4LKEA

Crystal structure of pseudomonas aeruginosa lectin leca complexed with gala-wri at 1.65 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I galactophilic lectin
publication title Structure-Based Optimization of the Terminal Tripeptide in Glycopeptide Dendrimer Inhibitors of Pseudomonas aeruginosa Biofilms Targeting LecA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein/inhibitor
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4lkeA00
1W9FA 4LK7A 2JWPA 3ZYBA 4CP9A 2O14A 4CPBD 1W8WA 1OH3A 2KR2A 4AL9A 1GWLA 1OKOA 1W8UA 1GWMA 3ZYHA 1WMXA 4YW6A 1W8TA 5D21A 4YW7A 4YWAA 1WZXA 4LKEA 2WYFA 3ORJA 4BQ2A 4BQ4A 2LRPA 2Q1FA 2VXJA 4BQ3A 1HN0A 4LJHA 1V0AA 1W8ZA 1WCUA 4LK6A 3UT0A 2K46A 4CPBA 4CP9B 1UOJA 4LKDA 1L7LA 4A6SA 2LROA 1GWKA 1W90A 2C24A 3ZYFA 4LKFA 3F95A 4BQ5A
chains in the Genus database with same CATH superfamily
1C8M3 2AR6A 4FO9A 4EJRA 4RS5A 2UY9A 2XONA 5FY9A 1VRH2 3POWA 4Q1RA 3LGRA 2YXSA 4AXOA 2IZWA 4BLJA 1YRZA 3JBG3 4QPGC 3KV4A 1RUI2 2XVKA 4AGRA 2LALA 1EPWA 1QJFA 1KEXA 5C9AC 3Q8AA 3PHMA 4OUMA 2RJ2A 2WT0A 3PUSA 4LHSA 1PVXA 1XYPA 2C9AA 4KWUA 5IVCA 1ASJ3 2E32A 4GB31 4LR4A 5FZDA 2G4IA 2DURA 4CPBA 1VBD2 3HPNA 3GNEA 3L2YA 1W04A 2B4KA 2VNOA 3R05A 2WFF2 3O1OA 3KLSA 4CYDA 1AYN1 1QWRA 1SPPB 2P3JA 2WQ4A 5AC91 5CG8A 2RV9A 4QKNA 5FZOB 1HDKA 1OLQA 1W6NB 5I0SA 2JD4A 3DECA 3RZMA 1V6OA 2C9KA 2CWSA 4KU8A 2E63A 2LM3A 1UOGA 4D6SA 3FC0A 2BFUL 4JQTA 1ULGA 1C8M1 2RDRA 3WT3A 1W6MB 3I54A 1W03A 1MEC2 5FZ6A 3S7IA 3U10A 1IPKA 1KDMA 2FZ1A 3EXUA 1N3QA 3JBG1 5JPNB 2KM2A 5FZ0A 1D4M1 1NT0A 1HXS3 1S2EA 1EUTA 1S0IA 5L7OA 1LECA 4UAPA 2BU9A 4FQZA 3W5NA 1DIWA 4LBQA 4RR3C 5F6KA 3GBWA 5CG9A 1MQTB 1F4HA 3AFKA 1VBE1 3K2OA 4LIVA 4YM1A 5KHGA 4WM7C 1YHFA 2YBSA 2IC1A 4GMP3 4GJYA 1RHI3 4CCNA 3IMNA 1CAUB 1OPOA 4LBJA 4Q26A 2H6BA 3J9SA 1DBNA 1MS3A 1QJX3 1VB2A 1I5PA 1PNGA 1SACA 4LBMA 4BB3A 3CF6E 1JYIA 3TEWA 4QX2A 4YM2A 4QGMA 2YPDA 4JCKA 1ENXA 1UPIA 2WO7A 4NPRA 1PGW1 2VXJA 3PVBB 3KVAA 3PJQA 4NR1A 4XDPA 1RYYA 3WW4A 5K7PA 1ZM1A 1UYYA 1OSGA 4TWTA 4AHWA 4LO4B 1PX4A 2J1AA 2AZ5A 2QQVA 3NJVA 4FFGA 1GQGA 1ZX5A 2ZZQA 2CGPA 3KT4A 4NMIA 4CZSA 2WR9A 1O6UA 1ZA7A 4BQ5A 4ZKTB 2WQZC 1H8TC 1NLSA 4H3WA 2XL7A 2NLRA 3E5UA 3B00A 3IDCB 4HZFA 3KV6A 2P3KA 1STMA 3X29B 3NJZA 2TBVA 2VUDA 4FPEA 3VBOB 1ULEA 4S2HA 5FO9B 2JG8B 1IS6A 2BUKA 4XJ8A 1FATA 4CXYA 1J3RA 2V73A 2VCAA 4ONUA 3WOGA 3DV8A 1UZYA 4BQ3A 4JTOA 3NNFA 1WCUA 3ZDSA 2ZX0A 4AI0A 3ACGA 2JDPA 4EZ4A 3K4DA 2G9FA 4RHV2 3MW4A 4CCLA 5J09A 5LZ6A 2A3WA 2VOWA 1G9BA 3Q8EA 4Z2WA 1LOCA 3DXUA 3LDKA 4P9LA 4GH4C 5C8WA 2QCSB 1COV1 4ZXKA 4N7UA 2PTMA 1C5IA 1URXA 3AXDA 4XFGA 2QQJA 4O9EA 4IW3A 3TN92 2WN2A 4TLFA 2XH6A 3TEYA 4NIGA 3AKRA 1Z78A 4LEJA 4AQSA 2PLV1 4FXKB 1MS8A 5FZMA 1NA1C 3OYWA 4F83A 4R8HA 1LJ7A 3OPZA 4QPGA 3LSEA 3OEBA 1RB8G 2G1MA 1UZWA 1UOJA 2OQ7A 1DGWX 2B46X 4N53B 1TE1B 1H0BA 3TNQA 3WQ1A 3AM2A 4AFBA 2E53A 3BTAA 4FAGA 3AB0A 1RGSA 5FZBA 5F9TA 2WZ8A 2V09A 2ZKLA 2MEV3 4LE3A 3UJOA 3RZGA 1TZOA 1W05A 2HWB2 3P3NA 3U0ZA 2YMZA 1FPN2 2ZAHA 4FT8A 4W6YA 1BJQA 1US3A 5FK7A 2VZOA 4AFDA 3EYPA 4E8CA 1RJ8A 2A6VA 2ZX3A 2WNEA 2HWC3 3WG3A 5D8AB 2VZQA 1IOAA 1R092 4LO5B 5FLIA 4OI1A 1OFNA 5FP8A 1ULOA 4QM9A 1BBT3 3LDBA 3BKZA 5DUUA 1SFYA 2K2SA 4FXGB 3WP4A 1W3XA 1CR7A 2VZ3A 1K3IA 4I0WB 1RUOA 2VMFA 2WLQA 4FOVA 3ZIXA 1GBGA 1W06A 2PAMA 2VBDA 1FOD2 1O4TA 2Q30A 3O14A 4UW4A 4X8PA 2XG3A 3BUCA 1O5UA 4GKXA 2AEZA 3FN9A 2G19A 4PI2A 4I01A 3FBYA 4EYUA 3AZXA 3Q9OA 3IN9A 1QDOA 5KBFA 1GKBA 1SBDA 3WUCA 4UFHA 2GH8A 3G7DA 1PGL2 4NRQA 5TSWA 5FY5A 2DYCA 3VKLA 3ZO0B 2UURA 1FX5A 3IBMA 5I91A 3CLPA 1WA4A 2MEV1 1FV2A 1EV11 3IAQA 3VHRA 4XEZA 5LRSA 2MHFA 3L2HA 5HV0A 3V56A 5IFPA 2VG9A 1R1ZA 4QPIB 2WWJA 3LE0A 4A6SA 2WLPA 2FMYA 5KHKA 1W90A 1ZNPA 2JX9A 3GZAA 3HT1A 2RM23 2OT7A 3GJBA 1VRH1 1Z7S2 5FZFA 1HX6A 5FYTA 2ATFA 3POGA 5T52A 1CAXB 5C4WB 3B69A 1REEA 4CDQA 5FPUA 1V9U3 1K5MC 1QKQA 3GBFA 5EFUA 3C7OA 3WW3A 2CHHA 2FMDA 5C7GA 1AYM1 2RS33 4JGYC 4AEMA 4NPMA 4XUQA 4XUPA 3C7GA 5K8SA 2GC0A 2IXCA 1FMD1 5I8SA 4YGCA 4A3ZA 4M01A 4ATFA 1AX1A 5BNOB 5A7WB 3KV5A 2BVVA 1S55A 2HWE1 4MADA 1VBD1 1WW7A 3HQRA 5IVJA 3WEZA 2I07B 5A1FA 3OTFA 4I02A 1JHNA 4JHZA 1EP0A 3CL1A 4IV1C 4XFAA 1QNWA 5EJ3A 3EBRA 1X8EA 2CDOA 5CFDC 4QHOA 4OHZA 3WNLA 5FZEA 1CJPA 4BDVB 4MXWB 2XPJA 1QJY2 1C5HA 2AH2A 4RN5A 4HPKA 1TG7A 1F9KA 4A41A 5ABJB 5IK8A 3ZFFC 3QD6A 1G9DA 1VLNA 3ACLA 1CPNA 1PHMA 3ZMNA 3IWZA 1VE0A 3DCQA 4LOTA 1DQ5A 2B39A 2ADEA 1QJZA 2D7FA 1SLLA 1OBNA 3ES4A 5KXCA 1YEWA 2VO5A 1X50A 5A3WA 4IERA 4M3CB 3WP3A 1BZWA 1DP0A 3ZFGC 3ORJA 5DAXA 3LAGA 3FHIB 4JZRA 3WDYA 3ZN4A 3B94A 1NZCA 2PA7A 1H9PA 4Q8LA 5IATA 1YI7A 3W20A 2YC4A 1G9AA 5LK7B 1UY1A 2W1WA 3OPWA 2PXJA 3AP4A 5DAVA 1XYNA 5LB6A 5FZAA 4AI3A 2VBBA 2A1XA 1AF9A 1VBB3 4NE9A 3M3EA 3DGTA 5C70A 2Y33A 1G7YA 2J1TA 5GZFA 3U14A 1F4AA 1YFYA 1NXD1 3JD73 5FPBA 1Y9MA 2D6MA 4AVTA 4KBZA 4Y20B 3RYRA 2ET1A 3VZKA 4YARA 4HG6B 2CWMA 1A6CA 1F5FA 1B35B 1YIFA 1YQ2A 5M0TA 2X09A 2XGXA 2BGCA 5LA2A 4MLOA 3H1MA 4KQ7A 1RUH2 1WLTA 5J48A 1ZBA3 1DGLA 2ZMKA 4GQ7A 5FXWA 5EJZB 1S0DA 3OY8B 4FI9A 4IEVA 1XE7A 4K1YA 4FSJA 1ODMA 1Y9QA 4XF1A 2R073 4NAOA 4UF0A 3DL3A 2R1BA 2QQMA 4QMAA 1CIWA 2ZX2A 4W50A 4BIFA 4DY5A 4D94A 1RL3A 2Z42A 2J1SA 2VR4A 1TMF1 4UWDA 4AEDB 4EZHA 1D2QA 1C3HA 2BZDA 4CUCA 1S4CA 2Y26A 2OPWA 5JOZA 1W8UA 1XOYA 2EAKA 5FLHA 4TLGA 1K45A 1JU3A 1OI6A 4AAXA 3O1MA 1R1A3 4F7ZA 3KCYA 4CEYB 1MR5A 3VZOA 3ACIA 1QJU2 2ZGOA 1QQP2 1TNRA 4BQ2A 4L99A 1UN1A 1VMFA 2XBO1 1QOTA 3D0SA 2NQYA 3PUQA 4RHV1 1JMUB 4INDA 4MO3M 5JZGC 3DYOA 4LHKA 1KS5A 3AKTA 2GNDA 3LEGA 3M1HA 1AL0G 1MQTC 2BGPA 4GWMA 5L73A 3ZOIA 5CADA 5KC5A 5BUVA 5JMOA 1HB2A 5T5OA 4WV8A 1ZBA1 4GKYA 3PMSA 1HRV2 4Q4W1 1DQ4A 1LR5A 4BMEA 4P9WA 3M70A 2R042 4XMAA 2J22A 5A7PA 3WCRA 2R071 2DUPA 3I3MA 1W9SA 3SCFA 4C1WA 4YFWA 5JI9A 2DBNA 4MGKE 3FX3A 4Y4RA 4YZ5A 2JG9B 5JXHA 5FYHA 3KT1A 2EF6A 3VBUC 4EWDA 1OFSA 1UMIA 1VPHA 2TNFA 4LMFA 2VOVA 4H7LA 4IEOA 1QH7A 4CEWB 3NJYA 1R1A1 1AR93 2FHRA 5GJ6A 5IT6A 1PVC2 2Z2SB 5EZWA 1YQ8A 5LBEA 1U12A 5LBBA 1LOAA 4P08A 2HWB1 5FO8B 4UI9L 5A1LA 5I0DA 1V6IA 1W2OA 2HWF2 3P1IA 1QXRA 3USUB 1W6PA 3CZJA 2X5IA 1UKGA 3VBOC 4D6RA 3KZ4C 1LHNA 3RQ0A 2D44A 2JG8C 2OZJA 1M06G 2VU9A 4IV1A 2FBEA 3ZFEA 4I3GA 1DYKA 2R063 5GKAC 2P6HA 4M3CE 5J96B 1HQWA 1A8DA 2AYHA 4BISA 4YG0A 5ACA3 1IS4A 3PL0A 1V6LA 2W0XA 3DYMA 1MS5A 4OCTA 3T2QA 5DPNA 2P3YA 2VGDA 1FOD1 2FCUA 4AK3A 2RR11 2FDIA 3GYDA 2RJKA 5FO7B 5AFEA 3ZFGA 1QIQA 3VBRB 4IV3C 1NCRC 2GMPA 1WLDA 3RI9A 4LTAA 1LTEA 3PNAA 4YZ2A 3LEKA 3I3EA 4OHWA 1LNSA 4Q0VA 1UQXA 5EYXA 5FZKA 1RMU3 1VBA3 2GSYA 2VQUA 3BYWA 3NW4A 2WQ8A 4YW4A 3WSOA 4BMBA 1SCRA 3MBWA 1OVPA 2LS6A 2Z5WA 4AVVA 1O59A 4MGZE 3RG0A 2WA4A 2Y64A 5FMDA 3VN4A 1SZBA 1JU4A 3N36A 4X6RB 3ZSEA 3ZPYA 4N53C 1RVF3 4F3JA 5BNNC 4FTBA 1NY72 4COVA 5F37A 4Q2FA 1GZ9A 4QB1A 3THDA 4NOTA 3U78A 1JZ8A 5FRAA 3LPFA 3RZHA 1UU6A 1OKOA 2QDRA 5CKNA 2C5DA 3DKWA 4LO7A 2B7YA 5JSOA 2XLGA 1SPPA 4BK4A 2DU1A 4QPWA 4ZHNA 1BVVA 2R0HA 3MUZ1 4CDWB 3SKJE 1YFWA 3U37A 3USSA 2YFUA 4PDWB 4LOSA 1OD3A 1XU1A 2ZBJA 3I2JA 3AP7A 3GJAA 4DXZA 3ZMOA 3ZM8A 2ZGKA 5FY1A 4Q0SA 1YQCA 5JVVA 4CDQB 1UXXX 4LLOA 1PO13 1W6MA 4LBOA 2C24A 2DCYA 4NRPA 3S30A 3N3HA 4OQ8A 5DDJ2 4HANA 3FMGA 1CONA 4AI1A 3VDBA 4NPLA 1K12A 4CE8A 1S0BA 3RI8A 4DPNA 5FPXA 2YYOA 1JYNA 2WINB 3T2TA 4IEYA 4Q4V1 4MYEA 2B5HA 1MQTA 3SC7X 4E27A 2R30A 1C4RA 4C8DA 1UZ0A 4AYUA 1E5SA 2YBPA 1GNZA 1U5YA 4XBLA 4K21A 5C71A 3NV3A 1XBFA 1CAUA 2JE8A 3RVHA 1AR73 3AMNA 2QQKA 5C3RA 2D97A 1ZREA 1YI9A 2OZ6A 3O0WA 4W6WA 3SMHA 1ZBE2 4O65A 1FNZA 4NWVA 4UYBA 4IEPA 4WVVA 4Z8BA 4QQHA 1Q43A 2Z69A 3A7QA 1EAH3 3JCIA 4EN6B 4L9BA 1AXYA 5FPAA 3TEZA 3POJA 1V6NA 2GDFA 2Q4SA 3FE5A 4DRRA 5BNOC 1DF0A 2BBVA 4MHRA 5IVVA 4AI8A 1RUJ2 4D8MA 3ELNA 3KV9A 3RJ2X 4PF1A 1LEDA 4CA9A 3AP9A 3DXTA 4YGBA 3S0MA 1DG6A 2LRPA 1LKNA 2NZ9A 3ITQA 3VBOA 3CJIB 4R9CA 4UW5A 4XHXA 1DQ6A 3E1F1 3ZPOA 4D7TA 3EB7A 2JG8A 3N9OA 3RWKX 2JXAA 3WNPA 2GC1A 1GP5A 3JU9A 2Y6LA 5GALA 4DUXA 2RS51 1UWWA 1ASJ2 1IPSA 2VZRA 1UL9A 4YVWB 2FDGA 4DQAA 2JKXA 3PIJA 2ZHLA 3TOJA 2ORZA 2WZPP 4C90A 3E6DA 5EV7A 4IXLA 2QJVA 2VECA 2JDNA 5CAZA 2ADDA 3JQWA 4QB2A 1XB9A 2VMGA 2PHRA 4DXTA 4GJZA 1PMHX 1ZZ7A 2WNUB 1Q56A 1AJKA 2AUYA 3K3OA 2EICA 3NV2A 5A3MA 4JRAA 4ORFA 1MS0A 1FV3A 5EPAA 1CAWB 1MS4A 4IEXA 1LOBA 1RUE3 5FLJA 4Y1UA 4EN0A 1UX6A 1FAYA 2ZKNA 3I97A 2JDZA 4LE4A 3IDEA 4QGLA 1UAIA 2WFPA 4DO0A 4LQRA 4P9JA 5DUXA 2D5FA 1HRV1 4YZ4A 3TAYA 4CXWA 3KB5A 1VAKA 3WDXA 3AP5A 4R9AA 1NYWA 1HV0A 4YZ3A 2UY8A 2O14A 4CVUA 1WLWA 2Q0AA 3LOIA 3S7EA 2EXKA 1J58A 1OC1A 3SISA 4N53A 