4LK7A

Crystal structure of pseudomonas aeruginosa lectin leca complexed with resorufin-b-d-galactopyranoside at 1.76 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I galactophilic lectin
publication title CH-pi "T-Shape" Interaction with Histidine Explains Binding of Aromatic Galactosides to Pseudomonas aeruginosa Lectin LecA
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 21
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4lk7A00
4BQ5A 2KR2A 4YW6A 1UOJA 4CPBA 4BQ3A 4BQ4A 2VXJA 1W8WA 1WCUA 4LKEA 4CPBD 4LJHA 1W8ZA 4LKDA 1WZXA 4YWAA 1W90A 4YW7A 3ZYHA 4BQ2A 1OH3A 2O14A 4LK6A 2LRPA 3UT0A 1L7LA 4A6SA 2K46A 1OKOA 3ZYFA 2Q1FA 1W8UA 3F95A 1WMXA 1GWLA 4CP9B 2WYFA 4LKFA 4AL9A 4CP9A 4LK7A 1W9FA 2JWPA 3ORJA 3ZYBA 1HN0A 1V0AA 1W8TA 1GWKA 2LROA 5D21A 2C24A 1GWMA
chains in the Genus database with same CATH superfamily
4HSJA 4FTBA 2PFWA 2CY6A 1CQ9A 3ZFFC 1Y7BA 3SEPA 1WD4A 1G86A 1T2XA 1H4HA 4Y1XA 1IS4A 2LALA 1QQP2 3RI9A 1R1ZA 4ISRA 1C4RA 1YI9A 1GZWB 1F9KA 4LO6B 2W47A 4AOCA 5K0UA 2WZ8A 5EXOA 3NJXA 2CL2A 4XFHA 1H9PA 4KG8A 4V2WA 3WDWA 3RZGA 4YW2A 1CPNA 2X09A 3VBOC 5GZFA 1O3QA 3EYPA 5J36A 4W6YA 2ZMKA 1UOFA 4LE3A 2Z42A 3U11A 3VZNA 1UPIA 2EALA 3MLJA 1XU1A 4IV3A 1GU3A 2H0BA 3LPGA 3ORJA 2UYAA 1UY2A 2WA3A 5FY1A 4RGAA 4HT1T 1J84A 2A6XA 3WY6A 4FSJA 2RDSA 4HLTA 2PHLA 3N9QA 4HXCA 4TWTA 2RR12 1JZ3A 1YRZA 4WVVA 1S0DA 4M0HA 4NMIA 2C9KA 2MEV2 4WVWA 1MZ6A 4AFMA 4UW5A 2ERFA 2DVDA 5IWFA 3R0RA 3AMMA 4GJZA 4XHXA 3A21A 3O1TA 3RQ0A 1OURA 2WT2A 3DEMA 4YZ3A 1TMF2 5EJ3A 4BMBA 2HKXA 4AL9A 4PDWC 4EROA 5FZCA 5IT6A 3ZYPA 3VKNA 4Z07A 1IQDC 1HN0A 4K3UA 1QDCA 3IDBB 3OGJA 2O0OA 2WQ8A 3IAQA 3POBA 5FO8B 3PJQA 4PF1A 3TRSB 1KDKA 1QJFA 1N3OA 3VKMA 5CADA 4AHZA 1RVF3 2R0HA 2RS12 3W21A 1ULGA 4AEDA 1JOPA 1D4M3 3SKJE 3A23A 4V2VA 2CWMA 2IC1A 1DLLA 3H42B 4AVTA 4XJAA 4QB1A 3FE5A 1QJY1 3F2ZA 1VMHA 4IE6A 4BM8A 3LA3A 1I1EA 2VR4A 1TE1B 1IS3A 1HB3A 2ZEWA 3MLKA 1CX4A 4XQ4A 1E5HA 4Y33A 1W9FA 1YQ8A 1S0EA 3LEKA 4BK4A 1AL21 1QOSA 3K4DA 2W1WA 2Y8KA 3SCGA 1HKDA 3ES4A 3O1UA 1H6YA 2W9XA 5KXEA 2F4LA 3TNQA 2ZAAA 3NKGA 5BV6A 3N36A 3N9NA 3C2UA 5JI7A 4PIYA 4Y5Z0 3APBA 5BNQA 1CAVA 5ACA2 2YGLA 4HMZA 5BYNA 5CYYA 2LRPA 2VPVA 2JG8B 1N1YA 4LHSA 1KDMA 5FP8A 4ES8A 4TLFA 4KU8A 3J7LA 4BB3A 2K2SA 3ZXAC 1IQAA 4CCKA 1F31A 1LGCA 2N7GA 3KV9A 4LOTA 4M01A 3ZXKA 2QUOA 4LO5B 1OMIA 1EPZA 4XDPA 4QPIA 5LY2A 4CEWA 2FDFA 3IMMA 4QM9A 3G7DA 5A3OA 5FO9B 1IPJA 2A73B 4BQ3A 4F8AA 4QPGB 2UY9A 4FXGB 1K45A 3JU9A 4Q4X2 3S7IA 4QKNA 4GH4A 1YJKA 1ALYA 1ND2A 3WW4A 1OLRA 4PLOA 5FBJA 1ZRFA 2A3YA 4QU1A 3ACLA 3U1XA 4KMQA 1RL3A 2ZX2A 3LDRA 5L7OA 5DN2A 1REEA 4CDUB 4GB31 4RSUA 5GJ6A 5CKMA 2YZ4A 1RHI3 5DUXA 4PHZA 4RQPB 2D6KA 2CDOA 2D7FA 3OSDA 4HONA 4QHZA 1COV2 1ASJ1 3KCCA 2FBEA 2YXSA 4FOYA 1NXD1 5FOBB 2VMEA 2B42B 1RUF2 3AB0A 5DDJ1 1HRV1 3PL0A 4IV1B 2WNUA 5FMCA 5H9PA 4QDRA 4ZONA 1W6PB 4ZS2A 3UGGA 2A71A 4XFIA 1VBB1 2D5HA 3CMGA 1KJRA 4I3PA 1OC1A 2HWB1 4AE2A 1ZBE1 2QBXA 1AR92 4IV1C 4O7XA 3POFA 4DUWA 4BIFA 1MQTC 3DKWA 1J3QA 4B7KA 4CYDA 3VLBB 2E7AA 1ONAA 4MXWA 2VZTA 5GLTA 2QQLA 4SBVA 2WYFA 1SCSA 2A70A 5T5LA 4CDWB 3ZN6B 3HJRA 2WFF1 4C8DA 3A0KA 4PIZA 1NCQA 1NXMA 3H3LA 5FXVA 2VJXA 3S30A 4XF0A 3M4FA 4CCMA 3ZMOA 1ST8A 2RM23 4CCLA 3BI3A 2UWCA 4XF4A 2UU8A 4XUNA 3CDZB 3WQ0A 4KQ7A 2QQIA 1JYXA 1WUVA 4L92A 2ZGKA 4P14A 3FFZA 4YARA 1SLAA 3CIHA 1VAMA 3PUHA 1ZA7A 3AP7A 3QACA 2PYTA 1IKQA 2C26A 2DWRA 4CA9A 2OZJA 1QOOA 4XF3A 1A34A 1HN1A 5FKCA 1F35A 2GC3A 3GNEA 2I07B 3ZYJB 5I8SA 2B8MA 2V5DA 2NZ9A 2IXHA 5EPAA 5A70A 1H30A 1DBNA 4BLJA 2CV6A 4BXSV 1K42A 4A4AA 4MGKE 1GNYA 2BWCA 2EVXA 1XYOA 3T30A 4QPYA 1YJLA 3S7EA 5IAXA 4BQ1A 3K4ZA 3O5SA 2GP3A 2JE8A 3AYDA 4QQHA 2JDHA 2B39A 3ZYHA 5KHGA 4XJUA 3KLSA 2RR13 3FUOA 5J48A 1PNGA 2ZAHA 2XVKA 2QQUA 3OBTA 1DYPA 3RJRA 5BNOC 3I54A 3VHOA 4PLMA 1X7NA 3WXPA 4GMP0 2XHNA 3BIEA 1OA2A 2NLRA 4B4QA 5I8TA 1IHMA 2BJSA 1EV12 5IUQA 3GBFA 1GWMA 1LGNA 2HLEA 1NCRB 1FI2A 1RUC2 1WLTA 2JICA 2WLPA 3AKPA 4FAHA 1BK0A 1W04A 1LOEA 4XBQA 4JGYB 4K7JA 5H9QA 4XUOA 3JD73 5LA9A 4MV2A 5JLVA 4YZ1A 4HSLA 4E2GA 2RS13 2BGOA 2DV9A 1OQEA 1G9CA 2Q30A 5FYCA 2VZVA 5KXDA 3AFGA 4R8HA 4XXPA 4LBKA 4M0NA 3DPRB 4RS5A 1GNZA 4N43C 2VQTA 1RTVA 3AVRA 3BU0A 1S0IA 4IGOA 2BFUS 1OF4A 4RR3B 4FFFA 1BVP1 3NNJA 3N3HA 3MICA 3W5NA 4W6XA 1LOCA 2WO7A 4MGYE 4OI4A 3ZYGA 4ZXKA 2QQKA 3T2QA 5L19A 2VCMA 4DRVA 4L0PA 4LK6A 4MHRA 4XIKA 5IVFA 1PGL1 1QU0A 3MF9A 4OI1A 3NKTA 3VBRA 4AVVA 5FP4A 2P3KA 2PA7A 2UWBA 4V1PA 4XETA 4Y3OA 5FUIA 4KBZA 3ZFGB 1UMIA 2CSGA 4DRRA 4XBLA 1VBA1 5FYHA 5FMOL 4MHUA 1JODA 5LASA 3I2FA 1AXKA 4K40A 4QX3A 1UCXA 4WVZA 4ZU7A 4R4ZA 1AYN2 4JVAA 4E2SA 1HB4A 5T5JA 5E8AA 3T0AA 3GDBA 2ATFA 5FPVA 4RHV1 4EN8B 1D0GA 4LKEA 3TEWA 4Y24A 1S0FA 3EXUA 3ROUA 3QCWA 4YWAA 4HL0A 2AR6A 3D5OA 3USUB 3VBOA 4BWOA 4UF0A 1W8FA 1GZWA 2QDRA 3B9CA 4LR4A 1W8HA 4OYUA 5F5AA 1NZIA 5JDBA 2FDGA 3HNBM 5I0RA 4YGCA 2ZTNA 2HBTA 3VD9A 4Q4X3 1QXRA 4CXXA 2JX9A 5FXWA 5JOZA 1DQ0A 1PIV1 2K0GA 5H9SA 4FQ4A 5A3LA 2YBSA 5I0DA 2JE7A 1CX1A 1RUI1 2B9VA 4Q29A 5FZMA 3WLUA 4KBBA 4X8PA 2ARCA 2LROA 2QQNA 1UIKA 4ARXA 5K4LA 3W5MA 1QH6A 4XUTA 1MEC1 3AP6A 2WT0A 4NOTA 1COV3 2QZ3A 3JBG2 3RYPA 3W58A 5FPUA 4RYDA 2HWD2 2R042 1RUF3 3VHPA 5K0UB 5LRSA 2QJVA 5F3IA 2IVIB 1DFQA 3NVCA 1FAYA 4I30A 2HBUA 1BMV2 1JH5A 2QZ2A 3I3BA 4PDWA 3TWIA 1OUXA 2VZ3A 4NUBA 4AQ2A 4OHZA 1AR93 3FMGA 4U2AA 4IV3B 1CIYA 1RUD2 2I74A 2WDBA 1U5ZA 3MF6A 4IESA 4CP2A 2WZPP 3KVBA 1OSGA 4B7EA 2XJVA 1YIFA 2VE1A 4XJWA 3WINE 2BQPA 5FZGA 5KC5A 3B02A 3RFRA 3KMHA 4LBMA 5FPBA 1AJOA 1ZRCA 5LATA 3A0NA 3OF1A 3WG2A 1YI7A 4Q1RA 1GQPA 1FV2A 1R082 2VUJA 3FC0A 3AZYA 1D0HA 2UYBA 4GXLA 3CJIC 5FY5A 4OMDA 3I49A 3KS7A 4B1MA 2EF6A 5EZWA 4E8CA 4Q4W3 3X29B 1V6NA 3KM5A 2D44A 3ALQA 1ZRRA 1VBD1 2TEPA 2GNTA 3L2YA 1SBEA 2A1XA 5D2AA 3T2TA 5AC91 3VDDC 3I4IA 3WQ7A 3D0JA 2GMMA 4ZKTB 2PTMA 2IFRA 2GAUA 1OLME 4IE5A 2YBPA 4Q0SA 2Y6LA 3FHAA 1GQGA 3O0XA 4AHXA 3H50A 2VH9A 2ZGPA 2RE9A 3IZOA 4H2AA 5D8AC 2E31A 1ZBA1 2RVAA 2Q5TA 4AEDB 2A6WA 3KHCA 5FXXA 4LHLA 2ZA9A 2OYZA 3WT3A 2VZSA 2ZGRA 4Y26A 1H8VA 3C7EA 1BQPA 1SZBA 2Y33A 1Q8VA 1AF9A 1C8M2 2P6CA 2F17A 4JQTA 1BZWA 1E5IA 3K3OA 4FPOB 3H8RA 1LHVA 1IPKA 5F3EA 1S2KA 4OZXA 2GN3A 4N9IA 4KNCA 1IG3A 1QJX2 1L7RA 1KQRA 4XW3A 1ZM1A 3BTXA 2YFUA 1BEV1 3IIAA 2VQUA 5FZ6A 2VVFA 4BQ5A 5ABJC 4LULA 1EY2A 4I0AA 4XILA 3H0OA 2RS51 3SEEA 2ILMA 2RDQA 3H9AA 5IATA 1EV13 5JSOA 2VTFA 1V6OA 4Z2WA 1CAVB 3T0BA 3BOWA 4MXVA 4AG4A 1C28A 2FCUA 4MADA 1NA1C 4Y4YA 3WNPA 1RUOA 2VY0A 1HRI2 2E51A 1KS5A 4QXHA 1HXS3 5T52A 1W0PA 2W5FA 3IDCB 3TAYA 5F3GA 4BLIA 3PUIA 1OKOA 2A6YA 4CCOA 2WO3A 1UX7A 5C3RA 5EJ1B 3OD4A 5IW0A 5FY8A 5BNNC 1CZTA 2W92A 4QPIB 4CEWB 1G6NA 2P6HA 4Q4V2 4COWA 3LCPA 1GWKA 4FFGA 2HWF1 2ES3A 2C24A 3U10A 2BGCA 1W3VA 2HWC3 2WUHA 5FREA 1W6MA 3WNNA 3THPA 4COYA 1XNDA 1OQ1A 3KB5A 4YVSC 4IV1A 2BVVA 4E2QA 1KITA 5E1RA 4GH4B 5F9TA 1ND2B 4YYOA 4IEVA 3ZX7A 1RUE3 3FBYA 4J1XA 1PO22 1BBT2 5CU1A 3WG3A 3I3DA 1AYM2 3NWKA 5L7OB 5AFEA 3C7OA 4XBNA 4TTGA 1RUH3 5CEHA 2EXIA 2YROA 2JDYA 3J7MA 4G9SB 1CJDA 3A22A 1GICA 3ZYRA 3WG4A 3R4SA 3CHXA 1VJ2A 2J22A 1CGPA 1HB2A 1TME1 4NRQA 1UYZA 3OGVA 2WNUB 3ZOIA 3OBZA 3J9SA 1ZZCA 3ABZA 3WF0A 1J1TA 2Y0IA 1BCXA 5F2WA 2IXLA 1HJGA 1C57A 1JHJA 2YC4A 4LJHA 1MS8A 3T4VA 3ZN4A 3VZKA 4LIUA 1V9U1 4YW7A 4AGGA 3KWVA 2SLIA 1RMU1 2JE9A 2Z79A 4EZ4A 1LJ7A 4GZ9A 2C5DA 4XMIA 1WLWA 4MXWB 3Q8FA 4TSVA 4AXOA 5IVCA 1UZVA 3BODA 3ZFEC 3J7NA 1OVPA 4MYEA 4FP3A 2XKOA 4JAAA 2CAVA 3VUOA 2JDZA 1H2KA 2E6VA 4LOSA 4F7ZA 4JGZC 2XPJA 3JQXA 5JXGA 2H6CA 3UKVA 3VL9A 3LZZA 5FP7A 1VIWB 1QQP1 2OW4A 4MO3M 4WVMA 1LOFC 4LBOA 4XYXA 3LGRA 3I3QA 1AR72 5CG8A 3POWA 1EUTA 4HVQA 3M1HA 2ZKLA 1BK1A 2HYXA 4RD7A 3KGLA 5DAWA 5E88A 1D4M2 1EAH3 3CQOA 3I2HA 4OFGA 5K7PA 3CBNA 4LBNA 1MS4A 2G4IA 2HEWF 3POYA 1A8DA 3CJXA 5BNOA 4O9EA 4H7LA 3PVBB 1VMJA 2F4PA 3JBG3 4CRQA 4CUCA 2WAOA 2V4AA 1QF3A 2R043 2Z4FA 3KSCA 1AR82 2RDNA 4CU9A 2FD8A 4I2OA 3AP4A 5JSRA 2VMDA 3VDAA 1W0NA 4LK7A 5C3PA 5FDBA 1LCLA 1SEFA 1MZ5A 5T5OA 4P5YA 5DAVA 1QWRA 4OI2A 4WM8C 4L97A 4B8EA 1HV1A 1RUD3 2MEV1 5FZIA 2A6ZA 2W1SA 2QTWB 4P9XA 2QE3A 5FZ1A 3O1RA 4N7IA 1GSLA 2WNVC 2YDEA 1ZYBA 4JDMA 1RUJ3 4NROA 5HV4A 1CWPA 1FV3A 1H1IA 2WS91 1TMF1 2IWGB 3SQOA 1C5HA 2J42A 3CF6E 1HB1A 2AACA 4B3NA 2EXJA 1WD3A 4N43A 1SBDA 1ULEA 2ZMNA 3EHKA 2BRTA 2PHTA 2FDJA 3OUHA 2RS33 5FK7A 2WYSA 1A3KA 1UQXA 2DFBA 2W1UA 3JZVA 3MUZ1 3R4UA 4DXTA 4PIXA 3E1F1 2XBO1 2XUEA 5JMCA 4AI1A 1QHDA 5CIRA 1GOHA 3GXUA 1DU3D 1UYXA 4JX0A 2NQYA 1K3IA 1QJEA 4HN0A 5GZCA 4AWDA 5EWSA 1DHKB 1PK6C 2G9GA 5EFUA 5GZEA 1FPN2 2DCZA 