4LKSA

Structure of cbm32-3 from a family 31 glycoside hydrolase from clostridium perfringens in complex with galactose
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
157
structure length
157
Chain Sequence
b'LYKKAGSEFALDSSKLEAIYATSEADRDYKENAVDGDENTIWHSAYQAADKLPVSITIKLDKAYDLNQIDYLPRQNSRNGHVTEYKIETSLDNENWTEVRTGNLEVNEAGNALANRGYNPIRFNTINAQYLRFTALKTLGDTNNKYASAAELVFYGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Sugar binding protein
total genus 37
structure length 157
sequence length 157
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4lksA00
5EIYB 2W5FA 4DEQA 2QQOA 4KI5M 3VD3A 1PMJX 3OB8A 2VZRA 3LEIA 1GUIA 2W1WA 3CMGA 4ZZ8A 3C8XA 2VZTA 5EJ1B 1CIYA 2C4XA 1GOHA 3UETA 3CQOA 2ORXA 3THCA 3MO4A 5HPOA 3ECQA 4OUEA 4M4PA 1J83A 3P1IA 2QQIA 2E33A 1DLCA 1HN1A 1W8NA 4RN5A 4QX1A 2WUHA 3GDBA 2VCCA 1UYYA 3T2OA 1UYXA 2VZ1A 2VMEA 4ZXEA 5J1XA 1WCQA 4PQQA 1CZSA 1LNSA 4OMDA 4UAPA 3IIIA 1JZ4A 4ARYA 3AC0A 3CDZB 2VR4A 3LEKA 3CZUA 5IYYA 1JU3A 2WN3A 5G05L 3E1F1 4A4AA 1XC6A 2Y6HA 4A42A 1UXXX 3BGAA 4MGSA 2VMCA 2YC4A 4MADA 3I3EA 1D7PM 2J1SA 2BGOA 2C9KA 2QQMA 4OMCA 4TXWA 3C7HA 1K45A 2J1TA 2RV9A 1W0NA 2VQUA 2J1VA 2VZPA 2VJXA 2WO2A 3UESA 4PT6A 3IDAA 4UOJA 4P00B 3SKVA 1JZ8A 3W5NA 2ZEWA 2EIEA 5LA0A 1XNAA 2Y6KA 3C7GA 3EYPA 5JXJA 4A6OA 2HLEA 4LKSA 3DYPA 1P8JA 2EICA 4QB6A 3EB7A 2VCBA 2VC9A 4QDSA 3LPFA 3SEPA 4KWUA 1IQDC 2VZSA 4Z2AA 2L9LA 2R7EB 4JKMA 4QB1A 3PUHA 3SKJE 1UY0A 2V5DA 3THDA 4CU7A 4AG4A 1H6YA 1JYNA 4CU6A 1TG7A 4PF1A 3A7QA 2Z4FA 1PX4A 3HEIA 1PMHX 4BJ0A 2VZVA 2WDBA 1JZ6A 4XVHA 1UXZA 5CZKA 3DECA 4CUAA 3UNPA 2YG0A 1BHGA 3I2FA 4JKLA 2XQXA 4MO3M 3I2HA 2W47A 4BK5A 2X10A 4DXRA 3VD4A 1CZTA 2DDUA 4QDQA 1GOFA 3HNMA 4DEVA 1SDDB 1JYXA 2XOMA 2Y6JA 3OEAA 4LPLA 2VZOA 5C71A 3ACHA 3MUY1 4CUBA 3DYOA 2W95A 5DPNA 1ULPA 5EJZB 3T0DA 3GGLA 3MUZ1 1O8PA 2WO3A 3HNBM 4JX0A 1O8SA 2WAOA 4BXSV 3HOBA 4JHZA 4W50A 1I5PA 1W8OA 3FL7A 1NX9A 5LCWL 2JD9A 3WF1A 3WNLA 2QQNA 1OF4A 4XUQA 1UWWA 3C7OA 3WNMA 1W99A 5B4XA 5C7GA 2JE8A 4XURA 3SEEA 3CKHA 3ACIA 2VMFA 4DUXA 4XUPA 2XHNA 1JHJA 1US3A 3T2PA 3T0BA 1JU4A 3WF0A 3U37A 3VDCA 2BGPA 3MV01 3DYMA 1UMIA 3GM8A 5HXMA 5JXGA 1K3IA 2W46A 2ZXQA 2CDPA 4CUCA 2W3JA 1WKYA 3I3BA 1UY1A 3WNNA 4E8CA 3I2JA 4MGQA 1W9SA 2W87A 5F7UA 1KGYA 2ID4A 2DCJA 3OGVA 4GZ9A 3D3AA 3LE0A 4JKKA 4QX2A 1K42A 1JZ5A 2ZEYA 3K4ZA 2E32A 1NUKA 3CIHA 5LA2A 2QQJA 2EIBA 2WZEA 3NNGA 3WNPA 1T2XA 3ACFA 1JZ2A 2WO1A 2W94A 4DXSA 1JZ3A 2B9VA 2Y8KA 2JDAA 1TVGA 4AAXA 4ZZ5A 3ABZA 3T08A 5JUVA 1L7QA 1OT5A 2BBAA 4D8MA 4DUVA 4LQRA 5A1AA 2J1UA 3I97A 5B4NA 2E26A 5JMOA 2PQSA 3J7HA 5FUIA 1JYWA 2VZQA 3HNYM 4CVUA 5DQ0A 4FI9A 4QAWA 3WF3A 4QX0A 2QQKA 4KMQA 4P02B 3T09A 1JYVA 3C7FA 4XUNA 4BK4A 4E8DA 1SG3A 3K46A 1W9WA 2LW8A 2ZEZA 3OG2A 3VD5A 1R64A 3WNKA 2WBKA 3NQHA 5JXIA 5JR2A 1EUTA 3HJRA 2C26A 3LQCA 2WAAA 5IFPA 2QQLA 1GQPA 3MBWA 4IUGA 3LEGA 1DP0A 2YB7A 4W8JA 4CU9A 3WNOA 1J84A 4CU8A 1EUUA 1L7RA 1US2A 3WEZA 5C70A 3IAPA 5IJRA 2V4VA 3VD9A 4P08A 2W1UA 4MOAA 1GMMA 1F4AA 3ETPA 3HPNA 3I2GA 2VZUA 3JXSA 4M4RA 5DMYA 1OH4A 1W9TA 2XONA 4W4ZA 2EIDA 5IHRA 2WZ8A 3BN6A 4HG6B 5JXHA 3CZJA 4OYUA 1JZ7A 1UY2A 2E31A 3OGRA 1UZ0A 4ET7A 2JKXA 2ZEXA 4L0PA 4QB2A 3WSOA 4D0QA 1K12A 2WABA 4LHSA 3ACGA 1NAEA 2X09A 4A44A 2VQTA 1UY3A 4P5YA 3A23A 3PUIA 2VM9A 3T2QA 1JI6A 4GWJA 2CDOA 4XUTA 5G04L 4BDVB 4QDRA 3VDAA 2RVAA 3NRUA 2WN2A 1UYZA 1DYOA 2J1RA 3WF2A 1PX3A 2VTFA 1OD3A 5IFTA 2BZDA 1SHWB 3IAQA 2W1QA 3C7EA 2VOTA 3FHAA 2BERA 3F2ZA 1CX1A 2VMDA 2OKXA 1YQ2A 2KD7A 2DCKA 3W5MA 4QX3A 4A3ZA 5CYYA 2J7MA 3I2IA 2Y64A 1OF3A 1UY4A 2W1SA 2YFZA 3NJVA 4GWIA 4DXTA 1ULOA 2VL4A 3P6BA 2YC2A 3LPGA 3VD7A 3I2KA 3MV11 4A41A 3OGSA 1GNYA 3HN3A 1MPXA 3K4AA 3WQBA 1O59A 1XNTA 1CZVA 1NKGA 2Y6GA 4XZUG 3ZM8A 3NJXA 2J1EA 1UMHA 4OZOA 2W91A 2Y6LA 1H6XA 1GU3A 3FHQA 3GXUA 2LS6A 2YFUA 5LA1A 5DN2A 3A21A 3OEBA 2HYXA 2ORZA 4UI9L 2VCAA 1XPWA 3K75B 3T0AA 2J22A 2VO5A 1F4HA 1RYYA 4QPWA 1KEXA 3A22A 3I3DA 2RJ2A 4TTGA 3OBAA 1GOGA 3K77A 4A45A 5I0DA 4DUWA 2J1AA 3VDBA 2W9XA 4YPJA 4RYDA 2X05A 2QBXA 2WQ8A 2V72A 3IB3A 4ARXA 4XUOA 3K4DA 3WF4A 2VZ3A 3FN9A 1UX7A 2W92A 4ZY9A 2WYSA 2B4KA