3VDCA 2VMHA 5L7OC 5LW9A 3QCWA 3T0BA 3VZLA 5E8AA 4NWWA 5FJHA 3O7OA 2W95A 3B9IA 1I3HA 4YW1A 4AEJA 3MIGA 5L36A 3T4VA 4Y24A 1H6XA 5FZHA 3ROUA 1RHI2 5T5PA 1ODNA 5A7QA 1OPMA 2CAUA 4FPGA 4G4FA 5FDBA 4PT6A 2R7EB 4AEDC 4A45A 4HFSA 4UW6A 4CDUA 3VKMA 5A6YA 4LKFA 5D8AA 2HWF1 1HB4A 3UGGA 3NV4A 2D3SA 1PO23 3I2GA 1JYWA 4BM8A 2ZX4A 1L7RA 5HV4A 3H9AA 2HEYF 4CU7A 1W2AX 3KVBA 5K0UA 2RMU3 1D7PM 1AR63 4UFKA 1NLRA 4XOGA 4W8JA 1JOJA 2J7MA 5EHDA 3AP6A 3POFA 4EN9B 2RVAA 2OXBA 3OF1A 5A3NA 1GZWB 2WT2A 4AEKA 2BEOA 2ILMA 3VHPA 4CP9B 2EAAA 4COWA 1O7FA 5ISLA 1XSQA 3VDDB 3OBAA 2ZEZA 4CDXB 2WWSA 4QB6A 2PYTA 4Y1ZA 2JB8A 3FFZA 3ASIA 1CZSA 4MGYE 4QPIA 4FP3A 4GB33 5SV5A 3ILFA 5IVBA 1AJOA 4WM8B 2DTYA 2EIGA 2C1FA 1CAXA 2JG9C 2ZPXA 5D21A 5APAA 5C4WA 4C1XA 1SLBA 1RJ7A 4NN0A 4D3WA 2Q1FA 1N1VA 1AYN3 2WZR2 5AC93 1TME3 4S2DA 3ZSLA 4LKSA 4NIIA 1BEV1 1AL22 3WW1A 3AKPA 5BNOA 2ZACA 4A6OA 1AR61 5L9RA 1REFA 5A7WA 5FMOL 1TNFA 4PIYA 3SEPA 5HI0A 1JODA 2C0ZA 2GZWA 2EIBA 3BB6A 3H3LA 5GLZA 1ENSA 5J7MA 4HSJA 4BHPA 4MGQA 2DF7A 4E4SA 4NIDA 4GWIA 1UZVA 3CNAA 4YW2A 4JC1A 2PHLA 1HLCA 2VPVA 4BXFA 2IFWA 3OBRA 3KT7A 1VRBA 1D4M3 1WMFA 4MXWA 1WMXA 5I93A 3BTXA 4FPCA 3BTYA 1Q5OA 2Q8CA 5ABJA 2VE1A 4AZZA 2GALA 1J83A 3F2ZA 3GF6A 4IE0A 1UX7A 4JGZB 2FCTA 4B7KA 2IXLA 4AVCA 1AUYA 3D82A 1AVBA 1VBE3 2CU5A 4JTNA 3ACHA 3HEIA 5IVYA 2CNAA 2DVBA 2FDHA 2P4EA 2OUJA 1O3RA 3HNMA 2YC2A 1LCLA 4L8QA 4M3CA 5KWRA 1H1MA 1QF3A 2E7QA 2TUNA 1ZRRA 4OZOA 3ZXFA 5FKBA 4EE2A 3Q8BA 4AGVA 3WG1A 2HWC2 2E31A 2VMIA 1TME1 3QOPA 1E5IA 3VBFA 4PIZA 3LD8A 1BBT2 3KGZA 4YFZA 4B1MA 1W9YA 2VNRA 2XVGA 3S6PA 1I1EA 4E2GA 4Y26A 1WMDA 3ILNA 3WINE 4ZZ8A 2IVJA 3BOWA 4RFT0 3I2HA 1UIJA 1ALYA 3C3VA 4B8EA 4MGIE 2EXHA 4Y20A 1HN1A 3D3AA 1IHMA 1ZBE1 2SBAA 3FHQA 2Q8EA 1B35A 3N9QA 1WD3A 1W0OA 2WSUA 4B7EA 2ZTNA 2QTWB 1ULDA 2VMCA 2WO2A 4WVMB 2ARAA 5IW0A 3W9AA 2P34A 1GZTA 2ZGNA 5JXIA 1GNHA 4RGGA 2ZGQA 3OY8A 2ZMNA 5FR3A 4QHZA 2P1BA 1DGRA 2WS93 1GWMA 1BK1A 4Q1PA 3PU3A 4D6QA 2C4XA 1VBC1 1DYOA 2JDAA 2ZABA 1DZQA 5D2AA 3TNPB 4AEDA 2RM22 2XHKA 4QU2A 3CO2A 3FLPA 1OHFA 4OFGA 2QFEA 1RXFA 3I3QA 3NV1A 4Q4Y1 3LA7A 5T54A 5GZDA 3THTA 5FOJB 1V9U2 1MVEA 4CDQC 1H30A 2RS32 1COV3 4CU8A 4CU6A 5FFOC 3FBMA 4P9IA 4FTSA 4CEYA 4ZPIA 5FUNA 1NLQA 2BWCA 3VZJA 3LKJA 1ZZ9A 2W47A 5CYYA 1N3OA 2ZGMA 2AREA 1BXHA 3AVRA 3H8UA 1JHJA 3I4IA 1Q3EA 4NUBA 1W9TA 4BQXA 1SG3A 2BW8A 2JWPA 2PLV3 2VUAA 3GHMA 1HRI1 5FMCA 1NE4A 2A6ZA 2NYYA 2YGMA 3CHXA 4XZUG 3RDIA 4RD7A 5DQ0A 1YXWA 3NKGA 2HBUA 3AZZA 4HXCA 1JZ7A 3GBGA 4FTEA 4XTPA 4YVSB 1LAJA 3CEWA 4BWOA 1S0JA 2LUWA 3I8TA 4K40A 4IEQA 5LA1A 1VJ2A 3OGJA 3I59B 3J8F1 2WS91 2HLEA 1MZ5A 3SHRA 2ZOEB 1R081 1W8ZA 4XE9A 4KWLA 4MGTA 1JYCA 1QOOA 2VTFA 1JZ3A 3RS6A 3AJZA 2JEMA 2JG9A 2ZXQA 3WY6A 1C28A 3BGAA 4COZA 4B29A 1V6JA 2WYSA 5FAXA 1Q8SA 5FZ4A 3WF0A 2P37A 5FZ3A 2FDFA 3IPVB 4CEWA 4OI0A 4XJWA 2VM9A 4CP2A 1SDWA 1VR3A 1OQEA 4QT6A 1VBB2 5F3EA 5IFTA 1I6XA 2DTWA 1WW4A 2DVDA 3M3IA 4NHXA 1XNCA 2P5BA 5FBZA 3USUA 3KD4A 3HBKA 3D6EA 3WF1A 1JYVA 3JD72 4RQPB 5ERLA 3UV9A 3BCWA 1ZZ6A 4N43A 5T3NA 3U07A 3WDVA 3WNKA 2GP5A 1AR82 1GICA 5HCBA 4IE5A 4KI5M 3BI3A 2RE9A 5A70A 5CNAA 4YM3A 1OT5A 2VOXA 3CIHA 4AVSA 1EV13 4QXCA 3WCSA 3M4FA 2FD8A 4QDQA 2WNUC 4XDQA 2HWD1 2ZGSA 3VUOA 4NAMA 3VBRA 5T50A 2QQWA 3THPA 1VRH3 4MZUA 4CDUB 4B3NA 4H55A 4K1ZA 1QGLA 3HQXA 1CZTA 2C26A 1PIV2 3HOBA 2D6NA 2P2KA 1AYM3 5IK5A 3OG2A 5F8PA 1JYXA 3FJSA 4P5YA 3RGBA 4KU7A 3MUY1 4JKLA 1YYNA 1FMD3 2EXJA 5K0UB 3OUHA 4LUKA 5E6HA 3THCA 3MICA 4QXKA 1IQAA 2W68A 1ENQA 2YROA 3AL6A 5F2SA 3ZYHA 4LXLA 2HWE3 1JZ4A 1VBD3 2W2IA 1RUF1 3K4AA 3PMEA 3NNMA 1BKZA 1BMV2 2BYVE 2DCTA 1APNA 1UD1A 2R16A 1G6NA 2RS11 2ET7A 3LPGA 4LA3A 2WZR1 5LA0A 2TEPA 1WZXA 4FFFA 2PFWA 1NUKA 5FZ9A 4ASLA 3I2DA 5CVRA 1EPZA 1AL21 5JSRA 3E5QA 2E26A 3D0JA 1S2BA 3LQCA 1FI2A 3KWVA 1WCQA 3BALA 4R4XA 4CDWA 3ETQA 3POEA 4M4RA 4PDWA 4AHXA 5FXXA 4OI4A 1EUUA 1U0AA 3C7HA 4BJ0A 3AKSA 1SCSA 2JECA 1RUI1 2R6QA 4KWJA 2ZEWA 3H42B 1SDDB 2DUQA 2QQPA 4XMIA 2YV8A 1GP4A 5KC6A 3VV1A 2D93A 1ND3B 2ZEYA 4ET7A 3WVJA 3IT8A 3EMRA 1JOPA 1ONAA 5JR2A 3CJXA 2VCBA 3MV01 1E5HA 1RUD2 1ND2A 1QXJA 3K48A 3AYEA 2VTXA 2X5IC 3MV11 4LK6A 1MS1A 4XURA 1AZDA 3URFA 4CDXC 2WFF1 2JDUA 4XQ4A 5DAWA 3V64A 3ZFEC 1DLLA 2XJSA 4JHTA 5LBCA 1W8FA 2F4PA 4XIOA 1V00A 2AGSA 4HN1A 3MYXA 4PQ9A 5FJKA 1YQ5A 3T0AA 4AL9A 3KM5A 5ACA2 3AMPA 5CU1A 3RYKA 2ZHKA 2YG0A 1W2TA 4YW3A 4QHBA 2FCVA 2JDYA 1LGCA 2XJTA 1WW6A 4MV2A 1OQDA 1US2A 4HVRA 3TWIA 1MEC1 5DAQA 4LO8A 1O4YA 3SCGA 2ZGTA 2VBPA 1MACA 2BOJA 2J42A 1W3VA 2QUOA 3AL5A 3IAPA 4XJAA 3W59A 3AJYA 1TMF3 5JR7B 5FYSA 5FKCA 5A3OA 4GD4A 1RMU2 1VBA2 3UETA 3VBFB 3O1SA 2HKXA 3N9PA 2KA3A 3IZOA 3KQ4B 5A7OA 1KFXL 1REDA 3CJIA 4AVAA 4ZONA 4Q8KA 2JICA 2MPFA 1RIRA 2X29A 2DCZA 1RVF2 2XBO3 5CFCB 1X9TA 4IQPA 4RHV3 2O8OA 1N1SA 4EROA 2V72A 4YVWA 2CGOA 3AFGA 4AQ2A 3O0XA 3WDTA 3JQXA 5C3OA 4TTGA 5G05L 1W8OA 3OUJA 1T6GC 4M4PA 1RUG2 2XMLA 3WG2A 4Q4W3 2ETEA 2VVDA 5L9BA 3H8OA 4LBKA 1ENRA 2WNUA 5G04L 2LTNA 2GU9A 3KF3A 2N7GA 2VMDA 2NP0A 5F3CA 3WF4A 1MZ6A 4MUVA 1CAWA 3ENRA 4KG0A 1EYBA 5SV8A 3HAGA 5EYYA 2H6CA 1RUC2 5A80A 4CSWA 1GV9A 3U4SA 4Y5TA 4F8AA 2XUEA 3MIHA 2A5ZA 3MPBA 4QAWA 2R1DA 4NHLA 4RL7A 5JAXA 1JZ6A 5C8CA 3NL1A 2IXHA 4CP0A 3I2IA 4PIXA 3T2PA 2HWB3 3M3QA 4ASMB 3E6BA 3BOPA 2VZPA 2WN3A 1IPJA 3AZVA 4B4PA 2GNMA 2DDUA 2DVFA 4HKLA 2RDQA 2VULA 4JX0A 2LW8A 1UNBA 3OB8A 3N7KA 3UGHA 3CMGA 4N9HA 1NAEA 1W9FA 2OVUA 1LB2A 2VCMA 2P17A 1WW5A 1X7NA 4CPBD 3TN91 2PHFA 5LATA 3HWJA 1AR72 3HQUA 1HJGA 5CB7A 4ZZ5A 2AACA 2WWUA 5EIYB 3PVOA 2OIIA 1WGPA 1DLCA 5BNPB 4RGAA 5C6CA 4BIOA 2QZ2A 4QQLA 1FOD3 3MHZA 2RR13 2W1UA 2WO1A 2WYFA 2J1VA 4SBVA 1ZZ8A 2A71A 1EAH2 2W08A 3N7JA 2VJXA 4YYOA 1U5XA 3MLLA 1X82A 4QX8A 1W0PA 5CZKA 3WF2A 1SQ4A 4CP1A 5C3PA 1X8MA 4NIHA 5JXJA 1CD3G 2J1UA 3ZYPA 3J7NA 3HIFA 3SH3A 2RJLA 1GZWA 1Y4WA 5JI7A 4CP9A 1XNAA 4KG8A 4PQQA 4YNIA 3TBDA 3VDDA 1FPN1 2CL2A 2F6BA 4YVSC 4CDXA 1Q8OA 2XB6C 3WW2A 1SLIA 3MI8A 1SMVA 1Z7S3 3AMHA 2VXRA 4PCRA 4N43B 1R091 5CKMA 4Z2AA 3T1MA 2QZ3A 2YGLA 2VAUA 3BN6A 4PI0A 1PIV1 2A75A 1F15A 4WM8A 4XACA 1QU0A 2WJSA 1LENA 1O8SA 3OD0A 4NHYA 4CCJA 4Q4X2 4Y5Z0 3T1LA 3NO8A 4QX0A 4MHUA 2BPA2 5JOYA 1RTVA 3MIBA 1UF2C 3PUHA 1CESA 1POV0 2OPKA 5C3SA 5BNQA 4XF4A 4XQDA 1EY2A 1NE6A 4X6QB 1A8MA 5FZIA 1DQ2A 4LBLA 1LESA 4RFRB 5EQUA 1ZRDA 2WABA 1H2NA 2RHPA 1X9PA 4XPVA 1WLCA 1PGL1 4AHYA 1KRIA 5IK7A 5FUIA 1JYTA 1DHKB 2ZZJA 5GZEA 5C9AB 4L0PA 4QX1A 1D0GA 5K4LA 4RQPC 4QDSA 1DQ1A 3VHOA 4Q5OA 4PBOA 4HKWA 1JXNA 4E2SA 3BVCA 4U36A 1BQPA 3MFCA 2CAVA 4PLNA 1HIXA 2V5YA 4EN7B 1Z7S1 4JGZA 4Q4V3 3L9JT 3J7MA 3KS7A 3PUIA 4H2AA 4R9BA 2UWAA 4HETA 3S5QA 5FMBA 1XPWA 1JI6A 4BA6A 5KXEA 4Z92B 1WA6X 3RJRA 1GNYA 4GIQA 3AYAA 1N1YA 1PGSA 5E88A 1OLME 4FBFA 4L2NA 1CWPA 3SEEA 4QQ2A 2OQ6A 5DG2A 1HJFA 3FFQA 2WAAA 4MOAA 1UCXA 1IQDC 3AMQA 4CDUC 4D7SA 5D8AC 3E97A 4XABA 1JUHA 1RUD1 1DU3D 3MW2A 2YUEA 1PO22 2DFCA 4WZCA 3R4UA 4A42A 3KHCA 1H6YA 4S2FA 2V5DA 3R4DB 3NWKA 2D98A 3VD5A 1QJY1 4AAPA 5K0UC 2D3PA 1S0CA 2Y6KA 3WZ1A 4RR3B 1P8JA 3ATGA 3IIIA 3MGUA 4XW3A 4WM7B 5F2WA 5LY2A 4AW7A 2EVXA 5AVPA 3N7LA 4WVMA 1YCIA 4MH0E 3ZIWA 1ND2B 4QKFA 1SFPA 4JQRA 3GZTB 1UYXA 3HNBM 4A7ZA 1ZYBA 2RS53 3AXEA 4HK8A 5FY7A 3WF3A 2ERFA 4GB32 4JVAA 2OUHA 2QDNA 4FPJA 4QPIC 5JMCA 3H7YA 1OF4A 2Y60A 3NMBA 4OHXA 4Q0PA 5L9VA 2XJUA 4RA0A 2LROA 4PF5A 1J3PA 5FZ1A 5IWFA 1RINA 5C4WC 5JSPA 1OLRA 4Y4YA 5A6QA 5HXVA 1AYN2 4XFBA 5AC92 5C5UA 3MF6A 1ZRCA 1H8TB 1ND3C 1HQNA 1QNYA 4XZPA 1IGOA 1I5ZA 1LEMA 4XF3A 1UW8A 4PHZA 4QU1A 4YRDA 1NCQA 1QY4A 3JZVA 2HBTA 1RUH1 4PBPA 1UU4A 4GWJA 2Y0IA 3GZEA 1W2UA 1HRV3 1C8M2 4LLFA 3N9MA 1G86A 4XF0A 1XNBA 3WDUA 1QDCA 3JBG2 3ZN5A 1POQA 4YVSA 1C1FA 4C0HA 3A22A 3SKVA 4AOCA 2XKOA 3PTRB 4M00A 3ZSJA 4DNYA 4MXVA 3I59A 3GZUC 5ABJC 3H3ZA 4R4ZA 1H2KA 3BIWE 3WNMA 1V6MA 2GC2A 3P5BA 3Q8FA 4JV4A 5FWEA 3GHNA 1VBE2 4GH4B 1QXPA 1OA2A 3ST7A 3T30A 3WHUA 4ES9A 2BNOA 4XXPA 5IYYA 2BWAA 2X53S 5FREA 3VD4A 2B9VA 3BTZA 1Y3TA 3P6BA 4FQ4A 1G9FA 1QJU1 1UY2A 1TVGA 1QQP1 4XJ9A 2ORXA 1LU2A 5FYUA 1W2NA 1I9RA 1FYUA 3IPVA 4OI2A 2HWF3 1BCXA 1JW6A 1YIPA 2YY1A 2ZMLA 4G3YC 2H0VA 3WNNA 4IUGA 3VBFC 1NA1B 1KJRA 1PGW2 4EWAA 4LNVA 5FY0A 5GLVA 5I8TA 4CCOA 4PLOA 5KXDA 1WBFA 5J36A 1YUDA 5IAVA 3ZYFA 1ULFA 3V0BB 4RQPA 2YZ4A 3FHAA 2VQ0A 1W8NA 2R041 2YPJA 2HH9A 5CFCC 1GANA 2GP3A 3VZMA 4XTMA 3K3NA 4K20A 3FWEA 3SH5A 5CISA 1VALA 5C8CB 1HXS2 1B35C 2SLIA 2RG4A 3ILRA 4AF9A 1O3SA 2OA2A 3OD4A 4XAEA 5LASA 5HBAA 1OOPA 3PTYA 2VNVA 4Y22B 3LEIA 2A3YA 2D3RA 3ETPA 2W91A 1O5LA 1G9CA 3ES1A 4NHMA 4SLIA 2Y6HA 2BTVC 2Y34A 4B1LA 2Q5TA 