5BPXA 3U75A 2PELA 3KVAA 2R0FA 5B2GB 4FPGA 1TQ5A 4DOUA 1VBC1 5GKAC 5FZDA 1DZTA 1GR3A 1W2TA 2ZGSA 3FFQA 1EP0A 3POJA 1SLBA 1UZWA 2D6LX 3B7MA 1W99A 2WN3A 4RS5B 5IFPA 4RFRB 2XWBB 2FZ1A 3IT8A 1C8M3 4EN7B 2BWAA 3K3NA 1JTZX 3HAGA 4QWNA 4DFSA 3WP4A 4YM0A 4BQWA 4DNYA 5ACA1 4AI8A 4PQQA 3BTZA 1VB2A 1QJU1 2ET7A 4LXLA 4XTMA 2HJIA 1O5LA 1DQ4A 1XE7A 5BXXA 2WZEA 2R49A 2ZHMA 4HVOA 4ISQA 4YFZA 4EWAA 5CFCC 1WCDJ 5KHJA 1IS5A 1NAEA 1LULA 3AM2A 4XABA 3RGBA 3VZLA 1VBE1 3TBDA 3MGUA 2GP5A 4QKBA 5LBBA 4Z8BA 2QCSB 4GWJA 4LO8A 3WEZA 2WN2A 2C0ZA 1R1A2 3F95A 4IETA 1UXZA 1YFXA 1DZQA 3AK0A 3ZFFB 4FTEA 4YLZA 5T3NA 1S2BA 2ZX1A 4G4FA 1OI6A 2RJ2A 2LM3A 4LPLA 3TB0A 1PGSA 1SLLA 4BH9A 3N7KA 4YW6A 1TZOA 1LHWA 1N1VA 1IS6A 3AKRA 4Q4V3 4IEPA 4NIDA 5FO7B 3MPBA 1AXYA 4Y22A 4MG2A 3VGIA 2JD4A 3VBOB 4UF0B 3E5UA 3H8UA 1JXNA 1NLSA 3ZKYA 1DF0A 1I3HA 2WWJA 1OH4A 1F4AA 3HEIA 4COUA 1S1AA 1MACA 1PO23 1BBT3 4XUPA 1AYM3 3WDXA 5FZKA 1ZZ7A 3MI8A 4PCRA 2DVBA 3FBMA 4XIOA 3N9LA 4O9GA 3JUUA 3NJZA 4FPFA 1DZRA 4YVWC 4UI9L 2VOKA 2R1DA 4YSFA 1KRIA 4E27A 4UFHA 4I02A 1O6UA 2WIIB 4MH0E 1GNHA 2PQSA 4WM7C 3CJIA 4A3ZA 2DTWA 5HCFA 4FBFA 2R071 2WFPA 2EIDA 4K21A 5A7OA 4PDWB 5FMBA 1Q8SA 4Q2FA 4AI0A 2GMEA 3PMSA 2QQPA 4LBQD 2J1RA 1OA4A 4P9LA 3VDDA 2G9FA 3HPNA 1NY71 2YPJA 1NE6A 2R16A 4JC1A 1ZA4A 4PI2A 3RZZA 3OGSA 2BOJA 3E5QA 4HOOA 2LTNA 4ZZ5A 5FPZA 2VM9A 3G6JB 4H7MA 2VC9A 1PGW1 4JHTA 1W6NA 4HKOA 5D8AA 2XQRA 3Q9OA 2WABA 4QXBA 5FZEA 2DVGA 4BE3A 3B69A 1Q8QA 3JD72 4IERA 4Q8KA 4DUVA 1CZVA 3GBWA 5JWPA 5CVRA 2Y6HA 4M3CE 3SHRA 2P5BA 1JS9A 1AR73 2NYYA 3LB9A 1BYHA 4D69A 2Y64A 5FY4A 1IOAA 2EIGA 2OXBA 3DCQA 4I01A 1ZNPA 3JXSA 4C1XA 5I93A 2GNBA 3AYEA 3SCFA 5KR7A 3ZLIA 3KZ4C 3K46A 1Y9MA 3POSA 2OUHA 2PLV2 3O1OA 4CCCA 3RZJA 5AVPA 5F37A 1YFUA 4S2FA 2QVSB 3LQCA 2E53A 5ABJA 4YZ5A 1AR83 2CDPA 4EYUA 3S0MA 4XHBA 3FHQA 3M3IA 4XZUG 3NNLA 1KS4A 4UFIA 2J1TA 3AFKA 1W9YA 2Q8DA 1O8SA 1U5XA 3CZJA 1TVGA 2GDFA 1NA1A 2XUMA 4QPWA 4HKLA 1WCUA 2VMIA 2E63A 4EN6B 3AL6A 4XFCA 1W8OA 3POIA 1W6OB 1CONA 1PVC2 2O8QA 3C7GA 4F83A 3POGA 5CBLA 4PJYA 1S4CA 2WJSA 4JZRA 5FTTC 5BNNA 1CIWA 3ZYFA 3K48A 3HT1A 3DGTA 3AC0A 2ZABA 4LLOA 3QLQA 5FLHA 5BNPC 1RUC1 4BMEA 4LO7A 1PO11 1R093 3O7OA 3DL3A 5HCAA 1X9PA 1C8NA 4A7YA 1XBFA 4YVSA 4Q4Y2 3SITA 4AR2A 4FAGA 4P9GA 3GHMA 1WBLA 3OUIA 4YGDA 1LECA 2D6PA 2P34A 2B9UA 2DUPA 2VZRA 1LESA 3J4UH 3M3QA 4YFWA 1WLCA 3K75B 2R062 4AF9A 5J98B 1AR62 2OZ6A 4AVBA 2JD9A 3PTYA 1FPN3 4AI3A 3ZN5A 1FOD2 1O8PA 2XDVA 3LFIA 2HWE1 3PIJA 4Q5OA 3TN93 1XRUA 5FZLA 4Y20A 5FZOA 2VTXJ 2CNAA 3I2JA 4CU8A 2DVFA 2V73A 3M3EA 1W6MB 3FLPA 5CAZA 3RZLA 4CUGA 5FYVA 2B7YA 2YB7A 3OTFA 5FK8A 2UY8A 4IXLA 5ANQA 4ITCA 3EMRA 3V64A 4BZ4A 4Q27A 1MQTB 3GHNA 3H1WA 4LKDA 1ZZBA 1T6GC 1WWYA 4GWNA 5FYTA 3ZFEA 3VD4A 5DG2A 3UKTA 1GQHA 1XXNA 4JGZA 2E33A 2XLAA 1VAKA 3MZHA 1SBFA 4Y5TA 1XE8A 4FCAA 1AYN1 3SCHA 1LOFA 3SNMA 3U37A 4AGRA 4YZ4A 3O1SA 2VUCA 5F8PA 1W8NA 1V6KA 2D3RA 2Z5WA 3TEXA 3O0VA 4IGQA 3OGRA 4NAOA 1ZRDA 1R1A3 1L7QA 3GGLA 4CUAA 5F32A 1NX9A 3NJVA 5KBFA 3LE0A 4HG6B 1O3RA 3PUQA 2Y60A 5FP3A 2Z2SB 3H3ZA 1JYWA 5H9RA 5LCWL 2J1EA 2FZ2A 3MW3A 4LUMA 4E4SA 3J8F1 2VBPA 3O0WA 4YW1A 1A78A 4RA0A 4LBJA 4Q4W2 1JZ7A 1UNBA 2VTXA 3JB8A 3BGAA 1BJQA 4UW3A 5IAVA 2X05A 3O1MA 3R6SA 3NJYA 2A3WA 1RIRA 1UO9A 5A3PA 2VUAA 3OD0A 4CCNA 2PXJA 4I09A 2YC0A 2BFUL 3NW4A 5SV5A 4Q1PA 1OFSA 4WM8A 3ZDSA 1AJKA 3IM0A 2A75A 3ETQA 2A6VA 4FT8A 3SMHA 4WVMB 5JIUA 4KI5M 5CISA 3WF3A 3NNFA 4QHOA 4OQ8A 2HWD1 2WNVA 5A3MA 2W39A 1IZ3A 5A7PA 1YFWA 1VRBA 2FCTA 2HEVF 2JDMA 4HPKB 1TNRA 2BGPA 3IDEA 1OXCA 4L8QA 4ZU5A 4DS0A 1OT5A 1JYNA 1W28A 1BMV1 5F6LB 1WMDA 3KQ4B 3M8LA 4D3WA 5BNOB 3I2DA 1OHFA 2RMU3 3NAPC 5IJRA 1Z7S1 4ZHNA 4BQ2A 3J26N 1O4TA 5FFOC 2H6BA 4YG0A 1UOGA 4XDOA 5LBCA 3UV9A 2G19A 2IUWA 4UOJA 5C3SA 4BQYA 5LA0A 3AMQA 3H3UA 1UZ0A 4F3JA 1WW5A 4LEJA 4LMFA 3ZXFA 2YC2A 4IEYA 1NQDA 5FAXA 4I0WB 1GUIA 2SBAA 1ND3C 5CFDC 4CVUA 1N1SA 3AKQA 3LWCA 3INAA 1REDA 4NWWA 3J7HA 5FZ3A 3RMXA 5GLVA 2WINB 2J1AA 1R081 2YY1A 3I97A 3WDYA 1PK6A 1LHNA 3AJYA 4PF5A 4GIQA 3MIDA 4NHKA 1HXS2 3VD7A 1RB8G 4FTSA 2R7EB 1JYCA 2XL9A 1FNZA 3SKVA 3EBRA 3S57A 2OPKA 1AHSA 3ZIXA 4N43B 1FATA 1DCSA 1EPWA 1Q5OA 1IPSA 1ULOA 2D6MA 3AYCA 4AEKA 4CDQC 2YUEA 5FQ0A 4G3YC 4ZPIA 1LNSA 2ZGQA 3BALA 3OPWA 3FL7A 5LRRA 3WZ1A 1NLRA 2ZKNA 4N53C 1RUG3 2HWC2 3RRDA 2R6QA 3ILFA 3HN1A 1TEIA 4JKKA 1POQA 2Y34A 4NR1A 4ZS3A 4A45A 2PLV3 1A8MA 3AP9A 2WA4A 5CKNA 2ZHNA 1UOJA 4YW5A 1VR3A 2ADEA 3KHBA 2O1QA 3PDQA 1RUE2 4FOVA 5C9AC 2WZR3 5CFCA 4TLGA 3RMYA 4EN9B 2TNFA 4QQOA 1UY4A 2BBAA 2X10A 5GLZA 3VBSC 1PNFA 1RUH2 1UZZA 4XQDA 2RG4A 1POV1 1UKGA 3ZXGA 3I3MA 2ZEYA 4QX8A 3UGFA 5A3UA 4AQ6A 2GMPA 2ZX4A 2QQWA 2A3XA 5A6YA 2VBBA 1HLCA 1VRH1 1KD7A 1QJX1 2VW1A 4HBNA 1CVNA 2YFZA 1PVC3 5LWBA 4QX0A 2D3SA 3N9MA 3WNLA 1IKPA 4GB32 1F2NA 5FPLA 2QNKA 4GD4A 1N47A 1GBGA 1YLLA 4GMP3 1GOFA 4X6RB 3ZFFA 5EYXA 3T2OA 4CXWA 3NO8A 1ASJ2 1FMD2 3Q8BA 3WUCA 2Y0OA 1JZ8A 1KXGA 2GC0A 4N90A 4Z1VA 1HQLA 3ATGA 1HRI1 3P5BA 3I2OA 1OD3A 3BN6A 4Q4Y3 4LT5A 1MS3A 2VL4A 2VOVA 1MPXA 1SQ4A 4PI0A 3UESA 1GYKA 1HW5A 4UBHA 4XACA 5HXVA 1ODNA 2OPWA 3BVCA 4RGKA 3E6DA 2GALA 4K8FA 4Y1YA 5G05L 4L11A 4ZZ8A 5M0TA 4IEUA 2BV4A 1UU6A 2R063 5JXHA 3M2MA 3MHZA 5FJKA 5L9VA 4CXYA 1W3XA 1LENA 3HNYM 3IAPA 4WZCA 5LW9A 4FQZA 4YVWA 1AR63 2ZOEB 1EAH2 1K12A 3MFCA 1BXHA 1FOD3 4WM7A 1O3TA 1AX0A 3OPTA 1OLQA 3BCWA 2VCAA 5F2SA 1UL9A 4CPBA 5C5UA 3ACGA 3VDCA 2VNGA 5EP9A 5T54A 4Y22B 5IHRA 3LOBA 2QQJA 1JYIA 3CU7A 1W8ZA 2AH2A 2ZZQA 4BOWA 1UF2C 3RWKX 4YM1A 2DFCA 3JQWA 5FCCA 4ARYA 4NO4A 3RZKA 3VD5A 4X6QB 2YYOA 2ZS6B 5IK8A 4FVVA 4OMCA 4W4ZA 4DY5A 2XL7A 2Q1FA 2KA3A 5IYYA 3WG1A 4LTAA 2G1MA 1U0AA 2GNMA 1OLMA 2JWPA 2WSUA 2VMHA 1UD1A 2JJ6A 4GWMA 1YEWA 4P9JA 1RUJ2 5ISLA 4XJ8A 2D97A 2WO1A 3ENRA 3GALA 3CJIB 1CD3G 1XNAA 5I8YA 4A41A 2VULA 1GLHA 4MGZE 4UT5A 2BOIA 2D6NA 4CPBD 3B5LB 3C7HA 4D7YA 5IK5A 1JW6A 4OVEA 2DF7A 5E89A 1VB4A 4IEZA 3WHTA 2PHWA 1AVBA 4E4ZA 1OD5A 5L36A 1S0GA 1JZ6A 4OUEA 3VDDB 4EWEA 2RS32 4KU7A 5FYMA 2VCCA 1DGLA 5D1IA 5GM0A 2P3IA 4OLLA 2BTVC 1KFXL 1RVF1 2DBIA 1RYYA 2IXIA 2VMFA 4LNVA 2VD7A 1W6QB 3N7MA 3DECA 2JXAA 1W9SA 1YC61 1JZ2A 1VMFA 1W6NB 2AEZA 1D4M1 2W3JA 3BYWA 4META 4W6WA 5D8AB 4GA9A 4JCKA 2XR4A 1JBCA 3AXEA 5KHHA 3K77A 1DQ5A 5CB7A 2PHXA 3HQXA 4KG0A 1DQ6A 5CG9A 2W52A 3BB6A 1UOBA 2GU9A 5E16A 3VDBA 1E5SA 3WSOA 4AEJA 3DKQA 4P5HA 3KCYA 1Y9QA 4HANA 2P1BA 4NHMA 3MLLA 5DG1A 4R4XA 3UT0A 2AENA 3I7DA 3OGGA 2PAMA 1W6OA 3HN3A 5BNPA 1U12A 5DPNA 1WGPA 5F1RA 2KXLA 5L73A 2AGSA 1TNFA 1C5IA 3QBQA 1MVQA 5ABJB 5SV8A 2OQ7A 4KL1A 5EYYA 2OX0A 2D5FA 3LDBA 4QB2A 5FYSA 2XLGA 4XCAA 3KT1A 1W8TA 2ZXQA 4CDXC 1JZ5A 1B35C 1OF3A 2P2KA 4FPJA 2E26A 1NA1B 3AZZA 3M70A 1QJY3 1E57A 1SFPA 3RI8A 3TYJA 1UY1A 3KT7A 3P1IA 2OUJA 4MZUA 3OJBA 4BCUA 1QKQA 5K8SA 4OI0A 1XNCA 2VOXA 2ZEZA 3MV11 3V56A 1AL23 1XB9A 5E6HA 3USSA 5FY7A 4LIVA 3WVJA 5BNNB 1MS1A 4CCEA 2VGDA 2EIBA 2WL1A 5IK4A 3BPSA 4FPEA 2VU9A 1G9AA 3OB8A 4E8DA 4UFJA 1SLCA 5CZKA 5LBEA 3ZXLA 1N3QA 2ZMLA 3GJAA 3ZKUA 1RJ8A 4AYUA 3V0BA 5FJHA 4YVSB 2D3PA 3DXTA 5FYZA 5FZ7A 2BUKA 3THDA 1NQJA 1W06A 3H1MA 3I59A 2JDKA 4ONUA 2W95A 4NIGA 3GBGA 5A1LA 1RHI1 5DUUA 4AVCA 2CGNA 2ARBA 1X36A 2EICA 1MQTA 4NJ4A 1X8MA 1OOPC 1T6BX 5T50A 4D94A 1OVSA 3NNGA 4ET7A 3EQEA 1LODA 1UAIA 2WO2A 4WZFA 5JZGC 3B01A 4DIQA 2Q1ZB 4XC9A 2XXZA 4GQ7A 1W8UA 2YPDA 1RJ7A 3QH7A 1SFYA 3MFAA 4Y20B 3HBZA 5FZOB 2Z69A 2JEMA 4D7SA 5DZFA 4XZPA 1PIV2 3RWNA 4GKYA 1ULCA 1JHNA 2DTYA 5A33A 5J7MA 5LZ6A 1Y43B 5B4NA 1YWKA 1RUI2 1QXJA 3P3PA 1FT9A 4GB33 5GALA 5JR7B 4BXFA 1RUNA 4R9AA 3E5XA 3LA7A 1LHOA 4FO9A 1MEC2 4K1YA 3ZFEB 1ASJ3 1FMD3 1Y9GA 3AJZA 4K6BA 3T4HB 3MIFA 4NIIA 4CP0A 1H2LA 2RM21 1NUKA 4JGZB 1HRV3 1NE4A 2P3JA 2DU0A 4TN7A 3HQRA 1XE0A 1Q8PA 1Y4WA 3LD8A 4P9WA 4YM3A 1JOBA 1H8TC 1VBB3 2DUQA 3RDIA 3WP6A 1SLIA 3ACHA 2E9QA 2HWB3 1O4ZA 4AI2A 3CNAA 4RN5A 3ZYIB 1ZBE3 5ANNA 1AL0G 3E6BA 3H7JA 2ZPXA 2NP0A 4E4HA 1Z0HA 2Q1MA 3NAPA 3UETA 1YCIA 4TZDA 4HPKA 5JOYA 5EV7A 3RZHA 2JDPA 2WFF3 4YW4A 3WQ1A 1Z78A 3KQRA 4ATEA 1DGWX 1G9DA 3FX3A 1ZVFA 1FNYA 4K20A 5F5CA 3LAGA 1L7LA 5LA2A 2PHRA 2XHKA 3BTAA 4XFFA 5C33A 4DUXA 2R1BA 3M7AA 5CFDA 3VZMA 4MGSA 4WM8B 2W91A 3D82A 4HETA 4BA6A 3GZEA 4J1WA 5FRAA 3C7FA 4DO0A 5C3QA 5JR2A 2FDKA 5J1XA 1PVXA 3MIEA 4NPLA 2WNVB 3VBUC 2RR11 1PM4A 3ACIA 3LA2A 4LHNA 4LO4B 1V6JA 1APNA 1VPHA 1J3RA 2ET1A 2NMNA 2WKKA 2WNOA 1XNTA 3AZWA 5JUVA 1J58A 3VHRA 2XJQA 2OVUA 1ZZ6A 1JI6A 2WWSA 5A7WA 5LB6A 2K9ZA 3E6CC 2E32A 2W87A 1ZBA2 4CDQA 4CSWA 5FZBA 2PHFA 3DYMA 1RITA 4IEQA 2QDNA 3GCWA 3H7YA 2NM1A 1R092 1UYYA 1EYBA 2IXKA 