4LK0M

Crystal structure analysis of the e.coli holoenzyme/t7 gp2 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
51
structure length
51
Chain Sequence
NKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phage T7 Gp2 inhibition of Escherichia coli RNA polymerase involves misappropriation of sigma 70 domain 1.1.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 11
structure length 51
sequence length 51
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF16857 RNA_pol_inhib RNA polymerase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.510 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4lk0M00
2LMCA 4LLGM 2WNMA 4LK0M
chains in the Genus database with same CATH superfamily
2LGYA 1JCKB 3AEFB 4RF0A 2L8JA 4ANUA 1TJEA 3WIMA 2EKIA 2KC2A 3ZKJC 1QT9A 4P16A 4LJOB 4WIPA 2FCSA 2LRUA 2BGFA 3APDA 3NVWA 2KWDA 2QDFA 3R7QA 2LGIA 3L08A 1UUPA 1PDXA 4ZRIA 4YTNB 3RNAC 1VRAB 3H7SA 2GB1A 1IP9A 4A20A 1SEBD 3L17A 2O2VB 1K52A 2K22A 3TCAA 4EZJA 3APCA 4N59A 1FNUA 3OJ4B 3RNEC 4ZYNA 5EE0A 4FN2A 2N7EA 2ZW1A 3P1MA 1DYQA 3VH4B 1NENB 5FR6A 2X8XX 2V3PA 2ACZB 2FIDA 2D3CA 1UWXA 3EGRA 4K81A 3W5VB 2MH7A 1IBXB 2KDIA 4ZRJA 2JT4B 2Y5PA 1K51A 2DYMA 1S1QB 5H92C 1YQBA 2Y3AA 4FHKA 3ZGZA 3NY5A 4HKZE 3W1SA 3I3TB 3T3NA 3MTNB 3L54A 3BWUD 5KHOA 4A55A 4GIVA 1EWCA 1T5XD 4M01A 3NZUA 2GI9A 4FLHA 2LXAA 1TYGB 2Z0EB 3KUDB 2KAJA 4EZKA 2DZIA 1YD8U 4ANWA 4EZLA 4A6QA 2IBIB 3TEYA 2LVQA 2KZRA 5D7GA 5G5HA 1FCLA 1AARA 3DOWA 3BYYB 1WFYA 3JSVB 4X57B 3MP9A 4RGMA 4KIKB 3KLSX 3DBLI 3V6CB 1ZP0B 1TZOA 2LHDA 5IOIA 3SFEB 5IO9A 2KTRB 2HE7A 1ZE3D 2JPHA 1T0QC 3EHVA 3EUB2 3NZSA 1P7FA 1EWYC 5E6NA 2D2QA 1MHXA 3CMMB 1C4AA 4WAAA 3ZNHB 1TGZB 3GE3C 3P4PB 2WWZA 1MG4A 2KDFB 5CHFA 2KNBA 4W9GA 2D5GA 3BVGA 4YWGG 4IWOA 5IA7A 2DZKA 3BVMA 3RNBC 2NS5A 4KKIA 4IG7B 3VHTC 3AXCA 4BZAA 3AB5A 1K8RB 1KM7A 1DGJA 3E56A 3NVZA 3PVLA 2LRWA 3HM6X 4YSXB 5IP4D 3VUXA 1WGYA 4BVUC 1ISNA 2LVPA 5JHBA 1NEKB 2INDC 5AZHA 5HI1A 2WXMA 4BFRA 1XLQA 2J4XA 2KQ4X 1VZ6A 4ARIA 4ICUA 1QOGA 2BWES 3C19A 4ZDVA 2FCQA 3AE4B 1I42A 3BINA 1CJEA 2ZNVB 4IM3A 4EFOA 3DWGC 1UBQA 3M95A 4REZA 2YEPB 1YIWA 3NVYA 4AOFA 4NZLB 5C2TB 3RYTA 1M94A 1PUTA 3A9JB 3QJZA 1SIFA 1P0RA 2AL3A 1ZDXA 1JWMD 2XNAC 2KDEB 3DDCB 3PV1A 4IW0A 2Z59B 2Y5CA 4HJKA 1E8ZA 3AN1A 1CQVA 4GB9A 2D3BA 3FC4A 1JRPA 2Q5WD 1WGGA 2JUOA 2R61A 4M0WA 2LXCA 3H6NA 2VRRB 2INCC 3HHMA 2MA9B 3AECB 2BVCA 4DXFA 3N9YC 4E71A 2KK8A 3L10B 1KH0A 3URYA 5GMVA 3SHQA 3QWZB 4JGHB 4C7YA 2DZMA 3FKYA 4EOYA 1P9DU 1QQRA 3Q3FA 4YT0B 1VDVA 1I4PA 2MBEA 1YQ3B 5BMIA 1C79A 2MCNB 3KYDD 4BKSD 3HVZA 2G4DB 1C1YB 3A4SC 3AMZA 5AEKB 2BYFA 3PO0A 4FBJB 5FK9C 1FFVA 1V9JA 3I5JC 3RULA 2N9LA 1XQQA 2WXPA 3IG3A 2LZ6A 1XF5L 4LLGM 1H8CA 1UGJA 4XDDA 2M17A 2HTME 5AZFA 2RSUA 4JWUC 2HJ1A 2J0MA 1C3TA 5EE9A 2WXJA 2D3AA 1G6JA 3VUWA 4OVUA 1P3QU 4B9KA 4B95A 1U4AA 3QX1A 4KGSA 2WLBA 1T0SC 2IDYA 4ARCA 5DPRA 2LJ5A 2IYDB 5DCNA 3RD2A 2IGDA 2MX2A 2WXKA 5D94A 1RFAA 2W54A 4PS7A 1SE9A 1YN5A 4ICVA 4J3OD 1E0ZA 1SF0A 1D4BA 4E3CA 2XEWA 1I4XA 2D11A 1E7VA 1RWSA 2RDHA 4TQ1A 3KQ4A 4JE3B 1B1ZA 1R4MI 2JVCA 5KHQA 3VFKA 1GC7A 2BT6A 2KQ7A 2Z0DB 4C7ZA 2O6VA 3N1XC 4CO7A 4TUUA 2DZJA 4G50A 1AW7A 2K39A 2KFKB 2E6XA 1WX7A 2WXNA 1HTQA 3PPAA 2KLCA 1YOVB 5MPOA 2VZKB 4HXDA 1R4NB 2KFJA 3QC8B 1UZXB 1OTRB 3MC0B 1V49A 1V80A 3V61A 2AWTA 2N9PC 3VR9B 1ZXHA 2W82A 4II2B 2N0SB 5LXHA 4XWTA 4BBNC 3DVGY 2L0TA 1XEEA 2ZJDA 3DWMA 3N20C 3PLVA 2FIFA 1N62A 3SFDB 1WXAA 3UI3A 2G45B 2MEKA 2WXOA 3U52E 1L5PA 3DVNV 1L0XB 1P1AA 1OQQA 2WXIA 4WJOA 1Q0WB 3PRMB 1FMAD 3V05A 1J8CA 1I4RA 1KLGD 1WGRA 2LJIA 2RMMA 2GLSA 3N30A 4BBNF 2XN9C 1N5WA 2KQSA 3CSTA 2KMCA 4WURA 1DOYA 2M19A 2L76A 2WU2B 3AEAB 4CQNA 4LNKA 5AUIA 3PZDA 4GOCA 2R2OA 2BPSA 3JYUA 3DHIC 2GOWA 2BKFA 2NBWB 4G0NB 4NY0A 3L4PA 1OEYA 2VH2A 4YSYB 1YX5B 3Q3OC 4YSZB 5BMHA 2FUG1 2BYVE 2MRPA 4MGZE 2C7MB 2MBHA 4IKGA 1WE6A 3FAHA 3K9OB 3R2TA 2GBJA 4GMVA 4HCNB 1V6EA 1JWSD 2G1EA 4F7ZA 4XWWA 4C4VA 4OZAA 1KFYB 2JYTA 2I1KA 1WM3A 1T0YA 4HKQA 3U8ZA 1ENFA 5DPWA 3ZYYX 3VQIA 2M1MA 3LJ3A 1RAXA 3EFUA 1YJJA 2RDBC 2ZPYA 4FXCA 2WDVB 4OHJA 2D10A 2KX0A 4HCPB 1WH3A 2OOBB 1J7AA 1FXTB 1SE2A 1NBFC 1CK1A 2D3GA 4ZRKA 2YVCA 1GOZA 2AEHA 1K50A 2KC1A 3SEBA 5CHWA 1E5WA 1L0YB 1OFFA 1WRIA 2NBUA 4URKA 3ZJVA 2N1WA 2KMMA 3R3MA 1XLOA 2I2YA 1WXSA 2J53A 4K7SA 2MSED 2IO2B 1OEYJ 2JQRB 3MFGA 2NTSA 3VUYA 1GC6A 4RNAA 2BS2B 2RGFA 3SR6A 1N63A 2WXQA 2N7DA 4WWMA 1PGBA 2BS3B 1LM8B 4JPSA 1TKEA 4II3B 2KN4A 2EMSA 3BK2A 4BKTA 4M8MA 3L13A 3C0RB 2FCNA 4ANVA 1WJNA 1SE3A 2PVGC 3RZFA 3ABVB 3QARA 4I6NB 1XT9B 2DLBA 2SAKA 4DBGA 1ZW7A 1HA5A 2KJ6A 2QILA 2WDRB 3DBRI 3ONSA 4GU2A 3R2IA 3B1LX 4LTUA 2PE6B 3AE6B 3ZQ4A 3NVVA 2KDBA 1XO3A 2X38A 3UIPB 2NTTA 4GDLA 2ONQA 3TEWA 3KW5B 1UELA 4CHKA 2PPHA 1AN8A 3AE1B 1T6BX 4KV2A 4M00A 4OW0A 3H1UA 4A9AA 4MJSA 2K1FA 4PYZA 1AWDA 3ZXRA 5L95C 2W9NA 4LK0M 2N4FA 1BT0A 4R3DA 1RM6C 3LYYA 1IPGA 1MFWA 2KOXA 1RFKA 4L2YA 3E9SA 3B0AA 2O6VD 5FKAC 4XDCA 3NOBA 2V3NA 4WWNA 4N9F4 3VRAB 3DBHI 4ANXA 2KO3A 3JVZX 1E8YA 3QA8A 1WXVA 1V5TA 3Q8EA 1C4PA 1HTOA 3BZDB 4TQ0A 2OJWA 1DOXA 4A3OA 2Z8LA 