3A23A 3PVEA 3RZJA 5JXGA 1ZZBA 3VBSB 1YJKA 1UIKA 4I30A 5KHJA 4FPLA 2XXZA 1PVC1 1QJX2 2E7AA 3KSCA 5DABA 3AC0A 3A0NA 1POV1 1QHDA 3C8XA 4HBNA 5F5AA 2YU2A 3WR0A 3GDBA 4HOOA 1V70A 5LY1A 1W6OB 1SBEA 2FZ2A 5LK5A 5KHHA 3VBHB 1MZFA 3DUIA 3PU8A 3O1UA 1NOVA 4BOWA 1S0GA 5AFBA 4ZU7A 1BEV3 4CEYC 4MG2A 5CKQA 1O91A 1W6QB 1XJAA 2EALA 3SITA 3I7DA 1PM7A 4CU9A 1PX3A 4OUEA 3FLTA 2PLV2 3K51A 4Q4X1 3J7LA 5LEKA 4HLTA 1OD5A 1XYOA 1SFNA 1OKQA 4A4AA 3WP5A 5BY5A 2YFZA 1KGYA 4E8DA 3OBTA 3VL8A 1WWYA 2JIGA 3OGVA 2GH2A 3LCPA 3VKNA 5BNPC 1SLTA 1LULA 3H7JA 3HD8B 4K8RB 2W87A 1ZRIA 2X10A 1TEIA 3NNJA 4BQYA 2J1RA 4JGYB 1SLCA 1F35A 2Y8KA 4ITCA 4YLZA 2WNOA 4Q27A 2GMEA 2Y0OA 1G8WA 3AKQA 5A3UA 1QH6A 4XBNA 1V6KA 1V0AA 1GOFA 1VIWB 1BK0A 1ND3A 1NY71 4CEWC 4P9XA 4DXRA 5C5TA 3IM0A 3WNOA 4P00B 5GM0A 5F7UA 1GLHA 5GLWA 2I2SA 1PK6B 4KBBA 3INAA 2ARCA 1JBCA 1LRHA 5DZFA 5FYBA 4YGDA 3ZXJA 5CFDB 2PAEA 4A7YA 4Y33A 1C8NA 5FYMA 2BRTA 1LOEA 4EWEA 2G9GA 4XFIA 3WUDA 3ZFFB 1CPMA 3O1VA 2YB7A 2RDNA 3MZHA 3MDPA 1ZBE3 3QH7A 1T6BX 2IWGB 4N43C 3ON7A 2NPIA 5FP3A 4ES8A 3HN3A 4DB5A 3GXUA 2VOTA 5FY4A 4NO4A 3K75B 4GA9A 3T4HB 3T3YA 2GNBA 5FQ0B 4L11A 4QM8A 3ZXLA 3UT0A 2MEV2 1XC6A 1EV12 1GQHA 1SHWB 2K46A 3SLIA 3V0AB 4XVHA 4QX3A 2BBAA 2Y6FA 2EIDA 2Z4FA 3WG4A 3H0OA 1F31A 5DDJ1 1VBC3 2VCCA 2W92A 4A2UA 4CCEA 5C33A 2W46A 1GU3A 2JE9A 3VBRC 1CGPA 4I0AA 1J1TA 1RXGA 2E51A 2IUWA 3N35A 4KMQA 1PZ9A 4Q4Y3 3TEXA 3V65A 3VKFC 4MX3A 1O3QA 2VZVA 4OLLA 3T08A 3LB9A 2YBKA 2BFUS 3ZSMA 4QQOA 4DINB 2QBXA 1A34A 3O0VA 3T0DA 4ZU4A 1AYM2 1HB3A 2WRAA 3M3OA 4IGOA 1NQDA 2XJRA 3VD3A 3NJXA 4IESA 4LA2A 2V4AA 1FMD2 1RITA 1JUIA 3J26N 2BVBA 3NKTA 3H50A 3ZX7A 1UKRA 5CFCA 2XQRA 2HWE2 1DZRA 3LSDA 4QX5A 1HRI3 4E2QA 4P9YA 3U1XA 2FDJA 4M3CF 2ZJCA 4ZY9A 1GWKA 4B4QA 2A7AA 3ZN6B 5FZ8A 2XLFA 4O7XA 2BQPA 4IETA 2GMMA 5FZCA 5A1AA 1W8HA 3M3CA 1W8WA 1F8VA 2JIJA 4AFCA 2JDMA 3J8F3 5BPXA 3ZKYA 5FYZA 1R083 1RUJ1 2ZEXA 3FL7A 3IIAA 4FPYA 3ZR5A 4CUBA 4V2WA 4CDWC 4LUMA 4NHKA 3ZDVA 5FWJA 4PDWC 4BQWA 3ZYIB 3DPRA 1VB4A 3EHKA 3DYPA 2H0BA 4HT1T 5DZGA 3MF9A 4AI9A 1OLMA 4MGSA 3VD9A 3LWCA 4LBNA 2Y6JA 3WQ7A 2QQLA 4P9GA 5JZGB 2E7TA 3AZWA 4UFJA 3U4XA 1ASJ1 4RGKA 3NAPB 1YQ6A 3ZXDA 5HCAA 1GSLA 2WNVB 2YU1A 2GNTA 1NCQB 3ZYRA 4E4DX 4K6BA 5FYVA 3H1YA 4IEUA 5HXMA 4J25A 1ND2C 1O8PA 3QH6A 4OMDA 2W39A 3HR9A 4I09A 1ZRFA 1W9WA 4LITA 2R32A 4QKBA 2AEYA 2F4LA 2V4VA 4D0QA 2PHUA 4G9SB 4YM0A 1B09A 1ACCA 1Q8VA 4EQVA 2Q1MA 4V2VA 4XILA 3WP6A 2JDKA 5A3LA 1FXZA 2G9ZA 4LJHA 4S2GA 1IS5A 4XYXA 5BNPA 3NSTA 3VBUB 4TSVA 3WHTA 4AWDA 3B5LB 2E33A 3FUOA 4M0HA 1WKYA 2AC1A 2ARBA 4LT5A 3VDAA 3SQOA 2HWD3 2W5FA 1N47A 3ZXKA 5BV6A 1BVP1 1UO9A 2EXIA 2GC3A 2QNKA 1GQPA 1AHSA 1H4HA 1HXS1 1TMF2 2ZGRA 4XIKA 2XUMA 4LIUA 5H9RA 4E9KA 2VW2A 1N1TA 1YFUA 1S2KA 3IB3A 5A3TA 3POBA 2CTVA 4ZS2A 4DIQA 1LOFA 2QQOA 3W5MA 5J3UA 4YWAA 3K4ZA 3LEMA 3T2OA 3H8XA 1UYPA 3JUUA 1KS4A 4GMP1 1W99A 1RHI1 5DG1A 3BODA 3CJIC 5K9YA 1H8VA 5I0RA 5FYIA 3CZUA 2XVLA 1M4WA 3TRSB 1L3JA 2XBO2 1QJX1 2WDBA 1RC6A 4OHVA 2HEVF 4E4HA 3E6CC 1ST8A 5FXZA 2DUOA 4I2OA 2W1QA 1W39A 2X8KA 3CBNA 4YPJA 4ASKA 5JUVA 2XWJB 1RUF3 5A32B 4YVWC 2XHNA 1XQNA 2RS13 2A3XA 3GCXA 3M8LA 3VZNA 1OOPB 2VZSA 1JS9A 2WZR3 2WUHA 5FIXA 1CAVB 1ZBA2 5GLUA 1IS3A 4IV3B 4Q4W2 4R9DA 1NCRB 5IK4A 1AL23 3A21A 1F5JA 4WVZA 3OUIA 1KD7A 5JOXA 2R072 3UL2A 1GFF2 1VAVA 4XAAA 2BERA 4BLIA 4DY3A 4QXHA 4KNCA 2WBKA 3JXSA 4PJYA 1OUSA 1OVSA 1D0HA 4ATEA 4QKDA 1DGRN 3D8CA 2DWRA 2E6VA 3ZXAC 4COYA 1RUI3 4IGPA 1QEXA 3N7MA 4Q0UA 1JH5A 1AX0A 2VUJA 3HT2A 5C9AA 1DCSA 5I0UA 3RSJA 3UKVA 5BNNB 5LWBA 4L92A 3DKQA 3KCCA 3PUAA 1R1A2 2YHJA 2WKKA 2CDPA 2CYFA 5C8CC 1NQJA 4QXBA 2KR2A 1JZ2A 3K46A 3WNXA 2XQXA 5F32A 2ZHMA 2W9XA 2KD7A 4UW3A 4UOJA 4OULA 2VW0A 2WFF3 5D1IA 3H1WA 5FZLA 4AFAA 1CIYA 4QD2A 4YGEA 1XSRA 3S57A 1Y9GA 2VUCA 1QOSA 5JWPA 4META 4I0BA 3PVNA 3QACA 5H9SA 3VBSC 4BXSV 4QX7A 2QVSB 4UFLA 2W3JA 3UESA 3KF5A 3ZYGA 1VMHA 4LKDA 3RPQA 2Y38A 2Y6GA 3MIDA 4BK5A 4LULA 3POSA 5A33B 2RR12 2DBIA 2CY6A 2HYXA 1MEC3 1GR3A 3HBZA 5CBLA 4BPZA 3VBHC 2K0GA 2NMNA 5ANNA 4BH9A 5IJRA 2EIEA 2PN5A 1WMEA 1CQ9A 5I0TA 4ARYA 1OH4A 3RNSA 2EA7A 1BYHA 4RR3A 5IHRA 4L97A 1UOBA 4A44A 3MPPG 1AR92 4C0BA 4YW7A 4HKOA 1DZTA 1E5RA 2JDHA 2WT1A 4KGGA 5C3QA 4WM7A 2IFRA 3R0RA 4FCAA 2DU0A 4IDZA 4GALA 2IXKA 4XHBA 2VD7A 1HQLA 5B4XA 3PURA 4FFHA 3VDDC 1IG3A 2BJSA 1J84A 1LHVA 4PLMA 1Y43B 4HK9A 2ID4A 2K9ZA 2R062 2HWC1 3B3QE 2XJPA 2XLAA 2UYAA 2PQQA 2UWCA 2ES3A 4HN0A 4OYUA 4DEQA 5L19A 2A6YA 4LK7A 1BBT1 4YZ1A 1YLLA 4WM8C 3WX5A 4BE3A 4GAZA 3I3DA 5E89A 4AGGA 1GUIA 1YWKA 2W94A 2QQIA 4HL0A 5IUQA 3SNMA 2VC9A 1CX1A 4I3PA 2BOIA 4ISQA 2PMWB 1WCKA 2D6KA 1YC61 1H8TA 3FZ3A 2JE7A 2VVFA 3MO4A 4GZ9A 4K9SA 4BYYA 3PLQA 2B45X 1ULPA 1R64A 2A70A 2QKDA 5FP7A 1UYZA 1ULCA 4RS5B 3S5AA 2D43A 1HW5A 5ANQA 4FPFA 1PK6C 4DZGA 1XNDA 5FXVA 3MEPA 4CRQA 5BYNA 4ZXEA 5KXBA 2WSVA 4M0NA 4RYDA 1LHOA 3N9NA 5JIUA 3POIA 1VMJA 4UFMA 4K7JA 1OA4A 3IMMA 5AVAA 2PHDA 4QWNA 5EWSA 4TYSA 3UJQA 3VD7A 1KDKA 3LFIA 2RM21 4YW6A 1W8TA 3WDWA 1PM4A 5IVFA 2GN7A 3QBQA 4Q4V2 2W52A 4JGZC 5FP9A 4TZDA 1QJEA 4IL7A 4GH4A 3EO6A 1V9U1 4OZXA 3LDRA 5GZGA 2XDVA 2RS31 2VOKA 3HJRA 2VNGA 2JKBA 4UBHA 4DRVA 1AX2A 3GCWA 1Q8QA 3TN93 3B93A 5B4NA 4FVVA 2YC0A 3AX4A 3UGFA 3UKNA 5A6ZA 2NM1A 2R0FA 2I74A 1PMJX 1WCSA 5CIRA 2VW1A 5A7SA 4IEZA 1NA1A 3ZYBA 2DV9A 2DVAA 2NMOA 3LA3A 1QMJA 2VH9A 3DPRB 3OBZA 5HPOA 4GXLA 2KXLA 3LIGA 2PQSA 3IDBB 3ACFA 3V0BA 1AR83 5JPMB 1JZ5A 1AXKA 3RRDA 1PO12 5L7OB 1K5JA 3GGLA 3EQEA 2CSGA 1H1AA 3I3BA 4IE6A 4NRMA 4O9GA 4LBQB 3CU7A 4B4RA 3P3PA 1IG0A 3K77A 1NXMA 2PELA 3MW3A 5FZGA 4AQTA 3AMMA 5FPVA 5H9PA 4Y22A 5FBJA 4URAA 4XFFA 3IDAA 1FPN3 2VZ1A 3WQ0A 3N9LA 5FOBB 2VZUA 4N7IA 3PIGA 4IGQA 4XFHA 3RZLA 3KHBA 2RS52 4IE7A 5HCFA 1Y7BA 3D5OA 2AENA 1R093 3VBSA 4DXSA 2IXJA 5DAPA 2CV6A 1PIV3 4AE2A 1VBB1 3OJBA 3KGLA 4D69A 3G6JB 5HCHA 1XXNA 4W65A 4BQ1A 3HN1A 4NVPA 4TXWA 3JD71 1W6OA 4DUWA 1CVNA 4XDOA 1Z0HA 2JENA 1UZZA 3OOXA 4BQ4A 2J1EA 3VBHA 4J6GA 3OEAA 2DCKA 2ENRA 3RMYA 2E9QA 1AR81 3CKHA 3NAPC 1SEFA 4CCMA 1W6QA 1H4GA 5DN2A 2UYBA 2WNVC 1DGWA 3FUQA 4JRLA 3UYJA 2D5HA 4AI2A 1NCQC 3ZR6A 3A4UA 3SH4A 3Q8CA 1BHGA 1CZVA 1PMIA 3C7FA 2QQUA 4K8FA 5FPZA 4H7MA 4AHZA 1S0FA 3LOBA 1GWLA 1E57A 1Q8PA 1UU5A 5FZ7A 4YG6A 3LFMA 4LBQD 4AQ6A 2XR4A 1IZ3A 4GULA 3ECQA 3H3UA 3MLKA 4DEVA 4FOQA 4J1XA 1FNYA 1K5MA 3CQOA 3SCHA 2JJ6A 4JGYA 4DUVA 3NNLA 3GM8A 4XETA 1H9WA 1PZ7A 5DZEA 5A6XA 2WAOA 2A6XA 4MVTA 2OS2A 4HMZA 3RWNA 1SBFA 4WVWA 1YNAA 5F1RA 1NKGA 2JB4A 1A3KA 2PHTA 3VKOA 1OH3A 1RUD3 3GALA 1YFXA 2L9LA 2RDSA 5J37A 2FQPA 3OYWB 1RUE2 5KR7A 2ZAAA 1RUNA 3HVDA 1BMV1 1XNKA 4UXAA 4MSVA 1PK6A 1IKPA 4QPGB 5CFDA 4XJZA 1UY4A 3TYJA 2IVIB 4HSLA 3O5SA 2BV4A 3WQBA 1QJY3 4LHNA 4JAAA 3ZFFA 5JDBA 1XE0A 2WO3A 5FPLA 1LGBA 3RFRA 4NJ4A 5FYYA 4IEWA 5BXXA 2Q8OA 5EJ1B 1UY0A 4XF9A 5LA9A 1OOPC 2OW4A 3OGGA 1H2LA 1UMZA 3VLBB 5FQ0A 2WIIB 4XUTA 4ZU5A 5A7NA 4UFIA 2VQAA 5KHIA 1HV1A 3V0AA 2W1SA 2ZX1A 3KCXA 1A78A 4CCKA 4CUGA 2GAUA 3NQHA 4UT5A 2OKXA 4EV0A 1AR91 4YG3A 5F39A 4CCCA 1H1IA 4Z82A 3O1TA 4QQPA 3O1PA 2WA3A 4ISRA 3BPSA 1KJLA 1GYKA 3HNYM 4ZS3A 3CDZB 4COUA 5LCWL 3I49A 1N3PA 4CTEA 1NG0A 2XOMA 2ARXA 3ZKUA 1WUVA 5GLTA 2R061 1J3QA 2IXIA 4D7YA 1WD4A 1D2SA 4XCAA 1BEV2 2ZGPA 5CA6A 2RMU2 1OMIA 1LU1A 4V1PA 1AR62 1GOGA 2OX0A 1KQRA 1J1LA 4UBGA 4XBQA 2Q8DA 5DMYA 1RUH3 1UXZA 3M7AA 5ACA1 1RUG3 1MS9A 4FOWA 2VMEA 2A73B 2QQNA 3H8RA 2NN8A 3ZN6A 3DN7A 5FZOA 1GP6A 1O3TA 1W6NA 3BPZA 2BDRA 3NVCA 4J1WA 3ME2A 5DXDA 2DFBA 4P14A 1OA3A 3NRUA 5IAXA 5E1RA 3ZXGA 3APBA 1FT9A 1YO8A 5T5JA 4WZFA 4JKKA 5FCCA 4P5HA 3VB9A 3WD5A 1RUC3 4YSFA 2HYKA 3ZSKA 1MVQA 1RMU1 1VBA1 5FK8A 1KXGA 3BU7A 5J98B 2WL1A 3J4UH 3ZLIA 4Y3OA 2D40A 4OQ9A 4AG4A 1OUXA 2D6OX 3HMYA 4Y1YA 5JLVA 3R6SA 3W58A 1CN1A 3PDQA 1QJU3 5JCTA 1QQP3 1U5ZA 3AK0A 1RVF1 1JTZX 3I2KA 2WZEA 3LF7A 3U75A 2P6CA 1UOFA 3M2MA 1TME2 4CXXA 5JZGA 4XUNA 4BZ4A 3NAPA 3MIEA 3NNGA 4A7KA 1UMHA 1S1AA 2WNVA 3DF0A 5F5IA 1OURA 1YJLA 2YDEA 1PNFA 2XJQA 1JN2P 3OSDA 4N90A 4Y1VA 4HVQA 2A6WA 4LORA 5LBFA 4XQWA 1RUG1 3BIEA 4W4ZA 1NZIA 1HN0A 5EP9A 1UY3A 4HPKB 1JOBA 2VTXJ 2R043 5DUVA 1T2XA 3WLUA 2BNNA 4OVEA 1IKQA 1W28A 3O12A 4CUAA 2BGOA 3E5XA 1D4M2 3LA2A 3N4MA 2ZS6B 1L7QA 3F95A 4RSUA 5LEJA 2I45A 4Y5SA 3VBUA 1RUC1 4WBBA 3J7HA 2DCJA 1LGNA 5J1XA 4LPLA 2ZHNA 1PO11 5CEHA 3ZVXA 3OGRA 4HVOA 1C1LA 4KH9A 4DFSA 1MZEA 1VBC2 1X36A 2ZA9A 5F6LB 2JD9A 2O8QA 4URTA 2ZGUA 4XFCA 4DOUA 1BLZA 1PVC3 1ZZCA 3T09A 1XU2A 4IE4A 5I8YA 4N9IA 4Q4Y2 4OUSA 4RS5C 1POV3 5H9QA 3C2UA 2BNMA 1C57A 3WXPA 3LZZA 2B8MA 3SXWA 1DYPA 3ABZA 4FAHA 1AR71 4JKMA 1O4ZA 