4N53A 1VAVA 2EXHA 4IE4A 4QQPA 3WDVA 1PHMA 1WA6X 1VALA 1YXWA 3MIBA 4IE7A 1POV0 1W9TA 2EAAA 3PU8A 3TNPB 4KWLA 4IE0A 1W05A 2Q4SA 4CP9A 1U5IA 3MIHA 2RJLA 2A7AA 2WT1A 3JD71 3N35A 4NPRA 1QY4A 2F6BA 5C9AA 4R9DA 3ASIA 3LF7A 1OQDA 3L9JT 4UFKA 4AW7A 1PK6B 2RS11 4L9BA 1PMHX 3UGHA 3VBSA 4XJ9A 3DYOA 1AX2A 1WLDA 5FY0A 2A5ZA 4BU2A 5LA1A 1QDOA 2RS52 1ULDA 1QNYA 3VBHC 2P4EA 5DAPA 2I2SA 4NRMA 5EHDA 3WUDA 4XTPA 3BUCA 5APAA 3WR0A 1V6IA 4NHXA 4Y5SA 3ZSLA 2AREA 1W2OA 2HYKA 4URTA 5FQ0B 3TN92 3V0AA 4DEQA 2C1FA 3FHIB 1WCQA 4HK9A 1UU4A 5FY9A 4ES9A 1D2SA 1GP6A 2B46X 2VQAA 3WF1A 1H1MA 2TUNA 4A2UA 1FX5A 1X50A 2O8OA 2H0VA 2PQQA 3AMHA 3PURA 1UMHA 3WP3A 5FZ9A 3AX4A 3VHNA 5CFCB 1D2QA 3GCXA 3VBFC 5JPMB 2HWF2 3ZR6A 1C1LA 3GZTB 3ZDVA 4CCDA 3ZSEA 4PT6A 1UX6A 2XB6C 1WMFA 2VMGA 4L2NA 4DMIA 2D40A 1WZXA 4KH9A 2ZJCA 1FXZA 1MS9A 2IVJA 3R4DB 1GANA 3ETPA 4IUGA 5C4WC 3N7JA 3KF3A 2FHRA 2RHPA 3ZM8A 3WNMA 3CL1A 2ZGOA 2X5IC 5A3WA 3VN4A 4BIOA 1NYWA 4YM2A 3Q8EA 1MZEA 2JG9C 3FJSA 4AI9A 2W1QA 4JRAA 4W65A 3FWEA 3PLQA 3GF6A 3LDKA 2OT7A 3IN9A 3QH6A 3I2IA 3B94A 2CGPA 3ZSJA 4Q0UA 3WCRA 4HVRA 4XQWA 3VKOA 4Q4X1 5JPNB 1TME2 3KV4A 4Z92B 2BEOA 3GZUC 4KWJA 4LE4A 5EJZB 1VBA3 1IGOA 1DDLA 2MHFA 4W8JA 3SXWA 3ES1A 1HX6A 5FXZA 4B29A 2VW2A 1H6XA 1O4YA 3K4AA 4XDQA 5J96B 1D4VB 1FOD1 2V5YA 4YRDA 3OCPA 4LBQA 1ZZ8A 2PMWB 4YZ2A 5FYYA 4P9YA 3HVDA 5C8WA 1RMU2 3OPZA 4YGBA 5FUPA 5GLUA 1COV1 1F5FA 3VKFC 4RHV3 2TBVA 2YU1A 2VNOA 2ZGLA 4XF1A 3OEAA 1RUF1 4N8MA 4YVWB 3AMNA 4XJZA 4NHLA 3I2KA 1DP0A 1N3PA 4WM7B 4JV4A 1AXZA 2L9LA 3D3AA 3ZR5A 3QD6A 2PHDA 2RMU2 1EUUA 5I0TA 1HQNA 4INDA 4M3CA 4PBOA 1AR91 1PIV3 1RC6A 5T55A 4CEYC 3THTA 5JAXA 5FZ0A 1RUI3 4Y1UA 5DMYA 4M4PA 2YMZA 3VB9A 2W0XA 3CO2A 3Q8AA 4A6SA 4XMAA 2QFEA 1GP4A 1MEC3 4IEWA 4DY3A 4FPYA 3MIGA 4B4RA 4CU7A 4YG6A 5DAXA 2C9AA 2VZQA 3GZAA 1PZ8A 3AL5A 1GKBA 3ILRA 4Y1ZA 1H0BA 4XFGA 3KF5A 5IVYA 3QOPA 1OFNA 4B1LA 1W6QA 3OBAA 2IFWA 3WDUA 2JIJA 3PHMA 5HPOA 4Q4W1 3ZVXA 4QQLA 3IKWA 3T1MA 5KC6A 2DYCA 4QMAA 3RYKA 3VV1A 3NL1A 3N4MA 4OHYA 5KWRA 3THCA 1SHWB 5A7QA 4QDSA 2ENRA 4Q26A 2BP6A 2R30A 2Y6KA 3DV8A 2GZWA 3WCSA 5KHIA 2WS92 3WDTA 4QGNA 5C70A 2VG9A 1RUG2 4Z82A 4BISA 1J1LA 4FFHA 3S6PA 3LKJA 3EB7A 5C7GA 1OPMA 3HR9A 2PAEA 3MV01 4CDXA 1B35A 5A7NA 5T5PA 3PJYA 4D7TA 3SLIA 1CJPA 1OKQA 5TSWA 1V70A 3C8XA 2WZR2 1HQWA 3OG2A 2JDUA 2E7TA 1WW7A 2KR2A 2NMOA 1JZ4A 1L3JA 5FYBA 1CAXA 1BHGA 1QOTA 2BNNA 2G9ZA 1YQ5A 1W03A 2DCTA 2X53S 2XBO2 3IPVA 4R52A 5JIAA 3UJOA 1VBD3 2XJTA 3HQUA 5AC93 1JN2P 3O1VA 2ZHLA 1PZ7A 4W50A 3N7LA 4M3CF 5BNPB 5FPAA 3PNAA 3AZXA 3WQBA 4IDZA 1UU5A 1M06G 2FQPA 2VZ1A 3T0DA 1GZTA 4ZY9A 1V6LA 2OKXA 1VBC2 4E9KA 1O91A 1ZBA3 1EV11 5F3CA 2RJKA 3EJKA 4A3XA 4EN0A 1MR5A 2VQ0A 3OY8A 1DG6A 3LEIA 3UK9A 5IVBA 3RJ2X 4PQ9A 4S2DA 4LBLA 3ZPOA 3BKZA 2WC2A 2XJUA 3O12A 2XKPA 4P02B 2BBVA 5KHKA 1HXS1 2D43A 2LW8A 3Q8CA 2VZUA 3ITQA 1MZFA 1NZCA 1US3A 1ZZ9A 1DYKA 2MNGA 2QKDA 2UWAA 5A1FA 1OOPA 3ME2A 2NN8A 4QGLA 1ZX5A 3IWZA 5JZGA 2XVGA 1QJU2 5FWEA 5FWJA 4NIAA 5F5QA 4BPZA 1BEV3 3MW2A 3WF2A 1J59A 1LU2A 1P8JA 2HWC1 3N9OA 1BLZA 2RS53 1CR7A 4QX5A 1VBE2 2VCBA 1QEXA 2YV8A 4QB6A 4DEVA 3WOGA 1ENSA 2JG8C 5C8CC 3RG0A 5F7UA 2WSVA 2ETEA 3V0BB 3WNOA 4DXSA 4EV0A 2VOTA 3AP5A 1V0AA 1RUE1 4Q0VA 4A44A 5B4XA 1ZREA 3I8TA 3I59B 4TYSA 2Q8CA 1GMMA 1MS5A 2BVBA 4K9SA 1PZ9A 3DF0A 4A7ZA 3P3NA 1RUH1 5HV0A 5K9YA 5AVAA 4QXKA 4CZSA 3ACFA 2XGXA 2VXJA 5F5IA 2W94A 1LEMA 4IGPA 3IIIA 4CCJA 2D93A 2VECA 5C8CA 3MPPG 3LSDA 3W20A 4P00B 2HWF3 4LKSA 1H8TA 4QPGC 4SLIA 2YGMA 2EAKA 5FV3A 3SH4A 2ZGUA 2FMDA 3DN7A 5I91A 4CP1A 4AFAA 1LOGA 4ATFA 4XXAA 1FMD1 4FPLA 1QMJA 4HZFA 4CDUC 5A33B 5J3UA 1QIQA 4TXWA 3NV3A 1XOYA 3MO4A 3WHUA 4BHPA 1LHUA 4D0QA 4RQPC 2CYFA 3IMNA 3U0ZA 1CAWB 5DUVA 3P6BA 1Q8OA 3PMEA 5JOWA 4IEXA 2WQZC 1YFYA 4KWKA 2Y6GA 4FFIA 3EO6A 2CAUA 1TME3 5FPXA 4JHZA 3RNSA 4AFCA 1UXXX 1X9TA 3C3VA 4XCBA 1WMEA 2R072 1LU1A 2BW8A 5DUWA 5L9RA 1EAH1 1S0CA 1YYNA 3VBUA 1XNKA 4H3WA 4BJ0A 1V9U3 3NV4A 1NY72 4WBBA 3HBKA 3ECQA 1RMU3 1QJZA 4OHVA 3S5QA 1ODMA 2DCYA 1VE0A 2ZX0A 3JBG1 1SDWA 1K5MB 3KCXA 3NAPB 5GLWA 2R041 4CDWC 4D6SA 1XU2A 2XMLA 2OS2A 2XWJB 3NRUA 5FBZA 1PGW2 2EA7A 4IL7A 5FMDA 5A32B 5FOJB 2CWSA 2BU9A 2XJSA 5FLJA 4LHKA 1LGBA 1RXFA 3POEA 4EJRA 5IVJA 1GFF2 3V65A 3A4UA 4QX1A 1IG0A 1K5MC 1QQP3 3NSTA 3AVSA 2JIGA 1OUSA 5HCBA 1CZSA 1ND3B 1RUD1 2WLQA 4LUKA 5CFDB 3IBMA 3DYPA 2GSYA 4NIHA 4AZZA 2GC1A 3OUJA 2QQMA 1W2AX 1NLQA 4QX7A 5F6KA 1D7PM 3RVHA 1RUJ1 2BYVE 3NMBA 5C5TA 3S5AA 2HH9A 5HBAA 1QJY2 4YGEA 1HDKA 4OUMA 1REFA 5JCTA 1MVEA 4S2GA 3LIGA 2J1SA 1SPPA 2W2IA 3HWJA 3VBHA 3K51A 1RGSA 1GP5A 2W46A 3HOBA 5A7WB 1AL22 4R9CA 2DUOA 5EQUA 4UBGA 1F5JA 3WP5A 4COZA 1SG3A 4LLFA 4UW6A 5A3TA 4DZGA 2RS31 4GKXA 4CDQB 4KWUA 1UZYA 4GAZA 2Q8EA 3WNXA 2JECA 1LB2A 1O7FA 3ZPYA 4N53B 1JMUB 1WBFA 2MEV3 1MS0A 3OBRA 4Y4RA 3WW1A 3U07A 2JDAA 3ILNA 5FZHA 3OYWA 3NNMA 1UN1A 5A7SA 4CP9B 4HKWA 2FMYA 4Q8LA 3PTRB 3BTYA 4DXRA 2WS93 4IW3A 4MX3A 4GJYA 4RFT0 2VZOA 1YQ2A 2B45X 4WV8A 5JVVA 5C9AB 1TMF3 5CA6A 3VBFA 1WCKA 3ELNA 4EE2A 2P17A 1PO12 3VBSB 1UYPA 4OUSA 4OQ9A 4Q0PA 3ZMNA 5BUVA 3FZ3A 4OCTA 1J3PA 1NG0A 4EWDA 1S55A 2VBDA 5A3NA 5C4WA 2W08A 1NCRC 5I0UA 3VZJA 2OQ6A 4K1ZA 3VKLA 2X5IA 1C8M1 1J83A 2XBO3 3V0AB 2JG9A 1NKGA 4D6QA 4B4PA 3LPFA 4JGYC 3LEGA 5FIXA 5DZGA 1HV0A 2ORXA 4KGQA 2V4VA 2DDUA 4AGVA 5LBFA 4XE9A 2AUYA 3MEPA 4MGTA 2CU5A 5LEJA 1VBC3 2HWE2 1G8WA 2WQ4A 4LQRA 4Y1VA 5A6ZA 3DPRC 3D6EA 3OEBA 1WKYA 4S2HA 4YG3A 3KV6A 3ZSKA 4AVAA 4RR3C 1HRV2 3HNMA 5DDJ2 3K2OA 3PVEA 5JMOA 3VL8A 2Q8OA 3H8XA 1VBB2 1CAUA 1LTEA 4QX2A 2HWB2 5ACA3 2VVEA 1ZBE2 1QJU3 4Q4V1 1YNAA 5I0SA 3KD4A 1XSRA 1JYTA 3B3QE 2IXJA 3AKSA 2IXCA 1PM7A 1SLTA 2Y6FA 3MDPA 3WW2A 4XAEA 5D21A 1VBE3 4PLNA 3ZFGC 5JSPA 4DB5A 4AAPA 4CEYA 4I3GA 2WFF2 1BKZA 2JB4A 3PU3A 2WNEA 1JYVA 1YO8A 1PO21 1BBT1 1ULPA 2Q0AA 2AC1A 2OA2A 1WW4A 1AYM1 2WR9A 3PVOA 4R9BA 4UFLA 5DXDA 4KGGA 3SC7X 2BNOA 2ZGNA 4NHYA 4LBQB 3J8F2 3KGZA 2C4XA 1VP6A 3T09A 1YIPA 2DU1A 2KM2A 2W68A 1URXA 3HD8B 2ZCWA 4GULA 1DGRA 2KD7A 4I0BA 4XF9A 3ZIWA 2AZ5A 3HIFA 1X8EA 2J1VA 4XFBA 2FDIA 4CE8A 3ON7A 5IFTA 1DQ1A 1XQNA 3CLPA 3RYRA 1HJFA 2ZZJA 4M3CB 1QH7A 3FUQA 4C91A 3PUAA 3H8OA 3UNPA 2J7MA 2JKXA 1W8WA 4XEZA 4COVA 5FLIA 4ASLA 4JKLA 1KJLA 3WV6A 3VD3A 4YW3A 5FZFA 5CKQA 1Q56A 3O1PA 2BNMA 1UKRA 3MBWA 2DURA 2VNRA 2BDRA 1S2EA 1SDDB 4XUQA 5J09A 5K0UC 3B00A 4ZXEA 1N1TA 1Z7S2 2LS6A 3T3YA 3T1LA 4MUVA 4CU6A 3IDAA 4J25A 1GOGA 4MGQA 1R64A 2YBKA 1JUHA 1ENRA 1S0BA 4AAXA 1QXPA 1AR71 2AEYA 4OHXA 4BDVB 2R073 3FLRA 5DABA 4IV3C 1LKNA 1I9RA 3PVNA 5FMOS 5A80A 5JXJA 1AX1A 1GZCA 4N7UA 1JU3A 3BIWE 3RSJA 1S0JA 2RV9A 1XNBA 2XH6A 1H9WA 2PN5A 3TOJA 4IQPA 1Q43A 4JKMA 5LY1A 1PMIA 1I6XA 2XVLA 3CKHA 2VVDA 1YQ6A 4AHYA 4XVHA 1AR81 1DQ2A 2O14A 4GWIA 2EIEA 4AFBA 3AKTA 2BERA 4LORA 4AQTA 4CDXB 5BY5A 1BVVA 4M00A 1B35B 2Y38A 3BPZA 4C1WA 4DINB 1F8VA 1CESA 2GC2A 4QU2A 3UL2A 2XONA 5JXIA 4C0BA 1GZ9A 4YNIA 3WNKA 3KV5A 3RPQA 3D8CA 1LOAA 4XPVA 1AZDA 2Y26A 3LOIA 1CAXB 4O61A 2CHHA 4QXCA 2FDHA 3W59A 2VAUA 3IPVB 4BQ4A 2C6SA 1UMZA 3FN9A 3M3OA 3ZXDA 5FYIA 1LAJA 1R091 2Y6JA 1JOJA 1NT0A 3NV2A 2ZACA 5AFBA 2NPIA 2VUDA 3PIGA 1LRHA 1US2A 4NAMA 3JB4C 4EQVA 4AEDC 1Y3TA 5A1AA 2JG8A 3U4XA 2ID4A 1SACA 2ADDA 5HI0A 2VXRA 4AVSA 1PGL2 3OY8B 1W2NA 3IB3A 4ASKA 3R05A 4PBPA 5LK5A 1VRH2 4FPHA 5DQ0A 4QDQA 2BZDA 1VBA2 1PX3A 1M4WA 1KFUL 2IZWA 2ARXA 2DCJA 2R32A 3N9PA 1H4GA 4AHWA 5C71A 4FOQA 1RXGA 1FPN1 1OOPB 2DVAA 1RUC3 5JZGB 1PO13 1W9WA 4QPGA 3TN91 1OBNA 2HEYF 3U4SA 4QQ2A 1X82A 3T08A 4RHV2 1V6MA 2XG3A 1AUYA 1UPSA 1YQCA 3LIHA 3U14A 3I2GA 1STMA 3NQHA 4CDUA 1XPWA 2DCKA 5F39A 1DGRN 2VNVA 4FP2A 2CTVA 2UURA 3UYJA 1DLCA 4DQAA 3GJBA 1ZRIA 4O65A 4RQPA 1HIXA 1CN1A 2VZPA 5LK7B 1E5RA 2X8KA 4U36A 4BQXA 4J6GA 3FLTA 4QPIC 4CEWC 4JQRA 4A42A 1H2NA 1YUDA 1QGLA 4JDNA 1CAWA 4NN0A 3W9AA 1W6PA 2HWE3 5C6CA 5C8CB 2XJPA 5LEKA 4URAA 1TG7A 2V09A 1DIWA 1H8TB 3LFMA 3E97A 2YG0A 4RL7A 4NE9A 1R1A1 1C3HA 2VOWA 4GH4C 4QKDA 5DDJ3 3ZXEA 1ND2C 4D8MA 3VZOA 5IVVA 1G9BA 4NVPA 2QQOA 1GWLA 1O59A 4MLOA 3ST7A 4XFAA 4DXZA 5JOXA 4LITA 3B93A 4QAWA 1OPOA 5L7OC 4LA3A 4CDWA 2WWUA 3ZN6A 2P3YA 1F15A 4AEMA 2X29A 4IEOA 1UY0A 4JDOA 2OIIA 1VLNA 1NOVA 4MVTA 3MUY1 3CZUA 3SISA 4DPNA 1K5MA 3OOXA 4K8RB 1AYN3 4NWVA 5A32A 1W39A 1X33A 2WNUC 1LEDA 1ENQA 2ZGTA 2VW0A 1OH3A 3TEZA 3ZXJA 2VO5A 2ZGMA 5FYUA 4HN1A 2DBNA 2RDRA 1CPMA 2D6OX 3BU7A 4YPJA 1GV9A 4QM8A 2PHUA 5GZGA 4CTEA 4A7KA 1ND3A 3VBUB 3GYDA 4OZOA 4AFDA 5G04L 1NCQB 3J8F3 1O5UA 1LOBA 2RMU1 2P37A 1SMVA 4UXAA 4MSVA 4XAAA 1RVF2 4HK8A 3SH5A 4EZHA 4UW4A 4MGIE 1VBD2 1V00A 5AC92 1NCQC 