4LKLA

Crystal structure of plk1 polo-box domain in complex with pl-55
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
222
structure length
214
Chain Sequence
CHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK1
publication title Exploring the binding nature of pyrrolidine pocket-dependent interactions in the polo-box domain of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 71
structure length 214
sequence length 222
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2013-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4lklA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4lklA01
1Q4OA 4YYPA 2OJXA 4X9VA 4HY2A 3C5LA 4HABA 4J7BB 4WHLA 3P37A 3P2ZA 4XB0A 4E9DA 5DMSA 3P36A 4RCPA 1Q4KA 5LHZA 4E9CA 3FVHA 4WHKA 3P35A 4H71A 4LKLA 4E67A 5DMVC 3Q1IA 4WHHA 2OGQA 5DNJA 4RS6A 4O56A 4O6WA 5J19A 3HIKA 4H5XA 3RQ7A 4DFWA 3P2WA 4HCOA 4LKMA 2N19A 3HIHA 3P34A 4O9WA 4X9RA 4X9WA 1UMWA 3BZIA
chains in the Genus database with same CATH superfamily
1Q4OA 3KDRA 2OJXA 4X9VA 4HY2A 1N2LA 4CXSA 1Q4KA 3GYVA 4E9CA 4WHKA 4O56A 3HIKA 1E2TA 3P2WA 3FS3A 3HIHA 3P34A 4O9WA 3BZIA 1E1ZP 1N2KA 4HABA 4J7BB 4WHLA 1F34B 5DMSA 4FDJA 4RCPA 2I9XA 5LHZA 3FVHA 4N7VA 4H71A 4E67A 4RS6A 4NKBA 5J19A 4DFWA 2I9ZA 1P49A 1E33P 4CYSA 4NK7A 4X9WA 1UMWA 1E2SP 2UV8G 1FSUA 4CYRA 4CXKA 3GYWA 3P2ZA 4CXUA 4E9DA 1A87A 2VKZG 4N9JA 5AJ9A 3P36A 3HFDA 1AUKA 1HDHA 3P35A 4LKLA 3Q1IA 4WHHA 2OGQA 5DNJA 4HCOA 4G7NA 2QZUA 4X9RA 5DAYA 3LM3A 4YYPA 4N7ZA 1F32A 3LXQA 3C5LA 3ED4A 3P37A 4XB0A 2E50A 2IA9A 1E3CP 5DMVC 4O6WA 4H5XA 3RQ7A 4LKMA 2N19A 4FDIA 3HMJG
chains in the Genus database with same CATH topology
1Q4OA 4YYPA 2OJXA 4X9VA 4HY2A 3C5LA 4HABA 4J7BB 4WHLA 3P37A 3P2ZA 4XB0A 4E9DA 5DMSA 3P36A 4RCPA 1Q4KA 5LHZA 4E9CA 3FVHA 4WHKA 3P35A 4H71A 4LKLA 4E67A 5DMVC 3Q1IA 4WHHA 2OGQA 5DNJA 4RS6A 4O56A 4O6WA 5J19A 3HIKA 4H5XA 3RQ7A 4DFWA 3P2WA 4HCOA 4LKMA 2N19A 3HIHA 3P34A 4O9WA 4X9RA 4X9WA 1UMWA 3BZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q4O A;  4YYP A;  2OJX A;  4X9V A;  4HY2 A;  3C5L A;  4HAB A;  4J7B B;  4WHL A;  3P37 A;  3P2Z A;  4XB0 A;  4E9D A;  5DMS A;  3P36 A;  4RCP A;  1Q4K A;  5LHZ A;  4E9C A;  3FVH A;  4WHK A;  3P35 A;  4H71 A;  4LKL A;  4E67 A;  5DMV C;  3Q1I A;  4WHH A;  2OGQ A;  5DNJ A;  4RS6 A;  4O56 A;  4O6W A;  5J19 A;  3HIK A;  4H5X A;  3RQ7 A;  4DFW A;  3P2W A;  4HCO A;  4LKM A;  2N19 A;  3HIH A;  3P34 A;  4O9W A;  4X9R A;  4X9W A;  1UMW A;  3BZI A; 
#chains in the Genus database with same CATH topology
 1Q4O A;  3KDR A;  2OJX A;  4X9V A;  4HY2 A;  1N2L A;  4CXS A;  1Q4K A;  3GYV A;  4E9C A;  4WHK A;  4O56 A;  3HIK A;  1E2T A;  3P2W A;  3FS3 A;  3HIH A;  3P34 A;  4O9W A;  3BZI A;  1E1Z P;  1N2K A;  4HAB A;  4J7B B;  4WHL A;  1F34 B;  5DMS A;  4FDJ A;  4RCP A;  2I9X A;  5LHZ A;  3FVH A;  4N7V A;  4H71 A;  4E67 A;  4RS6 A;  4NKB A;  5J19 A;  4DFW A;  2I9Z A;  1P49 A;  1E33 P;  4CYS A;  4NK7 A;  4X9W A;  1UMW A;  1E2S P;  2UV8 G;  1FSU A;  4CYR A;  4CXK A;  3GYW A;  3P2Z A;  4CXU A;  4E9D A;  1A87 A;  2VKZ G;  4N9J A;  5AJ9 A;  3P36 A;  3HFD A;  1AUK A;  1HDH A;  3P35 A;  4LKL A;  3Q1I A;  4WHH A;  2OGQ A;  5DNJ A;  4HCO A;  4G7N A;  2QZU A;  4X9R A;  5DAY A;  3LM3 A;  4YYP A;  4N7Z A;  1F32 A;  3LXQ A;  3C5L A;  3ED4 A;  3P37 A;  4XB0 A;  2E50 A;  2IA9 A;  1E3C P;  5DMV C;  4O6W A;  4H5X A;  3RQ7 A;  4LKM A;  2N19 A;  4FDI A;  3HMJ G; 
#chains in the Genus database with same CATH homology
 1Q4O A;  4YYP A;  2OJX A;  4X9V A;  4HY2 A;  3C5L A;  4HAB A;  4J7B B;  4WHL A;  3P37 A;  3P2Z A;  4XB0 A;  4E9D A;  5DMS A;  3P36 A;  4RCP A;  1Q4K A;  5LHZ A;  4E9C A;  3FVH A;  4WHK A;  3P35 A;  4H71 A;  4LKL A;  4E67 A;  5DMV C;  3Q1I A;  4WHH A;  2OGQ A;  5DNJ A;  4RS6 A;  4O56 A;  4O6W A;  5J19 A;  3HIK A;  4H5X A;  3RQ7 A;  4DFW A;  3P2W A;  4HCO A;  4LKM A;  2N19 A;  3HIH A;  3P34 A;  4O9W A;  4X9R A;  4X9W A;  1UMW A;  3BZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...