4JDOA 3RZKA 1D4VB 4Q4X3 2UWBA 1HRI2 4FFIA 5T5LA 5T55A 5A32A 2B9UA 2ZGLA 3A0KA 3RZZA 5B2GB 3VHNA 1DQ0A 3B02A 1CAVA 2B42B 2XL9A 3ALQA 3B01A 4O61A 4UF0B 4W6XA 1EAH1 2Q1ZB 4LKEA 4IV3A 4FPOB 3WV6A 1NCRA 3BU0A 2XJVA 3UNPA 3UKTA 2GN3A 2D6LX 3J8F2 3O1RA 2WS92 1CX4A 5F3GA 4NIAA 1R082 4E4ZA 4DS0A 3PJYA 1L7LA 2DVGA 1PZ8A 4XXAA 4ARXA 3MFAA 1W0NA 2UU8A 2Z79A 5FUPA 4R52A 3DPRC 1NX9A 4BU2A 4U2AA 5FYCA 2C6SA 4X8NA 2VQTA 4FPKA 5FP4A 3AZYA 2X05A 2VZTA 5BNNA 5F5CA 5FV3A 1COV2 1ZA4A 4EN8B 1GOHA 4Z07A 4KGQA 2MNGA 3ZXEA 1VP6A 3U11A 2O1QA 2P3IA 3W21A 2BP6A 4CCDA 3R4SA 3I2FA 4GMP0 4AR2A 4TN7A 5JIAA 4KWKA 1OF3A 4FPHA 4YW5A 3RYPA 1GMMA 3AYCA 4Q0QA 1DDLA 4XJUA 1UPSA 2FDKA 1J59A 3VGIA 1OQ1A 4LHLA 1GZCA 3MIFA 3OGSA 3JB4C 1KFUL 5FTTC 1RUE1 1WBLA 1LHWA 3FLRA 5F3IA 1F2NA 3B7MA 3VL9A 5F5QA 1KITA 4QDRA 1K5MB 4DMIA 2R49A 2ZCWA 5A33A 3TB0A 4XC9A 2WC2A 2VVEA 2HWD2 3AYDA 5DDJ3 5GZCA 4OHYA 4N8MA 4LO6B 2XWBB 3OPTA 5FMOS 1H2MA 1S0EA 4AVBA 4JDMA 2PHXA 1VAMA 2O0OA 1W6PB 1WCDJ 2X5IB 4GWNA 1XE8A 4A3XA 1LOGA 5E16A 1LOFC 1XNTA 5FY8A 5JOWA 4XUOA 3RMXA 1MPXA 1SLAA 2HEWF 4Y1XA 4IV1B 5DUWA 3ZFEB 2CGNA 1LHUA 3OCPA 4OMCA 3IKWA 4FP2A 2F17A 4Z1VA 1U5IA 3AVSA 3QLQA 4XCBA 1HKDA 3UK9A 1X33A 2OYZA 2VY0A 5IVEA 1XRUA 5A3PA 4JDNA 4K3UA 1RUF2 4QPYA 1ZVFA 1LODA 2D6PA 3B9CA 2HJIA 4FOYA 3ZYJB 1PO21 2PAKA 2RS12 2XKPA 3JB8A 4AFMA 4P02B 1K42A 1AXZA 3MLJA 1TQ5A 3POYA 4Q29A 3I2OA 5LRRA 3KMHA 3DEMA 3D4KA 5EXOA 3ZFGB 1CJDA 2QE3A 2RMU1 4H14A 2PHWA 4HONA 3KQRA 3C7EA 4QGNA 4NROA 4BCUA 3LIHA 1RUJ3 2VL4A 1DFQA 4C91A 1OXCA 3EJKA 4KL1A 1HB1A
chains in the Genus database with same CATH topology
1W9FA 4LK7A 2JWPA 3ZYBA 4CP9A 2O14A 4CPBD 1W8WA 1OH3A 2KR2A 4AL9A 1GWLA 1OKOA 1W8UA 1GWMA 3ZYHA 1WMXA 4YW6A 1W8TA 5D21A 4YW7A 4YWAA 1WZXA 4LKEA 2WYFA 3ORJA 4BQ2A 4BQ4A 2LRPA 2Q1FA 2VXJA 4BQ3A 1HN0A 4LJHA 1V0AA 1W8ZA 1WCUA 4LK6A 3UT0A 2K46A 4CPBA 4CP9B 1UOJA 4LKDA 1L7LA 4A6SA 2LROA 1GWKA 1W90A 2C24A 3ZYFA 4LKFA 3F95A 4BQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W9F A;  4LK7 A;  2JWP A;  3ZYB A;  4CP9 A;  2O14 A;  4CPB D;  1W8W A;  1OH3 A;  2KR2 A;  4AL9 A;  1GWL A;  1OKO A;  1W8U A;  1GWM A;  3ZYH A;  1WMX A;  4YW6 A;  1W8T A;  5D21 A;  4YW7 A;  4YWA A;  1WZX A;  4LKE A;  2WYF A;  3ORJ A;  4BQ2 A;  4BQ4 A;  2LRP A;  2Q1F A;  2VXJ A;  4BQ3 A;  1HN0 A;  4LJH A;  1V0A A;  1W8Z A;  1WCU A;  4LK6 A;  3UT0 A;  2K46 A;  4CPB A;  4CP9 B;  1UOJ A;  4LKD A;  1L7L A;  4A6S A;  2LRO A;  1GWK A;  1W90 A;  2C24 A;  3ZYF A;  4LKF A;  3F95 A;  4BQ5 A; 
#chains in the Genus database with same CATH topology
 1C8M 3;  2AR6 A;  4FO9 A;  4EJR A;  4RS5 A;  2UY9 A;  2XON A;  5FY9 A;  1VRH 2;  3POW A;  4Q1R A;  3LGR A;  2YXS A;  4AXO A;  2IZW A;  4BLJ A;  1YRZ A;  3JBG 3;  4QPG C;  3KV4 A;  1RUI 2;  2XVK A;  4AGR A;  2LAL A;  1EPW A;  1QJF A;  1KEX A;  5C9A C;  3Q8A A;  3PHM A;  4OUM A;  2RJ2 A;  2WT0 A;  3PUS A;  4LHS A;  1PVX A;  1XYP A;  2C9A A;  4KWU A;  5IVC A;  1ASJ 3;  2E32 A;  4GB3 1;  4LR4 A;  5FZD A;  2G4I A;  2DUR A;  4CPB A;  1VBD 2;  3HPN A;  3GNE A;  3L2Y A;  1W04 A;  2B4K A;  2VNO A;  3R05 A;  2WFF 2;  3O1O A;  3KLS A;  4CYD A;  1AYN 1;  1QWR A;  1SPP B;  2P3J A;  2WQ4 A;  5AC9 1;  5CG8 A;  2RV9 A;  4QKN A;  5FZO B;  1HDK A;  1OLQ A;  1W6N B;  5I0S A;  2JD4 A;  3DEC A;  3RZM A;  1V6O A;  2C9K A;  2CWS A;  4KU8 A;  2E63 A;  2LM3 A;  1UOG A;  4D6S A;  3FC0 A;  2BFU L;  4JQT A;  1ULG A;  1C8M 1;  2RDR A;  3WT3 A;  1W6M B;  3I54 A;  1W03 A;  1MEC 2;  5FZ6 A;  3S7I A;  3U10 A;  1IPK A;  1KDM A;  2FZ1 A;  3EXU A;  1N3Q A;  3JBG 1;  5JPN B;  2KM2 A;  5FZ0 A;  1D4M 1;  1NT0 A;  1HXS 3;  1S2E A;  1EUT A;  1S0I A;  5L7O A;  1LEC A;  4UAP A;  2BU9 A;  4FQZ A;  3W5N A;  1DIW A;  4LBQ A;  4RR3 C;  5F6K A;  3GBW A;  5CG9 A;  1MQT B;  1F4H A;  3AFK A;  1VBE 1;  3K2O A;  4LIV A;  4YM1 A;  5KHG A;  4WM7 C;  1YHF A;  2YBS A;  2IC1 A;  4GMP 3;  4GJY A;  1RHI 3;  4CCN A;  3IMN A;  1CAU B;  1OPO A;  4LBJ A;  4Q26 A;  2H6B A;  3J9S A;  1DBN A;  1MS3 A;  1QJX 3;  1VB2 A;  1I5P A;  1PNG A;  1SAC A;  4LBM A;  4BB3 A;  3CF6 E;  1JYI A;  3TEW A;  4QX2 A;  4YM2 A;  4QGM A;  2YPD A;  4JCK A;  1ENX A;  1UPI A;  2WO7 A;  4NPR A;  1PGW 1;  2VXJ A;  3PVB B;  3KVA A;  3PJQ A;  4NR1 A;  4XDP A;  1RYY A;  3WW4 A;  5K7P A;  1ZM1 A;  1UYY A;  1OSG A;  4TWT A;  4AHW A;  4LO4 B;  1PX4 A;  2J1A A;  2AZ5 A;  2QQV A;  3NJV A;  4FFG A;  1GQG A;  1ZX5 A;  2ZZQ A;  2CGP A;  3KT4 A;  4NMI A;  4CZS A;  2WR9 A;  1O6U A;  1ZA7 A;  4BQ5 A;  4ZKT B;  2WQZ C;  1H8T C;  1NLS A;  4H3W A;  2XL7 A;  2NLR A;  3E5U A;  3B00 A;  3IDC B;  4HZF A;  3KV6 A;  2P3K A;  1STM A;  3X29 B;  3NJZ A;  2TBV A;  2VUD A;  4FPE A;  3VBO B;  1ULE A;  4S2H A;  5FO9 B;  2JG8 B;  1IS6 A;  2BUK A;  4XJ8 A;  1FAT A;  4CXY A;  1J3R A;  2V73 A;  2VCA A;  4ONU A;  3WOG A;  3DV8 A;  1UZY A;  4BQ3 A;  4JTO A;  3NNF A;  1WCU A;  3ZDS A;  2ZX0 A;  4AI0 A;  3ACG A;  2JDP A;  4EZ4 A;  3K4D A;  2G9F A;  4RHV 2;  3MW4 A;  4CCL A;  5J09 A;  5LZ6 A;  2A3W A;  2VOW A;  1G9B A;  3Q8E A;  4Z2W A;  1LOC A;  3DXU A;  3LDK A;  4P9L A;  4GH4 C;  5C8W A;  2QCS B;  1COV 1;  4ZXK A;  4N7U A;  2PTM A;  1C5I A;  1URX A;  3AXD A;  4XFG A;  2QQJ A;  4O9E A;  4IW3 A;  3TN9 2;  2WN2 A;  4TLF A;  2XH6 A;  3TEY A;  4NIG A;  3AKR A;  1Z78 A;  4LEJ A;  4AQS A;  2PLV 1;  4FXK B;  1MS8 A;  5FZM A;  1NA1 C;  3OYW A;  4F83 A;  4R8H A;  1LJ7 A;  3OPZ A;  4QPG A;  3LSE A;  3OEB A;  1RB8 G;  2G1M A;  1UZW A;  1UOJ A;  2OQ7 A;  1DGW X;  2B46 X;  4N53 B;  1TE1 B;  1H0B A;  3TNQ A;  3WQ1 A;  3AM2 A;  4AFB A;  2E53 A;  3BTA A;  4FAG A;  3AB0 A;  1RGS A;  5FZB A;  5F9T A;  2WZ8 A;  2V09 A;  2ZKL A;  2MEV 3;  4LE3 A;  3UJO A;  3RZG A;  1TZO A;  1W05 A;  2HWB 2;  3P3N A;  3U0Z A;  2YMZ A;  1FPN 2;  2ZAH A;  4FT8 A;  4W6Y A;  1BJQ A;  1US3 A;  5FK7 A;  2VZO A;  4AFD A;  3EYP A;  4E8C A;  1RJ8 A;  2A6V A;  2ZX3 A;  2WNE A;  2HWC 3;  3WG3 A;  5D8A B;  2VZQ A;  1IOA A;  1R09 2;  4LO5 B;  5FLI A;  4OI1 A;  1OFN A;  5FP8 A;  1ULO A;  4QM9 A;  1BBT 3;  3LDB A;  3BKZ A;  5DUU A;  1SFY A;  2K2S A;  4FXG B;  3WP4 A;  1W3X A;  1CR7 A;  2VZ3 A;  1K3I A;  4I0W B;  1RUO A;  2VMF A;  2WLQ A;  4FOV A;  3ZIX A;  1GBG A;  1W06 A;  2PAM A;  2VBD A;  1FOD 2;  1O4T A;  2Q30 A;  3O14 A;  4UW4 A;  4X8P A;  2XG3 A;  3BUC A;  1O5U A;  4GKX A;  2AEZ A;  3FN9 A;  2G19 A;  4PI2 A;  4I01 A;  3FBY A;  4EYU A;  3AZX A;  3Q9O A;  3IN9 A;  1QDO A;  5KBF A;  1GKB A;  1SBD A;  3WUC A;  4UFH A;  2GH8 A;  3G7D A;  1PGL 2;  4NRQ A;  5TSW A;  5FY5 A;  2DYC A;  3VKL A;  3ZO0 B;  2UUR A;  1FX5 A;  3IBM A;  5I91 A;  3CLP A;  1WA4 A;  2MEV 1;  1FV2 A;  1EV1 1;  3IAQ A;  3VHR A;  4XEZ A;  5LRS A;  2MHF A;  3L2H A;  5HV0 A;  3V56 A;  5IFP A;  2VG9 A;  1R1Z A;  4QPI B;  2WWJ A;  3LE0 A;  4A6S A;  2WLP A;  2FMY A;  5KHK A;  1W90 A;  1ZNP A;  2JX9 A;  3GZA A;  3HT1 A;  2RM2 3;  2OT7 A;  3GJB A;  1VRH 1;  1Z7S 2;  5FZF A;  1HX6 A;  5FYT A;  2ATF A;  3POG A;  5T52 A;  1CAX B;  5C4W B;  3B69 A;  1REE A;  4CDQ A;  5FPU A;  1V9U 3;  1K5M C;  1QKQ A;  3GBF A;  5EFU A;  3C7O A;  3WW3 A;  2CHH A;  2FMD A;  5C7G A;  1AYM 1;  2RS3 3;  4JGY C;  4AEM A;  4NPM A;  4XUQ A;  4XUP A;  3C7G A;  5K8S A;  2GC0 A;  2IXC A;  1FMD 1;  5I8S A;  4YGC A;  4A3Z A;  4M01 A;  4ATF A;  1AX1 A;  5BNO B;  5A7W B;  3KV5 A;  2BVV A;  1S55 A;  2HWE 1;  4MAD A;  1VBD 1;  1WW7 A;  3HQR A;  5IVJ A;  3WEZ A;  2I07 B;  5A1F A;  3OTF A;  4I02 A;  1JHN A;  4JHZ A;  1EP0 A;  3CL1 A;  4IV1 C;  4XFA A;  1QNW A;  5EJ3 A;  3EBR A;  1X8E A;  2CDO A;  5CFD C;  4QHO A;  4OHZ A;  3WNL A;  5FZE A;  1CJP A;  4BDV B;  4MXW B;  2XPJ A;  1QJY 2;  1C5H A;  2AH2 A;  4RN5 A;  4HPK A;  1TG7 A;  1F9K A;  4A41 A;  5ABJ B;  5IK8 A;  3ZFF C;  3QD6 A;  1G9D A;  1VLN A;  3ACL A;  1CPN A;  1PHM A;  3ZMN A;  3IWZ A;  1VE0 A;  3DCQ A;  4LOT A;  1DQ5 A;  2B39 A;  2ADE A;  1QJZ A;  2D7F A;  1SLL A;  1OBN A;  3ES4 A;  5KXC A;  1YEW A;  2VO5 A;  1X50 A;  5A3W A;  4IER A;  4M3C B;  3WP3 A;  1BZW A;  1DP0 A;  3ZFG C;  3ORJ A;  5DAX A;  3LAG A;  3FHI B;  4JZR A;  3WDY A;  3ZN4 A;  3B94 A;  1NZC A;  2PA7 A;  1H9P A;  4Q8L A;  5IAT A;  1YI7 A;  3W20 A;  2YC4 A;  1G9A A;  5LK7 B;  1UY1 A;  2W1W A;  3OPW A;  2PXJ A;  3AP4 A;  5DAV A;  1XYN A;  5LB6 A;  5FZA A;  4AI3 A;  2VBB A;  2A1X A;  1AF9 A;  1VBB 3;  4NE9 A;  3M3E A;  3DGT A;  5C70 A;  2Y33 A;  1G7Y A;  2J1T A;  5GZF A;  3U14 A;  1F4A A;  1YFY A;  1NXD 1;  3JD7 3;  5FPB A;  1Y9M