5C3OA 2PAKA 5ERLA 5IVEA 1Q3EA 3AMPA 1G7YA 3DUIA 1XYNA 1KEXA 3HT2A 3TEYA 3LEMA 4QGMA 4Z2AA 1W90A 2YHJA 3T2PA 1ULFA 2ZEXA 1WA4A 2LUWA 5FP9A 4JTNA 3URFA 2HWD3 4FOWA 2FCVA 4QT6A 3I3EA 4QKFA 2ZX3A 3MW4A 5GZDA 2BPA2 4D6RA 1I5PA 3H1YA 5JI9A 1JU4A 4X8NA 4LKFA 1A6CA 1JUIA 5A6QA 1XC6A 4XOGA 3ZYBA 1UWWA 1Z7S3 1C1FA 2EXKA 3D0SA 4Q0QA 1B09A 4C0HA 1H2MA 1KGYA 5IK7A 2WBKA 1SPPB 3VBHB 4A6OA 1NCRA 3HMYA 4UWDA 5FR3A 3AXDA 2J1UA 1BEV2 1SCRA 1RUG1 5DZEA 4N9HA 2JENA 4JGYA 1DGWA 1F4HA 5FZAA 4FPCA 2PLV1 3D4KA 3UKNA 1LR5A 3OYWB 3B9IA 1R083 3M3CA 3A7QA 4CUBA 4UYBA 5KXCA 2WZR1 4C90A 1WMXA 1OA3A 2ZBJA 4ASMB 5HXMA 1XSQA 2V72A 3RS6A 2D98A 4RGGA 4ORFA 3VBFB 3DPRA 3BOPA 3UJQA 1H1AA 1G9FA 1PMJX 3AZVA 3DXUA 4RR3A 3CEWA 3SH3A 2B5HA 5C4WB 4NPMA 4QHBA 4OHWA 2E7QA 4HFSA 3KT4A 1PVC1 3ZSMA 2QQVA 4JTOA 2X5IB 4BYYA 3GM8A 4QD2A 5FZ4A 4M4RA 1FYUA 4FXKB 1K5JA 2JG9B 2GH8A 1RHI2 4ZU4A 4GMP1 2XOMA 2GN7A 3WD5A 2JKBA 1PX4A 4L99A 2K46A 2CGOA 1XYPA 3JCIA 1I5ZA 3MYXA 5L9BA 3WX5A 3WW3A 3RZMA 2XQXA 1RINA 2JB8A 3ZFGA 2B4KA 3WF4A 1ACCA 4Q4Y1 1UIJA 5A6XA 2MPFA 2YU2A 3AYAA 4AQSA 5HCHA 4FI9A 1POV3 2XLFA 3LSEA 4UAPA 1ENXA 1XJAA 1U5YA 5FKBA 2WAAA 1YHFA 4JRLA 4RS5C 5DAQA 1VRH3 2AYHA 1QJX3 4XURA 3L2HA 2I45A 2JDNA 2R061 4GALA 4MOAA 1W0OA 3PUSA 4LA2A 4BK5A 4H14A 3U78A 3VBRB 1AR61 2GNDA 1CAUB 2ZHKA 3O14A 3USUA 3ZO0B 2VMCA 1WW6A 4OULA 5CNAA 4E4DX 5EIYB 5FUNA 1DYOA 1QNWA 1UW8A 1V9U2 1W2UA 5J37A 1O3SA 4NRPA 3VBRC 5KXBA 1HRI3 1SFNA 1WCSA 2RM22 4FPKA 2XJRA 2ARAA 4UFMA 5FZ8A 2WRAA 2GH2A 4P9IA 4H55A 2ORZA 4P08A 1UY3A 4CEYB 3NV1A 4AK3A
chains in the Genus database with same CATH topology
4BQ5A 2KR2A 4YW6A 1UOJA 4CPBA 4BQ3A 4BQ4A 2VXJA 1W8WA 1WCUA 4LKEA 4CPBD 4LJHA 1W8ZA 4LKDA 1WZXA 4YWAA 1W90A 4YW7A 3ZYHA 4BQ2A 1OH3A 2O14A 4LK6A 2LRPA 3UT0A 1L7LA 4A6SA 2K46A 1OKOA 3ZYFA 2Q1FA 1W8UA 3F95A 1WMXA 1GWLA 4CP9B 2WYFA 4LKFA 4AL9A 4CP9A 4LK7A 1W9FA 2JWPA 3ORJA 3ZYBA 1HN0A 1V0AA 1W8TA 1GWKA 2LROA 5D21A 2C24A 1GWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQ5 A;  2KR2 A;  4YW6 A;  1UOJ A;  4CPB A;  4BQ3 A;  4BQ4 A;  2VXJ A;  1W8W A;  1WCU A;  4LKE A;  4CPB D;  4LJH A;  1W8Z A;  4LKD A;  1WZX A;  4YWA A;  1W90 A;  4YW7 A;  3ZYH A;  4BQ2 A;  1OH3 A;  2O14 A;  4LK6 A;  2LRP A;  3UT0 A;  1L7L A;  4A6S A;  2K46 A;  1OKO A;  3ZYF A;  2Q1F A;  1W8U A;  3F95 A;  1WMX A;  1GWL A;  4CP9 B;  2WYF A;  4LKF A;  4AL9 A;  4CP9 A;  4LK7 A;  1W9F A;  2JWP A;  3ORJ A;  3ZYB A;  1HN0 A;  1V0A A;  1W8T A;  1GWK A;  2LRO A;  5D21 A;  2C24 A;  1GWM A; 
#chains in the Genus database with same CATH topology
 4HSJ A;  4FTB A;  2PFW A;  2CY6 A;  1CQ9 A;  3ZFF C;  1Y7B A;  3SEP A;  1WD4 A;  1G86 A;  1T2X A;  1H4H A;  4Y1X A;  1IS4 A;  2LAL A;  1QQP 2;  3RI9 A;  1R1Z A;  4ISR A;  1C4R A;  1YI9 A;  1GZW B;  1F9K A;  4LO6 B;  2W47 A;  4AOC A;  5K0U A;  2WZ8 A;  5EXO A;  3NJX A;  2CL2 A;  4XFH A;  1H9P A;  4KG8 A;  4V2W A;  3WDW A;  3RZG A;  4YW2 A;  1CPN A;  2X09 A;  3VBO C;  5GZF A;  1O3Q A;  3EYP A;  5J36 A;  4W6Y A;  2ZMK A;  1UOF A;  4LE3 A;  2Z42 A;  3U11 A;  3VZN A;  1UPI A;  2EAL A;  3MLJ A;  1XU1 A;  4IV3 A;  1GU3 A;  2H0B A;  3LPG A;  3ORJ A;  2UYA A;  1UY2 A;  2WA3 A;  5FY1 A;  4RGA A;  4HT1 T;  1J84 A;  2A6X A;  3WY6 A;  4FSJ A;  2RDS A;  4HLT A;  2PHL A;  3N9Q A;  4HXC A;  4TWT A;  2RR1 2;  1JZ3 A;  1YRZ A;  4WVV A;  1S0D A;  4M0H A;  4NMI A;  2C9K A;  2MEV 2;  4WVW A;  1MZ6 A;  4AFM A;  4UW5 A;  2ERF A;  2DVD A;  5IWF A;  3R0R A;  3AMM A;  4GJZ A;  4XHX A;  3A21 A;  3O1T A;  3RQ0 A;  1OUR A;  2WT2 A;  3DEM A;  4YZ3 A;  1TMF 2;  5EJ3 A;  4BMB A;  2HKX A;  4AL9 A;  4PDW C;  4ERO A;  5FZC A;  5IT6 A;  3ZYP A;  3VKN A;  4Z07 A;  1IQD C;  1HN0 A;  4K3U A;  1QDC A;  3IDB B;  3OGJ A;  2O0O A;  2WQ8 A;  3IAQ A;  3POB A;  5FO8 B;  3PJQ A;  4PF1 A;  3TRS B;  1KDK A;  1QJF A;  1N3O A;  3VKM A;  5CAD A;  4AHZ A;  1RVF 3;  2R0H A;  2RS1 2;  3W21 A;  1ULG A;  4AED A;  1JOP A;  1D4M 3;  3SKJ E;  3A23 A;  4V2V A;  2CWM A;  2IC1 A;  1DLL A;  3H42 B;  4AVT A;  4XJA A;  4QB1 A;  3FE5 A;  1QJY 1;  3F2Z A;  1VMH A;  4IE6 A;  4BM8 A;  3LA3 A;  1I1E A;  2VR4 A;  1TE1 B;  1IS3 A;  1HB3 A;  2ZEW A;  3MLK A;  1CX4 A;  4XQ4 A;  1E5H A;  4Y33 A;  1W9F A;  1YQ8 A;  1S0E A;  3LEK A;  4BK4 A;  1AL2 1;  1QOS A;  3K4D A;  2W1W A;  2Y8K A;  3SCG A;  1HKD A;  3ES4 A;  3O1U A;  1H6Y A;  2W9X A;  5KXE A;  2F4L A;  3TNQ A;  2ZAA A;  3NKG A;  5BV6 A;  3N36 A;  3N9N A;  3C2U A;  5JI7 A;  4PIY A;  4Y5Z 0;  3APB A;  5BNQ A;  1CAV A;  5ACA 2;  2YGL A;  4HMZ A;  5BYN A;  5CYY A;  2LRP A;  2VPV A;  2JG8 B;  1N1Y A;  4LHS A;  1KDM A;  5FP8 A;  4ES8 A;  4TLF A;  4KU8 A;  3J7L A;  4BB3 A;  2K2S A;  3ZXA C;  1IQA A;  4CCK A;  1F31 A;  1LGC A;  2N7G A;  3KV9 A;  4LOT A;  4M01 A;  3ZXK A;  2QUO A;  4LO5 B;  1OMI A;  1EPZ A;  4XDP A;  4QPI A;  5LY2 A;  4CEW A;  2FDF A;  3IMM A;  4QM9 A;  3G7D A;  5A3O A;  5FO9 B;  1IPJ A;  2A73 B;  4BQ3 A;  4F8A A;  4QPG B;  2UY9 A;  4FXG B;  1K45 A;  3JU9 A;  4Q4X 2;  3S7I A;  4QKN A;  4GH4 A;  1YJK A;  1ALY A;  1ND2 A;  3WW4 A;  1OLR A;  4PLO A;  5FBJ A;  1ZRF A;  2A3Y A;  4QU1 A;  3ACL A;  3U1X A;  4KMQ A;  1RL3 A;  2ZX2 A;  3LDR A;  5L7O A;  5DN2 A;  1REE A;  4CDU B;  4GB3 1;  4RSU A;  5GJ6 A;  5CKM A;  2YZ4 A;  1RHI 3;  5DUX A;  4PHZ A;  4RQP B;  2D6K A;  2CDO A;  2D7F A;  3OSD A;  4HON A;  4QHZ A;  1COV 2;  1ASJ 1;  3KCC A;  2FBE A;  2YXS A;  4FOY A;  1NXD 1;  5FOB B;  2VME A;  2B42 B;  1RUF 2;  3AB0 A;  5DDJ 1;  1HRV 1;  3PL0 A;  4IV1 B;  2WNU A;  5FMC A;  5H9P A;  4QDR A;  4ZON A;  1W6P B;  4ZS2 A;  3UGG A;  2A71 A;  4XFI A;  1VBB 1;  2D5H A;  3CMG A;  1KJR A;  4I3P A;  1OC1 A;  2HWB 1;  4AE2 A;  1ZBE 1;  2QBX A;  1AR9 2;  4IV1 C;  4O7X A;  3POF A;  4DUW A;  4BIF A;  1MQT C;  3DKW A;  1J3Q A;  4B7K A;  4CYD A;  3VLB B;  2E7A A;  1ONA A;  4MXW A;  2VZT A;  5GLT A;  2QQL A;  4SBV A;  2WYF A;  1SCS A;  2A70 A;  5T5L A;  4CDW B;  3ZN6 B;  3HJR A;  2WFF 1;  4C8D A;  3A0K A;  4PIZ A;  1NCQ A;  1NXM A;  3H3L A;  5FXV A;  2VJX A;  3S30 A;  4XF0 A;  3M4F A;  4CCM A;  3ZMO A;  1ST8 A;  2RM2 3;  4CCL A;  3BI3 A;  2UWC A;  4XF4 A;  2UU8 A;  4XUN A;  3CDZ B;  3WQ0 A;  4KQ7 A;  2QQI A;  1JYX A;  1WUV A;  4L92 A;  2ZGK A;  4P14 A;  3FFZ A;  4YAR A;  1SLA A;  3CIH A;  1VAM A;  3PUH A;  1ZA7 A;  3AP7 A;  3QAC A;  2PYT A;  1IKQ A;  2C26 A;  2DWR A;  4CA9 A;  2OZJ A;  1QOO A;  4XF3 A;  1A34 A;  1HN1 A;  5FKC A;  1F35 A;  2GC3 A;  3GNE A;  2I07 B;  3ZYJ B;  5I8S A;  2B8M A;  2V5D A;  2NZ9 A;  2IXH A;  5EPA A;  5A70 A;  1H30 A;  1DBN A;  4BLJ A;  2CV6 A;  4BXS V;  1K42 A;  4A4A A;  4MGK E;  1GNY A;  2BWC A;  2EVX A;  1XYO A;  3T30 A;  4QPY A;  1YJL A;  3S7E A;  5IAX A;  4BQ1 A;  3K4Z A;  3O5S A;  2GP3 A;  2JE8 A;  3AYD A;  4QQH A;  2JDH A;  2B39 A;  3ZYH A;  5KHG A;  4XJU A;  3KLS A;  2RR1 3;  3FUO A;  5J48 A;  1PNG A;  2ZAH A;  2XVK A;  2QQU A;  3OBT A;  1DYP A;  3RJR A;  5BNO C;  3I54 A;  3VHO A;  4PLM A;  1X7N A;  3WXP A;  4GMP 0;  2XHN A;  3BIE A;  1OA2 A;  2NLR A;  4B4Q A;  5I8T A;  1IHM A;  2BJS A;  1EV1 2;  5IUQ A;  3GBF A;  1GWM A;  1LGN A;  2HLE A;  1NCR B;  1FI2 A;  1RUC 2;  1WLT A;  2JIC A;  2WLP A;  3AKP A;  4FAH A;  1BK0 A;  1W04 A;  1LOE A;  4XBQ A;  4JGY B;  4K7J A;  5H9Q A;  4XUO A;  3JD7 3;  5LA9 A;  4MV2 A;  5JLV A;  4YZ1 A;  4HSL A;  4E2G A;  2RS1 3;  2BGO A;  2DV9 A;  1OQE A;  1G9C A;  2Q30 A;  5FYC A;  2VZV A;  5KXD A;  3AFG A;  4R8H A;  4XXP A;  4LBK A;  4M0N A;  3DPR B;  4RS5 A;  1GNZ A;  4N43 C;  2VQT A;  1RTV A;  3AVR A;  3BU0 A;  1S0I A;  4IGO A;  2BFU S;  1OF4 A;  4RR3 B;  4FFF A;  1BVP 1;  3NNJ A;  3N3H A;  3MIC A;  3W5N A;  4W6X A;  1LOC A;  2WO7 A;  4MGY E;  4OI4 A;  3ZYG A;  4ZXK A;  2QQK A;  3T2Q A;  5L19 A;  2VCM A;  4DRV A;  4L0P A;  4LK6 A;  4MHR A;  4XIK A;  5IVF A;  1PGL 1;  1QU0 A;  3MF9 A;  4OI1 A;  3NKT A;  3VBR A;  4AVV A;  5FP4 A;  2P3K A;  2PA7 A;  2UWB A;  4V1P A;  4XET A;  4Y3O A;  5FUI A;  4KBZ A;  3ZFG B;  1UMI A;  2CSG A;  4DRR A;  4XBL A;  1VBA 1;  5FYH A;  5FMO L;  4MHU A;  1JOD A;  5LAS A;  3I2F A;  1AXK A;  4K40 A;  4QX3 A;  1UCX A;  4WVZ A;  4ZU7 A;  4R4Z A;  1AYN 2;  4JVA A;  4E2S A;  1HB4 A;  5T5J A;  5E8A A;  3T0A A;  3GDB A;  2ATF A;  5FPV A;  4RHV 1;  4EN8 B;  1D0G A;  4LKE A;  3TEW A;  4Y24 A;  1S0F A;  3EXU A;  3ROU A;  3QCW A;  4YWA A;  4HL0 A;  2AR6 A;  3D5O A;  3USU B;  3VBO A;  4BWO A;  4UF0 A;  1W8F A;  1GZW A;  2QDR A;  3B9C A;  4LR4 A;  1W8H A;  4OYU A;  