LUE A;  3SU8 X;  3BIN A;  2JVC A;  3RT3 B;  2V0G A;  2AQ1 B;  1K8R B;  2YVC A;  3IXS A;  2J4X A;  3KH0 A;  4RMA A;  2LJ5 A;  2ZNV B;  2ONQ A;  4G3X B;  4MH0 E;  2KAN A;  4DDI D;  3DHI C;  4BVU C;  2BT6 A;  3AE8 B;  2Z0E B;  3AB5 A;  2MA9 B;  1N61 A;  3PT2 B;  3OJ4 B;  2L0F A;  1I4G A;  1TS5 A;  5DCN A;  4B95 A;  4GDK B;  2JZZ A;  5BYR A;  2BF8 B;  2AQ3 B;  3KWV A;  3A9K B;  2C9W B;  1WXV A;  2PJH A;  2JU6 X;  2N7J A;  1I4X A;  1V8C A;  1WZ0 A;  2LVP A;  1JWU D;  2NBW B;  1P7F A;  2MBE A;  4E74 A;  1B1Z A;  1N63 A;  1V49 A;  4MM3 A;  4TV3 A;  1X1M A;  3L08 A;  4IG7 B;  1AW7 A;  2KJH B;  1L0X B;  3Q2A C;  3FC4 A;  4RGO S;  5GXG B;  1OEY J;  1UNS A;  2BYV E;  4US9 A;  3ZGZ A;  4NQL B;  2BYT A;  3BK2 A;  1M4V A;  2JSV X;  4FUL A;  2K3U A;  2B76 B;  2FAZ A;  3C8Y A;  2V1Y A;  2N9P C;  4ZRP A;  1FPY A;  1K52 A;  2V3N A;  4ITK A;  2N9E B;  3AUL A;  3P4R B;  2M56 B;  4MDK E;  2FNJ B;  5G5G A;  1GPX A;  4YXD B;  1SJE D;  2ZJD A;  3Q8B A;  1UWM A;  2GBK A;  1FNV A;  5BO4 B;  3H8H A;  2VH2 A;  3EUB 2;  5KHO A;  4PS3 A;  3LB8 C;  1KJT A;  3WAM A;  4ZHP A;  1OTR B;  2Z59 B;  3U4E G;  2KTR B;  2WXJ A;  3UIP B;  1WIA A;  2MJD A;  3EGR A;  2PVO D;  2MP2 B;  4WWP A;  2LUM A;  4Q2J A;  2ZPN A;  3VTV A;  1N6Z A;  1FFU A;  2FCN A;  2G4S A;  1Q10 A;  1WGG A;  3TIX A;  2DZK A;  2W3S A;  3TUO A;  4WJQ A;  1SEB D;  3V61 A;  2QIL A;  1LQB A;  1Z5S B;  3JSV B;  1TT5 B;  2WXQ A;  3W1S A;  5I4D A;  1JCK B;  2D3G A;  1L5P A;  4BAX A;  1CJE A;  4CQN A;  3VHT C;  2KTF A;  1R4N B;  5HHD G;  1F2R C;  1HTQ A;  2K1F A;  4ARI A;  1EU4 A;  1MPE A;  1T6B X;  3IBE A;  3RNE C;  3TMP B;  2XNA C;  3DHG C;  3RNC C;  2BTE A;  1V97 A;  3BK1 A;  4LNN A;  5LLI A;  4KZ0 A;  4YTN B;  4GDL A;  1KOT A;  3N1Y C;  4BBN C;  1D5Z C;  4AS1 A;  4P1B C;  5DPS A;  1QQR A;  2MBQ A;  3TEW A;  1VJK A;  5CX3 A;  3DBR B;  3APF A;  3PVL A;  3UI3 A;  4CYE A;  3AE3 B;  5D3I B;  3AED B;  3RNB C;  1DGJ A;  3RZF A;  4WAF A;  2KQS A;  1HQR D;  1G6J A;  3MC0 B;  4KKI A;  4FJV B;  2IDY A;  2WYQ A;  4DXF A;  1GNU A;  5FR3 A;  