chains in the Genus database with same CATH superfamily
1VBD1 3VDDC 5C9AB 2JECA 3POWA 4E9KA 2W5FA 2QQOA 1H9WA 1OHFA 2WFF2 1GZ9A 3L2YA 1KRIA 1W06A 2W1WA 1OC1A 2OUJA 4GQ7A 4UW3A 3KMHA 5EJ1B 1R1A3 2HWE2 1GOHA 1LODA 2BWAA 4HVOA 4PI0A 5A6ZA 5HPOA 3NO8A 1XB9A 1QHDA 4MYEA 4OUEA 4M4PA 1J83A 5EHDA 4COYA 2QQIA 5LEJA 2E33A 4ITCA 5FZBA 4B7EA 2ZAHA 4RN5A 5D8AB 4NRMA 2WUHA 2VCCA 3AKTA 1DG6A 1KITA 1YFWA 2WSVA 4V2VA 4R4ZA 3T2OA 1UYXA 1UZVA 2PAKA 1QEXA 2VZ1A 3NAPB 3QCWA 2R072 2ET1A 2WZR2 3LIGA 4AI0A 4PQQA 3GHNA 1URXA 3ZR6A 3ENRA 4OMDA 5FREA 4PIXA 3IIIA 4EN7B 3MPBA 2VBDA 4ARYA 4YFZA 1JZ4A 3CJIC 2QE3A 3CZUA 1HKDA 2WN3A 4MXWB 3OPWA 4GULA 5JCTA 1CAXB 5ABJC 3MHZA 5BPXA 2D6KA 1UXXX 5CU1A 4CYDA 5A3TA 1S0BA 1DQ6A 2JEMA 2ZHLA 3EMRA 1GP6A 1RHI2 4JHTA 4Q2FA 4QGNA 4XIKA 3ZFGC 4COVA 2G19A 5C8CA 3KLSA 1XSQA 2D6NA 4JQTA 5K4LA 2MNGA 2XXZA 5CFDC 1OXCA 2R061 5JSPA 5J48A 1AYN2 4OMCA 4TXWA 2FDGA 3C7HA 3ZYJB 1K45A 3N35A 1DZTA 4YM1A 3KSCA 2X29A 4AAPA 2WFF1 1NCQC 1UD1A 1UL9A 1N3OA 2J1VA 5F5CA 2WFPA 1SZBA 2JIGA 4Y4YA 1AR71 2WO2A 5FZ3A 1RUJ3 1NOVA 4PT6A 3BOWA 1RJ8A 3V0BB 4P00B 3VDDB 1JZ8A 1U5ZA 2KA3A 3WHUA 4BB3A 2ZEWA 2EIEA 1YLLA 4BWOA 2Y6KA 2VVDA 3NW4A 5FCCA 4AZZA 3RZZA 5C9AA 5LA0A 1FMD2 4UT5A 4YW2A 4LOSA 3MW4A 4N9HA 4LBLA 2WT0A 5EYXA 3AP9A 1OH3A 4Y20B 2VQ0A 5EYYA 4QQPA 1DCSA 3M2MA 3QACA 4IV1B 3OY8B 5H9SA 1C4RA 3IIAA 1D4M1 4YGCA 1ODMA 3AK0A 4XF1A 4COZA 4HLTA 1TME2 4GH4C 1P8JA 1AXKA 2E63A 1UOBA 4FXKB 4JDOA 5D1IA 5LWBA 3EB7A 4MX3A 2VCBA 5DUUA 2BVVA 1COV1 4FCAA 3UV9A 2VNVA 5LBEA 1GSLA 3KT4A 1OA3A 2V4AA 4YZ5A 1LOCA 1IQAA 2GC0A 2I74A 2VOWA 4WZFA 1IHMA 1U0AA 2VMGA 3NAPA 3FX3A 3LIHA 4P5HA 3AP7A 1RHI1 2A6XA 5F5QA 4LO4B 2R7EB 1J58A 4C1WA 1ULEA 5SV8A 5E1RA 1REEA 2V5DA 5KHKA 4HL0A 3CJIB 3ST7A 5J7MA 4AG4A 4AEJA 2FZ2A 1PO21 2R063 1AYN1 3TN92 5KHIA 1XE8A 4NIDA 1NA1B 4MXWA 1XE7A 2XKOA 3AMMA 3SC7X 2Q8EA 3A7QA 3U0ZA 3QH6A 2WS92 3JD73 3HEIA 3IDCB 2WFF3 1WLWA 3LSDA 2A73B 1ALYA 4X6RB 3ME2A 5FZCA 3ZN4A 5CZKA 1A3KA 4XACA 1AR73 4OULA 5FZAA 4AFAA 2Z69A 3I2FA 5A7SA 4BCUA 2XQXA 1ENRA 4LBJA 4IE4A 2WRAA 4MO3M 1NCRC 1E57A 4HZFA 4AFDA 5C6CA 2LUWA 1ULCA 4Q29A 4ATEA 1UPIA 4YW1A 3V65A 4YGDA 3ZYPA 2DDUA 4XFHA 4QDQA 1QJEA 3HNMA 4DEVA 5FPXA 1AR82 1WMEA 3POYA 4GWNA 1D4M3 3AL5A 4KQ7A 4RGAA 5A70A 3BB6A 2BBVA 4K3UA 1GBGA 1YQCA 3OEAA 3VDDA 3WY6A 3ACHA 2Q8OA 1PIV2 4LHKA 2Y34A 1COV3 1LHUA 3AYDA 4BLIA 5EJZB 3THPA 1V70A 3E6CC 1CWPA 5FLHA 4G3YC 5JOXA 1MS0A 3KF3A 4Y20A 5LASA 4CEYC 4ASLA 5JDBA 4IV1A 1HDKA 3MUZ1 1UIJA 3I2OA 1UO9A 3HNBM 4Q4Y1 4AI1A 4PIZA 3O1PA 2HWF2 1PZ8A 1ZNPA 1JUHA 4NWVA 2OXBA 1WCUA 3OOXA 3GZUC 3SHRA 1O8SA 1PO23 2WAOA 3VV1A 3WR0A 4BXSV 3FWEA 4JHZA 1I5PA 1QJFA 1YNAA 1Y4WA 4XJUA 1IKQA 1NX9A 1OFSA 2JXAA 3OUHA 5F5IA 3U1XA 1S0GA 3D82A 4B1LA 3NKGA 4XUQA 4HMZA 5F2SA 4Y26A 1H9PA 4KBZA 4RA0A 5K7PA 5DAXA 5B4XA 3CJIA 4WVVA 5FXXA 1GWMA 1R081 1R091 5ABJA 5F37A 1VAKA 1NA1A 1WD4A 2YGMA 2VMFA 3CU7A 3POBA 2ES3A 1RUG1 3B00A 2NPIA 5F3CA 1OVSA 3GCWA 4AVTA 2QZ2A 3WF0A 5C4WC 5CFDA 3GALA 3WT3A 2CNAA 2CSGA 4Q4W1 2DU0A 4CCOA 4FO9A 1AL0G 4CRQA 4U2AA 1G8WA 1UMIA 1NCRB 3GM8A 3BPZA 3PJYA 5FPAA 5JXGA 2VU9A 1RUF2 1UIKA 5KBFA 1NCQA 2W3JA 1WKYA 3I3BA 2Y33A 1C57A 1W05A 4OUMA 3OBRA 1H2NA 2VOKA 3T3YA 3M7AA 4DNYA 1O6UA 5GZDA 5A33B 4ZHNA 4CDQB 1UCXA 3I2JA 4Q0VA 1W9SA 3PURA 5FKBA 1I3HA 1UOGA 3ZDVA 3R4DB 4YM3A 5F7UA 1ASJ2 1CAUB 2C5DA 2VG9A 4Q4Y3 1VRH2 2D43A 3VBRC 3O12A 4FP2A 4JKKA 4OHXA 3T2TA 1K42A 3HWJA 2G9FA 4BQ1A 4CDUB 1W28A 3TYJA 3CIHA 3VZMA 5IW0A 3NNGA 3NSTA 5FP4A 4EWEA 1C8NA 4HETA 5EZWA 3W20A 2WO1A 2A71A 4RFT0 2JB8A 4F8AA 2QQVA 5FJKA 2VY0A 1STMA 3NNJA 2B9VA 4LBQD 2XBO2 3BVCA 1BEV1 3EJKA 4BM8A 2RDQA 4D7TA 1Z7S2 1YQ8A 4YZ1A 5I93A 5GKAC 1K5MC 1R093 1R083 5L36A 1OLRA 1TVGA 1ZZCA 2GC2A 3HBZA 2JDZA 4M01A 3DKQA 4XYXA 5EV7A 1RUG3 3H8UA 3VZNA 5JZGB 1L7QA 4D8MA 4N53B 4P9LA 4DUVA 5CKNA 2ZX1A 3LFIA 