A;  2D6M A;  4AVT A;  4KBZ A;  4Y20 B;  3RYR A;  2ET1 A;  3VZK A;  4YAR A;  4HG6 B;  2CWM A;  1A6C A;  1F5F A;  1B35 B;  1YIF A;  1YQ2 A;  5M0T A;  2X09 A;  2XGX A;  2BGC A;  5LA2 A;  4MLO A;  3H1M A;  4KQ7 A;  1RUH 2;  1WLT A;  5J48 A;  1ZBA 3;  1DGL A;  2ZMK A;  4GQ7 A;  5FXW A;  5EJZ B;  1S0D A;  3OY8 B;  4FI9 A;  4IEV A;  1XE7 A;  4K1Y A;  4FSJ A;  1ODM A;  1Y9Q A;  4XF1 A;  2R07 3;  4NAO A;  4UF0 A;  3DL3 A;  2R1B A;  2QQM A;  4QMA A;  1CIW A;  2ZX2 A;  4W50 A;  4BIF A;  4DY5 A;  4D94 A;  1RL3 A;  2Z42 A;  2J1S A;  2VR4 A;  1TMF 1;  4UWD A;  4AED B;  4EZH A;  1D2Q A;  1C3H A;  2BZD A;  4CUC A;  1S4C A;  2Y26 A;  2OPW A;  5JOZ A;  1W8U A;  1XOY A;  2EAK A;  5FLH A;  4TLG A;  1K45 A;  1JU3 A;  1OI6 A;  4AAX A;  3O1M A;  1R1A 3;  4F7Z A;  3KCY A;  4CEY B;  1MR5 A;  3VZO A;  3ACI A;  1QJU 2;  2ZGO A;  1QQP 2;  1TNR A;  4BQ2 A;  4L99 A;  1UN1 A;  1VMF A;  2XBO 1;  1QOT A;  3D0S A;  2NQY A;  3PUQ A;  4RHV 1;  1JMU B;  4IND A;  4MO3 M;  5JZG C;  3DYO A;  4LHK A;  1KS5 A;  3AKT A;  2GND A;  3LEG A;  3M1H A;  1AL0 G;  1MQT C;  2BGP A;  4GWM A;  5L73 A;  3ZOI A;  5CAD A;  5KC5 A;  5BUV A;  5JMO A;  1HB2 A;  5T5O A;  4WV8 A;  1ZBA 1;  4GKY A;  3PMS A;  1HRV 2;  4Q4W 1;  1DQ4 A;  1LR5 A;  4BME A;  4P9W A;  3M70 A;  2R04 2;  4XMA A;  2J22 A;  5A7P A;  3WCR A;  2R07 1;  2DUP A;  3I3M A;  1W9S A;  3SCF A;  4C1W A;  4YFW A;  5JI9 A;  2DBN A;  4MGK E;  3FX3 A;  4Y4R A;  4YZ5 A;  2JG9 B;  5JXH A;  5FYH A;  3KT1 A;  2EF6 A;  3VBU C;  4EWD A;  1OFS A;  1UMI A;  1VPH A;  2TNF A;  4LMF A;  2VOV A;  4H7L A;  4IEO A;  1QH7 A;  4CEW B;  3NJY A;  1R1A 1;  1AR9 3;  2FHR A;  5GJ6 A;  5IT6 A;  1PVC 2;  2Z2S B;  5EZW A;  1YQ8 A;  5LBE A;  1U12 A;  5LBB A;  1LOA A;  4P08 A;  2HWB 1;  5FO8 B;  4UI9 L;  5A1L A;  5I0D A;  1V6I A;  1W2O A;  2HWF 2;  3P1I A;  1QXR A;  3USU B;  1W6P A;  3CZJ A;  2X5I A;  1UKG A;  3VBO C;  4D6R A;  3KZ4 C;  1LHN A;  3RQ0 A;  2D44 A;  2JG8 C;  2OZJ A;  1M06 G;  2VU9 A;  4IV1 A;  2FBE A;  3ZFE A;  4I3G A;  1DYK A;  2R06 3;  5GKA C;  2P6H A;  4M3C E;  5J96 B;  1HQW A;  1A8D A;  2AYH A;  4BIS A;  4YG0 A;  5ACA 3;  1IS4 A;  3PL0 A;  1V6L A;  2W0X A;  3DYM A;  1MS5 A;  4OCT A;  3T2Q A;  5DPN A;  2P3Y A;  2VGD A;  1FOD 1;  2FCU A;  4AK3 A;  2RR1 1;  2FDI A;  3GYD A;  2RJK A;  5FO7 B;  5AFE A;  3ZFG A;  1QIQ A;  3VBR B;  4IV3 C;  1NCR C;  2GMP A;  1WLD A;  3RI9 A;  4LTA A;  1LTE A;  3PNA A;  4YZ2 A;  3LEK A;  3I3E A;  4OHW A;  1LNS A;  4Q0V A;  1UQX A;  5EYX A;  5FZK A;  1RMU 3;  1VBA 3;  2GSY A;  2VQU A;  3BYW A;  3NW4 A;  2WQ8 A;  4YW4 A;  3WSO A;  4BMB A;  1SCR A;  3MBW A;  1OVP A;  2LS6 A;  2Z5W A;  4AVV A;  1O59 A;  4MGZ E;  3RG0 A;  2WA4 A;  2Y64 A;  5FMD A;  3VN4 A;  1SZB A;  1JU4 A;  3N36 A;  4X6R B;  3ZSE A;  3ZPY A;  4N53 C;  1RVF 3;  4F3J A;  5BNN C;  4FTB A;  1NY7 2;  4COV A;  5F37 A;  4Q2F A;  1GZ9 A;  4QB1 A;  3THD A;  4NOT A;  3U78 A;  1JZ8 A;  5FRA A;  3LPF A;  3RZH A;  1UU6 A;  1OKO A;  2QDR A;  5CKN A;  2C5D A;  3DKW A;  4LO7 A;  2B7Y A;  5JSO A;  2XLG A;  1SPP A;  4BK4 A;  2DU1 A;  4QPW A;  4ZHN A;  1BVV A;  2R0H A;  3MUZ 1;  4CDW B;  3SKJ E;  1YFW A;  3U37 A;  3USS A;  2YFU A;  4PDW B;  4LOS A;  1OD3 A;  1XU1 A;  2ZBJ A;  3I2J A;  3AP7 A;  3GJA A;  4DXZ A;  3ZMO A;  3ZM8 A;  2ZGK A;  5FY1 A;  4Q0S A;  1YQC A;  5JVV A;  4CDQ B;  1UXX X;  4LLO A;  1PO1 3;  1W6M A;  4LBO A;  2C24 A;  2DCY A;  4NRP A;  3S30 A;  3N3H A;  4OQ8 A;  5DDJ 2;  4HAN A;  3FMG A;  1CON A;  4AI1 A;  3VDB A;  4NPL A;  1K12 A;  4CE8 A;  1S0B A;  3RI8 A;  4DPN A;  5FPX A;  2YYO A;  1JYN A;  2WIN B;  3T2T A;  4IEY A;  4Q4V 1;  4MYE A;  2B5H A;  1MQT A;  3SC7 X;  4E27 A;  2R30 A;  1C4R A;  4C8D A;  1UZ0 A;  4AYU A;  1E5S A;  2YBP A;  1GNZ A;  1U5Y A;  4XBL A;  4K21 A;  5C71 A;  3NV3 A;  1XBF A;  1CAU A;  2JE8 A;  3RVH A;  1AR7 3;  3AMN A;  2QQK A;  5C3R A;  2D97 A;  1ZRE A;  1YI9 A;  2OZ6 A;  3O0W A;  4W6W A;  3SMH A;  1ZBE 2;  4O65 A;  1FNZ A;  4NWV A;  4UYB A;  4IEP A;  4WVV A;  4Z8B A;  4QQH A;  1Q43 A;  2Z69 A;  3A7Q A;  1EAH 3;  3JCI A;  4EN6 B;  4L9B A;  1AXY A;  5FPA A;  3TEZ A;  3POJ A;  1V6N A;  2GDF A;  2Q4S A;  3FE5 A;  4DRR A;  5BNO C;  1DF0 A;  2BBV A;  4MHR A;  5IVV A;  4AI8 A;  1RUJ 2;  4D8M A;  3ELN A;  3KV9 A;  3RJ2 X;  4PF1 A;  1LED A;  4CA9 A;  3AP9 A;  3DXT A;  4YGB A;  3S0M A;  1DG6 A;  2LRP A;  1LKN A;  2NZ9 A;  3ITQ A;  3VBO A;  3CJI B;  4R9C A;  4UW5 A;  4XHX A;  1DQ6 A;  3E1F 1;  3ZPO A;  4D7T A;  3EB7 A;  2JG8 A;  3N9O A;  3RWK X;  2JXA A;  3WNP A;  2GC1 A;  1GP5 A;  3JU9 A;  2Y6L A;  5GAL A;  4DUX A;  2RS5 1;  1UWW A;  1ASJ 2;  1IPS A;  2VZR A;  1UL9 A;  4YVW B;  2FDG A;  4DQA A;  2JKX A;  3PIJ A;  2ZHL A;  3TOJ A;  2ORZ A;  2WZP P;  4C90 A;  3E6D A;  5EV7 A;  4IXL A;  2QJV A;  2VEC A;  2JDN A;  5CAZ A;  2ADD A;  3JQW A;  4QB2 A;  1XB9 A;  2VMG A;  2PHR A;  4DXT A;  4GJZ A;  1PMH X;  1ZZ7 A;  2WNU B;  1Q56 A;  1AJK A;  2AUY A;  3K3O A;  2EIC A;  3NV2 A;  5A3M A;  4JRA A;  4ORF A;  1MS0 A;  1FV3 A;  5EPA A;  1CAW B;  1MS4 A;  4IEX A;  1LOB A;  1RUE 3;  5FLJ A;  4Y1U A;  4EN0 A;  1UX6 A;  1FAY A;  2ZKN A;  3I97 A;  2JDZ A;  4LE4 A;  3IDE A;  4QGL A;  1UAI A;  2WFP A;  4DO0 A;  4LQR A;  4P9J A;  5DUX A;  2D5F A;  1HRV 1;  4YZ4 A;  3TAY A;  4CXW A;  3KB5 A;  1VAK A;  3WDX A;  3AP5 A;  4R9A A;  1NYW A;  1HV0 A;  4YZ3 A;  2UY8 A;  2O14 A;  4CVU A;  1WLW A;  2Q0A A;  3LOI A;  3S7E A;  2EXK A;  1J58 A;  1OC1 A;  3SIS A;  4N53 A;  3VDC A;  2VMH A;  5L7O C;  5LW9 A;  3QCW A;  3T0B A;  3VZL A;  5E8A A;  4NWW A;  5FJH A;  3O7O A;  2W95 A;  3B9I A;  1I3H A;  4YW1 A;  4AEJ A;  3MIG A;  5L36 A;  3T4V A;  4Y24 A;  1H6X A;  5FZH A;  3ROU A;  1RHI 2;  5T5P A;  1ODN A;  5A7Q A;  1OPM A;  2CAU A;  4FPG A;  4G4F A;  5FDB A;  4PT6 A;  2R7E B;  4AED C;  4A45 A;  4HFS A;  4UW6 A;  4CDU A;  3VKM A;  5A6Y A;  4LKF A;  5D8A A;  2HWF 1;  1HB4 A;  3UGG A;  3NV4 A;  2D3S A;  1PO2 3;  3I2G A;  1JYW A;  4BM8 A;  2ZX4 A;  1L7R A;  5HV4 A;  3H9A A;  2HEY F;  4CU7 A;  1W2A X;  3KVB A;  5K0U A;  2RMU 3;  1D7P M;  1AR6 3;  4UFK A;  1NLR A;  4XOG A;  4W8J A;  1JOJ A;  2J7M A;  5EHD A;  3AP6 A;  3POF A;  4EN9 B;  2RVA A;  2OXB A;  3OF1 A;  5A3N A;  1GZW B;  2WT2 A;  4AEK A;  2BEO A;  2ILM A;  3VHP A;  4CP9 B;  2EAA A;  4COW A;  1O7F A;  5ISL A;  1XSQ A;  3VDD B;  3OBA A;  2ZEZ A;  4CDX B;  2WWS A;  4QB6 A;  2PYT A;  4Y1Z A;  2JB8 A;  3FFZ A;  3ASI A;  1CZS A;  4MGY E;  4QPI A;  4FP3 A;  4GB3 3;  5SV5 A;  3ILF A;  5IVB A;  1AJO A;  4WM8 B;  2DTY A;  2EIG A;  2C1F A;  1CAX A;  2JG9 C;  2ZPX A;  5D21 A;  5APA A;  5C4W A;  4C1X A;  1SLB A;  1RJ7 A;  4NN0 A;  4D3W A;  2Q1F A;  1N1V A;  1AYN 3;  2WZR 2;  5AC9 3;  1TME 3;  4S2D A;  3ZSL A;  4LKS A;  4NII A;  1BEV 1;  1AL2 2;  3WW1 A;  3AKP A;  5BNO A;  2ZAC A;  4A6O A;  1AR6 1;  5L9R A;  1REF A;  5A7W A;  5FMO L;  1TNF A;  4PIY A;  3SEP A;  5HI0 A;  1JOD A;  2C0Z A;  2GZW A;  2EIB A;  3BB6 A;  3H3L A;  5GLZ A;  1ENS A;  5J7M A;  4HSJ A;  4BHP A;  4MGQ A;  2DF7 A;  4E4S A;  4NID A;  4GWI A;  1UZV A;  3CNA A;  4YW2 A;  4JC1 A;  2PHL A;  1HLC A;  2VPV A;  4BXF A;  2IFW A;  3OBR A;  3KT7 A;  1VRB A;  1D4M 3;  1WMF A;  4MXW A;  1WMX A;  5I93 A;  3BTX A;  4FPC A;  3BTY A;  1Q5O A;  2Q8C A;  5ABJ A;  2VE1 A;  4AZZ A;  2GAL A;  1J83 A;  3F2Z A;  3GF6 A;  4IE0 A;  1UX7 A;  4JGZ B;  2FCT A;  4B7K A;  2IXL A;  4AVC A;  1AUY A;  3D82 A;  1AVB A;  1VBE 3;  2CU5 A;  4JTN A;  3ACH A;  3HEI A;  5IVY A;  2CNA A;  2DVB A;  2FDH A;  2P4E A;  2OUJ A;  1O3R A;  3HNM A;  2YC2 A;  1LCL A;  4L8Q A;  4M3C A;  5KWR A;  1H1M A;  1QF3 A;  2E7Q A;  2TUN A;  1ZRR A;  4OZO A;  3ZXF A;  5FKB A;  4EE2 A;  3Q8B A;  4AGV A;  3WG1 A;  2HWC 2;  2E31 A;  2VMI A;  1TME 1;  3QOP A;  1E5I A;  3VBF A;  4PIZ A;  3LD8 A;  1BBT 2;  3KGZ A;  4YFZ A;  4B1M A;  1W9Y A;  2VNR A;  2XVG A;  3S6P A;  1I1E A;  4E2G A;  4Y26 A;  1WMD A;  3ILN A;  3WIN E;  4ZZ8 A;  2IVJ A;  3BOW A;  4RFT 0;  3I2H A;  1UIJ A;  1ALY A;  3C3V A;  4B8E A;  4MGI E;  2EXH A;  4Y20 A;  1HN1 A;  3D3A A;  1IHM A;  1ZBE 1;  2SBA A;  3FHQ A;  2Q8E A;  1B35 A;  3N9Q A;  1WD3 A;  1W0O A;  2WSU A;  4B7E A;  2ZTN A;  2QTW B;  1ULD A;  2VMC A;  2WO2 A;  4WVM B;  2ARA A;  5IW0 A;  3W9A A;  2P34 A;  1GZT A;  2ZGN A;  5JXI A;  1GNH A;  4RGG A;  2ZGQ A;  3OY8 A;  2ZMN A;  5FR3 A;  4QHZ A;  2P1B A;  1DGR A;  2WS9 3;  1GWM A;  1BK1 A;  4Q1P A;  3PU3 A;  4D6Q A;  2C4X A;  1VBC 1;  1DYO