3U7Z A;  4AWJ A;  4ZHO A;  1T3Q A;  2WXK A;  2PMV A;  1E8Y A;  1BUI C;  3NVW A;  1T0R C;  4IM0 A;  4FXC A;  1EUV B;  3D32 A;  4DBG A;  2A4Z A;  1WYG A;  4R3D A;  2JWZ A;  1OQY A;  1JWS D;  4B0M A;  1FNU A;  4N9F 4;  1HXY D;  1ZGU B;  2NTS A;  2SAK A;  3R7R A;  1EO6 A;  4HVB A;  3ZJV A;  2M17 A;  2CHX A;  2MRP A;  4X57 B;  2C5L C;  3CST A;  3IFW B;  3R3M A;  1WWT A;  3S2A A;  1E8X A;  4JE3 B;  4B6W A;  4MGZ E;  2KN4 A;  3PLV A;  3KQ4 A;  3MTN B;  2J7Q B;  4RF0 A;  2L3Z A;  4KSK C;  2MSE D;  2BVC A;  1RRB A;  3LDZ E;  3BVG A;  1WJU A;  2D3A A;  3PPA A;  4NJ6 A;  1IYF A;  3LXF A;  1E10 A;  1FMA D;  4GOC A;  5CHW A;  1J8C A;  2GBJ A;  2RSU A;  3ZJU A;  1C9F A;  2PTL A;  3ZLZ A;  3ZJT A;  3W1S C;  4BZA A;  4JLC A;  1PGA A;  1UGJ A;  2WU5 B;  4YTP B;  1XLQ A;  3OLM D;  2Y5B B;  3NHE B;  1H8C A;  4F7Z A;  2D11 A;  3IHP C;  3H9D A;  3NG0 A;  4XGA B;  3A4S C;  4LJP B;  2KK8 A;  3QX1 A;  1D6E C;  3AU5 A;  2YLM A;  5HFY A;  1KLG D;  1F0Z A;  4B0E A;  3AXC A;  2OJW A;  1DOI A;  1WSP A;  2KMC A;  4HXD A;  3AEB B;  5L95 C;  1E8Z A;  1TZO A;  1YN3 A;  2NBV B;  2JX5 A;  4FA6 A;  2WXH A;  3TBL D;  3DBS A;  4DK5 A;  3CIR B;  1DOY A;  5KHQ A;  5L83 A;  4HPL B;  2X38 A;  4W9I A;  1RFK A;  3AH7 A;  2Y3A A; 
#chains in the Genus database with same CATH homology
 3PZ7 A;  4YSY B;  1SXT A;  2IPK D;  5BMG A;  4JPS A;  2AQ2 B;  3TEY A;  1NEN B;  2H89 B;  1B9R A;  4OW0 A;  1L6V A;  5H8Y E;  2K5P A;  1FNW A;  4YT0 B;  2M19 A;  1CQV A;  2KQ4 X;  3FIL B;  5MPO A;  2W55 A;  3AE9 B;  1HZ5 A;  2JYE A;  2MJE A;  4XWW A;  4C7Y A;  1GB4 A;  2VZK D;  1PUT A;  4MM3 B;  4KGS A;  1SB3 C;  1XLO A;  3T3N A;  2QMT A;  3IAS 1;  1BML C;  1MHH E;  5AUI A;  3AE6 B;  2WDR B;  3AMZ A;  2E3T A;  3W2D A;  2K0P A;  1YJI A;  2SEB D;  2DWQ A;  4XWT A;  3W9C B;  1CZP A;  2M0A A;  2ICI A;  1ET6 A;  1YQ4 B;  1PYW D;  1JRP A;  1XXG A;  5H92 C;  5JXV A;  2QIE B;  3AN1 A;  1KRH A;  1XCQ L;  4NJC A;  1SBB B;  2BS2 B;  5E6J A;  1VDV A;  1HA5 A;  3AEC B;  1QOB A;  1TY0 A;  3NVV A;  2INP E;  1DYQ A;  4P16 A;  4XDD A;  