3KT1A 3VBUC 1GZCA 1PVC2 4JCKA 1AX0A 4V2WA 1F5JA 4AVSA 4Q4W3 1QKQA 1WW5A 2FBEA 1QQP3 2WJSA 5FUIA 2JENA 3PMEA 1Q8PA 2H0VA 1OPMA 5DQ0A 4KBBA 4AE2A 1SLBA 1FXZA 3KS7A 4Z82A 3WF3A 1WA6X 5C4WB 5J37A 1APNA 5C3QA 4A7KA 3T09A 1XNDA 4CA9A 4OI0A 4AK3A 4AW7A 4LA3A 3C7FA 5FZ9A 4E8DA 1MEC2 1SG3A 3UJQA 1F35A 2DU1A 5GZEA 2ZEZA 3OG2A 1ASJ1 4YVSC 3TWIA 3VD5A 3OD4A 1NCRA 4QT6A 3WNKA 4FOYA 1AL22 4TYSA 1DGLA 2FZ1A 4QX5A 3KCYA 1QXJA 1RUC2 3VL8A 5JIUA 3Q9OA 2A6YA 2VECA 2BEOA 1PK6B 2YHJA 1LOFA 2NLRA 2D5FA 2DUPA 2QNKA 5A7NA 3ZKUA 2PAMA 5A33A 3POEA 1GQPA 1JBCA 4IUGA 3N9QA 4IE5A 2ARXA 1SLIA 2SLIA 2VNRA 3KVBA 4CU9A 1CAUA 3O1TA 1Y9QA 5CISA 1V6OA 1PMIA 1WW6A 2PAEA 4ZXKA 1US2A 4Q8KA 1BEV3 2A1XA 1MQTC 1Z7S1 4L2NA 5C70A 1PZ9A 2V4VA 4CEYA 1XRUA 1QH7A 4NHMA 3APBA 3LAGA 4JTNA 4AGRA 5DMYA 5FO9B 3KGZA 2XONA 4W4ZA 1W0OA 4E4HA 1V9U2 2D97A 2EIDA 3AL6A 4UFIA 3VHNA 4QDSA 1PVC1 3WUCA 5IK8A 3RZJA 5BUVA 3BN6A 2HWC2 1ZRCA 3TNPB 4NPMA 3J7LA 1FNZA 5D2AA 1I5ZA 4WM7B 3OGRA 2GC1A 2QFEA 1GANA 1H8TC 1UZ0A 4LO6B 4WM8C 3RG0A 3WG2A 2K9ZA 4ET7A 5JZGA 2G1MA 2YUEA 3N7LA 5F3IA 3KT7A 2VUDA 2ZEXA 3URFA 2HKXA 2R041 3L9JT 5A3NA 2FDHA 4QGMA 4XDPA 1V00A 1ODNA 5HV0A 3RZHA 2RS52 2F4LA 1ASJ3 2GNMA 3ACGA 3ZFEC 1QGLA 4N43C 5L9BA 4BIOA 3IZOA 4CEWC 2KXLA 3R6SA 3PUIA 4NWWA 5DUXA 4OI1A 3O5SA 5C4WA 4BOWA 5LZ6A 2F17A 3FC0A 3H3LA 4S2HA 5T5OA 2RVAA 3ZN5A 2AZ5A 4V1PA 2VXRA 1UYZA 2UU8A 4WVZA 4YVSB 1LRHA 1WMFA 1DYOA 2BWCA 1SCSA 4D6QA 2BOJA 3AXEA 4DXZA 5BNOB 5DAQA 1LU1A 3ZSEA 1W8FA 5IVVA 1GYKA 3AKPA 3ZX7A 1FATA 1H1MA 1OSGA 3LWCA 3VB9A 3AKQA 4NAOA 3IAQA 1BQPA 4Y1VA 1BK0A 2QDNA 3C7EA 4IEPA 1PGL2 2XJRA 1V9U1 2VMDA 1JYTA 4QPIB 4UF0B 3MW3A 4RR3C 3VBRA 3WVJA 2PQQA 1PVC3 2DCKA 1WBFA 1ZBE1 2HWC1 4HANA 4UFHA 5CKMA 1NQDA 1DBNA 2IXHA 1FV2A 1SEFA 3H0OA 4A3ZA 4QD2A 3ZOIA 4H7LA 4NR1A 1C28A 1NQJA 2EF6A 2R1DA 2XMLA 2YDEA 4QX8A 4UFMA 4YNIA 5C3OA 5HCAA 3I2IA 4QGLA 4S2GA 5L9VA 4XJZA 4Q1PA 4Q1RA 4M00A 1CVNA 1CN1A 3D6EA 5DDJ2 3THTA 3VBOC 4AVAA 5I0TA 4LO8A 2XJVA 2D44A 4FTEA 2BNMA 1BMV2 3PHMA 1RUD1 2R043 4DXTA 4LULA 2RS51 3PU3A 3ZFFB 3VD7A 3I2KA 3MV11 5FPLA 4A41A 4CUGA 1GNYA 3WOGA 2GN3A 3MEPA 3LA7A 3AYAA 4WM7A 1JS9A 3BU0A 1O59A 1XNTA 1E5SA 1S0CA 4L92A 1W6MB 2IVJA 1O3SA 2UYBA 3FMGA 2GAUA 3ZM8A 2BFUL 2DURA 3R0RA 3DXTA 4XF9A 3ZFEB 2WZPP 2Y6LA 1GU3A 4KU7A 3U10A 3FHQA 5ANNA 4L11A 1IPKA 2O8QA 3OYWB 5TSWA 1H1IA 4YVWC 3FLTA 1NXD1 5K0UC 1O4YA 2ZGKA 2BJSA 2VUAA 2ZJCA 5LA1A 1QY4A 4XF0A 4ZS3A 4FXGB 4CDWB 1YYNA 2NM1A 1SPPA 4IEXA 4B7KA 2HYXA 1DIWA 4JZRA 5A3MA 3AP5A 2Q30A 4YVSA 1KS4A 2PHLA 1XPWA 3GBGA 3LF7A 4FFIA 4D69A 1RITA 1V9U3 1PGSA 4N90A 1WCSA 2J22A 2PN5A 2VO5A 3CF6E 3E6DA 3TEXA 2WLPA 1RYYA 4PLMA 1KEXA 1ZBE3 1AXYA 2HWC3 4QPWA 5E16A 2UWCA 1OA4A 5T5LA 3SXWA 4IEQA 5IK5A 2JDNA 4TTGA 4QQLA 1GOGA 1HB3A 2XJUA 2XL7A 3K77A 3KWVA 4XOGA 2HWD3 4F3JA 5EP9A 4AFMA 5A6XA 2I45A 1OURA 4B4QA 3GF6A 4AQSA 3I4IA 4RYDA 2WQ8A 4JRAA 2Z79A 4UF0A 5IT6A 3B5LB 3E5XA 1AHSA 3LKJA 5DAWA 1BMV1 2XHKA 4QKDA 2LALA 1MQTA 1RUD3 1XNCA 2C1FA 3BALA 3K4DA 4CCEA 1PHMA 1N3PA 2RS53 3WF4A 2P34A 2NP0A 4HN1A 3PU8A 4ZY9A 5T50A 3JBG1 2B4KA 4YWAA 4OQ8A 3IPVB 3P3PA 2RHPA 5EIYB 3RVHA 3OGGA 3KD4A 5AC92 4KI5M 4GMP0 5FP7A 1PMJX 4BQ2A 3J8F2 5BY5A 3AYEA 4Z8BA 4QKNA 4PHZA 3ETQA 5FZMA 5A7WB 4FSJA 4OZXA 4DRRA 2ZCWA 3HVDA 1EY2A 1S0DA 3CQOA 4YGBA 3ZFFA 1AYM1 3THCA 1ZYBA 2EVXA 2GH2A 3N9LA 4DZGA 5L73A 1G9AA 1L3JA 3P1IA 1X7NA 2Q5TA 1Y3TA 4FPYA 4M3CF 4QX1A 5FWJA 2H0BA 3OJBA 1UNBA 1O3QA 2PHFA 1W6MA 1N1TA 1WCKA 2IC1A 2VMEA 4HSLA 3V64A 1S2KA 1WLDA 4TSVA 1WCQA 3NV4A 3ILNA 3ZFEA 4AXOA 1GV9A 2OYZA 2XGXA 1RUE2 4QU2A 4CEWA 4UAPA 2PTMA 4XHXA 1HRV1 1PGW1 3W9AA 4D7YA 3CDZB 4NUBA 4BQ4A 4FBFA 5IYYA 1JU3A 3FUQA 4CDWA 3DUIA 3FHIB 5FYHA 4OFGA 1IG3A 3BU7A 3FFZA 4MGSA 3V56A 2YBKA 5C8CC 3S30A 4CP9B 1OOPB 3E97A 1ZREA 4IE7A 1D0HA 4Y24A 5F6LB 5CA6A 1D7PM 2D3RA 2W08A 2W68A 2HBTA 2J1SA 1F31A 3LDBA 2A70A 3PUQA 4R52A 4YW6A 3WW4A 2WC2A 2HWB2 3RZMA 3AMPA 3JBG3 3WNXA 2EXJA 2J1TA 4GD4A 5FZOA 3LEMA 3WD5A 4EJRA 2I2SA 