A;  2JDA A;  2ZAB A;  1DZQ A;  5D2A A;  3TNP B;  4AED A;  2RM2 2;  2XHK A;  4QU2 A;  3CO2 A;  3FLP A;  1OHF A;  4OFG A;  2QFE A;  1RXF A;  3I3Q A;  3NV1 A;  4Q4Y 1;  3LA7 A;  5T54 A;  5GZD A;  3THT A;  5FOJ B;  1V9U 2;  1MVE A;  4CDQ C;  1H30 A;  2RS3 2;  1COV 3;  4CU8 A;  4CU6 A;  5FFO C;  3FBM A;  4P9I A;  4FTS A;  4CEY A;  4ZPI A;  5FUN A;  1NLQ A;  2BWC A;  3VZJ A;  3LKJ A;  1ZZ9 A;  2W47 A;  5CYY A;  1N3O A;  2ZGM A;  2ARE A;  1BXH A;  3AVR A;  3H8U A;  1JHJ A;  3I4I A;  1Q3E A;  4NUB A;  1W9T A;  4BQX A;  1SG3 A;  2BW8 A;  2JWP A;  2PLV 3;  2VUA A;  3GHM A;  1HRI 1;  5FMC A;  1NE4 A;  2A6Z A;  2NYY A;  2YGM A;  3CHX A;  4XZU G;  3RDI A;  4RD7 A;  5DQ0 A;  1YXW A;  3NKG A;  2HBU A;  3AZZ A;  4HXC A;  1JZ7 A;  3GBG A;  4FTE A;  4XTP A;  4YVS B;  1LAJ A;  3CEW A;  4BWO A;  1S0J A;  2LUW A;  3I8T A;  4K40 A;  4IEQ A;  5LA1 A;  1VJ2 A;  3OGJ A;  3I59 B;  3J8F 1;  2WS9 1;  2HLE A;  1MZ5 A;  3SHR A;  2ZOE B;  1R08 1;  1W8Z A;  4XE9 A;  4KWL A;  4MGT A;  1JYC A;  1QOO A;  2VTF A;  1JZ3 A;  3RS6 A;  3AJZ A;  2JEM A;  2JG9 A;  2ZXQ A;  3WY6 A;  1C28 A;  3BGA A;  4COZ A;  4B29 A;  1V6J A;  2WYS A;  5FAX A;  1Q8S A;  5FZ4 A;  3WF0 A;  2P37 A;  5FZ3 A;  2FDF A;  3IPV B;  4CEW A;  4OI0 A;  4XJW A;  2VM9 A;  4CP2 A;  1SDW A;  1VR3 A;  1OQE A;  4QT6 A;  1VBB 2;  5F3E A;  5IFT A;  1I6X A;  2DTW A;  1WW4 A;  2DVD A;  3M3I A;  4NHX A;  1XNC A;  2P5B A;  5FBZ A;  3USU A;  3KD4 A;  3HBK A;  3D6E A;  3WF1 A;  1JYV A;  3JD7 2;  4RQP B;  5ERL A;  3UV9 A;  3BCW A;  1ZZ6 A;  4N43 A;  5T3N A;  3U07 A;  3WDV A;  3WNK A;  2GP5 A;  1AR8 2;  1GIC A;  5HCB A;  4IE5 A;  4KI5 M;  3BI3 A;  2RE9 A;  5A70 A;  5CNA A;  4YM3 A;  1OT5 A;  2VOX A;  3CIH A;  4AVS A;  1EV1 3;  4QXC A;  3WCS A;  3M4F A;  2FD8 A;  4QDQ A;  2WNU C;  4XDQ A;  2HWD 1;  2ZGS A;  3VUO A;  4NAM A;  3VBR A;  5T50 A;  2QQW A;  3THP A;  1VRH 3;  4MZU A;  4CDU B;  4B3N A;  4H55 A;  4K1Z A;  1QGL A;  3HQX A;  1CZT A;  2C26 A;  1PIV 2;  3HOB A;  2D6N A;  2P2K A;  1AYM 3;  5IK5 A;  3OG2 A;  5F8P A;  1JYX A;  3FJS A;  4P5Y A;  3RGB A;  4KU7 A;  3MUY 1;  4JKL A;  1YYN A;  1FMD 3;  2EXJ A;  5K0U B;  3OUH A;  4LUK A;  5E6H A;  3THC A;  3MIC A;  4QXK A;  1IQA A;  2W68 A;  1ENQ A;  2YRO A;  3AL6 A;  5F2S A;  3ZYH A;  4LXL A;  2HWE 3;  1JZ4 A;  1VBD 3;  2W2I A;  1RUF 1;  3K4A A;  3PME A;  3NNM A;  1BKZ A;  1BMV 2;  2BYV E;  2DCT A;  1APN A;  1UD1 A;  2R16 A;  1G6N A;  2RS1 1;  2ET7 A;  3LPG A;  4LA3 A;  2WZR 1;  5LA0 A;  2TEP A;  1WZX A;  4FFF A;  2PFW A;  1NUK A;  5FZ9 A;  4ASL A;  3I2D A;  5CVR A;  1EPZ A;  1AL2 1;  5JSR A;  3E5Q A;  2E26 A;  3D0J A;  1S2B A;  3LQC A;  1FI2 A;  3KWV A;  1WCQ A;  3BAL A;  4R4X A;  4CDW A;  3ETQ A;  3POE A;  4M4R A;  4PDW A;  4AHX A;  5FXX A;  4OI4 A;  1EUU A;  1U0A A;  3C7H A;  4BJ0 A;  3AKS A;  1SCS A;  2JEC A;  1RUI 1;  2R6Q A;  4KWJ A;  2ZEW A;  3H42 B;  1SDD B;  2DUQ A;  2QQP A;  4XMI A;  2YV8 A;  1GP4 A;  5KC6 A;  3VV1 A;  2D93 A;  1ND3 B;  2ZEY A;  4ET7 A;  3WVJ A;  3IT8 A;  3EMR A;  1JOP A;  1ONA A;  5JR2 A;  3CJX A;  2VCB A;  3MV0 1;  1E5H A;  1RUD 2;  1ND2 A;  1QXJ A;  3K48 A;  3AYE A;  2VTX A;  2X5I C;  3MV1 1;  4LK6 A;  1MS1 A;  4XUR A;  1AZD A;  3URF A;  4CDX C;  2WFF 1;  2JDU A;  4XQ4 A;  5DAW A;  3V64 A;  3ZFE C;  1DLL A;  2XJS A;  4JHT A;  5LBC A;  1W8F A;  2F4P A;  4XIO A;  1V00 A;  2AGS A;  4HN1 A;  3MYX A;  4PQ9 A;  5FJK A;  1YQ5 A;  3T0A A;  4AL9 A;  3KM5 A;  5ACA 2;  3AMP A;  5CU1 A;  3RYK A;  2ZHK A;  2YG0 A;  1W2T A;  4YW3 A;  4QHB A;  2FCV A;  2JDY A;  1LGC A;  2XJT A;  1WW6 A;  4MV2 A;  1OQD A;  1US2 A;  4HVR A;  3TWI A;  1MEC 1;  5DAQ A;  4LO8 A;  1O4Y A;  3SCG A;  2ZGT A;  2VBP A;  1MAC A;  2BOJ A;  2J42 A;  1W3V A;  2QUO A;  3AL5 A;  3IAP A;  4XJA A;  3W59 A;  3AJY A;  1TMF 3;  5JR7 B;  5FYS A;  5FKC A;  5A3O A;  4GD4 A;  1RMU 2;  1VBA 2;  3UET A;  3VBF B;  3O1S A;  2HKX A;  3N9P A;  2KA3 A;  3IZO A;  3KQ4 B;  5A7O A;  1KFX L;  1RED A;  3CJI A;  4AVA A;  4ZON A;  4Q8K A;  2JIC A;  2MPF A;  1RIR A;  2X29 A;  2DCZ A;  1RVF 2;  2XBO 3;  5CFC B;  1X9T A;  4IQP A;  4RHV 3;  2O8O A;  1N1S A;  4ERO A;  2V72 A;  4YVW A;  2CGO A;  3AFG A;  4AQ2 A;  3O0X A;  3WDT A;  3JQX A;  5C3O A;  4TTG A;  5G05 L;  1W8O A;  3OUJ A;  1T6G C;  4M4P A;  1RUG 2;  2XML A;  3WG2 A;  4Q4W 3;  2ETE A;  2VVD A;  5L9B A;  3H8O A;  4LBK A;  1ENR A;  2WNU A;  5G04 L;  2LTN A;  2GU9 A;  3KF3 A;  2N7G A;  2VMD A;  2NP0 A;  5F3C A;  3WF4 A;  1MZ6 A;  4MUV A;  1CAW A;  3ENR A;  4KG0 A;  1EYB A;  5SV8 A;  3HAG A;  5EYY A;  2H6C A;  1RUC 2;  5A80 A;  4CSW A;  1GV9 A;  3U4S A;  4Y5T A;  4F8A A;  2XUE A;  3MIH A;  2A5Z A;  3MPB A;  4QAW A;  2R1D A;  4NHL A;  4RL7 A;  5JAX A;  1JZ6 A;  5C8C A;  3NL1 A;  2IXH A;  4CP0 A;  3I2I A;  4PIX A;  3T2P A;  2HWB 3;  3M3Q A;  4ASM B;  3E6B A;  3BOP A;  2VZP A;  2WN3 A;  1IPJ A;  3AZV A;  4B4P A;  2GNM A;  2DDU A;  2DVF A;  4HKL A;  2RDQ A;  2VUL A;  4JX0 A;  2LW8 A;  1UNB A;  3OB8 A;  3N7K A;  3UGH A;  3CMG A;  4N9H A;  1NAE A;  1W9F A;  2OVU A;  1LB2 A;  2VCM A;  2P17 A;  1WW5 A;  1X7N A;  4CPB D;  3TN9 1;  2PHF A;  5LAT A;  3HWJ A;  1AR7 2;  3HQU A;  1HJG A;  5CB7 A;  4ZZ5 A;  2AAC A;  2WWU A;  5EIY B;  3PVO A;  2OII A;  1WGP A;  1DLC A;  5BNP B;  4RGA A;  5C6C A;  4BIO A;  2QZ2 A;  4QQL A;  1FOD 3;  3MHZ A;  2RR1 3;  2W1U A;  2WO1 A;  2WYF A;  2J1V A;  4SBV A;  1ZZ8 A;  2A71 A;  1EAH 2;  2W08 A;  3N7J A;  2VJX A;  4YYO A;  1U5X A;  3MLL A;  1X82 A;  4QX8 A;  1W0P A;  5CZK A;  3WF2 A;  1SQ4 A;  4CP1 A;  5C3P A;  1X8M A;  4NIH A;  5JXJ A;  1CD3 G;  2J1U A;  3ZYP A;  3J7N A;  3HIF A;  3SH3 A;  2RJL A;  1GZW A;  1Y4W A;  5JI7 A;  4CP9 A;  1XNA A;  4KG8 A;  4PQQ A;  4YNI A;  3TBD A;  3VDD A;  1FPN 1;  2CL2 A;  2F6B A;  4YVS C;  4CDX A;  1Q8O A;  2XB6 C;  3WW2 A;  1SLI A;  3MI8 A;  1SMV A;  1Z7S 3;  3AMH A;  2VXR A;  4PCR A;  4N43 B;  1R09 1;  5CKM A;  4Z2A A;  3T1M A;  2QZ3 A;  2YGL A;  2VAU A;  3BN6 A;  4PI0 A;  1PIV 1;  2A75 A;  1F15 A;  4WM8 A;  4XAC A;  1QU0 A;  2WJS A;  1LEN A;  1O8S A;  3OD0 A;  4NHY A;  4CCJ A;  4Q4X 2;  4Y5Z 0;  3T1L A;  3NO8 A;  4QX0 A;  4MHU A;  2BPA 2;  5JOY A;  1RTV A;  3MIB A;  1UF2 C;  3PUH A;  1CES A;  1POV 0;  2OPK A;  5C3S A;  5BNQ A;  4XF4 A;  4XQD A;  1EY2 A;  1NE6 A;  4X6Q B;  1A8M A;  5FZI A;  1DQ2 A;  4LBL A;  1LES A;  4RFR B;  5EQU A;  1ZRD A;  2WAB A;  1H2N A;  2RHP A;  1X9P A;  4XPV A;  1WLC A;  1PGL 1;  4AHY A;  1KRI A;  5IK7 A;  5FUI A;  1JYT A;  1DHK B;  2ZZJ A;  5GZE A;  5C9A B;  4L0P A;  4QX1 A;  1D0G A;  5K4L A;  4RQP C;  4QDS A;  1DQ1 A;  3VHO A;  4Q5O A;  4PBO A;  4HKW A;  1JXN A;  4E2S A;  3BVC A;  4U36 A;  1BQP A;  3MFC A;  2CAV A;  4PLN A;  1HIX A;  2V5Y A;  4EN7 B;  1Z7S 1;  4JGZ A;  4Q4V 3;  3L9J T;  3J7M A;  3KS7 A;  3PUI A;  4H2A A;  4R9B A;  2UWA A;  4HET A;  3S5Q A;  5FMB A;  1XPW A;  1JI6 A;  4BA6 A;  5KXE A;  4Z92 B;  1WA6 X;  3RJR A;  1GNY A;  4GIQ A;  3AYA A;  1N1Y A;  1PGS A;  5E88 A;  1OLM E;  4FBF A;  4L2N A;  1CWP A;  3SEE A;  4QQ2 A;  2OQ6 A;  5DG2 A;  1HJF A;  3FFQ A;  2WAA A;  4MOA A;  1UCX A;  1IQD C;  3AMQ A;  4CDU C;  4D7S A;  5D8A C;  3E97 A;  4XAB A;  1JUH A;  1RUD 1;  1DU3 D;  3MW2 A;  2YUE A;  1PO2 2;  2DFC A;  4WZC A;  3R4U A;  4A42 A;  3KHC A;  1H6Y A;  4S2F A;  2V5D A;  3R4D B;  3NWK A;  2D98 A;  3VD5 A;  1QJY 1;  4AAP A;  5K0U C;  2D3P A;  1S0C A;  2Y6K A;  3WZ1 A;  4RR3 B;  1P8J A;  3ATG A;  3III A;  3MGU A;  4XW3 A;  4WM7 B;  5F2W A;  5LY2 A;  4AW7 A;  2EVX A;  5AVP A;  3N7L A;  4WVM A;  1YCI A;  4MH0 E;  3ZIW A;  1ND2 B;  4QKF A;  1SFP A;  4JQR A;  3GZT B;  1UYX A;  3HNB M;  4A7Z A;  1ZYB A;  2RS5 3;  3AXE A;  4HK8 A;  5FY7 A;  3WF3 A;  2ERF A;  4GB3 2;  4JVA A;  2OUH A;  2QDN A;  4FPJ A;  4QPI C;  5JMC A;  3H7Y A;  1OF4 A;  2Y60 A;  3NMB A;  4OHX A;  4Q0P A;  5L9V A;  2XJU A;  4RA0 A;  2LRO A;  4PF5 A;  1J3P A;  5FZ1 A;  5IWF A;  1RIN A;  5C4W C;  5JSP A;  1OLR A;  4Y4Y A;  5A6Q A;  5HXV A;  1AYN 2;  4XFB A;  5AC9 2;  5C5U A;  3MF6 A;  1ZRC A;  1H8T B;  1ND3 C;  1HQN A;  1QNY A;  4XZP A;  1IGO A;  1I5Z A;  1LEM A;  4XF3 A;  1UW8 A;  4PHZ A;  4QU1 A;  4YRD A;  1NCQ A;  1QY4 A;  3JZV A;  2HBT A;  1RUH 1;  4PBP A;  1UU4 A;  4GWJ A;  2Y0I A;  3GZE A;  1W2U A;  1HRV 3;  1C8M 2;  4LLF A;  3N9M A;  1G86 A;  4XF0 A;  1XNB A;  3WDU A;  1QDC A;  3JBG 2;  3ZN5 A;  1POQ A;  4YVS A;  1C1F A;  4C0H A;  3A22 A;  3SKV A;  4AOC A;  2XKO A;  3PTR B;  