3Q8CA 2A4ZA 2IPKD 4AS1A 3AEBB 1V1OA 5HG2A 4ZOHC 4F1SA 4DXAB 2K8HA 1WGHA 2RR9A 4MGKE 2MHJA 2KN5A 1WX8A 2AQ3B 1SJED 4KVGB 4LNOA 2ZPNA 3H7PB 2GBKA 2QJLA 3DBHB 1KRHA 3WAPA 4IOIE 3KWVA 3EFCA 2HD5B 2PKOA 2BKRB 1QF6A 3AH7A 5J17A 1Y56A 2DBYA 2EELA 2V4IB 4NAWA 3W9CB 3MC8A 1JALA 4US8A 2OEDA 3TUOA 1WE7A 3WANA 3TMPB 3BYTB 3W2DA 4OZCA 1MHHE 3NG0A 3RT3B 3Q6BA 3AE9B 4LDTD 1AYFA 4XE0A 2LFIA 4IUMB 2K6QA 2WDQB 2G3QB 3IAM1 2H89B 4RGNA 1A5RA 1WMHB 5JZEB 5HKHA 1FRRA 1P7EA 4USAA 2O6VB 3Q3NC 3PHWB 3MHZA 3PRPB 5T8IA 1D5XC 3KWLA 3LXFA 3S2AA 2MJEA 1ZUD2 2DNFA 4JWSC 2KJRA 5D6JB 2PLPA 4P6VF 4RH6A 4MGYE 2YLMA 1PGXA 3CF6E 2ZW0A 1HXYD 2L0FA 2G4SA 3UQAA 3AE7B 2AQ2B 3JW0X 2WNMA 4WH4A 4TKNA 3Q69A 2JWZA 1Y8RC 3N3KB 2UU7A 4OVZA 3VAWA 3GS2A 2OHFA 3UINB 5J2RA 4LNFA 1TS4A 1R4NI 2V1YA 1Q1OA 3PTFC 1V1PA 2KWUB 1OQRA 1WGDA 1HQRD 4NQLB 2PE9A 3U4EG 2PJHA 2BB6A 3A9JA 1ROEA 4DHJD 4HEA1 1L6VA 1IYFA 2W3RA 4NJ7A 3ZXVA 2ZCBA 3PREA 1ACCA 1TS5A 4WJPA 4BOSC 1M4VA 4TSSA 2CJOA 3IVFA 2IO3B 2IY1B 1HZ5A 1CMXB 2KKCA 1GB4A 4FULA 4I6PA 1YMHE 2XK5B 4RGTA 1KF6B 3PLUA 4S17A 4PT5A 1V1PB 4WAFA 2L1AA 4LNNA 1MPEA 3Q8AA 3QK0A 1LGRA 3VXWA 1SSNA 2M8SA 5LNK1 4Q2JA 1FRDA 1QILA 2L52A 2K5PA 2V3SA 2OJRA 1IGDA 1ZPSA 1UNSA 1LO5D 5IKCM 4IM0A 2FCMA 5FR3A 3BIID 1JMLA 3P63A 2JZZA 3OJ3A 4XYCA 1V5OA 1A70A 4L1BA 5G55A 2RDGA 1L7YA 3MHSD 2NPTB 2HTHA 4JIOU 4MH0E 3RN9C 1X1MA 3AE8B 3CSFA 1XD3B 2WXGA 1PYWD 1SJHD 2L32A 5H8YE 3ZNGC 1N60A 2V4LA 1C77A 2CHXA 1C76A 3RI7C 3I63C 3NHEB 1E10A 1E8XA 2PVOD 1GG3A 1Q10A 3K9PB 5J18A 1FXIA 5GXGB 2C7NB 1V86A 3NJTA 2ASQA 2ON8A 1SIJA 5TSSA 3P4RB 5D3DA 3QHTA 3D32A 3I57A 2V9HA 1EF5A 3IFWB 2WXHA 3TIXA 3WALA 1SGHA 3C8YA 3EC8A 1YQ4B 1JQ4A 2NBVB 4BAXA 3ML9A 3T3OA 1EO6A 4KKJA 3VVWB 2L00B 1EUVB 1YN3A 3N1YC 2WGSA 1YJ1A 1UF0A 4EUTA 2CHWA 1TKYA 3TL5A 3DHGC 4BOZB 3IXSA 5G5GA 4WJNA 4M0WB 2C5LC 2QCZA 1RYJA 2KHWB 2FBWB 4PK1A 2KWVB 4US9A 2PTLA 1F0ZA 1F9JA 4ACFA 5HHDG 4W9CA 3AE2B 3DVNU 2CU3A 3M3JA 5CTRC 1VLBA 1SXTA 1I4GA 3DPDA 1WYGA 4NAMA 2J42A 3EA6A 4G3XB 2BBCA 4G11A 1FEHA 1T0RC 1XCTL 4RM8A 3RPFC 3ZNID 2ZNVC 1S3SG 2INPE 1J7BA 4WWPA 4NQKE 2GBNA 4KSLC 1JWAD 2H88B 1ZXIA 1SBBB 1L4ZB 4K7UA 5G2NA 1PQSA 1NYQA 1J7CA 4A90A 2N9KA 1UD7A 2QEJC 1PFDA 2KLGA 2ZCCA 4JL9A 1ZGUB 1TS2A 2KWCA 2K8CA 2VZKD 2DENB 3CWIA 4ZRQA 3RNCC 2V0GA 1VZ7A 4UDUC 5IAAC 2AX5A 2KYWA 1D6EC 1MG8A 1C4CA 1YJIA 3HRDD 3LDZE 3ZDTA 1WWTA 4F8CB 1B9RA 1FNVA 2DYBA 2NCNA 4AUQC 4EE2A 2KFKA 2EMTA 2KJHB 4P1CC 4N58A 1VD2A 3HUIA 3A1QB 4MDKE 2KX3A 3ZJUA 3O65B 3Q3JA 1TY0A 1WF9A 4JX1C 2DX5B 3ZTCA 5JXVA 1WZ3A 1PGAA 2L83A 2PW9A 2BYEA 2I38A 3TEXA 1R4MB 1WJUA 4XX5A 2CKHB 4AWJA 3ZRCA 1N61A 3L0WB 2A5UA 3KUZA 2WS3B 3UIOB 2NMQA 4E74A 3KH0A 1WMHA 4C00A 4MEMA 4OZBA 2PEAA 3SU8X 5HFYA 1V81A 2IJ0A 1JWUD 3ZIMA 1TTNA 1ESFA 2BYTA 4ZHOA 5EDSA 2MBBB 3P4SB 3V62A 1ZKHA 2REXA 4DHZB 2CJNA 2WXLA 1QKZA 2JF5A 5AUKA 4YL8A 3U7ZA 2M0AA 3W1YA 4DQOC 4GXBA 5D3IB 5C3JB 3V60A 5BMGA 1E9MA 2QHOA 4PYUA 2MJ3A 2LUEA 2L3ZA 3QCAA 1T3QA 4OVVA 3NS8A 2K8BA 3IAS1 2CS4A 4K3CA 4MH8A 2WXRA 1FM0D 2RPQA 1VR9A 3RCZA 3TBLD 4RMAA 2EKEC 3DHHC 3H8HA 1MVKA 2J0JA 3RUIB 3Q8FA 2IY0B 1IBXA 2WYQA 2XK5A 1F77A 4LDTB 1MI0A 4MM3B 4IM2A 1ET6A 1QOAA 4IC7B 3DCGA 1WXQA 4K3BA 2C60A 5LLIA 2QSDA 1ZOYB 2JRHA 4WQMA 3QIJA 4ZHPA 3P42A 4PS8A 1VZ8A 2MQJA 2ICIA 3MC9A 1JROA 3NRZA 1C78A 5EE3A 2BQQA 1E8WA 1LXDA 2BS4B 4KIKA 1OGWA 2DAFA 3RNGC 3HM3A 2W55A 1WXMA 3AULA 1JWBD 2LD9A 1E6EB 2N1VA 3UF8A 2KDMA 4A3PA 1XCQL 2KVZA 2LWPA 4JLCA 3ZRFA 2BF8B 1ZDVA 3BVZA 2JSVX 5E6JA 2LEKA 1XLPA 3KYCD 1WR6E 1KOTA 2B3AA 2CR5A 3Q8BA 2UYZB 3HIZA 5I4DA 3AI5A 2J0KA 2AQ1B 3SDLC 2N7JA 2C9WB 1WSPA 2JZ3B 2IO1B 4BKGA 1FD6A 4KGRA 1R7SA 3AEDB 2O2VA 3IHPC 4GGQA 2K0PA 4HK2A 4KSKC 1RLFA 5E6OA 3Q2AC 2DWQA 3KVFB 4EEWA 2W3SA 3CIRB 1NVID 4ZRPA 2WP9B 2GRIA 4J6IA 1NI3A 3Q14C 3OAWA 2QIEB 1YNTE 3HK0A 3DQVA 4HWIB 1P98A 3GE8C 1JRUA 3NS1A 4S0RA 4HLEA 1WZ0A 4C56C 1WIAA 4HDOA 2MP2A 3PGEA 1F52A 3RFZB 4HPPA 4YTPB 3OG5A 3X0WA 2KMAA 2LMCA 1FCCC 4ITKA 2IO0B 4HPLB 2BB5A 4M8NA 4GDLB 4NJCA 1GPXA 1V97A 2UWQA 1E90A 1F1HA 3KUCB 1NDDA 5LXIB 5CX3A 4ZYSA 2HJ8A 3PZ8A 2BWFA 2FAZA 3AE3B 2LGDA 4W9KA 3FILA 5TR5A 4K7WA 4GN1A 4DXGA 2M0XA 5BO4B 2RPVA 3ZJTA 3VR8B 4A8XC 1XXGA 2CHZA 1WR1A 5JHAA 4PS3A 3AE5B 1STEA 3N1ZC 2LHEA 2QMTA 1QOFA 1HE8A 1V8CA 1GAQB 1TBEA 2K3UA 4DDGD 1TIFA 3ZVVA 2GBRA 4FADA 2KTRA 2WHIA 4HPMB 3PT2B 3B08A 2LUMA 1WI0A 2ZVOA 3T8MA 1GUAB 2DYOA 3O13A 3PSEB 1HZ6A 3ZLZA 1QLBB 4M02A 3ZUNA 1C9FA 2WU5B 3WA0A 2B76B 1XLNA 4RGOS 3GZNI 1WM2A 3ML8A 3RMKC 3N32A 2LGSA 2M56B 3AU4A 1LQBA 4NAWB 1LFDA 2D07B 3BY4B 1TT5B 2LASA 5JH5C 4WQOB 4YTMB 1N6ZA 3VTUA 4RF1A 3A9KA 3GZNB 1TZ1A 3VH3B 1RRBA 1BXTA 3ZO5B 3ALBA 4DDID 4HVBA 3HVDA 4DK5A 2JU6X 1EF1A 1JW9D 4N6EB 4W9IA 3M63B 1FXAA 4B6WA 4XC2A 2E3TA 3VTVA 4W9DA 1D5MC 2ZZPB 4WWOA 3VDZA 3ETRA 5BYRA 1UGMA 4RM9A 3MJWA 3H7PA 2MP2B 1I4QA 4P7IA 3U7DA 5IN7A 4IWQA 3H9DA 4K1RB 4DWFA 2RD0A 3GOEA 4DHZE 2KANA 2N9EB 4W9FA 4P1BC 2MWSB 4GDKB 1E7UA 3ZNZB 2HDEA 4B0EA 1I7HA 4XGAB 4H2AA 2KACA 2NR2A 3RZWC 3X23A 2KTFA 3ENEA 1MJDA 4C80A 1FIQA 2J7QB 2L05A 2FNJB 2KVRA 1UH6A 1EU4A 