5F5A A;  1NZI A;  5JDB A;  2FDG A;  3HNB M;  5I0R A;  4YGC A;  2ZTN A;  2HBT A;  3VD9 A;  4Q4X 3;  1QXR A;  4CXX A;  2JX9 A;  5FXW A;  5JOZ A;  1DQ0 A;  1PIV 1;  2K0G A;  5H9S A;  4FQ4 A;  5A3L A;  2YBS A;  5I0D A;  2JE7 A;  1CX1 A;  1RUI 1;  2B9V A;  4Q29 A;  5FZM A;  3WLU A;  4KBB A;  4X8P A;  2ARC A;  2LRO A;  2QQN A;  1UIK A;  4ARX A;  5K4L A;  3W5M A;  1QH6 A;  4XUT A;  1MEC 1;  3AP6 A;  2WT0 A;  4NOT A;  1COV 3;  2QZ3 A;  3JBG 2;  3RYP A;  3W58 A;  5FPU A;  4RYD A;  2HWD 2;  2R04 2;  1RUF 3;  3VHP A;  5K0U B;  5LRS A;  2QJV A;  5F3I A;  2IVI B;  1DFQ A;  3NVC A;  1FAY A;  4I30 A;  2HBU A;  1BMV 2;  1JH5 A;  2QZ2 A;  3I3B A;  4PDW A;  3TWI A;  1OUX A;  2VZ3 A;  4NUB A;  4AQ2 A;  4OHZ A;  1AR9 3;  3FMG A;  4U2A A;  4IV3 B;  1CIY A;  1RUD 2;  2I74 A;  2WDB A;  1U5Z A;  3MF6 A;  4IES A;  4CP2 A;  2WZP P;  3KVB A;  1OSG A;  4B7E A;  2XJV A;  1YIF A;  2VE1 A;  4XJW A;  3WIN E;  2BQP A;  5FZG A;  5KC5 A;  3B02 A;  3RFR A;  3KMH A;  4LBM A;  5FPB A;  1AJO A;  1ZRC A;  5LAT A;  3A0N A;  3OF1 A;  3WG2 A;  1YI7 A;  4Q1R A;  1GQP A;  1FV2 A;  1R08 2;  2VUJ A;  3FC0 A;  3AZY A;  1D0H A;  2UYB A;  4GXL A;  3CJI C;  5FY5 A;  4OMD A;  3I49 A;  3KS7 A;  4B1M A;  2EF6 A;  5EZW A;  4E8C A;  4Q4W 3;  3X29 B;  1V6N A;  3KM5 A;  2D44 A;  3ALQ A;  1ZRR A;  1VBD 1;  2TEP A;  2GNT A;  3L2Y A;  1SBE A;  2A1X A;  5D2A A;  3T2T A;  5AC9 1;  3VDD C;  3I4I A;  3WQ7 A;  3D0J A;  2GMM A;  4ZKT B;  2PTM A;  2IFR A;  2GAU A;  1OLM E;  4IE5 A;  2YBP A;  4Q0S A;  2Y6L A;  3FHA A;  1GQG A;  3O0X A;  4AHX A;  3H50 A;  2VH9 A;  2ZGP A;  2RE9 A;  3IZO A;  4H2A A;  5D8A C;  2E31 A;  1ZBA 1;  2RVA A;  2Q5T A;  4AED B;  2A6W A;  3KHC A;  5FXX A;  4LHL A;  2ZA9 A;  2OYZ A;  3WT3 A;  2VZS A;  2ZGR A;  4Y26 A;  1H8V A;  3C7E A;  1BQP A;  1SZB A;  2Y33 A;  1Q8V A;  1AF9 A;  1C8M 2;  2P6C A;  2F17 A;  4JQT A;  1BZW A;  1E5I A;  3K3O A;  4FPO B;  3H8R A;  1LHV A;  1IPK A;  5F3E A;  1S2K A;  4OZX A;  2GN3 A;  4N9I A;  4KNC A;  1IG3 A;  1QJX 2;  1L7R A;  1KQR A;  4XW3 A;  1ZM1 A;  3BTX A;  2YFU A;  1BEV 1;  3IIA A;  2VQU A;  5FZ6 A;  2VVF A;  4BQ5 A;  5ABJ C;  4LUL A;  1EY2 A;  4I0A A;  4XIL A;  3H0O A;  2RS5 1;  3SEE A;  2ILM A;  2RDQ A;  3H9A A;  5IAT A;  1EV1 3;  5JSO A;  2VTF A;  1V6O A;  4Z2W A;  1CAV B;  3T0B A;  3BOW A;  4MXV A;  4AG4 A;  1C28 A;  2FCU A;  4MAD A;  1NA1 C;  4Y4Y A;  3WNP A;  1RUO A;  2VY0 A;  1HRI 2;  2E51 A;  1KS5 A;  4QXH A;  1HXS 3;  5T52 A;  1W0P A;  2W5F A;  3IDC B;  3TAY A;  5F3G A;  4BLI A;  3PUI A;  1OKO A;  2A6Y A;  4CCO A;  2WO3 A;  1UX7 A;  5C3R A;  5EJ1 B;  3OD4 A;  5IW0 A;  5FY8 A;  5BNN C;  1CZT A;  2W92 A;  4QPI B;  4CEW B;  1G6N A;  2P6H A;  4Q4V 2;  4COW A;  3LCP A;  1GWK A;  4FFG A;  2HWF 1;  2ES3 A;  2C24 A;  3U10 A;  2BGC A;  1W3V A;  2HWC 3;  2WUH A;  5FRE A;  1W6M A;  3WNN A;  3THP A;  4COY A;  1XND A;  1OQ1 A;  3KB5 A;  4YVS C;  4IV1 A;  2BVV A;  4E2Q A;  1KIT A;  5E1R A;  4GH4 B;  5F9T A;  1ND2 B;  4YYO A;  4IEV A;  3ZX7 A;  1RUE 3;  3FBY A;  4J1X A;  1PO2 2;  1BBT 2;  5CU1 A;  3WG3 A;  3I3D A;  1AYM 2;  3NWK A;  5L7O B;  5AFE A;  3C7O A;  4XBN A;  4TTG A;  1RUH 3;  5CEH A;  2EXI A;  2YRO A;  2JDY A;  3J7M A;  4G9S B;  1CJD A;  3A22 A;  1GIC A;  3ZYR A;  3WG4 A;  3R4S A;  3CHX A;  1VJ2 A;  2J22 A;  1CGP A;  1HB2 A;  1TME 1;  4NRQ A;  1UYZ A;  3OGV A;  2WNU B;  3ZOI A;  3OBZ A;  3J9S A;  1ZZC A;  3ABZ A;  3WF0 A;  1J1T A;  2Y0I A;  1BCX A;  5F2W A;  2IXL A;  1HJG A;  1C57 A;  1JHJ A;  2YC4 A;  4LJH A;  1MS8 A;  3T4V A;  3ZN4 A;  3VZK A;  4LIU A;  1V9U 1;  4YW7 A;  4AGG A;  3KWV A;  2SLI A;  1RMU 1;  2JE9 A;  2Z79 A;  4EZ4 A;  1LJ7 A;  4GZ9 A;  2C5D A;  4XMI A;  1WLW A;  4MXW B;  3Q8F A;  4TSV A;  4AXO A;  5IVC A;  1UZV A;  3BOD A;  3ZFE C;  3J7N A;  1OVP A;  4MYE A;  4FP3 A;  2XKO A;  4JAA A;  2CAV A;  3VUO A;  2JDZ A;  1H2K A;  2E6V A;  4LOS A;  4F7Z A;  4JGZ C;  2XPJ A;  3JQX A;  5JXG A;  2H6C A;  3UKV A;  3VL9 A;  3LZZ A;  5FP7 A;  1VIW B;  1QQP 1;  2OW4 A;  4MO3 M;  4WVM A;  1LOF C;  4LBO A;  4XYX A;  3LGR A;  3I3Q A;  1AR7 2;  5CG8 A;  3POW A;  1EUT A;  4HVQ A;  3M1H A;  2ZKL A;  1BK1 A;  2HYX A;  4RD7 A;  3KGL A;  5DAW A;  5E88 A;  1D4M 2;  1EAH 3;  3CQO A;  3I2H A;  4OFG A;  5K7P A;  3CBN A;  4LBN A;  1MS4 A;  2G4I A;  2HEW F;  3POY A;  1A8D A;  3CJX A;  5BNO A;  4O9E A;  4H7L A;  3PVB B;  1VMJ A;  2F4P A;  3JBG 3;  4CRQ A;  4CUC A;  2WAO A;  2V4A A;  1QF3 A;  2R04 3;  2Z4F A;  3KSC A;  1AR8 2;  2RDN A;  4CU9 A;  2FD8 A;  4I2O A;  3AP4 A;  5JSR A;  2VMD A;  3VDA A;  1W0N A;  4LK7 A;  5C3P A;  5FDB A;  1LCL A;  1SEF A;  1MZ5 A;  5T5O A;  4P5Y A;  5DAV A;  1QWR A;  4OI2 A;  4WM8 C;  4L97 A;  4B8E A;  1HV1 A;  1RUD 3;  2MEV 1;  5FZI A;  2A6Z A;  2W1S A;  2QTW B;  4P9X A;  2QE3 A;  5FZ1 A;  3O1R A;  4N7I A;  1GSL A;  2WNV C;  2YDE A;  1ZYB A;  4JDM A;  1RUJ 3;  4NRO A;  5HV4 A;  1CWP A;  1FV3 A;  1H1I A;  2WS9 1;  1TMF 1;  2IWG B;  3SQO A;  1C5H A;  2J42 A;  3CF6 E;  1HB1 A;  2AAC A;  4B3N A;  2EXJ A;  1WD3 A;  4N43 A;  1SBD A;  1ULE A;  2ZMN A;  3EHK A;  2BRT A;  2PHT A;  2FDJ A;  3OUH A;  2RS3 3;  5FK7 A;  2WYS A;  1A3K A;  1UQX A;  2DFB A;  2W1U A;  3JZV A;  3MUZ 1;  3R4U A;  4DXT A;  4PIX A;  3E1F 1;  2XBO 1;  2XUE A;  5JMC A;  4AI1 A;  1QHD A;  5CIR A;  1GOH A;  3GXU A;  1DU3 D;  1UYX A;  4JX0 A;  2NQY A;  1K3I A;  1QJE A;  4HN0 A;  5GZC A;  4AWD A;  5EWS A;  1DHK B;  1PK6 C;  2G9G A;  5EFU A;  5GZE A;  1FPN 2;  2DCZ A;  5BPX A;  3U75 A;  2PEL A;  3KVA A;  2R0F A;  5B2G B;  4FPG A;  1TQ5 A;  4DOU A;  1VBC 1;  5GKA C;  5FZD A;  1DZT A;  1GR3 A;  1W2T A;  2ZGS A;  3FFQ A;  1EP0 A;  3POJ A;  1SLB A;  1UZW A;  2D6L X;  3B7M A;  1W99 A;  2WN3 A;  4RS5 B;  5IFP A;  4RFR B;  2XWB B;  2FZ1 A;  3IT8 A;  1C8M 3;  4EN7 B;  2BWA A;  3K3N A;  1JTZ X;  3HAG A;  4QWN A;  4DFS A;  3WP4 A;  4YM0 A;  4BQW A;  4DNY A;  5ACA 1;  4AI8 A;  4PQQ A;  3BTZ A;  1VB2 A;  1QJU 1;  2ET7 A;  4LXL A;  4XTM A;  2HJI A;  1O5L A;  1DQ4 A;  1XE7 A;  5BXX A;  2WZE A;  2R49 A;  2ZHM A;  4HVO A;  4ISQ A;  4YFZ A;  4EWA A;  5CFC C;  1WCD J;  5KHJ A;  1IS5 A;  1NAE A;  1LUL A;  3AM2 A;  4XAB A;  3RGB A;  3VZL A;  1VBE 1;  3TBD A;  3MGU A;  2GP5 A;  4QKB A;  5LBB A;  4Z8B A;  2QCS B;  4GWJ A;  4LO8 A;  3WEZ A;  2WN2 A;  2C0Z A;  1R1A 2;  3F95 A;  4IET A;  1UXZ A;  1YFX A;  1DZQ A;  3AK0 A;  3ZFF B;  4FTE A;  4YLZ A;  5T3N A;  1S2B A;  2ZX1 A;  4G4F A;  1OI6 A;  2RJ2 A;  2LM3 A;  4LPL A;  3TB0 A;  1PGS A;  1SLL A;  4BH9 A;  3N7K A;  4YW6 A;  1TZO A;  1LHW A;  1N1V A;  1IS6 A;  3AKR A;  4Q4V 3;  4IEP A;  4NID A;  5FO7 B;  3MPB A;  1AXY A;  4Y22 A;  4MG2 A;  3VGI A;  2JD4 A;  3VBO B;  4UF0 B;  3E5U A;  3H8U A;  1JXN A;  1NLS A;  3ZKY A;  1DF0 A;  1I3H A;  2WWJ A;  1OH4 A;  1F4A A;  3HEI A;  4COU A;  1S1A A;  1MAC A;  1PO2 3;  1BBT 3;  4XUP A;  1AYM 3;  3WDX A;  5FZK A;  1ZZ7 A;  3MI8 A;  4PCR A;  2DVB A;  3FBM A;  4XIO A;  3N9L A;  4O9G A;  3JUU A;  3NJZ A;  4FPF A;  1DZR A;  4YVW C;  4UI9 L;  2VOK A;  2R1D A;  4YSF A;  1KRI A;  4E27 A;  4UFH A;  4I02 A;  1O6U A;  2WII B;  4MH0 E;  1GNH A;  2PQS A;  4WM7 C;  3CJI A;  4A3Z A;  2DTW A;  5HCF A;  4FBF A;  2R07 1;  2WFP A;  2EID A;  4K21 A;  5A7O A;  4PDW B;  5FMB A;  1Q8S A;  4Q2F A;  4AI0 A;  2GME A;  3PMS A;  2QQP A;  4LBQ D;  2J1R A;  1OA4 A;  4P9L A;  3VDD A;  2G9F A;  3HPN A;  1NY7 1;  2YPJ A;  1NE6 A;  2R16 A;  4JC1 A;  1ZA4 A;  4PI2 A;  3RZZ A;  3OGS A;  2BOJ A;  3E5Q A;  4HOO A;  2LTN A;  4ZZ5 A;  5FPZ A;  2VM9 A;  3G6J B;  4H7M A;  2VC9 A;  1PGW 1;  4JHT A;  1W6N A;  4HKO A;  5D8A A;  2XQR A;  3Q9O A;  2WAB A;  4QXB A;  5FZE A;  2DVG A;  4BE3 A;  3B69 A;  1Q8Q A;  3JD7 2;  4IER A;  4Q8K A;  4DUV A;  1CZV A;  3GBW A;  5JWP A;  5CVR A;  2Y6H A;  4M3C E;  3SHR A;  2P5B A;  1JS9 A;  1AR7 3;  2NYY A;  3LB9 A;  1BYH A;  4D69 A;  2Y64 A;  5FY4 A;  1IOA A;  2EIG A;  2OXB A;  3DCQ A;  4I01 A;  1ZNP A;  3JXS A;  4C1X A;  5I93 A;  2GNB A;  3AYE A;  3SCF A;  5KR7 A;  3ZLI A;  3KZ4 C;  3K46 A;  1Y9M A;  3POS A;  2OUH A;  2PLV 2;  3O1O A;  4CCC A;  3RZJ A;  5AVP A;  5F37 A;  1YFU A;  4S2F A;  2QVS B;  3LQC A;  2E53 A;  5ABJ A;  4YZ5 A;  1AR8 3;  2CDP A;  4EYU A;  3S0M A;  4XHB A;  3FHQ A;  3M3I A;  4XZU G;  3NNL A;  1KS4 A;  4UFI A;  2J1T A;  3AFK A;  1W9Y A;  2Q8D A;  1O8S A;  1U5X A;  3CZJ A;  1TVG A;  2GDF A;  1NA1 A;  2XUM A;  4QPW A;  4HKL A;  1WCU A;  2VMI A;  2E63 A;  4EN6 B;  3AL6 