4MXVA 2RV9A 3E5QA 1I9RA 2WQZC 2VQUA 4K1ZA 3ZKYA 2JWPA 1S2EA 5H9QA 1DHKB 2ZGMA 2WA3A 3H42B 4MGTA 4H55A 3IDAA 3PLQA 2JD4A 2RS12 3VHPA 3SH3A 5C9AC 1AYM3 3M3CA 1NE6A 2DBIA 1W2NA 2D98A 3IPVA 4NIAA 4DRVA 4ES9A 1BK1A 1OMIA 1UN1A 4AFBA 1UYPA 5LB6A 1HJFA 2WWSA 5E6HA 1DLLA 5LBFA 1NZCA 4EZ4A 1BKZA 3JZVA 3VKFC 2IXJA 4RHV1 2YC0A 2R1BA 2A3WA 5GZCA 1Z0HA 4LK6A 2ZHMA 5A7WA 4FAHA 5J36A 5L7OB 3JQWA 1VBB1 3I54A 4LKSA 5I0RA 4NHKA 1S1AA 2EICA 2WSUA 1U5XA 3NL1A 5FRAA 4WVWA 3R4SA 5D8AC 1XE0A 2MEV2 2OQ7A 2WT2A 1HRV3 2GMPA 2RMU1 2XQRA 1LU2A 3DCQA 2BQPA 3NV2A 2A6WA 3RNSA 1CAVB 4YLZA 4TLGA 4NVPA 5JPNB 1WMXA 1C8M1 1PZ7A 1A8MA 2VZSA 3I8TA 4FPFA 4LORA 4LUMA 4BMBA 4Z2AA 4XQDA 4HVQA 4XFCA 3OSDA 3QLQA 4Y5TA 5KHJA 5LW9A 1Y9MA 1QIQA 3SKJE 2YGLA 4R8HA 5DXDA 4YVWA 5K0UA 2O8OA 3EO6A 5A7QA 4BE3A 1DFQA 3QH7A 5GZFA 5IAVA 1TG7A 3S6PA 4QU1A 4ASMB 3SNMA 1OUXA 1CQ9A 4GALA 4NPLA 1ZBA2 1W6PB 4IDZA 4CP9A 1OOPA 2WDBA 2DVBA 3FFQA 3M8LA 1DZQA 3DECA 3JQXA 3KCXA 4INDA 3MYXA 3AKRA 2D7FA 1F5FA 3HIFA 2DUQA 2RS11 1QOSA 4JKLA 3H9AA 2GNBA 5GM0A 4Q27A 5FZ0A 5JSRA 1ENQA 4BHPA 1DGRA 4ONUA 4DXRA 5BYNA 5FXZA 4RHV3 1T6BX 1WMDA 2ZGRA 5C33A 2ZKLA 1CIWA 2CGPA 2GZWA 1HRI2 1SDDB 1RTVA 1VBB3 2WKKA 4NHYA 1UKRA 4Q0QA 1JYXA 2XOMA 2UWBA 2Y6JA 1OVPA 5C71A 5T5JA 3C2UA 2Q1FA 2RMU3 1VP6A 3VBHB 1RMU1 1BJQA 4D3WA 1HXS1 1H4HA 2ZGTA 4J1WA 3ZSMA 2DTWA 4IV1C 3A4UA 1V6LA 4FQ4A 1DZRA 4P9WA 1KJRA 1C8M3 3MFCA 1DYKA 2BP6A 2WNEA 5L7OA 3I59B 2XVKA 2WO3A 4JX0A 5FK7A 5ACA1 3B9CA 2ZKNA 4NN0A 4YZ3A 3CNAA 1FOD2 3TOJA 5KWRA 2EALA 3B69A 3GZAA 2PMWB 3WDTA 4QQHA 4LKDA 1VALA 1CAVA 1PO11 5A1FA 3HOBA 4NHXA 2W52A 3HQRA 4GIQA 4W50A 4DFSA 4F83A 4JVAA 1XNKA 4X8PA 3N7JA 4AR2A 3CEWA 5LCWL 3WF1A 1RVF1 3SLIA 2HEWF 4H7MA 4C0BA 2QQNA 5BV6A 3C7OA 3L2HA 4MHUA 4NOTA 1VBA2 5K9YA 5C7GA 4XFIA 5FAXA 2GMMA 2B7YA 3KB5A 2LM3A 1NA1C 4DIQA 2RS13 2RDNA 1GZWB 1YI7A 3S5QA 1VRBA 1I1EA 1VMFA 3CKHA 3ACIA 2CAUA 3AVSA 4JV4A 3PVNA 4K7JA 4DUXA 1V6IA 4XUPA 3WDUA 2OIIA 4BZ4A 4EZHA 1JU4A 2DBNA 1Q8VA 3ON7A 5APAA 5BXXA 1LB2A 5LY1A 3VDCA 1TNRA 2Q8DA 3ZXKA 1YEWA 1HRI1 1VBD3 4XFGA 3WG1A 2YBSA 2GMEA 3MV01 3PTRB 3HAGA 5JWPA 2HBUA 3PNAA 4META 2NMOA 4F7ZA 2D6OX 2ENRA 4BQ5A 1WW4A 1AXZA 2CDPA 3PDQA 1FX5A 1KDKA 3JB4C 5CBLA 1RMU3 2HWE1 3WNNA 4E8CA 1HXS3 4YZ2A 3SCFA 2W39A 2WIIB 5I0SA 3AYCA 3PUSA 3F95A 4MGQA 3MLKA 4C8DA 1LOBA 1UZYA 5A6QA 2XPJA 2DCJA 5ACA3 4AHXA 2V09A 2HEYF 3D3AA 2ZZQA 3LCPA 3LE0A 4QX2A 1N1YA 2A3XA 2EAKA 1JZ5A 2VCMA 3N4MA 5FZDA 2R071 4XETA 5FUNA 3VBHA 2WZR1 2P3YA 3D0SA 1PO13 1NUKA 1IZ3A 3MIEA 4FPCA 5FY0A 2XWJB 2EIBA 1ST8A 2P1BA 2JDUA 2QZ3A 3LB9A 1RVF3 4LXLA 3I59A 1JZ2A 4XFFA 4CXWA 2K0GA 1VBA1 5D8AA 4DXSA 1JZ3A 1YFUA 4G4FA 3RI8A 3RZLA 5FZFA 3AB0A 2Y8KA 4YW5A 1LR5A 2VW2A 4HONA 2ADEA 3VBFB 2VBPA 1CD3G 1YI9A 2VTXA 3KV5A 1AR92 2AENA 4ZZ5A 3ABZA 4XXAA 2RS32 2X53S 1CJPA 3ZPOA 1QMJA 5ANQA 4NRQA 1QF3A 1AVBA 1C5HA 1YC61 2MHFA 1RUOA 5HCBA 3W59A 5C3SA 1VLNA 2ARCA 4B4PA 5FOJB 2E26A 4ASKA 2K2SA 1CAXA 2PQSA 1HRI3 3J7HA 4KWLA 5DZEA 4C0HA 5JMOA 5CADA 3HNYM 1GZWA 1QJU2 3MF6A 4XTMA 3A0NA 5F3GA 4Q0SA 3HT2A 3RMXA 1CESA 1YCIA 1KJLA 2CV6A 4QAWA 1UKGA 3MW2A 4QX0A 2QQKA 3LSEA 3UK9A 5FDBA 1JYIA 2HWE3 4RS5B 5BNNC 2B42B 4YM0A 4XHBA 4GB32 1AUYA 2X8KA 4AOCA 1LTEA 3T1LA 2LTNA 5LK5A 2LW8A 1MZEA 3MGUA 5FJHA 1FMD1 3ZYGA 4DPNA 3DV8A 4P9GA 5HXVA 2VUCA 4LBNA 5FYZA 3Q8AA 2DYCA 1LOFC 1EUTA 1F15A 2CWSA 2ZBJA 2R073 3HD8B 4LBMA 3HJRA 2WZR3 2WLQA 4O9EA 1RUI2 4CDQC 1TME1 2AREA 3V0BA 3CHXA 2K46A 2D3PA 2E7AA 2ZGOA 2YU1A 4PQ9A 1W8ZA 5FY4A 1DP0A 2VVEA 3POGA 3WNOA 2OX0A 1MZFA 4TWTA 1VBA3 2OW4A 2WWJA 4CDUC 3GZTB 3ZR5A 4GAZA 4BU2A 4QHOA 1UU5A 2YV8A 3OY8A 4P08A 2W1UA 4MOAA 1RHI3 4GMP1 4IV3C 4EV0A 5IK4A 2H6CA 2UWAA 1JOJA 2G9GA 3OPZA 3TN91 2DVFA 1VR3A 1AYN3 2CWMA 1VMHA 3UGFA 5JI9A 5KXBA 2WS91 2OT7A 2E6VA 4HG6B 5EJ3A 2Q1MA 1GQGA 1TZOA 3HR9A 3LDKA 4OYUA 5JXHA 1UOFA 4NMIA 4XJ8A 1UMZA 1LESA 2DVAA 3AP6A 3PL0A 5JZGC 3MLJA 4N53C 1JXNA 1E5HA 4YRDA 5IATA 2OPKA 4XE9A 3WQ7A 1W8TA 4QB2A 4YGEA 3WSOA 