2FUHB 4GDKA 3W1SC 2KT7A 3P2BA 1WYWB 2LGXA 2JYEA 1L4DB 2INNE 2GMIC 4W9HA 4O1NA 5BYQA 3AEEB 3V6EB 4WJQA 3ZTDA 3P4QB 4I6LB 3WAMA 3VRBB 4D2KA 2SEBD 3Q3MC 2TSSA 3ZDMC 3IT4B 1Z5SB 3OWEB 3TJPA 3U30A 1YN4A 1BMLC 3JSVA 3IBEA 3SD5A 2L7RA 3QAQA 2WQYB 2WX1A 3R66C 2LI5A 3NUHB 4W9JA 4LNIA 3APFA 3WCQA 4KZ0A 4HROA 4MACA 4FJVB 3L16A 3DBSA 2J52A 2C7HA 2N9XA 2PMVA 4IWPA 5C23A 5BYSA 4NJ6A 4MM3A 1WX9A 1FPYA 3A4RA 2MLBA 2DHZA 4DHJB 1SE4A 1WRDB 3PZ7A 3V3XA 2WXFA 2Y5BB 1EU3A 1Q5WB 2YEPF 2MW5A 2K6DB 1UWMA 4QAYA 3PRZA 3A9KB 2JXTA 1TKGA 1TY2A 4NPNA 4ASWC 4BKSA 2ZVNA 1E7PB 2MBOA 1SB3C 4IDIA 5DPTA 2IGGA 3DBRB 4AP4C 1QZEA 1FFUA 4W9LA 3LB8C 3AV8A 2JRIB 2FE8A 4KDLB 1FNWA 4KX6B 4RCOA 1BUIC 3W5UB 1L0VB 1H4RA 4GSWA 4LJPB 3GP7A 4W9EA 1N5XA 4NNJB 4FJYA 1KJTA 1F2RI 4MJSB 4YXDB 2MBQA 1DOIA 2BW2A 3R7RA 3AU5A 1L6UA 3DBLB 1WGKA 4KDIC 2G9HD 4TMAB 5AZGA 1KLUD 4HJGE 1OQYA 1WY8A 1KLVA 3UGBB 2JXXA 5E6PA 3PHXB 4AQ7A 2JZPA 4HDQA 2K25A 2LVOA 3GB1A 4MELA 2VH1A 2JX5A 4MSMB 2MJDA 3IT6B 1TS3A 4MT5A 3UQBA 3OLMD 4L23A 2AL6A 2CU1A 5CHVC 2IZVB 3ECIA 1NYRA 2IGHA 1I35A 1Z2MA 1GB1A 1IUEA 3I9V1 4LCDE 4TV3A 4EKUA 1GJZA 2PIAA 3NZ3A 3B2GA 3VTWA 3U2SC 1I4HA 2WX0A 1FO4A 4B0MA 1D3ZA 4AJWA 3MJ5A 2KXJA 1WJ4A 1V2YA 1QOBA 3FILB 1D5ZC 4JQWC 3DVGX 5L83A 1VCBA 1IGCA 3TEZA 1GNUA 2R2QA 3T9LA 2WDTB 4AJYB 1KTKA 3WAOA 2QC8A 3AEGB 3QQ8B 3M62B 1HEZE 2BTEA 3BK1A 4HRSA 4CYEA 2AYOB 1CZPA 3A33B 3B2FA 4KZCA 1WJ6A 2XBBC 2DAJA 2JWUA 4MGIE 3PS6A 3EECA 3J9CA 4GLSC 1UBIA 1NI2A 1L2NA 2I1JA 3RNFC 5DPSA 3R8BA 1VJKA 1J19A 2ZEQA 1EM7A 1K53A 2NVUI 2M4NA 1J0GA 4MSQB 3A1QA 4XZ4A 4FA6A 5C1ZA 1YX6B 5D2MB 1ET9A 3ZW3A 1F2RC 2NPTA 3B9JA 3AM9A 2GBMA 4FHJA 4RFBA 4KGTA 3TSSA 2K9XA 5EE1A 2KD0A 4C4VB 2JY6A 4FJZA
chains in the Genus database with same CATH topology
2LJIA 2RMMA 1C76A 1JCKB 3AEFB 1XXGA 4RF0A 1E10A 2XN9C 1N5WA 3AE5B 2PVOD 1TJEA 1Q10A 1DOYA 1STEA 4WURA 2EKIA 2M19A 2LHEA 2QMTA 1FXIA 2WU2B 1QOFA 1QT9A 4P16A 5GXGB 3AEAB 4CQNA 1V8CA 4WIPA 1GAQB 2K3UA 5AUIA 3NVWA 2ON8A 2KWDA 2LGIA 1SIJA 1UUPA 1PDXA 5TSSA 3P4RB 4YTNB 5D3DA 1VRAB 3L4PA 2GB1A 2LUMA 4YSYB 3I57A 4YSZB 5BMHA 2DYOA 3O13A 2FUG1 1HZ6A 2WXHA 1QLBB 1SEBD 4IKGA 1K52A 1C9FA 3FAHA 3R2TA 2K22A 4N59A 1FNUA 2WU5B 1JWSD 3C8YA 1YQ4B 2G1EA 5EE0A 2B76B 1JQ4A 4XWWA 1XLNA 4RGOS 4OZAA 2ZW1A 3P1MA 1KFYB 2JYTA 3T3OA 4KKJA 4HKQA 1DYQA 1ENFA 1NENB 2M56B 2V3PA 4NAWB 1YN3A 3ZYYX 3VQIA 1TKYA 2ACZB 1UWXA 3EGRA 3IXSA 3W5VB 5G5GA 1YJJA 2MH7A 4OHJA 4FXCA 2WDVB 4YTMB 1IBXB 4RF1A 1RYJA 2FBWB 2Y5PA 1K51A 4US9A 1J7AA 1SE2A 2DYMA 2PTLA 1CK1A 2Y3AA 5H92C 1GOZA 1BXTA 3ZGZA 1F0ZA 3W1SA 1K50A 4HKZE 5HHDG 3AE2B 3T3NA 2CU3A 3SEBA 3BWUD 3HVDA 1VLBA 4A55A 1L0YB 2JU6X 1OFFA 1SXTA 1WRIA 1I4GA 1EWCA 1JW9D 4N6EB 1T5XD 1WYGA 3ZJVA 2KMMA 2GI9A 4NAMA 1XLOA 1FXAA 2I2YA 2J42A 2J53A 3EA6A 2E3TA 1TYGB 2JQRB 3MFGA 1D5MC 2NTSA 2BBCA 2KAJA 1FEHA 1XCTL 3RPFC 2INPE 3ETRA 1J7BA 4RNAA 2BS2B 5BYRA 1N63A 3SR6A 2WXQA 4A6QA 3TEYA 1I4QA 4WWMA 2H88B 1JWAD 1PGBA 5D7GA 2BS3B 4JPSA 5G5HA 1TKEA 1FCLA 1ZXIA 1SBBB 1L4ZB 2KN4A 3BK2A 3BYYB 1NYQA 3MP9A 1J7CA 1SE3A 2PVGC 4A90A 2N9KA 3ABVB 4RGMA 2QEJC 1PFDA 3KLSX 2DLBA 2SAKA 4GDKB 1ZP0B 2HDEA 4B0EA 1TS2A 1TZOA 2LHDA 2VZKD 1HA5A 1I7HA 2QILA 2WDRB 3CWIA 4H2AA 2KACA 3R2IA 4ZRQA 4LTUA 3SFEB 3AE6B 2V0GA 1VZ7A 4UDUC 3ZQ4A 4C80A 1FIQA 3NVVA 2AX5A 1ZE3D 1XO3A 2X38A 1D6EC 3EUB2 1P7FA 1EWYC 2NTTA 1C4CA 1YJIA 1EU4A 3HRDD 2ONQA 3TEWA 1MHXA 1C4AA 1L4DB 1WWTA 2INNE 1AN8A 2JYEA 1T6BX 3AE1B 5BYQA 4O1NA 1B9RA 4OW0A 1FNVA 3AEEB 4A9AA 3P4PB 1AWDA 3P4QB 4EE2A 3VRBB 4D2KA 4LK0M 2D5GA 3BVGA 4YWGG 4R3DA 2SEBD 1RM6C 3LYYA 2TSSA 3BVMA 4N58A 3HUIA 3IT4B 3OWEB 4KKIA 1RFKA 4L2YA 3E9SA 3AB5A 1YN4A 1BMLC 5FKAC 1DGJA 3E56A 4XDCA 3ZJUA 2V3NA 3NVZA 4YSXB 2WQYB 3VRAB 3NUHB 1NEKB 1TY0A 3Q8EA 5HI1A 1C4PA 2WXMA 3BZDB 3WCQA 4TQ0A 4JX1C 1XLQA 2J4XA 1DOXA 2KQ4X 4HROA 1VZ6A 4MACA 4ARIA 2Z8LA 3Q8CA 5JXVA 2J52A 2PMVA 1QOGA 2IPKD 4AS1A 5BYSA 1PGAA 2L83A 2PW9A 3AE4B 2I38A 3AEBB 3TEXA 1V1OA 1CJEA 5HG2A 4ZOHC 1N61A 1SE4A 3DWGC 3PZ7A 3V3XA 2WXFA 2WS3B 1EU3A 2NMQA 4REZA 2AQ3B 2YEPB 4OZBA 1SJED 2YEPF 3NVYA 4NZLB 5HFYA 5C2TB 1UWMA 2QJLA 1KRHA 2IJ0A 1JWUD 1PUTA 4IOIE 3KWVA 1ESFA 2BYTA 4ZHOA 2JXTA 1TKGA 1TY2A 2PKOA 3P4SB 1QF6A 3AH7A 1E7PB 1ZDXA 1JWMD 2XNAC 1SB3C 1Y56A 4IDIA 2CJNA 2DBYA 2WXLA 2IGGA 2EELA 2V4IB 3W9CB 2Y5CA 1QKZA 1JALA 3AN1A 1CQVA 2OEDA 5AUKA 4US8A 3TUOA 3U7ZA 1FFUA 3FC4A 2M0AA 1JRPA 3BYTB 2Q5WD 3AV8A 3LB8C 4DQOC 2R61A 3W2DA 2FE8A 5D3IB 5C3JB 1FNWA 4KX6B 4M0WA 5BMGA 1E9MA 4OZCA 2MJ3A 1BUIC 1MHHE 4RCOA 1T3QA 3AE9B 3W5UB 1L0VB 3IAS1 4MH8A 1AYFA 2WXRA 4XE0A 2LFIA 1FM0D 3AECB 3GP7A 2WDQB 4DXFA 1N5XA 1VR9A 3N9YC 3IAM1 1KH0A 2H89B 1F2RI 3URYA 4YXDB 4RGNA 1DOIA 2BW2A 3H8HA 1MVKA 4C7YA 1L6UA 3Q8FA 1IBXA 1FRRA 1P7EA 1WGKA 4USAA 1F77A 1QQRA 1MI0A 4MM3B 4YT0B 1VDVA 1I4PA 2G9HD 1ET6A 3MHZA 4TMAB 1KLUD 1QOAA 5T8IA 1YQ3B 1WXQA 5BMIA 1C79A 1D5XC 4HJGE 3HVZA 2QSDA 1ZOYB 3KWLA 3LXFA 2MJEA 1ZUD2 3AMZA 4WQMA 2JZPA 4AQ7A 4ZHPA 4JWSC 3GB1A 3P42A 3PO0A 1VZ8A 2PLPA 4P6VF 5FK9C 2JX5A 2ICIA 4RH6A 1JROA 3NRZA 2MJDA 1C78A 1FFVA 3IT6B 1TS3A 