4LKLA

Crystal structure of plk1 polo-box domain in complex with pl-55
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
222
structure length
214
Chain Sequence
b'CHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK1
publication title Exploring the binding nature of pyrrolidine pocket-dependent interactions in the polo-box domain of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 71
structure length 214
sequence length 222
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2013-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4lklA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4lklA01
4YYPA 4WHHA 4HCOA 4LKMA 4H71A 4O9WA 4E67A 3BZIA 1Q4OA 4O56A 4O6WA 4RCPA 3P2WA 5J19A 3Q1IA 4HABA 3P36A 4WHKA 3HIHA 3HIKA 3P2ZA 3RQ7A 4E9CA 4WHLA 4H5XA 4XB0A 4HY2A 3FVHA 4J7BB 4X9WA 2OGQA 4X9RA 1UMWA 2OJXA 1Q4KA 5DNJA 5DMVC 4E9DA 3P35A 4RS6A 4LKLA 4X9VA 3C5LA 3P37A 4DFWA 2N19A 5LHZA 3P34A 5DMSA
chains in the Genus database with same CATH superfamily
4YYPA 4CXSA 2IA9A 3LXQA 4LKMA 4E67A 3BZIA 2I9XA 4O6WA 2E50A 3P2WA 3GYVA 4HABA 3HMJG 4NK7A 3HIKA 4XB0A 1AUKA 4X9WA 1UMWA 1E3CP 3HFDA 4CXKA 4CYRA 5DMVC 3P35A 4FDIA 3P37A 4DFWA 1HDHA 5DMSA 3LM3A 4HCOA 4N7VA 3P34A 4O9WA 1Q4OA 4CXUA 1FSUA 5J19A 1N2KA 5AJ9A 4G7NA 1A87A 3HIHA 4E9CA 3P2ZA 2OGQA 4RS6A 2N19A 4CYSA 5LHZA 4N9JA 2UV8G 4H71A 4RCPA 3P36A 1F32A 1P49A 4NKBA 3GYWA 4H5XA 1E1ZP 4HY2A 3FVHA 2OJXA 1E2TA 1Q4KA 4LKLA 1F34B 3RQ7A 1N2LA 4WHHA 1E2SP 3ED4A 4O56A 5DAYA 3FS3A 3Q1IA 4WHKA 1E33P 4WHLA 2I9ZA 4J7BB 4X9RA 2QZUA 5DNJA 3KDRA 4E9DA 4FDJA 3C5LA 4N7ZA 2VKZG 4X9VA
chains in the Genus database with same CATH topology
4YYPA 4WHHA 4HCOA 4LKMA 4H71A 4O9WA 4E67A 3BZIA 1Q4OA 4O56A 4O6WA 4RCPA 3P2WA 5J19A 3Q1IA 4HABA 3P36A 4WHKA 3HIHA 3HIKA 3P2ZA 3RQ7A 4E9CA 4WHLA 4H5XA 4XB0A 4HY2A 3FVHA 4J7BB 4X9WA 2OGQA 4X9RA 1UMWA 2OJXA 1Q4KA 5DNJA 5DMVC 4E9DA 3P35A 4RS6A 4LKLA 4X9VA 3C5LA 3P37A 4DFWA 2N19A 5LHZA 3P34A 5DMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YYP A;  4WHH A;  4HCO A;  4LKM A;  4H71 A;  4O9W A;  4E67 A;  3BZI A;  1Q4O A;  4O56 A;  4O6W A;  4RCP A;  3P2W A;  5J19 A;  3Q1I A;  4HAB A;  3P36 A;  4WHK A;  3HIH A;  3HIK A;  3P2Z A;  3RQ7 A;  4E9C A;  4WHL A;  4H5X A;  4XB0 A;  4HY2 A;  3FVH A;  4J7B B;  4X9W A;  2OGQ A;  4X9R A;  1UMW A;  2OJX A;  1Q4K A;  5DNJ A;  5DMV C;  4E9D A;  3P35 A;  4RS6 A;  4LKL A;  4X9V A;  3C5L A;  3P37 A;  4DFW A;  2N19 A;  5LHZ A;  3P34 A;  5DMS A; 
#chains in the Genus database with same CATH topology
 4YYP A;  4CXS A;  2IA9 A;  3LXQ A;  4LKM A;  4E67 A;  3BZI A;  2I9X A;  4O6W A;  2E50 A;  3P2W A;  3GYV A;  4HAB A;  3HMJ G;  4NK7 A;  3HIK A;  4XB0 A;  1AUK A;  4X9W A;  1UMW A;  1E3C P;  3HFD A;  4CXK A;  4CYR A;  5DMV C;  3P35 A;  4FDI A;  3P37 A;  4DFW A;  1HDH A;  5DMS A;  3LM3 A;  4HCO A;  4N7V A;  3P34 A;  4O9W A;  1Q4O A;  4CXU A;  1FSU A;  5J19 A;  1N2K A;  5AJ9 A;  4G7N A;  1A87 A;  3HIH A;  4E9C A;  3P2Z A;  2OGQ A;  4RS6 A;  2N19 A;  4CYS A;  5LHZ A;  4N9J A;  2UV8 G;  4H71 A;  4RCP A;  3P36 A;  1F32 A;  1P49 A;  4NKB A;  3GYW A;  4H5X A;  1E1Z P;  4HY2 A;  3FVH A;  2OJX A;  1E2T A;  1Q4K A;  4LKL A;  1F34 B;  3RQ7 A;  1N2L A;  4WHH A;  1E2S P;  3ED4 A;  4O56 A;  5DAY A;  3FS3 A;  3Q1I A;  4WHK A;  1E33 P;  4WHL A;  2I9Z A;  4J7B B;  4X9R A;  2QZU A;  5DNJ A;  3KDR A;  4E9D A;  4FDJ A;  3C5L A;  4N7Z A;  2VKZ G;  4X9V A; 
#chains in the Genus database with same CATH homology
 4YYP A;  4WHH A;  4HCO A;  4LKM A;  4H71 A;  4O9W A;  4E67 A;  3BZI A;  1Q4O A;  4O56 A;  4O6W A;  4RCP A;  3P2W A;  5J19 A;  3Q1I A;  4HAB A;  3P36 A;  4WHK A;  3HIH A;  3HIK A;  3P2Z A;  3RQ7 A;  4E9C A;  4WHL A;  4H5X A;  4XB0 A;  4HY2 A;  3FVH A;  4J7B B;  4X9W A;  2OGQ A;  4X9R A;  1UMW A;  2OJX A;  1Q4K A;  5DNJ A;  5DMV C;  4E9D A;  3P35 A;  4RS6 A;  4LKL A;  4X9V A;  3C5L A;  3P37 A;  4DFW A;  2N19 A;  5LHZ A;  3P34 A;  5DMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...