4M00 A;  3ZSJ A;  4DNY A;  4MXV A;  3I59 A;  3GZU C;  5ABJ C;  3H3Z A;  4R4Z A;  1H2K A;  3BIW E;  3WNM A;  1V6M A;  2GC2 A;  3P5B A;  3Q8F A;  4JV4 A;  5FWE A;  3GHN A;  1VBE 2;  4GH4 B;  1QXP A;  1OA2 A;  3ST7 A;  3T30 A;  3WHU A;  4ES9 A;  2BNO A;  4XXP A;  5IYY A;  2BWA A;  2X53 S;  5FRE A;  3VD4 A;  2B9V A;  3BTZ A;  1Y3T A;  3P6B A;  4FQ4 A;  1G9F A;  1QJU 1;  1UY2 A;  1TVG A;  1QQP 1;  4XJ9 A;  2ORX A;  1LU2 A;  5FYU A;  1W2N A;  1I9R A;  1FYU A;  3IPV A;  4OI2 A;  2HWF 3;  1BCX A;  1JW6 A;  1YIP A;  2YY1 A;  2ZML A;  4G3Y C;  2H0V A;  3WNN A;  4IUG A;  3VBF C;  1NA1 B;  1KJR A;  1PGW 2;  4EWA A;  4LNV A;  5FY0 A;  5GLV A;  5I8T A;  4CCO A;  4PLO A;  5KXD A;  1WBF A;  5J36 A;  1YUD A;  5IAV A;  3ZYF A;  1ULF A;  3V0B B;  4RQP A;  2YZ4 A;  3FHA A;  2VQ0 A;  1W8N A;  2R04 1;  2YPJ A;  2HH9 A;  5CFC C;  1GAN A;  2GP3 A;  3VZM A;  4XTM A;  3K3N A;  4K20 A;  3FWE A;  3SH5 A;  5CIS A;  1VAL A;  5C8C B;  1HXS 2;  1B35 C;  2SLI A;  2RG4 A;  3ILR A;  4AF9 A;  1O3S A;  2OA2 A;  3OD4 A;  4XAE A;  5LAS A;  5HBA A;  1OOP A;  3PTY A;  2VNV A;  4Y22 B;  3LEI A;  2A3Y A;  2D3R A;  3ETP A;  2W91 A;  1O5L A;  1G9C A;  3ES1 A;  4NHM A;  4SLI A;  2Y6H A;  2BTV C;  2Y34 A;  4B1L A;  2Q5T A;  3A23 A;  3PVE A;  3RZJ A;  5JXG A;  1ZZB A;  3VBS B;  1YJK A;  1UIK A;  4I30 A;  5KHJ A;  4FPL A;  2XXZ A;  1PVC 1;  1QJX 2;  2E7A A;  3KSC A;  5DAB A;  3AC0 A;  3A0N A;  1POV 1;  1QHD A;  3C8X A;  4HBN A;  5F5A A;  2YU2 A;  3WR0 A;  3GDB A;  4HOO A;  1V70 A;  5LY1 A;  1W6O B;  1SBE A;  2FZ2 A;  5LK5 A;  5KHH A;  3VBH B;  1MZF A;  3DUI A;  3PU8 A;  3O1U A;  1NOV A;  4BOW A;  1S0G A;  5AFB A;  4ZU7 A;  1BEV 3;  4CEY C;  4MG2 A;  5CKQ A;  1O91 A;  1W6Q B;  1XJA A;  2EAL A;  3SIT A;  3I7D A;  1PM7 A;  4CU9 A;  1PX3 A;  4OUE A;  3FLT A;  2PLV 2;  3K51 A;  4Q4X 1;  3J7L A;  5LEK A;  4HLT A;  1OD5 A;  1XYO A;  1SFN A;  1OKQ A;  4A4A A;  3WP5 A;  5BY5 A;  2YFZ A;  1KGY A;  4E8D A;  3OBT A;  3VL8 A;  1WWY A;  2JIG A;  3OGV A;  2GH2 A;  3LCP A;  3VKN A;  5BNP C;  1SLT A;  1LUL A;  3H7J A;  3HD8 B;  4K8R B;  2W87 A;  1ZRI A;  2X10 A;  1TEI A;  3NNJ A;  4BQY A;  2J1R A;  4JGY B;  1SLC A;  1F35 A;  2Y8K A;  4ITC A;  4YLZ A;  2WNO A;  4Q27 A;  2GME A;  2Y0O A;  1G8W A;  3AKQ A;  5A3U A;  1QH6 A;  4XBN A;  1V6K A;  1V0A A;  1GOF A;  1VIW B;  1BK0 A;  1ND3 A;  1NY7 1;  4CEW C;  4P9X A;  4DXR A;  5C5T A;  3IM0 A;  3WNO A;  4P00 B;  5GM0 A;  5F7U A;  1GLH A;  5GLW A;  2I2S A;  1PK6 B;  4KBB A;  3INA A;  2ARC A;  1JBC A;  1LRH A;  5DZF A;  5FYB A;  4YGD A;  3ZXJ A;  5CFD B;  2PAE A;  4A7Y A;  4Y33 A;  1C8N A;  5FYM A;  2BRT A;  1LOE A;  4EWE A;  2G9G A;  4XFI A;  3WUD A;  3ZFF B;  1CPM A;  3O1V A;  2YB7 A;  2RDN A;  3MZH A;  3MDP A;  1ZBE 3;  3QH7 A;  1T6B X;  2IWG B;  4N43 C;  3ON7 A;  2NPI A;  5FP3 A;  4ES8 A;  3HN3 A;  4DB5 A;  3GXU A;  2VOT A;  5FY4 A;  4NO4 A;  3K75 B;  4GA9 A;  3T4H B;  3T3Y A;  2GNB A;  5FQ0 B;  4L11 A;  4QM8 A;  3ZXL A;  3UT0 A;  2MEV 2;  1XC6 A;  1EV1 2;  1GQH A;  1SHW B;  2K46 A;  3SLI A;  3V0A B;  4XVH A;  4QX3 A;  2BBA A;  2Y6F A;  2EID A;  2Z4F A;  3WG4 A;  3H0O A;  1F31 A;  5DDJ 1;  1VBC 3;  2VCC A;  2W92 A;  4A2U A;  4CCE A;  5C33 A;  2W46 A;  1GU3 A;  2JE9 A;  3VBR C;  1CGP A;  4I0A A;  1J1T A;  1RXG A;  2E51 A;  2IUW A;  3N35 A;  4KMQ A;  1PZ9 A;  4Q4Y 3;  3TEX A;  3V65 A;  3VKF C;  4MX3 A;  1O3Q A;  2VZV A;  4OLL A;  3T08 A;  3LB9 A;  2YBK A;  2BFU S;  3ZSM A;  4QQO A;  4DIN B;  2QBX A;  1A34 A;  3O0V A;  3T0D A;  4ZU4 A;  1AYM 2;  1HB3 A;  2WRA A;  3M3O A;  4IGO A;  1NQD A;  2XJR A;  3VD3 A;  3NJX A;  4IES A;  4LA2 A;  2V4A A;  1FMD 2;  1RIT A;  1JUI A;  3J26 N;  2BVB A;  3NKT A;  3H50 A;  3ZX7 A;  1UKR A;  5CFC A;  2XQR A;  2HWE 2;  1DZR A;  3LSD A;  4QX5 A;  1HRI 3;  4E2Q A;  4P9Y A;  3U1X A;  2FDJ A;  4M3C F;  2ZJC A;  4ZY9 A;  1GWK A;  4B4Q A;  2A7A A;  3ZN6 B;  5FZ8 A;  2XLF A;  4O7X A;  2BQP A;  4IET A;  2GMM A;  5FZC A;  5A1A A;  1W8H A;  3M3C A;  1W8W A;  1F8V A;  2JIJ A;  4AFC A;  2JDM A;  3J8F 3;  5BPX A;  3ZKY A;  5FYZ A;  1R08 3;  1RUJ 1;  2ZEX A;  3FL7 A;  3IIA A;  4FPY A;  3ZR5 A;  4CUB A;  4V2W A;  4CDW C;  4LUM A;  4NHK A;  3ZDV A;  5FWJ A;  4PDW C;  4BQW A;  3ZYI B;  3DPR A;  1VB4 A;  3EHK A;  3DYP A;  2H0B A;  4HT1 T;  5DZG A;  3MF9 A;  4AI9 A;  1OLM A;  4MGS A;  3VD9 A;  3LWC A;  4LBN A;  2Y6J A;  3WQ7 A;  2QQL A;  4P9G A;  5JZG B;  2E7T A;  3AZW A;  4UFJ A;  3U4X A;  1ASJ 1;  4RGK A;  3NAP B;  1YQ6 A;  3ZXD A;  5HCA A;  1GSL A;  2WNV B;  2YU1 A;  2GNT A;  1NCQ B;  3ZYR A;  4E4D X;  4K6B A;  5FYV A;  3H1Y A;  4IEU A;  5HXM A;  4J25 A;  1ND2 C;  1O8P A;  3QH6 A;  4OMD A;  2W39 A;  3HR9 A;  4I09 A;  1ZRF A;  1W9W A;  4LIT A;  2R32 A;  4QKB A;  2AEY A;  2F4L A;  2V4V A;  4D0Q A;  2PHU A;  4G9S B;  4YM0 A;  1B09 A;  1ACC A;  1Q8V A;  4EQV A;  2Q1M A;  4V2V A;  4XIL A;  3WP6 A;  2JDK A;  5A3L A;  1FXZ A;  2G9Z A;  4LJH A;  4S2G A;  1IS5 A;  4XYX A;  5BNP A;  3NST A;  3VBU B;  4TSV A;  3WHT A;  4AWD A;  3B5L B;  2E33 A;  3FUO A;  4M0H A;  1WKY A;  2AC1 A;  2ARB A;  4LT5 A;  3VDA A;  3SQO A;  2HWD 3;  2W5F A;  1N47 A;  3ZXK A;  5BV6 A;  1BVP 1;  1UO9 A;  2EXI A;  2GC3 A;  2QNK A;  1GQP A;  1AHS A;  1H4H A;  1HXS 1;  1TMF 2;  2ZGR A;  4XIK A;  2XUM A;  4LIU A;  5H9R A;  4E9K A;  2VW2 A;  1N1T A;  1YFU A;  1S2K A;  3IB3 A;  5A3T A;  3POB A;  2CTV A;  4ZS2 A;  4DIQ A;  1LOF A;  2QQO A;  3W5M A;  5J3U A;  4YWA A;  3K4Z A;  3LEM A;  3T2O A;  3H8X A;  1UYP A;  3JUU A;  1KS4 A;  4GMP 1;  1W99 A;  1RHI 1;  5DG1 A;  3BOD A;  3CJI C;  5K9Y A;  1H8V A;  5I0R A;  5FYI A;  3CZU A;  2XVL A;  1M4W A;  3TRS B;  1L3J A;  2XBO 2;  1QJX 1;  2WDB A;  1RC6 A;  4OHV A;  2HEV F;  4E4H A;  3E6C C;  1ST8 A;  5FXZ A;  2DUO A;  4I2O A;  2W1Q A;  1W39 A;  2X8K A;  3CBN A;  4YPJ A;  4ASK A;  5JUV A;  2XWJ B;  1RUF 3;  5A32 B;  4YVW C;  2XHN A;  1XQN A;  2RS1 3;  2A3X A;  3GCX A;  3M8L A;  3VZN A;  1OOP B;  2VZS A;  1JS9 A;  2WZR 3;  2WUH A;  5FIX A;  1CAV B;  1ZBA 2;  5GLU A;  1IS3 A;  4IV3 B;  4Q4W 2;  4R9D A;  1NCR B;  5IK4 A;  1AL2 3;  3A21 A;  1F5J A;  4WVZ A;  3OUI A;  1KD7 A;  5JOX A;  2R07 2;  3UL2 A;  1GFF 2;  1VAV A;  4XAA A;  2BER A;  4BLI A;  4DY3 A;  4QXH A;  4KNC A;  2WBK A;  3JXS A;  4PJY A;  1OUS A;  1OVS A;  1D0H A;  4ATE A;  4QKD A;  1DGR N;  3D8C A;  2DWR A;  2E6V A;  3ZXA C;  4COY A;  1RUI 3;  4IGP A;  1QEX A;  3N7M A;  4Q0U A;  1JH5 A;  1AX0 A;  2VUJ A;  3HT2 A;  5C9A A;  1DCS A;  5I0U A;  3RSJ A;  3UKV A;  5BNN B;  5LWB A;  4L92 A;  3DKQ A;  3KCC A;  3PUA A;  1R1A 2;  2YHJ A;  2WKK A;  2CDP A;  2CYF A;  5C8C C;  1NQJ A;  4QXB A;  2KR2 A;  1JZ2 A;  3K46 A;  3WNX A;  2XQX A;  5F32 A;  2ZHM A;  2W9X A;  2KD7 A;  4UW3 A;  4UOJ A;  4OUL A;  2VW0 A;  2WFF 3;  5D1I A;  3H1W A;  5FZL A;  4AFA A;  1CIY A;  4QD2 A;  4YGE A;  1XSR A;  3S57 A;  1Y9G A;  2VUC A;  1QOS A;  5JWP A;  4MET A;  4I0B A;  3PVN A;  3QAC A;  5H9S A;  3VBS C;  4BXS V;  4QX7 A;  2QVS B;  4UFL A;  2W3J A;  3UES A;  3KF5 A;  3ZYG A;  1VMH A;  4LKD A;  3RPQ A;  2Y38 A;  2Y6G A;  3MID A;  4BK5 A;  4LUL A;  3POS A;  5A33 B;  2RR1 2;  2DBI A;  2CY6 A;  2HYX A;  1MEC 3;  1GR3 A;  3HBZ A;  5CBL A;  4BPZ A;  3VBH C;  2K0G A;  2NMN A;  5ANN A;  4BH9 A;  5IJR A;  2EIE A;  2PN5 A;  1WME A;  1CQ9 A;  5I0T A;  4ARY A;  1OH4 A;  3RNS A;  2EA7 A;  1BYH A;  4RR3 A;  5IHR A;  4L97 A;  1UOB A;  4A44 A;  3MPP G;  1AR9 2;  4C0B A;  4YW7 A;  4HKO A;  1DZT A;  1E5R A;  2JDH A;  2WT1 A;  4KGG A;  5C3Q A;  4WM7 A;  2IFR A;  3R0R A;  4FCA A;  2DU0 A;  4IDZ A;  4GAL A;  2IXK A;  4XHB A;  2VD7 A;  1HQL A;  5B4X A;  3PUR A;  4FFH A;  3VDD C;  1IG3 A;  2BJS A;  1J84 A;  1LHV A;  4PLM A;  1Y43 B;  4HK9 A;  2ID4 A;  2K9Z A;  2R06 2;  2HWC 1;  3B3Q E;  2XJP A;  2XLA A;  2UYA A;  2PQQ A;  2UWC A;  2ES3 A;  4HN0 A;  4OYU A;  4DEQ A;  5L19 A;  2A6Y A;  4LK7 A;  1BBT 1;  4YZ1 A;  1YLL A;  4WM8 C;  3WX5 A;  4BE3 A;  4GAZ A;  3I3D A;  5E89 A;  4AGG A;  1GUI A;  1YWK A;  2W94 A;  2QQI A;  4HL0 A;  5IUQ A;  3SNM A;  2VC9 A;  1CX1 A;  4I3P A;  2BOI A;  4ISQ A;  2PMW B;  1WCK A;  2D6K A;  1YC6 1;  1H8T A;  3FZ3 A;  2JE7 A;  2VVF A;  3MO4 A;  4GZ9 A;  4K9S A;  4BYY A;  3PLQ A;  2B45 X;  1ULP A;  1R64 A;  2A70 A;  2QKD A;  5FP7 A;  1UYZ A;  1ULC A;  4RS5 B;  3S5A A;  2D43 A;  1HW5 A;  5ANQ A;  4FPF A;  1PK6 C;  4DZG A;  1XND A;  5FXV A;  3MEP A;  4CRQ A;  5BYN A;  4ZXE A;  5KXB A;  2WSV A;  