1PGXA 5EE3A 2N9LA 2WXPA 2BS4B 2ZW0A 4MT5A 1HXYD 1XF5L 4L23A 3AE7B 2AQ2B 2W55A 4LLGM 2WNMA 4WH4A 3Q69A 1JWBD 1UGJA 4XDDA 4OVZA 2HTME 1NYRA 3GS2A 2OHFA 2IGHA 1E6EB 4JWUC 2KDMA 1GB1A 1TS4A 1IUEA 1XCQL 5EE9A 2WXJA 1V1PA 3I9V1 1OQRA 4KGSA 2WLBA 1ZDVA 2IDYA 3BVZA 4ARCA 2JSVX 2PIAA 1HQRD 3NZ3A 5E6JA 3B2GA 3U2SC 1I4HA 2LEKA 3U4EG 1XLPA 2IGDA 4B0MA 1FO4A 2BB6A 2WXKA 2W54A 1ROEA 3Q8BA 1YN5A 5I4DA 3MJ5A 4HEA1 2AQ1B 4J3OD 1L6VA 1E0ZA 2N7JA 1SF0A 1D4BA 1QOBA 1WSPA 2W3RA 3FILB 1I4XA 1FD6A 4KGRA 1D5ZC 1R7SA 1ACCA 1RWSA 1TS5A 2RDHA 1M4VA 4TQ1A 3AEDB 4TSSA 2CJOA 2K0PA 3KQ4A 1HZ5A 4JE3B 1B1ZA 2DWQA 2BT6A 2W3SA 1GB4A 1IGCA 3CIRB 3TEZA 1NVID 4ZRPA 1YMHE 2GRIA 2WP9B 4C7ZA 1NI3A 4RGTA 1KF6B 2QIEB 1YNTE 1KTKA 1AW7A 3AEGB 4PT5A 1V1PB 3NS1A 4WAFA 2E6XA 4C56C 1HEZE 2BTEA 2WXNA 3BK1A 4HRSA 2L1AA 1MPEA 1CZPA 3Q8AA 3B2FA 1SSNA 5LNK1 4Q2JA 1FRDA 1QILA 2L52A 2K5PA 3RFZB 5MPOA 2JWUA 2VZKB 4YTPB 2LMCA 1FCCC 4ITKA 1IGDA 1ZPSA 1UNSA 1LO5D 2BB5A 3MC0B 3J9CA 4GLSC 4GDLB 3VR9B 1ZXHA 2W82A 4NJCA 1GPXA 1V97A 2N0SB 4XWTA 5FR3A 3R8BA 3BIID 1VJKA 1JMLA 3P63A 1XEEA 3DWMA 1N62A 3SFDB 3UI3A 1A70A 4L1BA 1EM7A 1K53A 2MEKA 2WXOA 2RDGA 3U52E 4ZYSA 1L5PA 3PZ8A 1L0XB 1OQQA 2WXIA 3AE3B 1ET9A 1F2RC 3B9JA 3AE8B 3AM9A 3FILA 1FMAD 2WXGA 4RFBA 1PYWD 1SJHD 2L32A 1I4RA 3V05A 1KLGD 4KGTA 5H8YE 4DXGA 3TSSA 2K9XA 5EE1A 1N60A 2RPVA 1C77A 3ZJTA 3VR8B 4A8XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMC A;  4LLG M;  2WNM A;  4LK0 M; 
#chains in the Genus database with same CATH topology
 2LGY A;  1JCK B;  3AEF B;  4RF0 A;  2L8J A;  4ANU A;  1TJE A;  3WIM A;  2EKI A;  2KC2 A;  3ZKJ C;  1QT9 A;  4P16 A;  4LJO B;  4WIP A;  2FCS A;  2LRU A;  2BGF A;  3APD A;  3NVW A;  2KWD A;  2QDF A;  3R7Q A;  2LGI A;  3L08 A;  1UUP A;  1PDX A;  4ZRI A;  4YTN B;  3RNA C;  1VRA B;  3H7S A;  2GB1 A;  1IP9 A;  4A20 A;  1SEB D;  3L17 A;  2O2V B;  1K52 A;  2K22 A;  3TCA A;  4EZJ A;  3APC A;  4N59 A;  1FNU A;  3OJ4 B;  3RNE C;  4ZYN A;  5EE0 A;  4FN2 A;  2N7E A;  2ZW1 A;  3P1M A;  1DYQ A;  3VH4 B;  1NEN B;  5FR6 A;  2X8X X;  2V3P A;  2ACZ B;  2FID A;  2D3C A;  1UWX A;  3EGR A;  4K81 A;  3W5V B;  2MH7 A;  1IBX B;  2KDI A;  4ZRJ A;  2JT4 B;  2Y5P A;  1K51 A;  2DYM A;  1S1Q B;  5H92 C;  1YQB A;  2Y3A A;  4FHK A;  3ZGZ A;  3NY5 A;  4HKZ E;  3W1S A;  3I3T B;  3T3N A;  3MTN B;  3L54 A;  3BWU D;  5KHO A;  4A55 A;  4GIV A;  1EWC A;  1T5X D;  4M01 A;  3NZU A;  2GI9 A;  4FLH A;  2LXA A;  1TYG B;  2Z0E B;  3KUD B;  2KAJ A;  4EZK A;  2DZI A;  1YD8 U;  4ANW A;  4EZL A;  4A6Q A;  2IBI B;  3TEY A;  2LVQ A;  2KZR A;  5D7G A;  5G5H A;  1FCL A;  1AAR A;  3DOW A;  3BYY B;  1WFY A;  3JSV B;  4X57 B;  3MP9 A;  4RGM A;  4KIK B;  3KLS X;  3DBL I;  3V6C B;  1ZP0 B;  1TZO A;  2LHD A;  5IOI A;  3SFE B;  5IO9 A;  2KTR B;  2HE7 A;  1ZE3 D;  2JPH A;  1T0Q C;  3EHV A;  3EUB 2;  3NZS A;  1P7F A;  1EWY C;  5E6N A;  2D2Q A;  1MHX A;  3CMM B;  1C4A A;  4WAA A;  3ZNH B;  1TGZ B;  3GE3 C;  3P4P B;  2WWZ A;  1MG4 A;  2KDF B;  5CHF A;  2KNB A;  4W9G A;  2D5G A;  3BVG A;  4YWG G;  4IWO A;  5IA7 A;  2DZK A;  3BVM A;  3RNB C;  2NS5 A;  4KKI A;  4IG7 B;  3VHT C;  3AXC A;  4BZA A;  3AB5 A;  1K8R B;  1KM7 A;  1DGJ A;  3E56 A;  3NVZ A;  3PVL A;  2LRW A;  3HM6 X;  4YSX B;  5IP4 D;  3VUX A;  1WGY A;  4BVU C;  1ISN A;  2LVP A;  5JHB A;  1NEK B;  2IND C;  5AZH A;  5HI1 A;  2WXM A;  4BFR A;  1XLQ A;  2J4X A;  2KQ4 X;  1VZ6 A;  4ARI A;  4ICU A;  1QOG A;  2BWE S;  3C19 A;  4ZDV A;  2FCQ A;  3AE4 B;  1I42 A;  3BIN A;  1CJE A;  2ZNV B;  4IM3 A;  4EFO A;  3DWG C;  1UBQ A;  3M95 A;  4REZ A;  2YEP B;  1YIW A;  3NVY A;  4AOF A;  4NZL B;  5C2T B;  3RYT A;  1M94 A;  1PUT A;  3A9J B;  3QJZ A;  1SIF A;  1P0R A;  2AL3 A;  1ZDX A;  1JWM D;  2XNA C;  2KDE B;  3DDC B;  3PV1 A;  4IW0 A;  2Z59 B;  2Y5C A;  4HJK A;  1E8Z A;  3AN1 A;  1CQV A;  4GB9 A;  2D3B A;  3FC4 A;  1JRP A;  2Q5W D;  1WGG A;  2JUO A;  2R61 A;  4M0W A;  2LXC A;  3H6N A;  2VRR B;  2INC C;  3HHM A;  2MA9 B;  3AEC B;  2BVC A;  4DXF A;  3N9Y C;  4E71 A;  2KK8 A;  3L10 B;  1KH0 A;  3URY A;  5GMV A;  3SHQ A;  3QWZ B;  4JGH B;  4C7Y A;  2DZM A;  3FKY A;  4EOY A;  1P9D U;  1QQR A;  3Q3F A;  4YT0 B;  1VDV A;  1I4P A;  2MBE A;  1YQ3 B;  5BMI A;  1C79 A;  2MCN B;  3KYD D;  4BKS D;  3HVZ A;  2G4D B;  1C1Y B;  3A4S C;  3AMZ A;  5AEK B;  2BYF A;  3PO0 A;  4FBJ B;  5FK9 C;  1FFV A;  1V9J A;  3I5J C;  3RUL A;  2N9L A;  1XQQ A;  2WXP A;  3IG3 A;  2LZ6 A;  1XF5 L;  4LLG M;  1H8C A;  1UGJ A;  4XDD A;  2M17 A;  2HTM E;  5AZF A;  2RSU A;  4JWU C;  2HJ1 A;  2J0M A;  1C3T A;  5EE9 A;  2WXJ A;  2D3A A;  1G6J A;  3VUW A;  4OVU A;  1P3Q U;  4B9K A;  4B95 A;  1U4A A;  3QX1 A;  4KGS A;  2WLB A;  1T0S C;  2IDY A;  4ARC A;  5DPR A;  2LJ5 A;  2IYD B;  5DCN A;  3RD2 A;  2IGD A;  2MX2 A;  2WXK A;  5D94 A;  1RFA A;  2W54 A;  4PS7 A;  1SE9 A;  1YN5 A;  4ICV A;  4J3O D;  1E0Z A;  1SF0 A;  1D4B A;  4E3C A;  2XEW A;  1I4X A;  2D11 A;  1E7V A;  1RWS A;  2RDH A;  4TQ1 A;  3KQ4 A;  4JE3 B;  1B1Z A;  1R4M I;  2JVC A;  5KHQ A;  3VFK