4N59 A;  1IUE A;  1KLU D;  4HEA 1;  1SE4 A;  1ZXH A;  2DLB A;  1NYR A;  1RYJ A;  2WNM A;  1RM6 C;  4L2Y A;  5EE1 A;  1P7E A;  1IGD A;  1SF0 A;  4WH4 A;  3I9V 1;  2D5G A;  1J7C A;  2J42 A;  3OWE B;  4M0W A;  3HRD D;  3L4P A;  2HTM E;  2LJI A;  2RDH A;  4ARC A;  2ZW0 A;  1F2R I;  3W5V B;  5FKA C;  1V1P A;  1GOZ A;  3BVM A;  3HVZ A;  2JYT A;  5HG2 A;  4DQO C;  3E56 A;  2W82 A;  1TKE A;  5BYQ A;  2WXP A;  2WXM A;  2N0S B;  3Q69 A;  2V3P A;  1XF5 L;  2WXI A;  2LFI A;  2KDM A;  3RFZ B;  1QOG A;  2EEL A;  1L4D B;  1NYQ A;  4ZOH C;  3W5U B;  4YWG G;  2V0G A;  2AQ1 B;  2LEK A;  2PVG C;  4A9A A;  1I4H A;  1L6U A;  4A6Q A;  3IXS A;  2J4X A;  2LHD A;  5D7G A;  1JAL A;  2ONQ A;  2BT6 A;  3AE8 B;  3AEA B;  3AB5 A;  1XLP A;  1CK1 A;  2JZP A;  3TEX A;  1N61 A;  2ACZ B;  3Q8F A;  1ZE3 D;  2RMM A;  1UWX A;  3SFE B;  3PO0 A;  1I4G A;  1E6E B;  1TS5 A;  4RH6 A;  1PFD A;  4H2A A;  4GDK B;  5BYR A;  2J52 A;  2AQ3 B;  1GB1 A;  2WXN A;  4TQ1 A;  4N58 A;  1PGB A;  3KWV A;  5C3J B;  1EWY C;  4AQ7 A;  2JU6 X;  1SIJ A;  1KTK A;  2K22 A;  1I4X A;  2N7J A;  1I4R A;  1V8C A;  1JWU D;  1ACC A;  1P7F A;  1C4P A;  4YSX B;  3R8B A;  1FRD A;  1PGX A;  1B1Z A;  1N63 A;  1VZ8 A;  3CWI A;  1ESF A;  3PZ8 A;  1MVK A;  3VQI A;  3AEF B;  1AW7 A;  1I4Q A;  2PIA A;  1FO4 A;  1YJJ A;  1JWB D;  1TY2 A;  1N62 A;  4D2K A;  1L0X B;  4IDI A;  3FC4 A;  4RGO S;  2PLP A;  5GXG B;  3SFD B;  4GDL B;  1UNS A;  2IGG A;  3MFG A;  4US9 A;  3ZGZ A;  1TS2 A;  3URY A;  1PDX A;  2BYT A;  3BK2 A;  1SE3 A;  4YTM B;  1FD6 A;  1M4V A;  1ZOY B;  2JSV X;  3TSS A;  5TSS A;  4ZYS A;  2K3U A;  2B76 B;  3KLS X;  4N6E B;  3C8Y A;  2TSS A;  4OHJ A;  1IBX B;  1NI3 A;  3BYY B;  1ENF A;  1E9M A;  1SJH D;  4ZRP A;  3HUI A;  1L4Z B;  5AUK A;  4LLG M;  1QIL A;  1K52 A;  2CU3 A;  2BW2 A;  1N5X A;  2V3N A;  4HKZ E;  4ITK A;  3P4R B;  4DXG A;  2M56 B;  1FIQ A;  5G5G A;  4UDU C;  4EE2 A;  1ZUD 2;  1R7S A;  2W3R A;  3P4P B;  1D5X C;  1UUP A;  1GPX A;  4YXD B;  1SJE D;  2NMQ A;  3O13 A;  3Q8B A;  4WQM A;  4OZA A;  3GB1 A;  1UWM A;  4WUR A;  