4M0N A;  4RYD A;  1LHO A;  3N9N A;  5JIU A;  3POI A;  1VMJ A;  4UFM A;  4K7J A;  1OA4 A;  3IMM A;  5AVA A;  2PHD A;  4QWN A;  5EWS A;  4TYS A;  3UJQ A;  3VD7 A;  1KDK A;  3LFI A;  2RM2 1;  4YW6 A;  1W8T A;  3WDW A;  1PM4 A;  5IVF A;  2GN7 A;  3QBQ A;  4Q4V 2;  2W52 A;  4JGZ C;  5FP9 A;  4TZD A;  1QJE A;  4IL7 A;  4GH4 A;  3EO6 A;  1V9U 1;  4OZX A;  3LDR A;  5GZG A;  2XDV A;  2RS3 1;  2VOK A;  3HJR A;  2VNG A;  2JKB A;  4UBH A;  4DRV A;  1AX2 A;  3GCW A;  1Q8Q A;  3TN9 3;  3B93 A;  5B4N A;  4FVV A;  2YC0 A;  3AX4 A;  3UGF A;  3UKN A;  5A6Z A;  2NM1 A;  2R0F A;  2I74 A;  1PMJ X;  1WCS A;  5CIR A;  2VW1 A;  5A7S A;  4IEZ A;  1NA1 A;  3ZYB A;  2DV9 A;  2DVA A;  2NMO A;  3LA3 A;  1QMJ A;  2VH9 A;  3DPR B;  3OBZ A;  5HPO A;  4GXL A;  2KXL A;  3LIG A;  2PQS A;  3IDB B;  3ACF A;  3V0B A;  1AR8 3;  5JPM B;  1JZ5 A;  1AXK A;  3RRD A;  1PO1 2;  5L7O B;  1K5J A;  3GGL A;  3EQE A;  2CSG A;  1H1A A;  3I3B A;  4IE6 A;  4NRM A;  4O9G A;  4LBQ B;  3CU7 A;  4B4R A;  3P3P A;  1IG0 A;  3K77 A;  1NXM A;  2PEL A;  3MW3 A;  5FZG A;  4AQT A;  3AMM A;  5FPV A;  5H9P A;  4Y22 A;  5FBJ A;  4URA A;  4XFF A;  3IDA A;  1FPN 3;  2VZ1 A;  3WQ0 A;  3N9L A;  5FOB B;  2VZU A;  4N7I A;  3PIG A;  4IGQ A;  4XFH A;  3RZL A;  3KHB A;  2RS5 2;  4IE7 A;  5HCF A;  1Y7B A;  3D5O A;  2AEN A;  1R09 3;  3VBS A;  4DXS A;  2IXJ A;  5DAP A;  2CV6 A;  1PIV 3;  4AE2 A;  1VBB 1;  3OJB A;  3KGL A;  4D69 A;  3G6J B;  5HCH A;  1XXN A;  4W65 A;  4BQ1 A;  3HN1 A;  4NVP A;  4TXW A;  3JD7 1;  1W6O A;  4DUW A;  1CVN A;  4XDO A;  1Z0H A;  2JEN A;  1UZZ A;  3OOX A;  4BQ4 A;  2J1E A;  3VBH A;  4J6G A;  3OEA A;  2DCK A;  2ENR A;  3RMY A;  2E9Q A;  1AR8 1;  3CKH A;  3NAP C;  1SEF A;  4CCM A;  1W6Q A;  1H4G A;  5DN2 A;  2UYB A;  2WNV C;  1DGW A;  3FUQ A;  4JRL A;  3UYJ A;  2D5H A;  4AI2 A;  1NCQ C;  3ZR6 A;  3A4U A;  3SH4 A;  3Q8C A;  1BHG A;  1CZV A;  1PMI A;  3C7F A;  2QQU A;  4K8F A;  5FPZ A;  4H7M A;  4AHZ A;  1S0F A;  3LOB A;  1GWL A;  1E57 A;  1Q8P A;  1UU5 A;  5FZ7 A;  4YG6 A;  3LFM A;  4LBQ D;  4AQ6 A;  2XR4 A;  1IZ3 A;  4GUL A;  3ECQ A;  3H3U A;  3MLK A;  4DEV A;  4FOQ A;  4J1X A;  1FNY A;  1K5M A;  3CQO A;  3SCH A;  2JJ6 A;  4JGY A;  4DUV A;  3NNL A;  3GM8 A;  4XET A;  1H9W A;  1PZ7 A;  5DZE A;  5A6X A;  2WAO A;  2A6X A;  4MVT A;  2OS2 A;  4HMZ A;  3RWN A;  1SBF A;  4WVW A;  1YNA A;  5F1R A;  1NKG A;  2JB4 A;  1A3K A;  2PHT A;  3VKO A;  1OH3 A;  1RUD 3;  3GAL A;  1YFX A;  2L9L A;  2RDS A;  5J37 A;  2FQP A;  3OYW B;  1RUE 2;  5KR7 A;  2ZAA A;  1RUN A;  3HVD A;  1BMV 1;  1XNK A;  4UXA A;  4MSV A;  1PK6 A;  1IKP A;  4QPG B;  5CFD A;  4XJZ A;  1UY4 A;  3TYJ A;  2IVI B;  4HSL A;  3O5S A;  2BV4 A;  3WQB A;  1QJY 3;  4LHN A;  4JAA A;  3ZFF A;  5JDB A;  1XE0 A;  2WO3 A;  5FPL A;  1LGB A;  3RFR A;  4NJ4 A;  5FYY A;  4IEW A;  5BXX A;  2Q8O A;  5EJ1 B;  1UY0 A;  4XF9 A;  5LA9 A;  1OOP C;  2OW4 A;  3OGG A;  1H2L A;  1UMZ A;  3VLB B;  5FQ0 A;  2WII B;  4XUT A;  4ZU5 A;  5A7N A;  4UFI A;  2VQA A;  5KHI A;  1HV1 A;  3V0A A;  2W1S A;  2ZX1 A;  3KCX A;  1A78 A;  4CCK A;  4CUG A;  2GAU A;  3NQH A;  4UT5 A;  2OKX A;  4EV0 A;  1AR9 1;  4YG3 A;  5F39 A;  4CCC A;  1H1I A;  4Z82 A;  3O1T A;  4QQP A;  3O1P A;  2WA3 A;  4ISR A;  3BPS A;  1KJL A;  1GYK A;  3HNY M;  4ZS3 A;  3CDZ B;  4COU A;  5LCW L;  3I49 A;  1N3P A;  4CTE A;  1NG0 A;  2XOM A;  2ARX A;  3ZKU A;  1WUV A;  5GLT A;  2R06 1;  1J3Q A;  2IXI A;  4D7Y A;  1WD4 A;  1D2S A;  4XCA A;  1BEV 2;  2ZGP A;  5CA6 A;  2RMU 2;  1OMI A;  1LU1 A;  4V1P A;  1AR6 2;  1GOG A;  2OX0 A;  1KQR A;  1J1L A;  4UBG A;  4XBQ A;  2Q8D A;  5DMY A;  1RUH 3;  1UXZ A;  3M7A A;  5ACA 1;  1RUG 3;  1MS9 A;  4FOW A;  2VME A;  2A73 B;  2QQN A;  3H8R A;  2NN8 A;  3ZN6 A;  3DN7 A;  5FZO A;  1GP6 A;  1O3T A;  1W6N A;  3BPZ A;  2BDR A;  3NVC A;  4J1W A;  3ME2 A;  5DXD A;  2DFB A;  4P14 A;  1OA3 A;  3NRU A;  5IAX A;  5E1R A;  3ZXG A;  3APB A;  1FT9 A;  1YO8 A;  5T5J A;  4WZF A;  4JKK A;  5FCC A;  4P5H A;  3VB9 A;  3WD5 A;  1RUC 3;  4YSF A;  2HYK A;  3ZSK A;  1MVQ A;  1RMU 1;  1VBA 1;  5FK8 A;  1KXG A;  3BU7 A;  5J98 B;  2WL1 A;  3J4U H;  3ZLI A;  4Y3O A;  2D40 A;  4OQ9 A;  4AG4 A;  1OUX A;  2D6O X;  3HMY A;  4Y1Y A;  5JLV A;  3R6S A;  3W58 A;  1CN1 A;  3PDQ A;  1QJU 3;  5JCT A;  1QQP 3;  1U5Z A;  3AK0 A;  1RVF 1;  1JTZ X;  3I2K A;  2WZE A;  3LF7 A;  3U75 A;  2P6C A;  1UOF A;  3M2M A;  1TME 2;  4CXX A;  5JZG A;  4XUN A;  4BZ4 A;  3NAP A;  3MIE A;  3NNG A;  4A7K A;  1UMH A;  1S1A A;  2WNV A;  3DF0 A;  5F5I A;  1OUR A;  1YJL A;  2YDE A;  1PNF A;  2XJQ A;  1JN2 P;  3OSD A;  4N90 A;  4Y1V A;  4HVQ A;  2A6W A;  4LOR A;  5LBF A;  4XQW A;  1RUG 1;  3BIE A;  4W4Z A;  1NZI A;  1HN0 A;  5EP9 A;  1UY3 A;  4HPK B;  1JOB A;  2VTX J;  2R04 3;  5DUV A;  1T2X A;  3WLU A;  2BNN A;  4OVE A;  1IKQ A;  1W28 A;  3O12 A;  4CUA A;  2BGO A;  3E5X A;  1D4M 2;  3LA2 A;  3N4M A;  2ZS6 B;  1L7Q A;  3F95 A;  4RSU A;  5LEJ A;  2I45 A;  4Y5S A;  3VBU A;  1RUC 1;  4WBB A;  3J7H A;  2DCJ A;  1LGN A;  5J1X A;  4LPL A;  2ZHN A;  1PO1 1;  5CEH A;  3ZVX A;  3OGR A;  4HVO A;  1C1L A;  4KH9 A;  4DFS A;  1MZE A;  1VBC 2;  1X36 A;  2ZA9 A;  5F6L B;  2JD9 A;  2O8Q A;  4URT A;  2ZGU A;  4XFC A;  4DOU A;  1BLZ A;  1PVC 3;  1ZZC A;  3T09 A;  1XU2 A;  4IE4 A;  5I8Y A;  4N9I A;  4Q4Y 2;  4OUS A;  4RS5 C;  1POV 3;  5H9Q A;  3C2U A;  2BNM A;  1C57 A;  3WXP A;  3LZZ A;  2B8M A;  3SXW A;  1DYP A;  3ABZ A;  4FAH A;  1AR7 1;  4JKM A;  1O4Z A;  4JDO A;  3RZK A;  1D4V B;  4Q4X 3;  2UWB A;  1HRI 2;  4FFI A;  5T5L A;  5T55 A;  5A32 A;  2B9U A;  2ZGL A;  3A0K A;  3RZZ A;  5B2G B;  3VHN A;  1DQ0 A;  3B02 A;  1CAV A;  2B42 B;  2XL9 A;  3ALQ A;  3B01 A;  4O61 A;  4UF0 B;  4W6X A;  1EAH 1;  2Q1Z B;  4LKE A;  4IV3 A;  4FPO B;  3WV6 A;  1NCR A;  3BU0 A;  2XJV A;  3UNP A;  3UKT A;  2GN3 A;  2D6L X;  3J8F 2;  3O1R A;  2WS9 2;  1CX4 A;  5F3G A;  4NIA A;  1R08 2;  4E4Z A;  4DS0 A;  3PJY A;  1L7L A;  2DVG A;  1PZ8 A;  4XXA A;  4ARX A;  3MFA A;  1W0N A;  2UU8 A;  2Z79 A;  5FUP A;  4R52 A;  3DPR C;  1NX9 A;  4BU2 A;  4U2A A;  5FYC A;  2C6S A;  4X8N A;  2VQT A;  4FPK A;  5FP4 A;  3AZY A;  2X05 A;  2VZT A;  5BNN A;  5F5C A;  5FV3 A;  1COV 2;  1ZA4 A;  4EN8 B;  1GOH A;  4Z07 A;  4KGQ A;  2MNG A;  3ZXE A;  1VP6 A;  3U11 A;  2O1Q A;  2P3I A;  3W21 A;  2BP6 A;  4CCD A;  3R4S A;  3I2F A;  4GMP 0;  4AR2 A;  4TN7 A;  5JIA A;  4KWK A;  1OF3 A;  4FPH A;  4YW5 A;  3RYP A;  1GMM A;  3AYC A;  4Q0Q A;  1DDL A;  4XJU A;  1UPS A;  2FDK A;  1J59 A;  3VGI A;  1OQ1 A;  4LHL A;  1GZC A;  3MIF A;  3OGS A;  3JB4 C;  1KFU L;  5FTT C;  1RUE 1;  1WBL A;  1LHW A;  3FLR A;  5F3I A;  1F2N A;  3B7M A;  3VL9 A;  5F5Q A;  1KIT A;  4QDR A;  1K5M B;  4DMI A;  2R49 A;  2ZCW A;  5A33 A;  3TB0 A;  4XC9 A;  2WC2 A;  2VVE A;  2HWD 2;  3AYD A;  5DDJ 3;  5GZC A;  4OHY A;  4N8M A;  4LO6 B;  2XWB B;  3OPT A;  5FMO S;  1H2M A;  1S0E A;  4AVB A;  4JDM A;  2PHX A;  1VAM A;  2O0O A;  1W6P B;  1WCD J;  2X5I B;  4GWN A;  1XE8 A;  4A3X A;  1LOG A;  5E16 A;  1LOF C;  1XNT A;  5FY8 A;  5JOW A;  4XUO A;  3RMX A;  1MPX A;  1SLA A;  2HEW F;  4Y1X A;  4IV1 B;  5DUW A;  3ZFE B;  2CGN A;  1LHU A;  3OCP A;  4OMC A;  3IKW A;  4FP2 A;  2F17 A;  4Z1V A;  1U5I A;  3AVS A;  3QLQ A;  4XCB A;  1HKD A;  3UK9 A;  1X33 A;  2OYZ A;  2VY0 A;  5IVE A;  1XRU A;  5A3P A;  4JDN A;  4K3U A;  1RUF 2;  4QPY A;  1ZVF A;  1LOD A;  2D6P A;  3B9C A;  2HJI A;  4FOY A;  3ZYJ B;  1PO2 1;  2PAK A;  2RS1 2;  2XKP A;  3JB8 A;  4AFM A;  4P02 B;  1K42 A;  1AXZ A;  3MLJ A;  1TQ5 A;  3POY A;  4Q29 A;  3I2O A;  5LRR A;  3KMH A;  3DEM A;  3D4K A;  5EXO A;  3ZFG B;  1CJD A;  2QE3 A;  2RMU 1;  4H14 A;  2PHW A;  4HON A;  3KQR A;  3C7E A;  4QGN A;  4NRO A;  4BCU A;  3LIH A;  1RUJ 3;  2VL4 A;  1DFQ A;  4C91 A;  1OXC A;  3EJK A;  4KL1 A;  1HB1 A; 
#chains in the Genus database with same CATH homology
 1W9F A;  4LK7 A;  2JWP A;  3ZYB A;  4CP9 A;  2O14 A;  4CPB D;  1W8W A;  1OH3 A;  2KR2 A;  4AL9 A;  1GWL A;  1OKO A;  1W8U A;  1GWM A;  3ZYH A;  1WMX A;  4YW6 A;  1W8T A;  5D21 A;  4YW7 A;  4YWA A;  1WZX A;  4LKE A;  2WYF A;  3ORJ A;  4BQ2 A;  4BQ4 A;  2LRP A;  2Q1F A;  2VXJ A;  4BQ3 A;  1HN0 A;  4LJH A;  1V0A A;  1W8Z A;  1WCU A;  4LK6 A;  3UT0 A;  2K46 A;  4CPB A;  4CP9 B;  1UOJ A;  4LKD A;  1L7L A;  4A6S A;  2LRO A;  1GWK A;  1W90 A;  2C24 A;  3ZYF A;  4LKF A;  3F95 A;  4BQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...