A;  1GC7 A;  2BT6 A;  2KQ7 A;  2Z0D B;  4C7Z A;  2O6V A;  3N1X C;  4CO7 A;  4TUU A;  2DZJ A;  4G50 A;  1AW7 A;  2K39 A;  2KFK B;  2E6X A;  1WX7 A;  2WXN A;  1HTQ A;  3PPA A;  2KLC A;  1YOV B;  5MPO A;  2VZK B;  4HXD A;  1R4N B;  2KFJ A;  3QC8 B;  1UZX B;  1OTR B;  3MC0 B;  1V49 A;  1V80 A;  3V61 A;  2AWT A;  2N9P C;  3VR9 B;  1ZXH A;  2W82 A;  4II2 B;  2N0S B;  5LXH A;  4XWT A;  4BBN C;  3DVG Y;  2L0T A;  1XEE A;  2ZJD A;  3DWM A;  3N20 C;  3PLV A;  2FIF A;  1N62 A;  3SFD B;  1WXA A;  3UI3 A;  2G45 B;  2MEK A;  2WXO A;  3U52 E;  1L5P A;  3DVN V;  1L0X B;  1P1A A;  1OQQ A;  2WXI A;  4WJO A;  1Q0W B;  3PRM B;  1FMA D;  3V05 A;  1J8C A;  1I4R A;  1KLG D;  1WGR A;  2LJI A;  2RMM A;  2GLS A;  3N30 A;  4BBN F;  2XN9 C;  1N5W A;  2KQS A;  3CST A;  2KMC A;  4WUR A;  1DOY A;  2M19 A;  2L76 A;  2WU2 B;  3AEA B;  4CQN A;  4LNK A;  5AUI A;  3PZD A;  4GOC A;  2R2O A;  2BPS A;  3JYU A;  3DHI C;  2GOW A;  2BKF A;  2NBW B;  4G0N B;  4NY0 A;  3L4P A;  1OEY A;  2VH2 A;  4YSY B;  1YX5 B;  3Q3O C;  4YSZ B;  5BMH A;  2FUG 1;  2BYV E;  2MRP A;  4MGZ E;  2C7M B;  2MBH A;  4IKG A;  1WE6 A;  3FAH A;  3K9O B;  3R2T A;  2GBJ A;  4GMV A;  4HCN B;  1V6E A;  1JWS D;  2G1E A;  4F7Z A;  4XWW A;  4C4V A;  4OZA A;  1KFY B;  2JYT A;  2I1K A;  1WM3 A;  1T0Y A;  4HKQ A;  3U8Z A;  1ENF A;  5DPW A;  3ZYY X;  3VQI A;  2M1M A;  3LJ3 A;  1RAX A;  3EFU A;  1YJJ A;  2RDB C;  2ZPY A;  4FXC A;  2WDV B;  4OHJ A;  2D10 A;  2KX0 A;  4HCP B;  1WH3 A;  2OOB B;  1J7A A;  1FXT B;  1SE2 A;  1NBF C;  1CK1 A;  2D3G A;  4ZRK A;  2YVC A;  1GOZ A;  2AEH A;  1K50 A;  2KC1 A;  3SEB A;  5CHW A;  1E5W A;  1L0Y B;  1OFF A;  1WRI A;  2NBU A;  4URK A;  3ZJV A;  2N1W A;  2KMM A;  3R3M A;  1XLO A;  2I2Y A;  1WXS A;  2J53 A;  4K7S A;  2MSE D;  2IO2 B;  1OEY J;  2JQR B;  3MFG A;  2NTS A;  3VUY A;  1GC6 A;  4RNA A;  2BS2 B;  2RGF A;  3SR6 A;  1N63 A;  2WXQ A;  2N7D A;  4WWM A;  1PGB A;  2BS3 B;  1LM8 B;  4JPS A;  1TKE A;  4II3 B;  2KN4 A;  2EMS A;  3BK2 A;  4BKT A;  4M8M A;  3L13 A;  3C0R B;  2FCN A;  4ANV A;  1WJN A;  1SE3 A;  2PVG C;  3RZF A;  3ABV B;  3QAR A;  4I6N B;  1XT9 B;  2DLB A;  2SAK A;  4DBG A;  1ZW7 A;  1HA5 A;  2KJ6 A;  2QIL A;  2WDR B;  3DBR I;  3ONS A;  4GU2 A;  3R2I A;  3B1L X;  4LTU A;  2PE6 B;  3AE6 B;  3ZQ4 A;  3NVV A;  2KDB A;  1XO3 A;  2X38 A;  3UIP B;  2NTT A;  4GDL A;  2ONQ A;  3TEW A;  3KW5 B;  1UEL A;  4CHK A;  2PPH A;  1AN8 A;  3AE1 B;  1T6B X;  4KV2 A;  4M00 A;  4OW0 A;  3H1U A;  4A9A A;  4MJS A;  2K1F A;  4PYZ A;  1AWD A;  3ZXR A;  5L95 C;  2W9N A;  4LK0 M;  2N4F A;  1BT0 A;  4R3D A;  1RM6 C;  3LYY A;  1IPG A;  1MFW A;  2KOX A;  1RFK A;  4L2Y A;  3E9S A;  3B0A A;  2O6V D;  5FKA C;  4XDC A;  3NOB A;  2V3N A;  4WWN A;  4N9F 4;  3VRA B;  3DBH I;  4ANX A;  2KO3 A;  3JVZ X;  1E8Y A;  3QA8 A;  1WXV A;  1V5T A;  3Q8E A;  1C4P A;  1HTO A;  3BZD B;  4TQ0 A;  2OJW A;  1DOX A;  4A3O A;  2Z8L A;  3Q8C A;  2A4Z A;  2IPK D;  4AS1 A;  3AEB B;  1V1O A;  5HG2 A;  4ZOH C;  4F1S A;  4DXA B;  2K8H A;  1WGH A;  2RR9 A;  4MGK E;  2MHJ A;  2KN5 A;  1WX8 A;  2AQ3 B;  1SJE D;  4KVG B;  4LNO A;  2ZPN A;  3H7P B;  2GBK A;  2QJL A;  3DBH B;  1KRH A;  3WAP A;  4IOI E;  3KWV A;  3EFC A;  2HD5 B;  2PKO A;  2BKR B;  1QF6 A;  3AH7 A;  5J17 A;  1Y56 A;  2DBY A;  2EEL A;  2V4I B;  4NAW A;  3W9C B;  3MC8 A;  1JAL A;  4US8 A;  2OED A;  3TUO A;  1WE7 A;  3WAN A;  3TMP B;  3BYT B;  3W2D A;  4OZC A;  1MHH E;  3NG0 A;  3RT3 B;  3Q6B A;  3AE9 B;  4LDT D;  1AYF A;  4XE0 A;  2LFI A;  4IUM B;  2K6Q A;  2WDQ B;  2G3Q B;  3IAM 1;  2H89 B;  4RGN A;  1A5R A;  1WMH B;  5JZE B;  5HKH A;  1FRR A;  1P7E A;  4USA A;  2O6V B;  3Q3N C;  3PHW B;  3MHZ A;  3PRP B;  5T8I A;  1D5X C;  3KWL A;  3LXF A;  3S2A A;  2MJE A;  1ZUD 2;  2DNF A;  4JWS C;  2KJR A;  5D6J B;  2PLP A;  4P6V F;  4RH6 A;  4MGY E;  2YLM A;  1PGX A;  3CF6 E;  2ZW0 A;  1HXY D;  2L0F A;  2G4S A;  3UQA A;  3AE7 B;  2AQ2 B;  3JW0 X;  2WNM A;  4WH4 A;  4TKN A;  3Q69 A;  2JWZ A;  1Y8R C;  3N3K B;  2UU7 A;  4OVZ A;  3VAW A;  3GS2 A;  2OHF A;  3UIN B;  5J2R A;  4LNF A;  1TS4 A;  1R4N I;  2V1Y A;  1Q1O A;  3PTF C;  1V1P A;  2KWU B;  1OQR A;  1WGD A;  1HQR D;  4NQL B;  2PE9 A;  3U4E G;  2PJH A;  2BB6 A;  3A9J A;  1ROE A;  4DHJ D;  4HEA 1;  1L6V A;  1IYF A;  2W3R A;  4NJ7 A;  3ZXV A;  2ZCB A;  3PRE A;  1ACC A;  1TS5 A;  4WJP A;  4BOS C;  1M4V A;  4TSS A;  2CJO A;  3IVF A;  2IO3 B;  2IY1 B;  1HZ5 A;  1CMX B;  2KKC A;  1GB4 A;  4FUL A;  4I6P A;  1YMH E;  2XK5 B;  4RGT A;  1KF6 B;  3PLU A;  4S17 A;  4PT5 A;  1V1P B;  4WAF A;  2L1A A;  4LNN A;  1MPE A;  3Q8A A;  3QK0 A;  1LGR A;  3VXW A;  1SSN A;  2M8S A;  5LNK 1;  4Q2J A;  1FRD A;  1QIL A;  2L52 A;  2K5P A;  2V3S A;  2OJR A;  1IGD A;  1ZPS A;  1UNS A;  1LO5 D;  5IKC M;  4IM0 A;  2FCM A;  5FR3 A;  3BII D;  1JML A;  3P63 A;  2JZZ A;  3OJ3 A;  4XYC A;  1V5O A;  1A70 A;  4L1B A;  5G55 A;  2RDG A;  1L7Y A;  3MHS D;  2NPT B;  2HTH A;  4JIO U;  4MH0 E;  3RN9 C;  1X1M A;  3AE8 B;  3CSF A;  1XD3 B;  2WXG A;  1PYW