1FNV A;  3H8H A;  4OZB A;  3EUB 2;  4HRO A;  3LB8 C;  4TMA B;  3WCQ A;  3U52 E;  4ZHP A;  1D4B A;  5C2T B;  1YNT E;  1NEK B;  3U4E G;  3T3O A;  2JXT A;  2WXJ A;  2EKI A;  2MEK A;  4IOI E;  3VR9 B;  1VZ6 A;  2MJD A;  3EGR A;  1ZPS A;  2FE8 A;  2PVO D;  1D5M C;  1YN5 A;  3IT6 B;  4PT5 A;  1AYF A;  1HZ6 A;  2PKO A;  1JWM D;  2LUM A;  4Q2J A;  4RNA A;  1WXQ A;  2KWD A;  2FBW B;  3V3X A;  4P6V F;  1FFU A;  2WQY B;  1XO3 A;  1JQ4 A;  2AX5 A;  1F77 A;  3P42 A;  1Q10 A;  1J7A A;  4NAM A;  1QT9 A;  1ZP0 B;  2W3S A;  3TUO A;  3U2S C;  4RGM A;  1BXT A;  3I57 A;  1SEB D;  1VR9 A;  4OVZ A;  5D3D A;  2QIL A;  1C4A A;  2H88 B;  3E9S A;  1V1O A;  2L52 A;  1VLB A;  2WXQ A;  3DWG C;  3W1S A;  1KFY B;  5I4D A;  1JCK B;  5T8I A;  1XCT L;  1L5P A;  4RF1 A;  3NZ3 A;  1FXI A;  1I7H A;  2WXF A;  1CJE A;  4HRS A;  2MJ3 A;  1C76 A;  4CQN A;  1C77 A;  2WLB A;  1K53 A;  3Q8C A;  5HHD G;  2CJN A;  2YEP B;  1F2R C;  4ARI A;  1EU4 A;  2N9L A;  1MPE A;  1T6B X;  4HKQ A;  3ZQ4 A;  1FRR A;  2J53 A;  1XLN A;  3NVZ A;  2XNA C;  1N60 A;  3VRB B;  2BTE A;  1V1P B;  1V97 A;  1K51 A;  2BBC A;  3BK1 A;  2WXR A;  1VZ7 A;  1FCC C;  4J3O D;  4IKG A;  4MAC A;  4YTN B;  1WGK A;  2G1E A;  3N9Y C;  4TQ0 A;  3FIL A;  2FUG 1;  1D5Z C;  1ZXI A;  3AE1 B;  4KX6 B;  1FCL A;  4AS1 A;  1AN8 A;  5BYS A;  1I4P A;  1QQR A;  2L32 A;  2KAC A;  4HJG E;  3TEW A;  1VJK A;  5EE3 A;  2WP9 B;  1ZDX A;  2I2Y A;  2ON8 A;  1K50 A;  2K9X A;  3UI3 A;  4GLS C;  1IBX A;  3Q8A A;  1MI0 A;  1C79 A;  5G5H A;  3DWM A;  2OED A;  1TYG B;  4LTU A;  2BB5 A;  3AE3 B;  5D3I B;  5EE0 A;  2KAJ A;  4ZRQ A;  3AED B;  4WIP A;  2E6X A;  1DGJ A;  2DBY A;  2R61 A;  4WAF A;  4O1N A;  1HQR D;  4A55 A;  4C7Z A;  3MC0 B;  2YEP F;  4KKI A;  1T5X D;  2IDY A;  4DXF A;  1HEZ E;  5FR3 A;  5BMI A;  2IGD A;  3U7Z A;  4MT5 A;  4KKJ A;  2Q5W D;  2ZW1 A;  1VRA B;  4XDC A;  4ZHO A;  1T3Q A;  2WXK A;  2PMV A;  1IGC A;  5EE9 A;  3NVW A;  1BUI C;  4US8 A;  1TKY A;  3SEB A;  3BVZ A;  3VRA B;  1YMH E;  2V4I B;  1EU3 A;  4RFB A;  1DOX A;  2QJL A;  3ABV B;  3BII