A;  4XFC A;  1W8O A;  3POI A;  1W6O B;  1CON A;  1PVC 2;  2O8Q A;  3C7G A;  4F83 A;  3POG A;  5CBL A;  4PJY A;  1S4C A;  2WJS A;  4JZR A;  5FTT C;  5BNN A;  1CIW A;  3ZYF A;  3K48 A;  3HT1 A;  3DGT A;  3AC0 A;  2ZAB A;  4LLO A;  3QLQ A;  5FLH A;  5BNP C;  1RUC 1;  4BME A;  4LO7 A;  1PO1 1;  1R09 3;  3O7O A;  3DL3 A;  5HCA A;  1X9P A;  1C8N A;  4A7Y A;  1XBF A;  4YVS A;  4Q4Y 2;  3SIT A;  4AR2 A;  4FAG A;  4P9G A;  3GHM A;  1WBL A;  3OUI A;  4YGD A;  1LEC A;  2D6P A;  2P34 A;  2B9U A;  2DUP A;  2VZR A;  1LES A;  3J4U H;  3M3Q A;  4YFW A;  1WLC A;  3K75 B;  2R06 2;  4AF9 A;  5J98 B;  1AR6 2;  2OZ6 A;  4AVB A;  2JD9 A;  3PTY A;  1FPN 3;  4AI3 A;  3ZN5 A;  1FOD 2;  1O8P A;  2XDV A;  3LFI A;  2HWE 1;  3PIJ A;  4Q5O A;  3TN9 3;  1XRU A;  5FZL A;  4Y20 A;  5FZO A;  2VTX J;  2CNA A;  3I2J A;  4CU8 A;  2DVF A;  2V73 A;  3M3E A;  1W6M B;  3FLP A;  5CAZ A;  3RZL A;  4CUG A;  5FYV A;  2B7Y A;  2YB7 A;  3OTF A;  5FK8 A;  2UY8 A;  4IXL A;  5ANQ A;  4ITC A;  3EMR A;  3V64 A;  4BZ4 A;  4Q27 A;  1MQT B;  3GHN A;  3H1W A;  4LKD A;  1ZZB A;  1T6G C;  1WWY A;  4GWN A;  5FYT A;  3ZFE A;  3VD4 A;  5DG2 A;  3UKT A;  1GQH A;  1XXN A;  4JGZ A;  2E33 A;  2XLA A;  1VAK A;  3MZH A;  1SBF A;  4Y5T A;  1XE8 A;  4FCA A;  1AYN 1;  3SCH A;  1LOF A;  3SNM A;  3U37 A;  4AGR A;  4YZ4 A;  3O1S A;  2VUC A;  5F8P A;  1W8N A;  1V6K A;  2D3R A;  2Z5W A;  3TEX A;  3O0V A;  4IGQ A;  3OGR A;  4NAO A;  1ZRD A;  1R1A 3;  1L7Q A;  3GGL A;  4CUA A;  5F32 A;  1NX9 A;  3NJV A;  5KBF A;  3LE0 A;  4HG6 B;  1O3R A;  3PUQ A;  2Y60 A;  5FP3 A;  2Z2S B;  3H3Z A;  1JYW A;  5H9R A;  5LCW L;  2J1E A;  2FZ2 A;  3MW3 A;  4LUM A;  4E4S A;  3J8F 1;  2VBP A;  3O0W A;  4YW1 A;  1A78 A;  4RA0 A;  4LBJ A;  4Q4W 2;  1JZ7 A;  1UNB A;  2VTX A;  3JB8 A;  3BGA A;  1BJQ A;  4UW3 A;  5IAV A;  2X05 A;  3O1M A;  3R6S A;  3NJY A;  2A3W A;  1RIR A;  1UO9 A;  5A3P A;  2VUA A;  3OD0 A;  4CCN A;  2PXJ A;  4I09 A;  2YC0 A;  2BFU L;  3NW4 A;  5SV5 A;  4Q1P A;  1OFS A;  4WM8 A;  3ZDS A;  1AJK A;  3IM0 A;  2A75 A;  3ETQ A;  2A6V A;  4FT8 A;  3SMH A;  4WVM B;  5JIU A;  4KI5 M;  5CIS A;  3WF3 A;  3NNF A;  4QHO A;  4OQ8 A;  2HWD 1;  2WNV A;  5A3M A;  2W39 A;  1IZ3 A;  5A7P A;  1YFW A;  1VRB A;  2FCT A;  2HEV F;  2JDM A;  4HPK B;  1TNR A;  2BGP A;  3IDE A;  1OXC A;  4L8Q A;  4ZU5 A;  4DS0 A;  1OT5 A;  1JYN A;  1W28 A;  1BMV 1;  5F6L B;  1WMD A;  3KQ4 B;  3M8L A;  4D3W A;  5BNO B;  3I2D A;  1OHF A;  2RMU 3;  3NAP C;  5IJR A;  1Z7S 1;  4ZHN A;  4BQ2 A;  3J26 N;  1O4T A;  5FFO C;  2H6B A;  4YG0 A;  1UOG A;  4XDO A;  5LBC A;  3UV9 A;  2G19 A;  2IUW A;  4UOJ A;  5C3S A;  4BQY A;  5LA0 A;  3AMQ A;  3H3U A;  1UZ0 A;  4F3J A;  1WW5 A;  4LEJ A;  4LMF A;  3ZXF A;  2YC2 A;  4IEY A;  1NQD A;  5FAX A;  4I0W B;  1GUI A;  2SBA A;  1ND3 C;  5CFD C;  4CVU A;  1N1S A;  3AKQ A;  3LWC A;  3INA A;  1RED A;  4NWW A;  3J7H A;  5FZ3 A;  3RMX A;  5GLV A;  2WIN B;  2J1A A;  1R08 1;  2YY1 A;  3I97 A;  3WDY A;  1PK6 A;  1LHN A;  3AJY A;  4PF5 A;  4GIQ A;  3MID A;  4NHK A;  1HXS 2;  3VD7 A;  1RB8 G;  4FTS A;  2R7E B;  1JYC A;  2XL9 A;  1FNZ A;  3SKV A;  3EBR A;  3S57 A;  2OPK A;  1AHS A;  3ZIX A;  4N43 B;  1FAT A;  1DCS A;  1EPW A;  1Q5O A;  1IPS A;  1ULO A;  2D6M A;  3AYC A;  4AEK A;  4CDQ C;  2YUE A;  5FQ0 A;  4G3Y C;  4ZPI A;  1LNS A;  2ZGQ A;  3BAL A;  3OPW A;  3FL7 A;  5LRR A;  3WZ1 A;  1NLR A;  2ZKN A;  4N53 C;  1RUG 3;  2HWC 2;  3RRD A;  2R6Q A;  3ILF A;  3HN1 A;  1TEI A;  4JKK A;  1POQ A;  2Y34 A;  4NR1 A;  4ZS3 A;  4A45 A;  2PLV 3;  1A8M A;  3AP9 A;  2WA4 A;  5CKN A;  2ZHN A;  1UOJ A;  4YW5 A;  1VR3 A;  2ADE A;  3KHB A;  2O1Q A;  3PDQ A;  1RUE 2;  4FOV A;  5C9A C;  2WZR 3;  5CFC A;  4TLG A;  3RMY A;  4EN9 B;  2TNF A;  4QQO A;  1UY4 A;  2BBA A;  2X10 A;  5GLZ A;  3VBS C;  1PNF A;  1RUH 2;  1UZZ A;  4XQD A;  2RG4 A;  1POV 1;  1UKG A;  3ZXG A;  3I3M A;  2ZEY A;  4QX8 A;  3UGF A;  5A3U A;  4AQ6 A;  2GMP A;  2ZX4 A;  2QQW A;  2A3X A;  5A6Y A;  2VBB A;  1HLC A;  1VRH 1;  1KD7 A;  1QJX 1;  2VW1 A;  4HBN A;  1CVN A;  2YFZ A;  1PVC 3;  5LWB A;  4QX0 A;  2D3S A;  3N9M A;  3WNL A;  1IKP A;  4GB3 2;  1F2N A;  5FPL A;  2QNK A;  4GD4 A;  1N47 A;  1GBG A;  1YLL A;  4GMP 3;  1GOF A;  4X6R B;  3ZFF A;  5EYX A;  3T2O A;  4CXW A;  3NO8 A;  1ASJ 2;  1FMD 2;  3Q8B A;  3WUC A;  2Y0O A;  1JZ8 A;  1KXG A;  2GC0 A;  4N90 A;  4Z1V A;  1HQL A;  3ATG A;  1HRI 1;  3P5B A;  3I2O A;  1OD3 A;  3BN6 A;  4Q4Y 3;  4LT5 A;  1MS3 A;  2VL4 A;  2VOV A;  1MPX A;  1SQ4 A;  4PI0 A;  3UES A;  1GYK A;  1HW5 A;  4UBH A;  4XAC A;  5HXV A;  1ODN A;  2OPW A;  3BVC A;  4RGK A;  3E6D A;  2GAL A;  4K8F A;  4Y1Y A;  5G05 L;  4L11 A;  4ZZ8 A;  5M0T A;  4IEU A;  2BV4 A;  1UU6 A;  2R06 3;  5JXH A;  3M2M A;  3MHZ A;  5FJK A;  5L9V A;  4CXY A;  1W3X A;  1LEN A;  3HNY M;  3IAP A;  4WZC A;  5LW9 A;  4FQZ A;  4YVW A;  1AR6 3;  2ZOE B;  1EAH 2;  1K12 A;  3MFC A;  1BXH A;  1FOD 3;  4WM7 A;  1O3T A;  1AX0 A;  3OPT A;  1OLQ A;  3BCW A;  2VCA A;  5F2S A;  1UL9 A;  4CPB A;  5C5U A;  3ACG A;  3VDC A;  2VNG A;  5EP9 A;  5T54 A;  4Y22 B;  5IHR A;  3LOB A;  2QQJ A;  1JYI A;  3CU7 A;  1W8Z A;  2AH2 A;  2ZZQ A;  4BOW A;  1UF2 C;  3RWK X;  4YM1 A;  2DFC A;  3JQW A;  5FCC A;  4ARY A;  4NO4 A;  3RZK A;  3VD5 A;  4X6Q B;  2YYO A;  2ZS6 B;  5IK8 A;  4FVV A;  4OMC A;  4W4Z A;  4DY5 A;  2XL7 A;  2Q1F A;  2KA3 A;  5IYY A;  3WG1 A;  4LTA A;  2G1M A;  1U0A A;  2GNM A;  1OLM A;  2JWP A;  2WSU A;  2VMH A;  1UD1 A;  2JJ6 A;  4GWM A;  1YEW A;  4P9J A;  1RUJ 2;  5ISL A;  4XJ8 A;  2D97 A;  2WO1 A;  3ENR A;  3GAL A;  3CJI B;  1CD3 G;  1XNA A;  5I8Y A;  4A41 A;  2VUL A;  1GLH A;  4MGZ E;  4UT5 A;  2BOI A;  2D6N A;  4CPB D;  3B5L B;  3C7H A;  4D7Y A;  5IK5 A;  1JW6 A;  4OVE A;  2DF7 A;  5E89 A;  1VB4 A;  4IEZ A;  3WHT A;  2PHW A;  1AVB A;  4E4Z A;  1OD5 A;  5L36 A;  1S0G A;  1JZ6 A;  4OUE A;  3VDD B;  4EWE A;  2RS3 2;  4KU7 A;  5FYM A;  2VCC A;  1DGL A;  5D1I A;  5GM0 A;  2P3I A;  4OLL A;  2BTV C;  1KFX L;  1RVF 1;  2DBI A;  1RYY A;  2IXI A;  2VMF A;  4LNV A;  2VD7 A;  1W6Q B;  3N7M A;  3DEC A;  2JXA A;  1W9S A;  1YC6 1;  1JZ2 A;  1VMF A;  1W6N B;  2AEZ A;  1D4M 1;  2W3J A;  3BYW A;  4MET A;  4W6W A;  5D8A B;  4GA9 A;  4JCK A;  2XR4 A;  1JBC A;  3AXE A;  5KHH A;  3K77 A;  1DQ5 A;  5CB7 A;  2PHX A;  3HQX A;  4KG0 A;  1DQ6 A;  5CG9 A;  2W52 A;  3BB6 A;  1UOB A;  2GU9 A;  5E16 A;  3VDB A;  1E5S A;  3WSO A;  4AEJ A;  3DKQ A;  4P5H A;  3KCY A;  1Y9Q A;  4HAN A;  2P1B A;  4NHM A;  3MLL A;  5DG1 A;  4R4X A;  3UT0 A;  2AEN A;  3I7D A;  3OGG A;  2PAM A;  1W6O A;  3HN3 A;  5BNP A;  1U12 A;  5DPN A;  1WGP A;  5F1R A;  2KXL A;  5L73 A;  2AGS A;  1TNF A;  1C5I A;  3QBQ A;  1MVQ A;  5ABJ B;  5SV8 A;  2OQ7 A;  4KL1 A;  5EYY A;  2OX0 A;  2D5F A;  3LDB A;  4QB2 A;  5FYS A;  2XLG A;  4XCA A;  3KT1 A;  1W8T A;  2ZXQ A;  4CDX C;  1JZ5 A;  1B35 C;  1OF3 A;  2P2K A;  4FPJ A;  2E26 A;  1NA1 B;  3AZZ A;  3M70 A;  1QJY 3;  1E57 A;  1SFP A;  3RI8 A;  3TYJ A;  1UY1 A;  3KT7 A;  3P1I A;  2OUJ A;  4MZU A;  3OJB A;  4BCU A;  1QKQ A;  5K8S A;  4OI0 A;  1XNC A;  2VOX A;  2ZEZ A;  3MV1 1;  3V56 A;  1AL2 3;  1XB9 A;  5E6H A;  3USS A;  5FY7 A;  4LIV A;  3WVJ A;  5BNN B;  1MS1 A;  4CCE A;  2VGD A;  2EIB A;  2WL1 A;  5IK4 A;  3BPS A;  4FPE A;  2VU9 A;  1G9A A;  3OB8 A;  4E8D A;  4UFJ A;  1SLC A;  5CZK A;  5LBE A;  3ZXL A;  1N3Q A;  2ZML A;  3GJA A;  3ZKU A;  1RJ8 A;  4AYU A;  3V0B A;  5FJH A;  4YVS B;  2D3P A;  3DXT A;  5FYZ A;  5FZ7 A;  2BUK A;  3THD A;  1NQJ A;  1W06 A;  3H1M A;  3I59 A;  2JDK A;  4ONU A;  2W95 A;  4NIG A;  3GBG A;  5A1L A;  1RHI 1;  5DUU A;  4AVC A;  2CGN A;  2ARB A;  1X36 A;  2EIC A;  1MQT A;  4NJ4 A;  1X8M A;  1OOP C;  1T6B X;  5T50 A;  4D94 A;  1OVS A;  3NNG A;  4ET7 A;  3EQE A;  1LOD A;  1UAI A;  2WO2 A;  4WZF A;  5JZG C;  3B01 A;  4DIQ A;  2Q1Z B;  4XC9 A;  2XXZ A;  4GQ7 A;  1W8U A;  2YPD A;  1RJ7 A;  3QH7 A;  1SFY A;  3MFA A;  4Y20 B;  3HBZ A;  5FZO B;  2Z69 A;  2JEM A;  4D7S A;  5DZF A;  4XZP A;  1PIV 2;  3RWN A;  4GKY A;  1ULC A;  1JHN A;  2DTY A;  5A33 A;  5J7M A;  5LZ6 A;  1Y43 B;  5B4N A;  1YWK A;  1RUI 2;  1QXJ A;  3P3P A;  1FT9 A;  4GB3 3;  5GAL A;  5JR7 B;  4BXF A;  1RUN A;  4R9A A;  3E5X A;  3LA7 A;  1LHO A;  4FO9 A;  1MEC 2;  4K1Y A;  3ZFE B;  1ASJ 3;  1FMD 3;  1Y9G A;  3AJZ A;  4K6B A;  3T4H B;  3MIF A;  4NII A;  4CP0 A;  1H2L A;  2RM2 1;  1NUK A;  4JGZ B;  1HRV 3;  1NE4 A;  2P3J A;  2DU0 A;  4TN7 