D;  1SJH D;  2L32 A;  5H8Y E;  3ZNG C;  1N60 A;  2V4L A;  1C77 A;  2CHX A;  1C76 A;  3RI7 C;  3I63 C;  3NHE B;  1E10 A;  1E8X A;  2PVO D;  1GG3 A;  1Q10 A;  3K9P B;  5J18 A;  1FXI A;  5GXG B;  2C7N B;  1V86 A;  3NJT A;  2ASQ A;  2ON8 A;  1SIJ A;  5TSS A;  3P4R B;  5D3D A;  3QHT A;  3D32 A;  3I57 A;  2V9H A;  1EF5 A;  3IFW B;  2WXH A;  3TIX A;  3WAL A;  1SGH A;  3C8Y A;  3EC8 A;  1YQ4 B;  1JQ4 A;  2NBV B;  4BAX A;  3ML9 A;  3T3O A;  1EO6 A;  4KKJ A;  3VVW B;  2L00 B;  1EUV B;  1YN3 A;  3N1Y C;  2WGS A;  1YJ1 A;  1UF0 A;  4EUT A;  2CHW A;  1TKY A;  3TL5 A;  3DHG C;  4BOZ B;  3IXS A;  5G5G A;  4WJN A;  4M0W B;  2C5L C;  2QCZ A;  1RYJ A;  2KHW B;  2FBW B;  4PK1 A;  2KWV B;  4US9 A;  2PTL A;  1F0Z A;  1F9J A;  4ACF A;  5HHD G;  4W9C A;  3AE2 B;  3DVN U;  2CU3 A;  3M3J A;  5CTR C;  1VLB A;  1SXT A;  1I4G A;  3DPD A;  1WYG A;  4NAM A;  2J42 A;  3EA6 A;  4G3X B;  2BBC A;  4G11 A;  1FEH A;  1T0R C;  1XCT L;  4RM8 A;  3RPF C;  3ZNI D;  2ZNV C;  1S3S G;  2INP E;  1J7B A;  4WWP A;  4NQK E;  2GBN A;  4KSL C;  1JWA D;  2H88 B;  1ZXI A;  1SBB B;  1L4Z B;  4K7U A;  5G2N A;  1PQS A;  1NYQ A;  1J7C A;  4A90 A;  2N9K A;  1UD7 A;  2QEJ C;  1PFD A;  2KLG A;  2ZCC A;  4JL9 A;  1ZGU B;  1TS2 A;  2KWC A;  2K8C A;  2VZK D;  2DEN B;  3CWI A;  4ZRQ A;  3RNC C;  2V0G A;  1VZ7 A;  4UDU C;  5IAA C;  2AX5 A;  2KYW A;  1D6E C;  1MG8 A;  1C4C A;  1YJI A;  3HRD D;  3LDZ E;  3ZDT A;  1WWT A;  4F8C B;  1B9R A;  1FNV A;  2DYB A;  2NCN A;  4AUQ C;  4EE2 A;  2KFK A;  2EMT A;  2KJH B;  4P1C C;  4N58 A;  1VD2 A;  3HUI A;  3A1Q B;  4MDK E;  2KX3 A;  3ZJU A;  3O65 B;  3Q3J A;  1TY0 A;  1WF9 A;  4JX1 C;  2DX5 B;  3ZTC A;  5JXV A;  1WZ3 A;  1PGA A;  2L83 A;  2PW9 A;  2BYE A;  2I38 A;  3TEX A;  1R4M B;  1WJU A;  4XX5 A;  2CKH B;  4AWJ A;  3ZRC A;  1N61 A;  3L0W B;  2A5U A;  3KUZ A;  2WS3 B;  3UIO B;  2NMQ A;  4E74 A;  3KH0 A;  1WMH A;  4C00 A;  4MEM A;  4OZB A;  2PEA A;  3SU8 X;  5HFY A;  1V81 A;  2IJ0 A;  1JWU D;  3ZIM A;  1TTN A;  1ESF A;  2BYT A;  4ZHO A;  5EDS A;  2MBB B;  3P4S B;  3V62 A;  1ZKH A;  2REX A;  4DHZ B;  2CJN A;  2WXL A;  1QKZ A;  2JF5 A;  5AUK A;  4YL8 A;  3U7Z A;  2M0A A;  3W1Y A;  4DQO C;  4GXB A;  5D3I B;  5C3J B;  3V60 A;  5BMG A;  1E9M A;  2QHO A;  4PYU A;  2MJ3 A;  2LUE A;  2L3Z A;  3QCA A;  1T3Q A;  4OVV A;  3NS8 A;  2K8B A;  3IAS 1;  2CS4 A;  4K3C A;  4MH8 A;  2WXR A;  1FM0 D;  2RPQ A;  1VR9 A;  3RCZ A;  3TBL D;  4RMA A;  2EKE C;  3DHH C;  3H8H A;  1MVK A;  2J0J A;  3RUI B;  3Q8F A;  2IY0 B;  1IBX A;  2WYQ A;  2XK5 A;  1F77 A;  4LDT B;  1MI0 A;  4MM3 B;  4IM2 A;  1ET6 A;  1QOA A;  4IC7 B;  3DCG A;  1WXQ A;  4K3B A;  2C60 A;  5LLI A;  2QSD A;  1ZOY B;  2JRH A;  4WQM A;  3QIJ A;  4ZHP A;  3P42 A;  4PS8 A;  1VZ8 A;  2MQJ A;  2ICI A;  3MC9 A;  1JRO A;  3NRZ A;  1C78 A;  5EE3 A;  2BQQ A;  1E8W A;  1LXD A;  2BS4 B;  4KIK A;  1OGW A;  2DAF A;  3RNG C;  3HM3 A;  2W55 A;  1WXM A;  3AUL A;  1JWB D;  2LD9 A;  1E6E B;  2N1V A;  3UF8 A;  2KDM A;  4A3P A;  1XCQ L;  2KVZ A;  2LWP A;  4JLC A;  3ZRF A;  2BF8 B;  1ZDV A;  3BVZ A;  2JSV X;  5E6J A;  2LEK A;  1XLP A;  3KYC D;  1WR6 E;  1KOT A;  2B3A A;  2CR5 A;  3Q8B A;  2UYZ B;  3HIZ A;  5I4D A;  3AI5 A;  2J0K A;  2AQ1 B;  3SDL C;  2N7J A;  2C9W B;  1WSP A;  2JZ3 B;  2IO1 B;  4BKG A;  1FD6 A;  4KGR A;  1R7S A;  3AED B;  2O2V A;  3IHP C;  4GGQ A;  2K0P A;  4HK2 A;  4KSK C;  1RLF A;  5E6O A;  3Q2A C;  2DWQ A;  3KVF B;  4EEW A;  2W3S A;  3CIR B;  1NVI D;  4ZRP A;  2WP9 B;  2GRI A;  4J6I A;  1NI3 A;  3Q14 C;  3OAW A;  2QIE B;  1YNT E;  3HK0 A;  3DQV A;  4HWI B;  1P98 A;  3GE8 C;  1JRU A;  3NS1 A;  4S0R A;  4HLE A;  1WZ0 A;  4C56 C;  1WIA A;  4HDO A;  2MP2 A;  3PGE A;  1F52 A;  3RFZ B;  4HPP A;  4YTP B;  3OG5 A;  3X0W A;  2KMA A;  2LMC A;  1FCC C;  4ITK A;  2IO0 B;  4HPL B;  2BB5 A;  4M8N A;  4GDL B;  4NJC A;  1GPX A;  1V97 A;  2UWQ A;  1E90 A;  1F1H A;  3KUC B;  1NDD A;  5LXI B;  5CX3 A;  4ZYS A;  2HJ8 A;  3PZ8 A;  2BWF A;  2FAZ A;  3AE3 B;  2LGD A;  4W9K A;  3FIL A;  5TR5 A;  4K7W A;  4GN1 A;  4DXG A;  2M0X A;  5BO4 B;  2RPV A;  3ZJT A;  3VR8 B;  4A8X C;  1XXG A;  2CHZ A;  1WR1 A;  5JHA A;  4PS3 A;  3AE5 B;  1STE A;  3N1Z C;  2LHE A;  2QMT A;  1QOF A;  1HE8 A;  1V8C A;  1GAQ B;  1TBE A;  2K3U A;  4DDG D;  1TIF A;  3ZVV A;  2GBR A;  4FAD A;  2KTR A;  2WHI A;  4HPM B;  3PT2 B;  3B08 A;  2LUM A;  1WI0 A;  2ZVO A;  3T8M A;  1GUA B;  2DYO A;  3O13 A;  3PSE B;  1HZ6 A;  3ZLZ A;  1QLB B;  4M02 A;  3ZUN A;  1C9F A;  2WU5 B;  3WA0 A;  2B76 B;  1XLN A;  4RGO S;  3GZN I;  1WM2 A;  3ML8 A;  3RMK C;  3N32 A;  2LGS A;  2M56 B;  3AU4 A;  1LQB A;  4NAW B;  1LFD A;  2D07 B;  3BY4 B;  1TT5 B;  2LAS A;  5JH5 C;  4WQO B;  4YTM B;  1N6Z A;  3VTU A;  4RF1 A;  3A9K A;  3GZN B;  1TZ1 A;  3VH3 B;  1RRB A;  1BXT A;  3ZO5 B;  3ALB A;  4DDI D;  4HVB A;  3HVD A;  4DK5 A;  2JU6 X;  1EF1 A;  1JW9 D;  4N6E B;  4W9I A;  3M63 B;  1FXA A;  4B6W A;  4XC2 A;  2E3T A;  3VTV A;  4W9D A;  1D5M C;  2ZZP B;  4WWO A;  3VDZ A;  3ETR A;  5BYR