D;  1TJE A;  5BMH A;  4FXC A;  2PW9 A;  2GRI A;  3P63 A;  4MH8 A;  4LK0 M;  3EA6 A;  3P1M A;  3Q8E A;  1YQ3 B;  3ETR A;  3HVD A;  3V05 A;  3B2G A;  1GAQ B;  3AE5 B;  3AV8 A;  1OQR A;  1WYG A;  1ROE A;  4R3D A;  3AEE B;  1KF6 B;  1JWS D;  1ET9 A;  3NVY A;  2W54 A;  4B0M A;  1FNU A;  1TKG A;  4A90 A;  2KMM A;  1HXY D;  2NTS A;  2I38 A;  2SAK A;  3VR8 B;  2DYM A;  3ZJV A;  2CJO A;  4C56 C;  1Y56 A;  4OZC A;  2HDE A;  1FXA A;  1WWT A;  2WXO A;  1EM7 A;  4REZ A;  2RPV A;  4JE3 B;  1E0Z A;  4KGR A;  3MJ5 A;  2Y5P A;  2QSD A;  1JRO A;  1TS3 A;  3J9C A;  3MP9 A;  3R2I A;  4WWM A;  1FFV A;  1JML A;  2GB1 A;  2KN4 A;  2GI9 A;  3KQ4 A;  3AE7 B;  4RF0 A;  3R2T A;  1YN4 A;  3P4S B;  3BVG A;  1SSN A;  1WRI A;  4L23 A;  2RDG A;  1L0V B;  3LXF A;  2BS4 B;  2NTT A;  3LYY A;  1FMA D;  1E10 A;  2IGH A;  2WDV B;  1QOF A;  5LNK 1;  3ZJU A;  1C9F A;  2PTL A;  2INN E;  3ZJT A;  3BWU D;  1A70 A;  1STE A;  2N9K A;  1E7P B;  1PGA A;  1UGJ A;  4TSS A;  2OHF A;  3ZYY X;  3MHZ A;  2WU5 B;  1SE2 A;  4YSZ B;  2L1A A;  4YTP B;  4KGT A;  1RWS A;  4L1B A;  1XLQ A;  3B9J A;  2BS3 B;  1MHX A;  1AWD A;  4JX1 C;  2WDQ B;  2WXL A;  3KWL A;  3SR6 A;  3RPF C;  4C80 A;  1C4C A;  2WXG A;  2XN9 C;  1OQQ A;  5HI1 A;  4NAW B;  4A8X C;  4XE0 A;  3NRZ A;  1D6E C;  2JWU A;  1EWC A;  2G9H D;  2IJ0 A;  2Y5C A;  5HFY A;  1NVI D;  1KLG D;  3BZD B;  1F0Z A;  4JWU C;  4B0E A;  1QF6 A;  2QEJ C;  2LGI A;  1DOI A;  1WSP A;  3AEB B;  2LHE A;  4NZL B;  3TEZ A;  1L0Y B;  4RCO A;  1N5W A;  4JWS C;  3AEG B;  1LO5 D;  2Z8L A;  3AM9 A;  3GP7 A;  2BB6 A;  3B2F A;  3P4Q B;  3AE2 B;  2L83 A;  3IAM 1;  3IT4 B;  2WU2 B;  1C78 A;  1JW9 D;  1TS4 A;  1TZO A;  5FK9 C;  1FEH A;  1YN3 A;  2JX5 A;  2JQR B;  3BYT B;  2DYO A;  3AE4 B;  1KH0 A;  2WXH A;  3NS1 A;  2WS3 B;  1QKZ A;  2LMC A;  1QLB B;  3CIR B;  2VZK B;  1DOY A;  3GS2 A;  3NUH B;  1XEE A;  1JWA D;  4RGN A;  2X38 A;  1FM0 D;  1OFF A;  1RFK A;  3AH7 A;  2MH7 A;  3FAH A;  2Y3A A;  1J7B A;  1ZDV A;  4RGT A;  1QOA A;  4USA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...