A;  3HQR A;  1XE0 A;  1Q8P A;  1Y4W A;  3LD8 A;  4P9W A;  4YM3 A;  1JOB A;  1H8T C;  1VBB 3;  2DUQ A;  3RDI A;  3WP6 A;  1SLI A;  3ACH A;  2E9Q A;  2HWB 3;  1O4Z A;  4AI2 A;  3CNA A;  4RN5 A;  3ZYI B;  1ZBE 3;  5ANN A;  1AL0 G;  3E6B A;  3H7J A;  2ZPX A;  2NP0 A;  4E4H A;  1Z0H A;  2Q1M A;  3NAP A;  3UET A;  1YCI A;  4TZD A;  4HPK A;  5JOY A;  5EV7 A;  3RZH A;  2JDP A;  2WFF 3;  4YW4 A;  3WQ1 A;  1Z78 A;  3KQR A;  4ATE A;  1DGW X;  1G9D A;  3FX3 A;  1ZVF A;  1FNY A;  4K20 A;  5F5C A;  3LAG A;  1L7L A;  5LA2 A;  2PHR A;  2XHK A;  3BTA A;  4XFF A;  5C33 A;  4DUX A;  2R1B A;  3M7A A;  5CFD A;  3VZM A;  4MGS A;  4WM8 B;  2W91 A;  3D82 A;  4HET A;  4BA6 A;  3GZE A;  4J1W A;  5FRA A;  3C7F A;  4DO0 A;  5C3Q A;  5JR2 A;  2FDK A;  5J1X A;  1PVX A;  3MIE A;  4NPL A;  2WNV B;  3VBU C;  2RR1 1;  1PM4 A;  3ACI A;  3LA2 A;  4LHN A;  4LO4 B;  1V6J A;  1APN A;  1VPH A;  1J3R A;  2ET1 A;  2NMN A;  2WKK A;  2WNO A;  1XNT A;  3AZW A;  5JUV A;  1J58 A;  3VHR A;  2XJQ A;  2OVU A;  1ZZ6 A;  1JI6 A;  2WWS A;  5A7W A;  5LB6 A;  2K9Z A;  3E6C C;  2E32 A;  2W87 A;  1ZBA 2;  4CDQ A;  4CSW A;  5FZB A;  2PHF A;  3DYM A;  1RIT A;  4IEQ A;  2QDN A;  3GCW A;  3H7Y A;  2NM1 A;  1R09 2;  1UYY A;  1EYB A;  2IXK A;  4N53 A;  1VAV A;  2EXH A;  4IE4 A;  4QQP A;  3WDV A;  1PHM A;  1WA6 X;  1VAL A;  1YXW A;  3MIB A;  4IE7 A;  1POV 0;  1W9T A;  2EAA A;  3PU8 A;  3TNP B;  4KWL A;  4IE0 A;  1W05 A;  2Q4S A;  4CP9 A;  1U5I A;  3MIH A;  2RJL A;  2A7A A;  2WT1 A;  3JD7 1;  3N35 A;  4NPR A;  1QY4 A;  2F6B A;  5C9A A;  4R9D A;  3ASI A;  3LF7 A;  1OQD A;  3L9J T;  4UFK A;  4AW7 A;  1PK6 B;  2RS1 1;  4L9B A;  1PMH X;  3UGH A;  3VBS A;  4XJ9 A;  3DYO A;  1AX2 A;  1WLD A;  5FY0 A;  2A5Z A;  4BU2 A;  5LA1 A;  1QDO A;  2RS5 2;  1ULD A;  1QNY A;  3VBH C;  2P4E A;  5DAP A;  2I2S A;  4NRM A;  5EHD A;  3WUD A;  4XTP A;  3BUC A;  5APA A;  3WR0 A;  1V6I A;  4NHX A;  4Y5S A;  3ZSL A;  2ARE A;  1W2O A;  2HYK A;  4URT A;  5FQ0 B;  3TN9 2;  3V0A A;  4DEQ A;  2C1F A;  3FHI B;  1WCQ A;  4HK9 A;  1UU4 A;  5FY9 A;  4ES9 A;  1D2S A;  1GP6 A;  2B46 X;  2VQA A;  3WF1 A;  1H1M A;  2TUN A;  4A2U A;  1FX5 A;  1X50 A;  2O8O A;  2H0V A;  2PQQ A;  3AMH A;  3PUR A;  1UMH A;  3WP3 A;  5FZ9 A;  3AX4 A;  3VHN A;  5CFC B;  1D2Q A;  3GCX A;  3VBF C;  5JPM B;  2HWF 2;  3ZR6 A;  1C1L A;  3GZT B;  3ZDV A;  4CCD A;  3ZSE A;  4PT6 A;  1UX6 A;  2XB6 C;  1WMF A;  2VMG A;  4L2N A;  4DMI A;  2D40 A;  1WZX A;  4KH9 A;  2ZJC A;  1FXZ A;  1MS9 A;  2IVJ A;  3R4D B;  1GAN A;  3ETP A;  4IUG A;  5C4W C;  3N7J A;  3KF3 A;  2FHR A;  2RHP A;  3ZM8 A;  3WNM A;  3CL1 A;  2ZGO A;  2X5I C;  5A3W A;  3VN4 A;  4BIO A;  1NYW A;  4YM2 A;  3Q8E A;  1MZE A;  2JG9 C;  3FJS A;  4AI9 A;  2W1Q A;  4JRA A;  4W65 A;  3FWE A;  3PLQ A;  3GF6 A;  3LDK A;  2OT7 A;  3IN9 A;  3QH6 A;  3I2I A;  3B94 A;  2CGP A;  3ZSJ A;  4Q0U A;  3WCR A;  4HVR A;  4XQW A;  3VKO A;  4Q4X 1;  5JPN B;  1TME 2;  3KV4 A;  4Z92 B;  2BEO A;  3GZU C;  4KWJ A;  4LE4 A;  5EJZ B;  1VBA 3;  1IGO A;  1DDL A;  2MHF A;  4W8J A;  3SXW A;  3ES1 A;  1HX6 A;  5FXZ A;  4B29 A;  2VW2 A;  1H6X A;  1O4Y A;  3K4A A;  4XDQ A;  5J96 B;  1D4V B;  1FOD 1;  2V5Y A;  4YRD A;  3OCP A;  4LBQ A;  1ZZ8 A;  2PMW B;  4YZ2 A;  5FYY A;  4P9Y A;  3HVD A;  5C8W A;  1RMU 2;  3OPZ A;  4YGB A;  5FUP A;  5GLU A;  1COV 1;  1F5F A;  3VKF C;  4RHV 3;  2TBV A;  2YU1 A;  2VNO A;  2ZGL A;  4XF1 A;  3OEA A;  1RUF 1;  4N8M A;  4YVW B;  3AMN A;  4XJZ A;  4NHL A;  3I2K A;  1DP0 A;  1N3P A;  4WM7 B;  4JV4 A;  1AXZ A;  2L9L A;  3D3A A;  3ZR5 A;  3QD6 A;  2PHD A;  2RMU 2;  1EUU A;  5I0T A;  1HQN A;  4IND A;  4M3C A;  4PBO A;  1AR9 1;  1PIV 3;  1RC6 A;  5T55 A;  4CEY C;  3THT A;  5JAX A;  5FZ0 A;  1RUI 3;  4Y1U A;  5DMY A;  4M4P A;  2YMZ A;  3VB9 A;  2W0X A;  3CO2 A;  3Q8A A;  4A6S A;  4XMA A;  2QFE A;  1GP4 A;  1MEC 3;  4IEW A;  4DY3 A;  4FPY A;  3MIG A;  4B4R A;  4CU7 A;  4YG6 A;  5DAX A;  2C9A A;  2VZQ A;  3GZA A;  1PZ8 A;  3AL5 A;  1GKB A;  3ILR A;  4Y1Z A;  1H0B A;  4XFG A;  3KF5 A;  5IVY A;  3QOP A;  1OFN A;  4B1L A;  1W6Q A;  3OBA A;  2IFW A;  3WDU A;  2JIJ A;  3PHM A;  5HPO A;  4Q4W 1;  3ZVX A;  4QQL A;  3IKW A;  3T1M A;  5KC6 A;  2DYC A;  4QMA A;  3RYK A;  3VV1 A;  3NL1 A;  3N4M A;  4OHY A;  5KWR A;  3THC A;  1SHW B;  5A7Q A;  4QDS A;  2ENR A;  4Q26 A;  2BP6 A;  2R30 A;  2Y6K A;  3DV8 A;  2GZW A;  3WCS A;  5KHI A;  2WS9 2;  3WDT A;  4QGN A;  5C70 A;  2VG9 A;  1RUG 2;  4Z82 A;  4BIS A;  1J1L A;  4FFH A;  3S6P A;  3LKJ A;  3EB7 A;  5C7G A;  1OPM A;  3HR9 A;  2PAE A;  3MV0 1;  4CDX A;  1B35 A;  5A7N A;  5T5P A;  3PJY A;  4D7T A;  3SLI A;  1CJP A;  1OKQ A;  5TSW A;  1V70 A;  3C8X A;  2WZR 2;  1HQW A;  3OG2 A;  2JDU A;  2E7T A;  1WW7 A;  2KR2 A;  2NMO A;  1JZ4 A;  1L3J A;  5FYB A;  1CAX A;  1BHG A;  1QOT A;  2BNN A;  2G9Z A;  1YQ5 A;  1W03 A;  2DCT A;  2X53 S;  2XBO 2;  3IPV A;  4R52 A;  5JIA A;  3UJO A;  1VBD 3;  2XJT A;  3HQU A;  5AC9 3;  1JN2 P;  3O1V A;  2ZHL A;  1PZ7 A;  4W50 A;  3N7L A;  4M3C F;  5BNP B;  5FPA A;  3PNA A;  3AZX A;  3WQB A;  4IDZ A;  1UU5 A;  1M06 G;  2FQP A;  2VZ1 A;  3T0D A;  1GZT A;  4ZY9 A;  1V6L A;  2OKX A;  1VBC 2;  4E9K A;  1O91 A;  1ZBA 3;  1EV1 1;  5F3C A;  2RJK A;  3EJK A;  4A3X A;  4EN0 A;  1MR5 A;  2VQ0 A;  3OY8 A;  1DG6 A;  3LEI A;  3UK9 A;  5IVB A;  3RJ2 X;  4PQ9 A;  4S2D A;  4LBL A;  3ZPO A;  3BKZ A;  2WC2 A;  2XJU A;  3O12 A;  2XKP A;  4P02 B;  2BBV A;  5KHK A;  1HXS 1;  2D43 A;  2LW8 A;  3Q8C A;  2VZU A;  3ITQ A;  1MZF A;  1NZC A;  1US3 A;  1ZZ9 A;  1DYK A;  2MNG A;  2QKD A;  2UWA A;  5A1F A;  1OOP A;  3ME2 A;  2NN8 A;  4QGL A;  1ZX5 A;  3IWZ A;  5JZG A;  2XVG A;  1QJU 2;  5FWE A;  5FWJ A;  4NIA A;  5F5Q A;  4BPZ A;  1BEV 3;  3MW2 A;  3WF2 A;  1J59 A;  1LU2 A;  1P8J A;  2HWC 1;  3N9O A;  1BLZ A;  2RS5 3;  1CR7 A;  4QX5 A;  1VBE 2;  2VCB A;  1QEX A;  2YV8 A;  4QB6 A;  4DEV A;  3WOG A;  1ENS A;  2JG8 C;  5C8C C;  3RG0 A;  5F7U A;  2WSV A;  2ETE A;  3V0B B;  3WNO A;  4DXS A;  4EV0 A;  2VOT A;  3AP5 A;  1V0A A;  1RUE 1;  4Q0V A;  4A44 A;  5B4X A;  1ZRE A;  3I8T A;  3I59 B;  4TYS A;  2Q8C A;  1GMM A;  1MS5 A;  2BVB A;  4K9S A;  1PZ9 A;  3DF0 A;  4A7Z A;  3P3N A;  1RUH 1;  5HV0 A;  5K9Y A;  5AVA A;  4QXK A;  4CZS A;  3ACF A;  2XGX A;  2VXJ A;  5F5I A;  2W94 A;  1LEM A;  4IGP A;  3III A;  4CCJ A;  2D93 A;  2VEC A;  5C8C A;  3MPP G;  3LSD A;  3W20 A;  4P00 B;  2HWF 3;  4LKS A;  1H8T A;  4QPG C;  4SLI A;  2YGM A;  2EAK A;  5FV3 A;  3SH4 A;  2ZGU A;  2FMD A;  3DN7 A;  5I91 A;  4CP1 A;  4AFA A;  1LOG A;  4ATF A;  4XXA A;  1FMD 1;  4FPL A;  1QMJ A;  4HZF A;  4CDU C;  5A33 B;  5J3U A;  1QIQ A;  4TXW A;  3NV3 A;  1XOY A;  3MO4 A;  3WHU A;  4BHP A;  1LHU A;  4D0Q A;  4RQP C;  2CYF A;  3IMN A;  3U0Z A;  1CAW B;  5DUV A;  3P6B A;  1Q8O A;  3PME A;  5JOW A;  4IEX A;  2WQZ C;  1YFY A;  4KWK A;  2Y6G A;  4FFI A;  3EO6 A;  2CAU A;  1TME 3;  5FPX A;  4JHZ A;  3RNS A;  4AFC A;  1UXX X;  1X9T A;  3C3V A;  4XCB A;  1WME A;  2R07 2;  1LU1 A;  2BW8 A;  5DUW A;  5L9R A;  1EAH 1;  1S0C A;  1YYN A;  3VBU A;  1XNK A;  4H3W A;  4BJ0 A;  1V9U 3;  3NV4 A;  1NY7 2;  4WBB A;  3HBK A;  3ECQ A;  1RMU 3;  1QJZ A;  4OHV A;  3S5Q A;  1ODM A;  2DCY A;  1VE0 A;  2ZX0 A;  3JBG 1;  1SDW A;  1K5M B;  3KCX A;  3NAP B;  5GLW A;  2R04 1;  4CDW C;  4D6S A;  1XU2 A;  2XML A;  2OS2 A;  2XWJ B;  3NRU A;  5FBZ A;  1PGW 2;  2EA7 A;  4IL7 A;  5FMD A;  5A32 B;  5FOJ B;  2CWS A;  2BU9 A;  2XJS A;  5FLJ A;  4LHK A;  1LGB A;  1RXF A;  3POE A;  4EJR A;  5IVJ A;  1GFF 2;  3V65 A;  3A4U A;  4QX1 A;  1IG0 A;  1K5M C;  1QQP 3;  3NST A;  3AVS A;  2JIG A;  1OUS A;  5HCB A;  1CZS A;  1ND3 B;  1RUD 1;  2WLQ A;  4LUK A;  5CFD B;  3IBM A;  3DYP A;  2GSY A;  4NIH A;  4AZZ A;  2GC1 A;  3OUJ A;  2QQM A;  1W2A X;  1NLQ A;  4QX7 A;  5F6K A;  1D7P M;  3RVH A;  1RUJ 1;  2BYV E;  3NMB A;  5C5T A;  3S5A A;  2HH9 A;  5HBA A;  1QJY 2;  4YGE A;  1HDK A;  4OUM A;  1REF A;  5JCT A;  1MVE A;  4S2G A;  3LIG A;  2J1S A;  1SPP A;  2W2I A;  3HWJ A;  3VBH A;  3K51 A;  1RGS A;  1GP5 A;  2W46 A;  3HOB A;  5A7W B;  1AL2 2;  4R9C A;  2DUO A;  5EQU A;  4UBG A;  1F5J A;  3WP5 A;  4COZ A;  1SG3 A;  4LLF A;  4UW6 A;  5A3T A;  4DZG A;  2RS3 1;  4GKX A;  4CDQ B;  4KWU A;  1UZY A;  4GAZ A;  2Q8E A;  3WNX A;  2JEC A;  1LB2 A;  1O7F A;  3ZPY A;  4N53 B;  1JMU B;  1WBF A;  2MEV 3;  1MS0 A;  3OBR A;  4Y4R A;  3WW1 A;  3U07 A;  2JDA A;  3ILN A;  5FZH A;  