4NE9A 2XB6C 1SDWA 2HYKA 1TMF2 1F9KA 1FMD3 2X09A 4A44A 1ZZ9A 2CGOA 2VQTA 3A23A 5BNNB 1W8UA 4KNCA 3KV6A 4NO4A 2ZGQA 4P9IA 5LBBA 4FTSA 1AR81 4AI9A 1W8HA 1H2LA 3FE5A 4CE8A 4RS5A 3NRUA 4HT1T 4COWA 1TME3 2RG4A 1KFUL 3ORJA 4HVRA 1PIV1 3BODA 1QDCA 1YIPA 2FDJA 2A7AA 1YHFA 5E8AA 2J42A 5FYIA 4ZU5A 4COUA 4YG6A 5EFUA 4IEUA 5FMCA 4AEDB 5F2WA 3WG4A 1YJLA 2J1RA 2RDSA 3D8CA 2AC1A 4E2QA 1LEDA 3VZKA 3NKTA 4E27A 1EV12 2FDIA 1PK6C 4ZPIA 1OD3A 5AVPA 1J59A 3J7NA 1MS1A 1W9YA 1ZA7A 2DCZA 4L9BA 4GMP3 2HWF1 2W1QA 4ISRA 3ZXJA 1QOTA 3POSA 5FBJA 1CX1A 3EQEA 3U14A 1YQ2A 4B3NA 5BNPC 3TN93 2KD7A 3B3QE 3GYDA 4AL9A 3W5MA 2XUEA 2WS93 2P6CA 1MS9A 5F39A 1VB2A 4IV3B 1ZRRA 2P17A 1CPNA 5CYYA 1W2UA 4LHLA 1HN0A 3PVBB 1OF3A 1UY4A 2VPVA 3TRSB 2BOIA 2JG8B 3P6BA 2Z2SB 1NLRA 2VVFA 3R4UA 5A1LA 2GP3A 3OGSA 4WM7C 3T30A 3K4AA 4Q4V2 1JTZX 3DXUA 3SCHA 2GH8A 1SLCA 5J96B 2C0ZA 1SLAA 4NPRA 4XFAA 1EYBA 1NKGA 2XR4A 1W90A 2JE7A 2ZPXA 1AR83 3DKWA 2Y6GA 1HW5A 4LE3A 3ZSLA 4E2GA 1RB8G 4BA6A 3PVEA 4XMAA 3WCSA 1RUF1 3B93A 4OZOA 1HB2A 1PIV3 2VE1A 4MZUA 2VXJA 1UPSA 3C3VA 4KU8A 2CL2A 1S55A 3J4UH 5FMBA 5EWSA 3RDIA 2YXSA 1TQ5A 3WDWA 3NV3A 1EV11 2Y60A 3GXUA 4FPHA 4OHWA 2RR12 5BNNA 3ALQA 5T55A 3BTXA 1QNYA 1QWRA 3PIGA 5HCFA 3UJOA 1VRH1 2HWF3 2VCAA 5FIXA 5GJ6A 2UYAA 5BNOC 3KZ4C 2V73A 3T0AA 2CY6A 4D7SA 2DCYA 1B09A 4E2SA 2LRPA 3A22A 1JW6A 5I91A 3ZSKA 2SBAA 4CDQA 1UOJA 1MS5A 2D6MA 3ITQA 2NQYA 2WA4A 3OBAA 1LOGA 4HKWA 5FPZA 1GWKA 5BNPB 4ATFA 1GP5A 2XBO1 2W0XA 3MICA 1J1TA 1O7FA 4QPIC 4YPJA 2QBXA 2X05A 2EXKA 2V72A 4IXLA 4PF5A 4CDUA 4ARXA 2Y0IA 1VIWB 2XJSA 3N3HA 4QM8A 4JDNA 4NHLA 3UKVA 4Z2WA 4CCLA 5F5AA 5I8YA 4HFSA 2VZ3A 2WQ4A 3SH5A 4I0BA 4XF3A 5JPMB 4IV3A 3B9IA 1XU1A 1HJGA 3B01A 3RYPA 4FPLA 3NNMA 4KG0A 3PIJA 1SBFA 2IZWA 5FPBA 3T1MA 4C90A 4AHWA 1LULA 1PM4A 3OB8A 1CAWB 1GUIA 3WDXA 4E4DX 1CONA 4ZZ8A 1H1AA 1X36A 3ZFFC 3C8XA 3H3UA 2VZTA 4K40A 1CIYA 1RUF3 2C4XA 2QVSB 2JDHA 3P3NA 2ORXA 3LGRA 5CVRA 3MO4A 3UETA 1CR7A 3ECQA 3USUB 3RYKA 1NG0A 4XBNA 5JVVA 4N53A 1MR5A 1POV1 1HN1A 1GKBA 1W8NA 3OGJA 5L19A 1EV13 2YU2A 1MEC1 3GDBA 3Q8FA 4EN8B 1QJY2 4QXCA 1RXGA 4OVEA 1NXMA 1XOYA 1WW7A 4ZXEA 1VRH3 1G9FA 1AL21 2Q0AA 1WCDJ 2GNTA 2YPDA 4FQZA 5DUWA 5LY2A 1RUC1 5J1XA 1CZSA 4NIIA 3H8OA 1LNSA 4W6XA 2GALA 5DAPA 1H30A 3O0WA 1XYPA 4UBHA 1XQNA 1S0IA 1WLTA 2PFWA 2VR4A 4BIFA 4CDWC 4IL7A 1LENA 4IW3A 1Z78A 1NY72 2ZX4A 3E1F1 1RXFA 3NJYA 3UKNA 2XJTA 1XC6A 2YZ4A 4A4AA 2Y6HA 3AXDA 2FCUA 3BGAA 4B29A 2JDKA 3VLBB 2XBO3 1LCLA 3KCCA 1Q56A 1Z7S3 5JAXA 1VAMA 4BLJA 4BXFA 3OD0A 1PK6A 3N9PA 4PIYA 5CAZA 2BGOA 1BYHA 5GLUA 2IFWA 2QQMA 4IEZA 3WLUA 3BKZA 3S57A 2BU9A 3ES1A 2AYHA 4AVCA 1J3RA 1HB4A 2PHRA 1AX1A 4IERA 5FTTC 3NNLA 4LOTA 5CFCC 1FI2A 4JRLA 4IQPA 4YW3A 5BNPA 3WW1A 1GICA 3KHBA 5KC5A 4CSWA 1LEMA 1F8VA 1ULGA 4QX7A 4UOJA 3SKVA 3W5NA 1C5IA 3FUOA 2TUNA 1W3VA 2O14A 4MGZE 2WNVB 1POV3 4XBQA 3EYPA 2PLV2 3ELNA 5FO8B 4W65A 1QJY1 1MEC3 1O5UA 1C3HA 4EE2A 2R16A 3JU9A 3I2DA 3QOPA 3M3IA 1AL23 4LR4A 4A6OA 1RUC3 2HLEA 3DYPA 2D6LX 2ET7A 4M3CE 5IUQA 3VL9A 5LK7B 3USUA 4BH9A 2VC9A 4IGQA 2D3SA 3NMBA 2D93A 1LHVA 3NV1A 3S0MA 1QJZA 4XBLA 1ULDA 4W6WA 2IUWA 4YG0A 1RL3A 4XDQA 4RGGA 1YO8A 5T5PA 3SEPA 4KWUA 3T4VA 1TE1B 1VE0A 5FZ6A 4EN6B 2L9LA 1RUNA 3LD8A 1Q5OA 3CLPA 4LBKA 4Z07A 5CG8A 4QB1A 5F1RA 2QQWA 3PUHA 1PM7A 2TBVA 1W04A 3AZWA 3M3EA 4QXKA 5FYSA 4CU7A 1HQNA 5FYTA 4CCNA 4CU6A 3H3ZA 3UL2A 1MS8A 1X33A 5K8SA 1PGL1 2YROA 4I3PA 4AGGA 1JN2P 1KQRA 2Z4FA 5FZ4A 1PX4A 4J25A 1OOPC 1YUDA 5BNOA 1IOAA 4XABA 1PMHX 4BJ0A 3MDPA 4Q0PA 2VZVA 2DF7A 2ZHNA 1JZ6A 4XVHA 5F3EA 4AI3A 3RZGA 4D94A 5D21A 3RS6A 1IKPA 4FPGA 1BHGA 2OZ6A 4QHBA 3OCPA 4JGZC 3TEYA 4PJYA 3FJSA 5DDJ1 5CFCB 3O1VA 3S7IA 4IE0A 4MLOA 2W47A 4BK5A 3DN7A 1BBT2 4QPIA 1A78A 5A80A 4HN0A 4HSJA 5IVFA 1D0GA 1CZTA 5E89A 2CU5A 4BQYA 1M06G 4LKFA 2VUJA 4LTAA 1QJX2 3LOIA 4GWMA 4XAAA 2FCVA 3H50A 3N7MA 4K8FA 2BV4A 4DINB 5CEHA 4QKBA 2FDFA 1SBEA 4Z92B 1OQDA 2PA7A 1XJAA 4LPLA 4PI2A 4CUBA 2ZMKA 2KM2A 4TLFA 2W95A 3T4HB 1DQ4A 1ULPA 5DPNA 