A;  1UGM A;  4RM9 A;  3MJW A;  3H7P A;  2MP2 B;  1I4Q A;  4P7I A;  3U7D A;  5IN7 A;  4IWQ A;  3H9D A;  4K1R B;  4DWF A;  2RD0 A;  3GOE A;  4DHZ E;  2KAN A;  2N9E B;  4W9F A;  4P1B C;  2MWS B;  4GDK B;  1E7U A;  3ZNZ B;  2HDE A;  4B0E A;  1I7H A;  4XGA B;  4H2A A;  2KAC A;  2NR2 A;  3RZW C;  3X23 A;  2KTF A;  3ENE A;  1MJD A;  4C80 A;  1FIQ A;  2J7Q B;  2L05 A;  2FNJ B;  2KVR A;  1UH6 A;  1EU4 A;  2FUH B;  4GDK A;  3W1S C;  2KT7 A;  3P2B A;  1WYW B;  2LGX A;  2JYE A;  1L4D B;  2INN E;  2GMI C;  4W9H A;  4O1N A;  5BYQ A;  3AEE B;  3V6E B;  4WJQ A;  3ZTD A;  3P4Q B;  4I6L B;  3WAM A;  3VRB B;  4D2K A;  2SEB D;  3Q3M C;  2TSS A;  3ZDM C;  3IT4 B;  1Z5S B;  3OWE B;  3TJP A;  3U30 A;  1YN4 A;  1BML C;  3JSV A;  3IBE A;  3SD5 A;  2L7R A;  3QAQ A;  2WQY B;  2WX1 A;  3R66 C;  2LI5 A;  3NUH B;  4W9J A;  4LNI A;  3APF A;  3WCQ A;  4KZ0 A;  4HRO A;  4MAC A;  4FJV B;  3L16 A;  3DBS A;  2J52 A;  2C7H A;  2N9X A;  2PMV A;  4IWP A;  5C23 A;  5BYS A;  4NJ6 A;  4MM3 A;  1WX9 A;  1FPY A;  3A4R A;  2MLB A;  2DHZ A;  4DHJ B;  1SE4 A;  1WRD B;  3PZ7 A;  3V3X A;  2WXF A;  2Y5B B;  1EU3 A;  1Q5W B;  2YEP F;  2MW5 A;  2K6D B;  1UWM A;  4QAY A;  3PRZ A;  3A9K B;  2JXT A;  1TKG A;  1TY2 A;  4NPN A;  4ASW C;  4BKS A;  2ZVN A;  1E7P B;  2MBO A;  1SB3 C;  4IDI A;  5DPT A;  2IGG A;  3DBR B;  4AP4 C;  1QZE A;  1FFU A;  4W9L A;  3LB8 C;  3AV8 A;  2JRI B;  2FE8 A;  4KDL B;  1FNW A;  4KX6 B;  4RCO A;  1BUI C;  3W5U B;  1L0V B;  1H4R A;  4GSW A;  4LJP B;  3GP7 A;  4W9E A;  1N5X A;  4NNJ B;  4FJY A;  1KJT A;  1F2R I;  4MJS B;  4YXD B;  2MBQ A;  1DOI A;  2BW2 A;  3R7R A;  3AU5 A;  1L6U A;  3DBL B;  1WGK A;  4KDI C;  2G9H D;  4TMA B;  5AZG A;  1KLU D;  4HJG E;  1OQY A;  1WY8 A;  1KLV A;  3UGB B;  2JXX A;  5E6P A;  3PHX B;  4AQ7 A;  2JZP A;  4HDQ A;  2K25 A;  2LVO A;  3GB1 A;  4MEL A;  2VH1 A;  2JX5 A;  4MSM B;  2MJD A;  3IT6 B;  1TS3 A;  4MT5 A;  3UQB A;  3OLM D;  4L23 A;  2AL6 A;  2CU1 A;  5CHV C;  2IZV B;  3ECI A;  1NYR A;  2IGH A;  1I35 A;  1Z2M A;  1GB1 A;  1IUE A;  3I9V 1;  4LCD E;  4TV3 A;  4EKU A;  1GJZ A;  2PIA A;  3NZ3 A;  3B2G A;  3VTW A;  3U2S C;  1I4H A;  2WX0 A;  1FO4 A;  4B0M A;  1D3Z A;  4AJW A;  3MJ5 A;  2KXJ A;  1WJ4 A;  1V2Y A;  1QOB A;  3FIL B;  1D5Z C;  4JQW C;  3DVG X;  5L83 A;  1VCB A;  1IGC A;  3TEZ A;  1GNU A;  2R2Q A;  3T9L A;  2WDT B;  4AJY B;  1KTK A;  3WAO A;  2QC8 A;  3AEG B;  3QQ8 B;  3M62 B;  1HEZ E;  2BTE A;  3BK1 A;  4HRS A;  4CYE A;  2AYO B;  1CZP A;  3A33 B;  3B2F A;  4KZC A;  1WJ6 A;  2XBB C;  2DAJ A;  2JWU A;  4MGI E;  3PS6 A;  3EEC A;  3J9C A;  4GLS C;  1UBI A;  1NI2 A;  1L2N A;  2I1J A;  3RNF C;  5DPS A;  3R8B A;  1VJK A;  1J19 A;  2ZEQ A;  1EM7 A;  1K53 A;  2NVU I;  2M4N A;  1J0G A;  4MSQ B;  3A1Q A;  4XZ4 A;  4FA6 A;  5C1Z A;  1YX6 B;  5D2M B;  1ET9 A;  3ZW3 A;  1F2R C;  2NPT A;  3B9J A;  3AM9 A;  2GBM A;  4FHJ A;  4RFB A;  4KGT A;  3TSS A;  2K9X A;  5EE1 A;  2KD0 A;  4C4V B;  2JY6 A;  4FJZ A; 
#chains in the Genus database with same CATH homology
 2LJI A;  2RMM A;  1C76 A;  1JCK B;  3AEF B;  1XXG A;  4RF0 A;  1E10 A;  2XN9 C;  1N5W A;  3AE5 B;  2PVO D;  1TJE A;  1Q10 A;  1DOY A;  1STE A;  4WUR A;  2EKI A;  2M19 A;  2LHE A;  2QMT A;  1FXI A;  2WU2 B;  1QOF A;  1QT9 A;  4P16 A;  5GXG B;  3AEA B;  4CQN A;  1V8C A;  4WIP A;  1GAQ B;  2K3U A;  5AUI A;  3NVW A;  2ON8 A;  2KWD A;  2LGI A;  1SIJ A;  1UUP A;  1PDX A;  5TSS A;  3P4R B;  4YTN B;  5D3D A;  1VRA B;  3L4P A;  2GB1 A;  2LUM A;  4YSY B;  3I57 A;  4YSZ B;  5BMH A;  2DYO A;  3O13 A;  2FUG 1;  1HZ6 A;  2WXH A;  1QLB B;  1SEB D;  4IKG A;  1K52 A;  1C9F A;  3FAH A;  3R2T A;  2K22 A;  4N59 A;  1FNU A;  2WU5 B;  1JWS D;  3C8Y A;  1YQ4 B;  2G1E A;  5EE0 A;  2B76 B;  1JQ4 A;  4XWW A;  1XLN A;  4RGO S;  4OZA A;  2ZW1 A;  3P1M A;  1KFY B;  2JYT A;  3T3O A;  4KKJ A;  4HKQ A;  1DYQ A;  1ENF A;  1NEN B;  2M56 B;  2V3P A;  4NAW B;  1YN3 A;  3ZYY X;  3VQI A;  1TKY A;  2ACZ B;  1UWX A;  3EGR A;  3IXS A;  3W5V B;  5G5G A;  1YJJ A;  2MH7 A;  4OHJ A;  4FXC A;  2WDV B;  4YTM B;  1IBX B;  4RF1 A;  1RYJ A;  2FBW B;  2Y5P A;  1K51 A;  4US9 A;  1J7A A;  1SE2 A;  2DYM A;  2PTL A;  1CK1 A;  2Y3A A;  5H92 C;  1GOZ A;  1BXT A;  3ZGZ A;  1F0Z A;  3W1S A;  1K50 A;  4HKZ E;  5HHD G;  3AE2 B;  3T3N A;  2CU3 A;  3SEB A;  3BWU D;  3HVD A;  1VLB A;  4A55 A;  1L0Y B;  2JU6 X;  1OFF A;  1SXT A;  1WRI A;  1I4G A;  1EWC A;  1JW9 D;  4N6E B;  1T5X D;  1WYG A;  3ZJV A;  2KMM A;  2GI9 A;  4NAM A;  1XLO A;  1FXA A;  2I2Y A;  2J42 A;  2J53 A;  3EA6 A;  2E3T A;  1TYG B;  2JQR B;  3MFG A;  1D5M C;  2NTS A;  2BBC A;  2KAJ A;  1FEH A;  1XCT L;  3RPF C;  2INP E;  3ETR A;  1J7B A;  4RNA A;  2BS2 B;  5BYR A;  1N63 A;  3SR6 A;  2WXQ A;  4A6Q A;  3TEY A;  1I4Q A;  4WWM A;  2H88 B;  1JWA D;  1PGB A;  5D7G A;  2BS3 B;  4JPS A;  5G5H A;  1TKE A;  1FCL A;  1ZXI A;  1SBB B;  1L4Z B;  2KN4 A;  3BK2 A;  3BYY B;  1NYQ A;  3MP9 A;  1J7C A;  1SE3 A;  2PVG C;  4A90 A;  2N9K A;  3ABV B;  4RGM A;  2QEJ C;  1PFD A;  3KLS