3OYW A;  3NNM A;  1UN1 A;  5A7S A;  4CP9 B;  4HKW A;  2FMY A;  4Q8L A;  3PTR B;  3BTY A;  4DXR A;  2WS9 3;  4IW3 A;  4MX3 A;  4GJY A;  4RFT 0;  2VZO A;  1YQ2 A;  2B45 X;  4WV8 A;  5JVV A;  5C9A B;  1TMF 3;  5CA6 A;  3VBF A;  1WCK A;  3ELN A;  4EE2 A;  2P17 A;  1PO1 2;  3VBS B;  1UYP A;  4OUS A;  4OQ9 A;  4Q0P A;  3ZMN A;  5BUV A;  3FZ3 A;  4OCT A;  1J3P A;  1NG0 A;  4EWD A;  1S55 A;  2VBD A;  5A3N A;  5C4W A;  2W08 A;  1NCR C;  5I0U A;  3VZJ A;  2OQ6 A;  4K1Z A;  3VKL A;  2X5I A;  1C8M 1;  1J83 A;  2XBO 3;  3V0A B;  2JG9 A;  1NKG A;  4D6Q A;  4B4P A;  3LPF A;  4JGY C;  3LEG A;  5FIX A;  5DZG A;  1HV0 A;  2ORX A;  4KGQ A;  2V4V A;  2DDU A;  4AGV A;  5LBF A;  4XE9 A;  2AUY A;  3MEP A;  4MGT A;  2CU5 A;  5LEJ A;  1VBC 3;  2HWE 2;  1G8W A;  2WQ4 A;  4LQR A;  4Y1V A;  5A6Z A;  3DPR C;  3D6E A;  3OEB A;  1WKY A;  4S2H A;  4YG3 A;  3KV6 A;  3ZSK A;  4AVA A;  4RR3 C;  1HRV 2;  3HNM A;  5DDJ 2;  3K2O A;  3PVE A;  5JMO A;  3VL8 A;  2Q8O A;  3H8X A;  1VBB 2;  1CAU A;  1LTE A;  4QX2 A;  2HWB 2;  5ACA 3;  2VVE A;  1ZBE 2;  1QJU 3;  4Q4V 1;  1YNA A;  5I0S A;  3KD4 A;  1XSR A;  1JYT A;  3B3Q E;  2IXJ A;  3AKS A;  2IXC A;  1PM7 A;  1SLT A;  2Y6F A;  3MDP A;  3WW2 A;  4XAE A;  5D21 A;  1VBE 3;  4PLN A;  3ZFG C;  5JSP A;  4DB5 A;  4AAP A;  4CEY A;  4I3G A;  2WFF 2;  1BKZ A;  2JB4 A;  3PU3 A;  2WNE A;  1JYV A;  1YO8 A;  1PO2 1;  1BBT 1;  1ULP A;  2Q0A A;  2AC1 A;  2OA2 A;  1WW4 A;  1AYM 1;  2WR9 A;  3PVO A;  4R9B A;  4UFL A;  5DXD A;  4KGG A;  3SC7 X;  2BNO A;  2ZGN A;  4NHY A;  4LBQ B;  3J8F 2;  3KGZ A;  2C4X A;  1VP6 A;  3T09 A;  1YIP A;  2DU1 A;  2KM2 A;  2W68 A;  1URX A;  3HD8 B;  2ZCW A;  4GUL A;  1DGR A;  2KD7 A;  4I0B A;  4XF9 A;  3ZIW A;  2AZ5 A;  3HIF A;  1X8E A;  2J1V A;  4XFB A;  2FDI A;  4CE8 A;  3ON7 A;  5IFT A;  1DQ1 A;  1XQN A;  3CLP A;  3RYR A;  1HJF A;  2ZZJ A;  4M3C B;  1QH7 A;  3FUQ A;  4C91 A;  3PUA A;  3H8O A;  3UNP A;  2J7M A;  2JKX A;  1W8W A;  4XEZ A;  4COV A;  5FLI A;  4ASL A;  4JKL A;  1KJL A;  3WV6 A;  3VD3 A;  4YW3 A;  5FZF A;  5CKQ A;  1Q56 A;  3O1P A;  2BNM A;  1UKR A;  3MBW A;  2DUR A;  2VNR A;  2BDR A;  1S2E A;  1SDD B;  4XUQ A;  5J09 A;  5K0U C;  3B00 A;  4ZXE A;  1N1T A;  1Z7S 2;  2LS6 A;  3T3Y A;  3T1L A;  4MUV A;  4CU6 A;  3IDA A;  4J25 A;  1GOG A;  4MGQ A;  1R64 A;  2YBK A;  1JUH A;  1ENR A;  1S0B A;  4AAX A;  1QXP A;  1AR7 1;  2AEY A;  4OHX A;  4BDV B;  2R07 3;  3FLR A;  5DAB A;  4IV3 C;  1LKN A;  1I9R A;  3PVN A;  5FMO S;  5A80 A;  5JXJ A;  1AX1 A;  1GZC A;  4N7U A;  1JU3 A;  3BIW E;  3RSJ A;  1S0J A;  2RV9 A;  1XNB A;  2XH6 A;  1H9W A;  2PN5 A;  3TOJ A;  4IQP A;  1Q43 A;  4JKM A;  5LY1 A;  1PMI A;  1I6X A;  2XVL A;  3CKH A;  2VVD A;  1YQ6 A;  4AHY A;  4XVH A;  1AR8 1;  1DQ2 A;  2O14 A;  4GWI A;  2EIE A;  4AFB A;  3AKT A;  2BER A;  4LOR A;  4AQT A;  4CDX B;  5BY5 A;  1BVV A;  4M00 A;  1B35 B;  2Y38 A;  3BPZ A;  4C1W A;  4DIN B;  1F8V A;  1CES A;  2GC2 A;  4QU2 A;  3UL2 A;  2XON A;  5JXI A;  4C0B A;  1GZ9 A;  4YNI A;  3WNK A;  3KV5 A;  3RPQ A;  3D8C A;  1LOA A;  4XPV A;  1AZD A;  2Y26 A;  3LOI A;  1CAX B;  4O61 A;  2CHH A;  4QXC A;  2FDH A;  3W59 A;  2VAU A;  3IPV B;  4BQ4 A;  2C6S A;  1UMZ A;  3FN9 A;  3M3O A;  3ZXD A;  5FYI A;  1LAJ A;  1R09 1;  2Y6J A;  1JOJ A;  1NT0 A;  3NV2 A;  2ZAC A;  5AFB A;  2NPI A;  2VUD A;  3PIG A;  1LRH A;  1US2 A;  4NAM A;  3JB4 C;  4EQV A;  4AED C;  1Y3T A;  5A1A A;  2JG8 A;  3U4X A;  2ID4 A;  1SAC A;  2ADD A;  5HI0 A;  2VXR A;  4AVS A;  1PGL 2;  3OY8 B;  1W2N A;  3IB3 A;  4ASK A;  3R05 A;  4PBP A;  5LK5 A;  1VRH 2;  4FPH A;  5DQ0 A;  4QDQ A;  2BZD A;  1VBA 2;  1PX3 A;  1M4W A;  1KFU L;  2IZW A;  2ARX A;  2DCJ A;  2R32 A;  3N9P A;  1H4G A;  4AHW A;  5C71 A;  4FOQ A;  1RXG A;  1FPN 1;  1OOP B;  2DVA A;  1RUC 3;  5JZG B;  1PO1 3;  1W9W A;  4QPG A;  3TN9 1;  1OBN A;  2HEY F;  3U4S A;  4QQ2 A;  1X82 A;  3T08 A;  4RHV 2;  1V6M A;  2XG3 A;  1AUY A;  1UPS A;  1YQC A;  3LIH A;  3U14 A;  3I2G A;  1STM A;  3NQH A;  4CDU A;  1XPW A;  2DCK A;  5F39 A;  1DGR N;  2VNV A;  4FP2 A;  2CTV A;  2UUR A;  3UYJ A;  1DLC A;  4DQA A;  3GJB A;  1ZRI A;  4O65 A;  4RQP A;  1HIX A;  1CN1 A;  2VZP A;  5LK7 B;  1E5R A;  2X8K A;  4U36 A;  4BQX A;  4J6G A;  3FLT A;  4QPI C;  4CEW C;  4JQR A;  4A42 A;  1H2N A;  1YUD A;  1QGL A;  4JDN A;  1CAW A;  4NN0 A;  3W9A A;  1W6P A;  2HWE 3;  5C6C A;  5C8C B;  2XJP A;  5LEK A;  4URA A;  1TG7 A;  2V09 A;  1DIW A;  1H8T B;  3LFM A;  3E97 A;  2YG0 A;  4RL7 A;  4NE9 A;  1R1A 1;  1C3H A;  2VOW A;  4GH4 C;  4QKD A;  5DDJ 3;  3ZXE A;  1ND2 C;  4D8M A;  3VZO A;  5IVV A;  1G9B A;  4NVP A;  2QQO A;  1GWL A;  1O59 A;  4MLO A;  3ST7 A;  4XFA A;  4DXZ A;  5JOX A;  4LIT A;  3B93 A;  4QAW A;  1OPO A;  5L7O C;  4LA3 A;  4CDW A;  2WWU A;  3ZN6 A;  2P3Y A;  1F15 A;  4AEM A;  2X29 A;  4IEO A;  1UY0 A;  4JDO A;  2OII A;  1VLN A;  1NOV A;  4MVT A;  3MUY 1;  3CZU A;  3SIS A;  4DPN A;  1K5M A;  3OOX A;  4K8R B;  1AYN 3;  4NWV A;  5A32 A;  1W39 A;  1X33 A;  2WNU C;  1LED A;  1ENQ A;  2ZGT A;  2VW0 A;  1OH3 A;  3TEZ A;  3ZXJ A;  2VO5 A;  2ZGM A;  5FYU A;  4HN1 A;  2DBN A;  2RDR A;  1CPM A;  2D6O X;  3BU7 A;  4YPJ A;  1GV9 A;  4QM8 A;  2PHU A;  5GZG A;  4CTE A;  4A7K A;  1ND3 A;  3VBU B;  3GYD A;  4OZO A;  4AFD A;  5G04 L;  1NCQ B;  3J8F 3;  1O5U A;  1LOB A;  2RMU 1;  2P37 A;  1SMV A;  4UXA A;  4MSV A;  4XAA A;  1RVF 2;  4HK8 A;  3SH5 A;  4EZH A;  4UW4 A;  4MGI E;  1VBD 2;  1V00 A;  5AC9 2;  1NCQ C;  5C3O A;  2PAK A;  5ERL A;  5IVE A;  1Q3E A;  3AMP A;  1G7Y A;  3DUI A;  1XYN A;  1KEX A;  3HT2 A;  3TEY A;  3LEM A;  4QGM A;  4Z2A A;  1W90 A;  2YHJ A;  3T2P A;  1ULF A;  2ZEX A;  1WA4 A;  2LUW A;  5FP9 A;  4JTN A;  3URF A;  2HWD 3;  4FOW A;  2FCV A;  4QT6 A;  3I3E A;  4QKF A;  2ZX3 A;  3MW4 A;  5GZD A;  2BPA 2;  4D6R A;  1I5P A;  3H1Y A;  5JI9 A;  1JU4 A;  4X8N A;  4LKF A;  1A6C A;  1JUI A;  5A6Q A;  1XC6 A;  4XOG A;  3ZYB A;  1UWW A;  1Z7S 3;  1C1F A;  2EXK A;  3D0S A;  4Q0Q A;  1B09 A;  4C0H A;  1H2M A;  1KGY A;  5IK7 A;  2WBK A;  1SPP B;  3VBH B;  4A6O A;  1NCR A;  3HMY A;  4UWD A;  5FR3 A;  3AXD A;  2J1U A;  1BEV 2;  1SCR A;  1RUG 1;  5DZE A;  4N9H A;  2JEN A;  4JGY A;  1DGW A;  1F4H A;  5FZA A;  4FPC A;  2PLV 1;  3D4K A;  3UKN A;  1LR5 A;  3OYW B;  3B9I A;  1R08 3;  3M3C A;  3A7Q A;  4CUB A;  4UYB A;  5KXC A;  2WZR 1;  4C90 A;  1WMX A;  1OA3 A;  2ZBJ A;  4ASM B;  5HXM A;  1XSQ A;  2V72 A;  3RS6 A;  2D98 A;  4RGG A;  4ORF A;  3VBF B;  3DPR A;  3BOP A;  3UJQ A;  1H1A A;  1G9F A;  1PMJ X;  3AZV A;  3DXU A;  4RR3 A;  3CEW A;  3SH3 A;  2B5H A;  5C4W B;  4NPM A;  4QHB A;  4OHW A;  2E7Q A;  4HFS A;  3KT4 A;  1PVC 1;  3ZSM A;  2QQV A;  4JTO A;  2X5I B;  4BYY A;  3GM8 A;  4QD2 A;  5FZ4 A;  4M4R A;  1FYU A;  4FXK B;  1K5J A;  2JG9 B;  2GH8 A;  1RHI 2;  4ZU4 A;  4GMP 1;  2XOM A;  2GN7 A;  3WD5 A;  2JKB A;  1PX4 A;  4L99 A;  2K46 A;  2CGO A;  1XYP A;  3JCI A;  1I5Z A;  3MYX A;  5L9B A;  3WX5 A;  3WW3 A;  3RZM A;  2XQX A;  1RIN A;  2JB8 A;  3ZFG A;  2B4K A;  3WF4 A;  1ACC A;  4Q4Y 1;  1UIJ A;  5A6X A;  2MPF A;  2YU2 A;  3AYA A;  4AQS A;  5HCH A;  4FI9 A;  1POV 3;  2XLF A;  3LSE A;  4UAP A;  1ENX A;  1XJA A;  1U5Y A;  5FKB A;  2WAA A;  1YHF A;  4JRL A;  4RS5 C;  5DAQ A;  1VRH 3;  2AYH A;  1QJX 3;  4XUR A;  3L2H A;  2I45 A;  2JDN A;  2R06 1;  4GAL A;  4MOA A;  1W0O A;  3PUS A;  4LA2 A;  4BK5 A;  4H14 A;  3U78 A;  3VBR B;  1AR6 1;  2GND A;  1CAU B;  2ZHK A;  3O14 A;  3USU A;  3ZO0 B;  2VMC A;  1WW6 A;  4OUL A;  5CNA A;  4E4D X;  5EIY B;  5FUN A;  1DYO A;  1QNW A;  1UW8 A;  1V9U 2;  1W2U A;  5J37 A;  1O3S A;  4NRP A;  3VBR C;  5KXB A;  1HRI 3;  1SFN A;  1WCS A;  2RM2 2;  4FPK A;  2XJR A;  2ARA A;  4UFM A;  5FZ8 A;  2WRA A;  2GH2 A;  4P9I A;  4H55 A;  2ORZ A;  4P08 A;  1UY3 A;  4CEY B;  3NV1 A;  4AK3 A; 
#chains in the Genus database with same CATH homology
 4BQ5 A;  2KR2 A;  4YW6 A;  1UOJ A;  4CPB A;  4BQ3 A;  4BQ4 A;  2VXJ A;  1W8W A;  1WCU A;  4LKE A;  4CPB D;  4LJH A;  1W8Z A;  4LKD A;  1WZX A;  4YWA A;  1W90 A;  4YW7 A;  3ZYH A;  4BQ2 A;  1OH3 A;  2O14 A;  4LK6 A;  2LRP A;  3UT0 A;  1L7L A;  4A6S A;  2K46 A;  1OKO A;  3ZYF A;  2Q1F A;  1W8U A;  3F95 A;  1WMX A;  1GWL A;  4CP9 B;  2WYF A;  4LKF A;  4AL9 A;  4CP9 A;  4LK7 A;  1W9F A;  2JWP A;  3ORJ A;  3ZYB A;  1HN0 A;  1V0A A;  1W8T A;  1GWK A;  2LRO A;  5D21 A;  2C24 A;  1GWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...