3T0DA 3N9NA 1VBC2 4S2DA 4N9IA 4YM2A 1NZIA 5L7OC 2TNFA 4LK7A 4Y1XA 1O8PA 3O1RA 3G7DA 4K6BA 4FOQA 4AI8A 3OF1A 5FMOS 4UFJA 4ZU4A 3MPPG 1S0EA 2AEYA 1F2NA 3M3QA 2CHHA 2D6PA 4MGIE 4YG3A 3OYWA 2JD9A 4NRPA 3WNLA 1GZTA 1EAH2 1LGCA 5M0TA 1W2AX 1OF4A 4P14A 1UWWA 3AJYA 3RZKA 2E9QA 4GJZA 1W99A 4LO7A 4LIUA 4Q5OA 2JE8A 4EYUA 3FZ3A 3N9OA 3SEEA 2WINB 2JDPA 3WHTA 5T52A 2GC3A 5DDJ3 3POJA 1U5YA 4OCTA 1O91A 4HBNA 5FZ7A 2XHNA 1US3A 3BUCA 4LT5A 3LZZA 3NWKA 3Q8BA 3T0BA 4B8EA 1KD7A 4QQ2A 4P9YA 1SFNA 4XJ9A 2X5IB 1UF2C 2BGPA 4AFCA 4JGZB 3LOBA 3DYMA 2NZ9A 2P4EA 3ZVXA 4M0HA 5AC91 1J3PA 2FHRA 1OKQA 2WL1A 1OLME 3J8F1 1K3IA 2W46A 3CJXA 5CFCA 1JOPA 3HQUA 2O0OA 2BVBA 4JAAA 2C6SA 5IAXA 5JOWA 2D5HA 1UY1A 4WVMB 1OA2A 1WA4A 4Z1VA 4L99A 1AF9A 4NROA 1ZZBA 1W8WA 1SLTA 5SV5A 1KGYA 2VTXJ 4LEJA 4RSUA 2BRTA 4NJ4A 4BQ3A 4TN7A 3BYWA 1UU4A 4XXPA 1CGPA 1WD3A 4A7ZA 4KGQA 5A3OA 3VBHC 1KS5A 4E4ZA 2ZEYA 2E32A 1BXHA 1PNGA 2JJ6A 3CO2A 4K1YA 4K8RB 4N8MA 4QPGC 3ROUA 5BNQA 3MF9A 4YW4A 1RUE1 1U12A 3O7OA 1T2XA 4CCMA 1BVP1 3LA2A 1AX2A 2Q8CA 1CX4A 2TEPA 1FPN2 1FT9A 3GJBA 4LITA 2JDAA 2OS2A 2RE9A 2VOXA 1YWKA 3VHRA 3WP6A 3E5UA 2W2IA 4Y4RA 2O1QA 3ZYBA 3AMQA 1DQ5A 1FAYA 4AAXA 1EPZA 2XJQA 3Q8CA 5FYBA 3FBMA 4JQRA 5FLIA 5LEKA 2R0FA 2BBAA 1A6CA 1W3XA 4Y33A 1ZRDA 3WP3A 3J7MA 3N36A 2J1UA 3I97A 5B4NA 2HWB1 3D0JA 4XC9A 3ZIWA 3EXUA 1JYWA 2IFRA 3J9SA 5LRRA 1QXPA 5AC93 1RUJ2 4CVUA 3SMHA 4CP2A 4NIGA 3J8F3 3NNFA 3ZXDA 1Y9GA 2VW0A 4B4RA 4M3CB 3RJRA 4XMIA 1OLQA 2JE9A 1XU2A 2H6BA 2CYFA 1OQEA 4XUNA 5JIAA 3ZXAC 2QQPA 3ZYRA 2NMNA 2VQAA 4FPKA 2P3IA 3AZYA 4JGZA 1OBNA 3RGBA 1Q8SA 1NLQA 1R64A 5FQ0B 3NQHA 1QH6A 4UW5A 3NJZA 1PVXA 4QM9A 3M4FA 4J1XA 4SLIA 5KR7A 2C26A 1OI6A 1B35B 3B94A 3LQCA 4Y1YA 2WAAA 5IFPA 2ZMNA 2ERFA 3GBFA 1RUE3 3SH4A 3MBWA 4EN0A 2R32A 4AHZA 2MEV1 2ZA9A 2BFUS 3LEGA 4EQVA 1LJ7A 2YB7A 2F4PA 1OKOA 4CU8A 4XZPA 1EUUA 3DPRB 1UAIA 2Q1ZB 2GU9A 4K9SA 4N7IA 4WZCA 1FPN1 4QPGB 3WEZA 3GHMA 3H1MA 1IS3A 5IJRA 2BPA2 3WQ0A 3JXSA 3HPNA 2R062 4M4RA 1OH4A 2FDKA 4A2UA 4MSVA 1J1LA 5CG9A 2RJKA 1IS5A 1SFPA 3O14A 2QTWB 2GDFA 3JD72 4PDWB 4J6GA 4R4XA 1POV0 2HWB3 5HI0A 3VBFC 4XFBA 3AX4A 5T54A 1O5LA 1AR72 1ZBA1 1RUJ1 1UU6A 2R6QA 4MGYE 3UKTA 1W6NB 2Y38A 3UYJA 3VBSB 4C91A 4BISA 1HQWA 1MVQA 4ES8A 2XLFA 1IPJA 2UURA 2JKXA 4YW7A 1SCRA 5JR7B 1JMUB 2C9AA 3U11A 4L0PA 2ZX0A 2VW1A 2DCTA 5F9TA 1JUIA 4QXBA 1XNBA 3WG3A 5HV4A 5IVCA 4FFFA 4LHSA 4BQXA 1YFXA 3H7JA 4MV2A 1A8DA 5F32A 1W6PA 3KV4A 1C1FA 1D4M2 3NVCA 4Q4X2 5FKCA 1HQLA 2PHUA 2VM9A 3T2QA 4RS5C 4M3CA 1EPWA 4BDVB 3I7DA 3AFKA 4QDRA 3RSJA 1COV2 1UZWA 2JDMA 1JOBA 3AM2A 3RMYA 3VZOA 4CPBA 1DQ2A 3VN4A 4HK8A 2MEV3 1SMVA 5GZGA 1X8MA 1BLZA 4BPZA 1FV3A 3ZN6B 1LGBA 5FQ0A 3IBMA 1D4VB 1PX3A 1FPN3 1ENXA 5DG2A 5IFTA 1WLCA 2AH2A 4QPYA 4UFLA 4WV8A 1VAVA 4H14A 1B35A 1LHWA 1PO22 1W39A 1LAJA 4R9CA 2VOTA 1FOD1 2PHTA 3FHAA 4P9JA 5FZEA 3F2ZA 4LBOA 1PNFA 5FXVA 4HOOA 4XJAA 1SFYA 3BCWA 3JD71 4LBQB 4AVVA 4IGOA 5FZ1A 3DPRA 4URTA 1E5RA 1J3QA 4QPGA 1L7LA 1ZX5A 3ZXGA 1ZBA3 4AGVA 2A6VA 2B5HA 3WQ1A 2ETEA 4MH0E 2Y64A 3MZHA 3H7YA 4ZONA 4DB5A 3BIWE 1ZRIA 5JI7A 2W1SA 5KHHA 2YFZA 3NJVA 2JB4A 1XXNA 2Y26A 4PDWA 4XCAA 4NIHA 1ULOA 2ZABA 4Y1ZA 3R05A 1NYWA 2YC2A 3MIFA 5FR3A 3LFMA 4FTBA 3HN3A 4X6QB 1MPXA 3VGIA 3VBSA 3IT8A 1W6NA 4IESA 4Q4X1 5FY5A 1DF0A 1VBE2 4I0WB 2ATFA 2IXLA 3ES4A 2PELA 1CZVA 4SBVA 5FPVA 4IEWA 5IWFA 2J1EA 1MACA 1UMHA 4LUKA 1H0BA 3ZMOA 1H6XA 3ZXLA 3PJQA 5C3RA 3GNEA 1HB1A 4IE6A 4K20A 3J26N 4OHYA 5EXOA 3INAA 1CPMA 1RGSA 2LS6A 3ILFA 4Q4Y2 4DQAA 1G6NA 5IVJA 4HKOA 5DN2A 1O4TA 3A21A 3HQXA 3OEBA 1O4ZA 2XG3A 1XYOA 4UI9L 4EN9B 5ABJB 1FOD3 4WBBA 5JR2A 1AZDA 3K75B 3M1HA 4AEDC 3ZFGB 3ZN6A 3RPQA 3IN9A 1LKNA 3TEWA 3IWZA 2A75A 1QU0A 5L9RA 5CFDB 3I3DA 5DUVA 3M3OA 4A3XA 2ZGSA 4A45A 4KGGA 4DUWA 2W9XA 4XW3A 1R082 1R092 2WO7A 5EPAA 3LDRA 1ND2C 3VZLA 4HPKB 1NCQB 2ZZJA 5F6KA 1RUG2 1ZZ6A 3MIGA 4LBQA 2WYFA 2DWRA 4S2FA 1AR91 3VZJA 1CJDA 1X50A 3GZEA 4QQOA 3TBDA 2RS31 3SQOA 3FN9A 3W21A 1GNZA 4AEKA 3KHCA 4AI2A 1JHNA 