X;  2DLB A;  2SAK A;  4GDK B;  1ZP0 B;  2HDE A;  4B0E A;  1TS2 A;  1TZO A;  2LHD A;  2VZK D;  1HA5 A;  1I7H A;  2QIL A;  2WDR B;  3CWI A;  4H2A A;  2KAC A;  3R2I A;  4ZRQ A;  4LTU A;  3SFE B;  3AE6 B;  2V0G A;  1VZ7 A;  4UDU C;  3ZQ4 A;  4C80 A;  1FIQ A;  3NVV A;  2AX5 A;  1ZE3 D;  1XO3 A;  2X38 A;  1D6E C;  3EUB 2;  1P7F A;  1EWY C;  2NTT A;  1C4C A;  1YJI A;  1EU4 A;  3HRD D;  2ONQ A;  3TEW A;  1MHX A;  1C4A A;  1L4D B;  1WWT A;  2INN E;  1AN8 A;  2JYE A;  1T6B X;  3AE1 B;  5BYQ A;  4O1N A;  1B9R A;  4OW0 A;  1FNV A;  3AEE B;  4A9A A;  3P4P B;  1AWD A;  3P4Q B;  4EE2 A;  3VRB B;  4D2K A;  4LK0 M;  2D5G A;  3BVG A;  4YWG G;  4R3D A;  2SEB D;  1RM6 C;  3LYY A;  2TSS A;  3BVM A;  4N58 A;  3HUI A;  3IT4 B;  3OWE B;  4KKI A;  1RFK A;  4L2Y A;  3E9S A;  3AB5 A;  1YN4 A;  1BML C;  5FKA C;  1DGJ A;  3E56 A;  4XDC A;  3ZJU A;  2V3N A;  3NVZ A;  4YSX B;  2WQY B;  3VRA B;  3NUH B;  1NEK B;  1TY0 A;  3Q8E A;  5HI1 A;  1C4P A;  2WXM A;  3BZD B;  3WCQ A;  4TQ0 A;  4JX1 C;  1XLQ A;  2J4X A;  1DOX A;  2KQ4 X;  4HRO A;  1VZ6 A;  4MAC A;  4ARI A;  2Z8L A;  3Q8C A;  5JXV A;  2J52 A;  2PMV A;  1QOG A;  2IPK D;  4AS1 A;  5BYS A;  1PGA A;  2L83 A;  2PW9 A;  3AE4 B;  2I38 A;  3AEB B;  3TEX A;  1V1O A;  1CJE A;  5HG2 A;  4ZOH C;  1N61 A;  1SE4 A;  3DWG C;  3PZ7 A;  3V3X A;  2WXF A;  2WS3 B;  1EU3 A;  2NMQ A;  4REZ A;  2AQ3 B;  2YEP B;  4OZB A;  1SJE D;  2YEP F;  3NVY A;  4NZL B;  5HFY A;  5C2T B;  1UWM A;  2QJL A;  1KRH A;  2IJ0 A;  1JWU D;  1PUT A;  4IOI E;  3KWV A;  1ESF A;  2BYT A;  4ZHO A;  2JXT A;  1TKG A;  1TY2 A;  2PKO A;  3P4S B;  1QF6 A;  3AH7 A;  1E7P B;  1ZDX A;  1JWM D;  2XNA C;  1SB3 C;  1Y56 A;  4IDI A;  2CJN A;  2DBY A;  2WXL A;  2IGG A;  2EEL A;  2V4I B;  3W9C B;  2Y5C A;  1QKZ A;  1JAL A;  3AN1 A;  1CQV A;  2OED A;  5AUK A;  4US8 A;  3TUO A;  3U7Z A;  1FFU A;  3FC4 A;  2M0A A;  1JRP A;  3BYT B;  2Q5W D;  3AV8 A;  3LB8 C;  4DQO C;  2R61 A;  3W2D A;  2FE8 A;  5D3I B;  5C3J B;  1FNW A;  4KX6 B;  4M0W A;  5BMG A;  1E9M A;  4OZC A;  2MJ3 A;  1BUI C;  1MHH E;  4RCO A;  1T3Q A;  3AE9 B;  3W5U B;  1L0V B;  3IAS 1;  4MH8 A;  1AYF A;  2WXR A;  4XE0 A;  2LFI A;  1FM0 D;  3AEC B;  3GP7 A;  2WDQ B;  4DXF A;  1N5X A;  1VR9 A;  3N9Y C;  3IAM 1;  1KH0 A;  2H89 B;  1F2R I;  3URY A;  4YXD B;  4RGN A;  1DOI A;  2BW2 A;  3H8H A;  1MVK A;  4C7Y A;  1L6U A;  3Q8F A;  1IBX A;  1FRR A;  1P7E A;  1WGK A;  4USA A;  1F77 A;  1QQR A;  1MI0 A;  4MM3 B;  4YT0 B;  1VDV A;  1I4P A;  2G9H D;  1ET6 A;  3MHZ A;  4TMA B;  1KLU D;  1QOA A;  5T8I A;  1YQ3 B;  1WXQ A;  5BMI A;  1C79 A;  1D5X C;  4HJG E;  3HVZ A;  2QSD A;  1ZOY B;  3KWL A;  3LXF A;  2MJE A;  1ZUD 2;  3AMZ A;  4WQM A;  2JZP A;  4AQ7 A;  4ZHP A;  4JWS C;  3GB1 A;  3P42 A;  3PO0 A;  1VZ8 A;  2PLP A;  4P6V F;  5FK9 C;  2JX5 A;  2ICI A;  4RH6 A;  1JRO A;  3NRZ A;  2MJD A;  1C78 A;  1FFV A;  3IT6 B;  1TS3 A;  1PGX A;  5EE3 A;  2N9L A;  2WXP A;  2BS4 B;  2ZW0 A;  4MT5 A;  1HXY D;  1XF5 L;  4L23 A;  3AE7 B;  2AQ2 B;  2W55 A;  4LLG M;  2WNM A;  4WH4 A;  3Q69 A;  1JWB D;  1UGJ A;  4XDD A;  4OVZ A;  2HTM E;  1NYR A;  3GS2 A;  2OHF A;  2IGH A;  1E6E B;  4JWU C;  2KDM A;  1GB1 A;  1TS4 A;  1IUE A;  1XCQ L;  5EE9 A;  2WXJ A;  1V1P A;  3I9V 1;  1OQR A;  4KGS A;  2WLB A;  1ZDV A;  2IDY A;  3BVZ A;  4ARC A;  2JSV X;  2PIA A;  1HQR D;  3NZ3 A;  5E6J A;  3B2G A;  3U2S C;  1I4H A;  2LEK A;  3U4E G;  1XLP A;  2IGD A;  4B0M A;  1FO4 A;  2BB6 A;  2WXK A;  2W54 A;  1ROE A;  3Q8B A;  1YN5 A;  5I4D A;  3MJ5 A;  4HEA 1;  2AQ1 B;  4J3O D;  1L6V A;  1E0Z A;  2N7J A;  1SF0 A;  1D4B A;  1QOB A;  1WSP A;  2W3R A;  3FIL B;  1I4X A;  1FD6 A;  4KGR A;  1D5Z C;  1R7S A;  1ACC A;  1RWS A;  1TS5 A;  2RDH A;  1M4V A;  4TQ1 A;  3AED B;  4TSS A;  2CJO A;  2K0P A;  3KQ4 A;  1HZ5 A;  4JE3 B;  1B1Z A;  2DWQ A;  2BT6 A;  2W3S A;  1GB4 A;  1IGC A;  3CIR B;  3TEZ A;  1NVI D;  4ZRP A;  1YMH E;  2GRI A;  2WP9 B;  4C7Z A;  1NI3 A;  4RGT A;  1KF6 B;  2QIE B;  1YNT E;  1KTK A;  1AW7 A;  3AEG B;  4PT5 A;  1V1P B;  3NS1 A;  4WAF A;  2E6X A;  4C56 C;  1HEZ E;  2BTE A;  2WXN A;  3BK1 A;  4HRS A;  2L1A A;  1MPE A;  1CZP A;  3Q8A A;  3B2F A;  1SSN A;  5LNK 1;  4Q2J A;  1FRD A;  1QIL A;  2L52 A;  2K5P A;  3RFZ B;  5MPO A;  2JWU A;  2VZK B;  4YTP B;  2LMC A;  1FCC C;  4ITK A;  1IGD A;  1ZPS A;  1UNS A;  1LO5 D;  2BB5 A;  3MC0 B;  3J9C A;  4GLS C;  4GDL B;  3VR9 B;  1ZXH A;  2W82 A;  4NJC A;  1GPX A;  1V97 A;  2N0S B;  4XWT A;  5FR3 A;  3R8B A;  3BII D;  1VJK A;  1JML A;  3P63 A;  1XEE A;  3DWM A;  1N62 A;  3SFD B;  3UI3 A;  1A70 A;  4L1B A;  1EM7 A;  1K53 A;  2MEK A;  2WXO A;  2RDG A;  3U52 E;  4ZYS A;  1L5P A;  3PZ8 A;  1L0X B;  1OQQ A;  2WXI A;  3AE3 B;  1ET9 A;  1F2R C;  3B9J A;  3AE8 B;  3AM9 A;  3FIL A;  1FMA D;  2WXG A;  4RFB A;  1PYW D;  1SJH D;  2L32 A;  1I4R A;  3V05 A;  1KLG D;  4KGT A;  5H8Y E;  4DXG A;  3TSS A;  2K9X A;  5EE1 A;  1N60 A;  2RPV A;  1C77 A;  3ZJT A;  3VR8 B;  4A8X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...