4LKLA

Crystal structure of plk1 polo-box domain in complex with pl-55
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
222
structure length
214
Chain Sequence
CHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploring the binding nature of pyrrolidine pocket-dependent interactions in the polo-box domain of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PLK1
total genus 71
structure length 214
sequence length 222
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2013-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4lklA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4lklA01
1Q4KA 4HABA 4O56A 4E9DA 4H5XA 2N19A 3P36A 4WHHA 4WHLA 4X9WA 4DFWA 3Q1IA 4RCPA 2OJXA 4YYPA 5DMVC 3HIHA 3P2ZA 4J7BB 3RQ7A 3HIKA 4O6WA 4O9WA 4E9CA 4LKLA 3C5LA 3BZIA 3P35A 4HCOA 1UMWA 4WHKA 5J19A 5LHZA 4LKMA 3FVHA 3P37A 4RS6A 2OGQA 1Q4OA 4E67A 4X9RA 5DNJA 5DMSA 4HY2A 4H71A 4XB0A 4X9VA 3P2WA 3P34A
chains in the Genus database with same CATH superfamily
1F34B 4CXKA 4N7ZA 4E9DA 1A87A 1N2KA 4H5XA 4DFWA 2QZUA 3P36A 4X9WA 1E2TA 3HFDA 1FSUA 3BZIA 5J19A 5LHZA 4E67A 1N2LA 2I9XA 4X9VA 3LXQA 4CYRA 4O56A 4WHHA 3Q1IA 2IA9A 2OJXA 4YYPA 5DMVC 3HIHA 4G7NA 4NKBA 3HIKA 4LKLA 4HCOA 4LKMA 3KDRA 1HDHA 4RS6A 2OGQA 1Q4OA 4X9RA 5DMSA 5AJ9A 2UV8G 4H71A 4HY2A 5DAYA 4HABA 1P49A 4RCPA 1AUKA 3ED4A 4FDIA 4CYSA 4N7VA 4J7BB 4CXSA 4O6WA 4O9WA 3GYWA 4E9CA 1UMWA 4FDJA 4N9JA 1E3CP 3FVHA 5DNJA 4XB0A 3P2WA 3HMJG 2I9ZA 1E2SP 1Q4KA 1E33P 1F32A 2N19A 4WHLA 2E50A 3GYVA 4CXUA 3P2ZA 4NK7A 3RQ7A 1E1ZP 3C5LA 3FS3A 3P35A 4WHKA 3LM3A 3P37A 2VKZG 3P34A
chains in the Genus database with same CATH topology
1Q4KA 4HABA 4O56A 4E9DA 4H5XA 2N19A 3P36A 4WHHA 4WHLA 4X9WA 4DFWA 3Q1IA 4RCPA 2OJXA 4YYPA 5DMVC 3HIHA 3P2ZA 4J7BB 3RQ7A 3HIKA 4O6WA 4O9WA 4E9CA 4LKLA 3C5LA 3BZIA 3P35A 4HCOA 1UMWA 4WHKA 5J19A 5LHZA 4LKMA 3FVHA 3P37A 4RS6A 2OGQA 1Q4OA 4E67A 4X9RA 5DNJA 5DMSA 4HY2A 4H71A 4XB0A 4X9VA 3P2WA 3P34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q4K A;  4HAB A;  4O56 A;  4E9D A;  4H5X A;  2N19 A;  3P36 A;  4WHH A;  4WHL A;  4X9W A;  4DFW A;  3Q1I A;  4RCP A;  2OJX A;  4YYP A;  5DMV C;  3HIH A;  3P2Z A;  4J7B B;  3RQ7 A;  3HIK A;  4O6W A;  4O9W A;  4E9C A;  4LKL A;  3C5L A;  3BZI A;  3P35 A;  4HCO A;  1UMW A;  4WHK A;  5J19 A;  5LHZ A;  4LKM A;  3FVH A;  3P37 A;  4RS6 A;  2OGQ A;  1Q4O A;  4E67 A;  4X9R A;  5DNJ A;  5DMS A;  4HY2 A;  4H71 A;  4XB0 A;  4X9V A;  3P2W A;  3P34 A; 
#chains in the Genus database with same CATH topology
 1F34 B;  4CXK A;  4N7Z A;  4E9D A;  1A87 A;  1N2K A;  4H5X A;  4DFW A;  2QZU A;  3P36 A;  4X9W A;  1E2T A;  3HFD A;  1FSU A;  3BZI A;  5J19 A;  5LHZ A;  4E67 A;  1N2L A;  2I9X A;  4X9V A;  3LXQ A;  4CYR A;  4O56 A;  4WHH A;  3Q1I A;  2IA9 A;  2OJX A;  4YYP A;  5DMV C;  3HIH A;  4G7N A;  4NKB A;  3HIK A;  4LKL A;  4HCO A;  4LKM A;  3KDR A;  1HDH A;  4RS6 A;  2OGQ A;  1Q4O A;  4X9R A;  5DMS A;  5AJ9 A;  2UV8 G;  4H71 A;  4HY2 A;  5DAY A;  4HAB A;  1P49 A;  4RCP A;  1AUK A;  3ED4 A;  4FDI A;  4CYS A;  4N7V A;  4J7B B;  4CXS A;  4O6W A;  4O9W A;  3GYW A;  4E9C A;  1UMW A;  4FDJ A;  4N9J A;  1E3C P;  3FVH A;  5DNJ A;  4XB0 A;  3P2W A;  3HMJ G;  2I9Z A;  1E2S P;  1Q4K A;  1E33 P;  1F32 A;  2N19 A;  4WHL A;  2E50 A;  3GYV A;  4CXU A;  3P2Z A;  4NK7 A;  3RQ7 A;  1E1Z P;  3C5L A;  3FS3 A;  3P35 A;  4WHK A;  3LM3 A;  3P37 A;  2VKZ G;  3P34 A; 
#chains in the Genus database with same CATH homology
 1Q4K A;  4HAB A;  4O56 A;  4E9D A;  4H5X A;  2N19 A;  3P36 A;  4WHH A;  4WHL A;  4X9W A;  4DFW A;  3Q1I A;  4RCP A;  2OJX A;  4YYP A;  5DMV C;  3HIH A;  3P2Z A;  4J7B B;  3RQ7 A;  3HIK A;  4O6W A;  4O9W A;  4E9C A;  4LKL A;  3C5L A;  3BZI A;  3P35 A;  4HCO A;  1UMW A;  4WHK A;  5J19 A;  5LHZ A;  4LKM A;  3FVH A;  3P37 A;  4RS6 A;  2OGQ A;  1Q4O A;  4E67 A;  4X9R A;  5DNJ A;  5DMS A;  4HY2 A;  4H71 A;  4XB0 A;  4X9V A;  3P2W A;  3P34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...