4IEOA 4CPBD 3CBNA 4Q4W2 1LHOA 1QQP2 3K2OA 1VBE1 4FFHA 4DEQA 4Q4X3 5FYYA 3S5AA 1OD5A 3VD3A 4PLOA 2CAVA 2VZRA 3LEIA 3VUOA 5IVEA 3VKMA 1OLMA 3CMGA 3ZO0B 2JG8C 1OQ1A 4G9SB 1QJU1 5FZHA 3VBFA 3KF5A 3WINE 2VOVA 3TEZA 4O7XA 1RJ7A 2QQUA 4D6RA 4KWKA 4GH4B 5AVAA 1DLCA 2BGCA 5CIRA 3ZDSA 4GB31 2UY8A 1Q43A 2B9UA 2P2KA 2PXJA 5FO7B 1UYYA 2MPFA 3ZPYA 1N47A 4CCCA 5JSOA 1W6QB 1YQ5A 2Z42A 3GBWA 1VPHA 2ZAAA 2B45X 4OHVA 4UW6A 1X82A 3UGHA 2DVDA 1R1ZA 1UX6A 2XL9A 1Q8OA 1RUI1 3BPSA 1WUVA 3ZMNA 1QNWA 3AC0A 4R9DA 5FZKA 3LEKA 2GSYA 5FYVA 2VD7A 4JC1A 2OUHA 3MLLA 5G05L 4RQPC 2VH9A 1BEV2 4DOUA 3O1MA 2ZGNA 4A42A 3JUUA 4UBGA 3O1UA 1SBDA 4CTEA 2VMCA 4KH9A 5KXEA 5FV3A 2XKPA 2YC4A 4Y22B 1GR3A 4EROA 3AP4A 4MADA 1V6NA 1EP0A 2A3YA 3I3EA 3ZFGA 4CZSA 4FFGA 1D2SA 2B8MA 2XJPA 1UW8A 3ASIA 4I02A 1AR93 1ONAA 1W2OA 2C9KA 3KGLA 4A6SA 2WWUA 2RS33 3OUJA 1RUH2 4LLFA 2QUOA 1MZ6A 1QQP1 2VMIA 3HT1A 2JIJA 3IDEA 5IVYA 5B2GB 1ND2B 3QBQA 5HCHA 1OUSA 1VBE3 1GWLA 5I8TA 1W0NA 3KVAA 4LA2A 2VULA 3D5OA 4HPKA 1H2MA 5JLVA 2XDVA 2VZPA 1A34A 2VJXA 3IDBB 4Q0UA 2ZX2A 1QJU3 2ZOEB 1D2QA 3UESA 3VKLA 5FP8A 2NN8A 4Y3OA 3PTYA 5FY8A 3MIDA 1KXGA 2QKDA 4BMEA 5A3UA 5J3UA 1XNAA 3AJZA 3C7GA 1BCXA 3V0AB 4P9XA 1T6GC 4GB33 1AJOA 5FY7A 5JXJA 5T3NA 1TMF1 4XDOA 2WR9A 5FZLA 4CEYB 5CNAA 1C1LA 4CCDA 5C5UA 2WNOA 2FMYA 5DZGA 4XTPA 4BYYA 1WZXA 3B7MA 4QB6A 1IPSA 2FCTA 2Q4SA 1RUI3 2WNUC 4GH4A 4YFWA 4AQ2A 3LPFA 2BNNA 4PBPA 2XLGA 1REDA 2ZHKA 2ZX3A 3PUAA 1IQDC 1W6QA 3VKNA 2A5ZA 2P3JA 3WZ1A 1E5IA 3ILRA 4JKMA 2HH9A 2IXIA 4U36A 1UY0A 3AMHA 2JKBA 4XCBA 3THDA 1JZ7A 1H6YA 2DTYA 1JYNA 3S7EA 4I01A 3OBZA 4AWDA 3ATGA 3X29B 1ZZ7A 4RQPB 2NYYA 3HBKA 1RUH1 4PF1A 4OLLA 2A6ZA 2XUMA 4QHZA 4H3WA 4AHYA 3MI8A 4IETA 1NT0A 1YJKA 3EBRA 4Q26A 5FOBB 4AEDA 3U4XA 2R49A 3RWKX 2XVGA 4FP3A 4XIOA 4Y22A 5EQUA 1UXZA 4H2AA 4CUAA 3UNPA 1GNHA 1YRZA 2AACA 1S0FA 2YG0A 3RWNA 1Y7BA 1K5JA 4JTOA 4HXCA 4CXYA 1W9FA 2D40A 2R042 2OVUA 2YPJA 3DL3A 3TB0A 1DYPA 3HN1A 3I2HA 3U75A 4LNVA 2X10A 1ND2A 4I3GA 1W2TA 2ARBA 4YYOA 5FMOL 2DUOA 3VD4A 5FXWA 1IS4A 4XF4A 1TMF3 2LROA 2HJIA 3DF0A 4CXXA 1GOFA 4Q4V1 5ISLA 1WGPA 3H1WA 2JX9A 4DMIA 1IG0A 2FMDA 4QXHA 2DFBA 2VZOA 1DQ1A 2WNVC 3MUY1 3WDVA 3DYOA 4GA9A 3VBRB 1M4WA 2EA7A 4FT8A 5E88A 2DFCA 5I8SA 2JG8A 4OI2A 3GGLA 4TZDA 1S4CA 1DGWA 2VNGA 4GKYA 4MHRA 4E4SA 4XAEA 1H2KA 1GFF2 4XQ4A 1H4GA 1KFXL 2WNUB 1KDMA 2F6BA 2RR11 1V6MA 4FOWA 1SQ4A 1DGWX 5FZ8A 1ENSA 3WUDA 2PHDA 1G9BA 1JH5A 1ZBE2 1LGNA 1RUH3 1W8OA 3WV6A 4DY3A 1K5MB 5FY1A 2B39A 3FL7A 2PHXA 2GN7A 4JGYC 5LATA 4KWJA 4EWAA 4X8NA 2BW8A 2HWD2 2FQPA 2N7GA 4Y1UA 5GLZA 2RDRA 3MIHA 3WNMA 5H9PA 3VBUB 5A3PA 4Y5Z0 3KM5A 4I30A 4XURA 3UGGA 3CL1A 3EHKA 4EWDA 3AMNA 4RQPA 3OUIA 1RUD2 3K51A 4XILA 4MGKE 2E7QA 5DZFA 2FD8A 1TNFA 1JHJA 3K48A 4L8QA 3DGTA 4GXLA 3T2PA 2ZS6B 1JODA 3WP4A 4B1MA 1VJ2A 5H9RA 4UXAA 1G9CA 3U37A 1SACA 2VMHA 2RM22 4RD7A 3WP5A 5J09A 4Q4V3 1SPPB 4R9BA 3IKWA 5HXMA 1MS3A 2VAUA 3M70A 4BQWA 3RQ0A 1POQA 1UQXA 2ZXQA 3FBYA 4CUCA 2ZMLA 2GNDA 1OPOA 5C8WA 1LOEA 4LLOA 1S2BA 1BVVA 2R0HA 3AZXA 1V0AA 4IEVA 2AUYA 2ZGUA 5CB7A 3POFA 1NE4A 3AKSA 3DEMA 3WW2A 1DGRN 3ZIXA 2W87A 3UT0A 1N3QA 2ID4A 1G7YA 1ND3C 3O0VA 3OGVA 1GQHA 3KQRA 2G4IA 4M0NA 3ZXEA 2OQ6A 2JICA 4GZ9A 3U07A 2RR13 4IGPA 2Z5WA 4LO5B 1CAWA 1U5IA 3K4ZA 5KHGA 3PVOA 3ZYFA 1LOAA 3TNQA 2XWBB 1MQTB 4KG8A 5LA2A 2QQJA 2XVLA 3PMSA 5HBAA 2IVIB 1VMJA 2WZEA 3HMYA 3JCIA 3WNPA 4DO0A 1I6XA 2OA2A 3ACFA 3IMNA 2HWD1 3WCRA 5LRSA 2BTVC 1Y43B 2E51A 2W94A 2WNUA 2AR6A 2ARAA 1NY71 4R9AA 4LE4A 2OZJA 2BUKA 5JMCA 5FK8A 2P6HA 1AR62 4AQ6A 5GLTA 4LHNA 3WX5A 5FZIA 2XLAA 4JGYB 4DY5A 3ZLIA 5A3LA 1WWYA 4ZKTB 3T08A 1K5MA 3OTFA 4URAA 5JUVA 3BTAA 1MS4A 1OT5A 3JBG2 1HV1A 1H8TB 3FLRA 4LQRA 4QMAA 4WM8B 5A1AA 2VNOA 2XH6A 2RM21 5FPUA 2JG9C 3B02A 3OPTA 3VBUA 5A6YA 4K21A 4JDMA 4YARA 2VZQA 4W6YA 3Q8EA 4ORFA 4CDXC 2B46X 4FI9A 5FUPA 3BI3A 4N43B 3BTYA 1AYM2 4CEWB 3KV9A 4KMQA 4P02B 1BZWA 3BOPA 4O9GA 1JYVA 5A3WA 2X5IC 2BNOA 4BK4A 5FP9A 4CCKA 2I07B 2PHWA 3K46A 1HIXA 5AFBA 5IK7A 1W9WA 4XJWA 4O61A 2PLV1 1FYUA 4GKXA 1G86A 3P5BA 3I49A 2WBKA 1QJY3 5AFEA 5CKQA 2QJVA 5JXIA 3H8RA 5FFOC 2EXHA 2ZACA 1O3RA 1X8EA 1YIFA 1GLHA 2Y6FA 5FLJA 1HRV2 1PGW2 1AJKA 3AFGA 1DDLA 2QQLA 3QD6A 3I3QA 2YMZA 1ND3B 2GP5A 3SISA 3AZZA 3OBTA 1IS6A 4W8JA 1W03A 2WNVA 5FZOB 1J84A 1N1SA 1L7RA 4LIVA 4RFRB 4RR3B 2C24A 5FMDA 1AR61 5C3PA 5IVBA 3G6JB 3IAPA 4NAMA 4A7YA 3VD9A 4GJYA 4PLNA 3O1SA 4HK9A 1GMMA 1F4AA 3ETPA 1QOOA 3I2GA 2G9ZA 2VZUA 1WBLA 3AZVA 3AVRA 1W6OB 5LA9A 5A7PA 1W9TA 1RIRA 4QWNA 2P5BA 2UY9A 2JDYA 3LA3A 4MUVA 3U4SA 3N9MA 3VBOB 1V6JA 5GLWA 2RM23 5IHRA 4CP1A 5J98B 2WZ8A 4LMFA 5DG1A 1ZA4A 1ZVFA 3USSA 4OHZA 1O3TA 3CZJA 3TAYA 3V0AA 3D4KA 1HLCA 3VHOA 2PYTA 4DS0A 4JGYA 1HX6A 1UY2A 1X9TA 2E31A 5FBZA 1OFNA 4D6SA 2VGDA 3SITA 3RRDA 1H8TA 4QKFA 4WM8A 2JG9B 2ZGPA 4D0QA 2OPWA 4FAGA 3O1OA 2IXKA 2ZTNA 4ISQA 1K12A 1VB4A 1BBT1 4CDXB 4RHV2 2WABA 5KC6A 2BDRA 2PLV3 2EAAA 2RJLA 1NAEA 5FYMA 1DU3D 4PCRA 1UY3A 1LHNA 1Q8QA 1VBB2 2CTVA 4N43A 4P5YA 1QJX1 4C1XA 4I0AA 1JI6A 4GWJA 4I09A 4YVWB 5K0UB 5LBCA 2CDOA 1XYNA 4XUTA 2HEVF 5G04L 3VDAA 3H8XA 2RMU2 2WN2A 3K3OA 2YBPA 1R1A2 3WXPA 3FLPA 3K3NA 1IGOA 2EXIA 4OQ9A 3RI9A 2AEZA 4IEYA 1H8VA 1MZ5A 1NLSA 3KQ4B 1C8M2 1HV0A 5FWEA 4AEMA 3WF2A 1VBC1 2BYVE 2IXCA 5FY9A 5A7OA 2ADDA 2VTFA 1AR63 1B35C 3POIA 4Q8LA 5DABA 5JOZA 2BZDA 4MG2A 3BIEA 4AVBA 1SHWB 1X9PA 2DVGA 2EIGA 3GCXA 1JYCA 4FPEA 4FPJA 2BERA 1ND3A 2OKXA 3DPRC 4RL7A 1YQ6A 1Q3EA 2V5YA 4LJHA 3WW3A 2AGSA 1FNYA 1ZM1A 4L97A 1YFYA 4OI4A 4OUSA 4RR3A 3MFAA 5A32B 3W58A 5ERLA 3ZYHA 3ZYIB 2ZGLA 4QX3A 4AYUA 2YY1A 2E7TA 1ZZ8A 4XPVA 1TEIA 1EAH1 3RJ2X 2DV9A 3BTZA 4XQWA 4Y5SA 4XEZA 2J7MA 1W6OA 1QXRA 3GJAA 1RINA 3A0KA 4CP0A 4PDWC 4ZU7A 1G9DA 4O65A 5F8PA 1S0JA 4FOVA 4GWIA 3VBOA 2P37A 2VL4A 3RYRA 3LPGA 5DAVA 4UW4A 3VBSC 1BBT3 4PBOA 4CCJA 5JOYA 2Y0OA 1ULFA 1ZRFA 3WQBA 1VBD2 1DQ0A 4AQTA 1GP4A 4HKLA 1QJX3 3N7KA 5FZGA 3RFRA 5FYUA 4LKEA 4XZUG 2JG9A 3IMMA 3NJXA 4KL1A 5KXDA 1R1A1 1RMU2 2IWGB 3H1YA 3NAPC 1HXS2 2E53A 2W91A 2ILMA 4UFKA 3ZXFA 2YYOA 1LECA 4CDXA 4RGKA 2CGNA 2VBBA 4UWDA 3O0XA 3U78A 1VBC3 4FPOB 5ACA2 4N7UA 2YFUA 4YZ4A 2QDRA 1UZZA 2QCSB 2X5IA 3WDYA 5FP3A 3I3MA 3IM0A 3VKOA 2ORZA 1YXWA 1PO12 4YSFA 5C8CB 5GLVA 1SLLA 4I2OA 1N1VA 1REFA 1F4HA 4WVMA 1RVF2 2WT1A 5I0UA 1ACCA 2R30A 2RJ2A 4MVTA 1XSRA 5C5TA 3JB8A 3MIBA 1EAH3 1W0PA 5I0DA 3SCGA 2J1AA 2KR2A 5GALA 5KXCA 1V6KA 4FVVA 3VDBA 2P3KA 3ACLA 1RC6A 3IB3A 4UYBA 5FYCA 4XUOA 3ZSJA 4ZS2A 1QDOA 4AF9A 1MVEA 5A32A 3E6BA 1XBFA 1UX7A 2W92A 2WYSA
chains in the Genus database with same CATH topology
5EIYB 2W5FA 4DEQA 2QQOA 4KI5M 3VD3A 1PMJX 3OB8A 2VZRA 3LEIA 1GUIA 2W1WA 3CMGA 4ZZ8A 3C8XA 2VZTA 5EJ1B 1CIYA 2C4XA 1GOHA 3UETA 3CQOA 2ORXA 3THCA 3MO4A 5HPOA 3ECQA 4OUEA 4M4PA 1J83A 3P1IA 2QQIA 2E33A 1DLCA 1HN1A 1W8NA 4RN5A 4QX1A 2WUHA 3GDBA 2VCCA 1UYYA 3T2OA 1UYXA 2VZ1A 2VMEA 4ZXEA 5J1XA 1WCQA 4PQQA 1CZSA 1LNSA 4OMDA 4UAPA 3IIIA 1JZ4A 4ARYA 3AC0A 3CDZB 2VR4A 3LEKA 3CZUA 5IYYA 1JU3A 2WN3A 5G05L 3E1F1 4A4AA 1XC6A 2Y6HA 4A42A 1UXXX 3BGAA 4MGSA 2VMCA 2YC4A 4MADA 3I3EA 1D7PM 2J1SA 2BGOA 2C9KA 2QQMA 4OMCA 4TXWA 3C7HA 1K45A 2J1TA 2RV9A 1W0NA 2VQUA 2J1VA 2VZPA 2VJXA 2WO2A 3UESA 4PT6A 3IDAA 4UOJA 4P00B 3SKVA 1JZ8A 3W5NA 2ZEWA 2EIEA 5LA0A 1XNAA 2Y6KA 3C7GA 3EYPA 5JXJA 4A6OA 2HLEA 4LKSA 3DYPA 1P8JA 2EICA 4QB6A 3EB7A 2VCBA 2VC9A 4QDSA 3LPFA 3SEPA 4KWUA 1IQDC 2VZSA 4Z2AA 2L9LA 2R7EB 4JKMA 4QB1A 3PUHA 3SKJE 1UY0A 2V5DA 3THDA 4CU7A 4AG4A 1H6YA 1JYNA 4CU6A 1TG7A 4PF1A 3A7QA 2Z4FA 1PX4A 3HEIA 1PMHX 4BJ0A 2VZVA 2WDBA 1JZ6A 4XVHA 1UXZA 5CZKA 3DECA 4CUAA 3UNPA 2YG0A 1BHGA 3I2FA 4JKLA 2XQXA 4MO3M 3I2HA 2W47A 4BK5A 2X10A 4DXRA 3VD4A 1CZTA 2DDUA 4QDQA 1GOFA 3HNMA 4DEVA 1SDDB 1JYXA 2XOMA 2Y6JA 3OEAA 4LPLA 2VZOA 5C71A 3ACHA 3MUY1 4CUBA 3DYOA 2W95A 5DPNA 1ULPA 5EJZB 3T0DA 3GGLA 3MUZ1 1O8PA 2WO3A 3HNBM 4JX0A 1O8SA 2WAOA 4BXSV 3HOBA 4JHZA 4W50A 1I5PA 1W8OA 3FL7A 1NX9A 5LCWL 2JD9A 3WF1A 3WNLA 2QQNA 1OF4A 4XUQA 1UWWA 3C7OA 3WNMA 1W99A 5B4XA 5C7GA 2JE8A 4XURA 3SEEA 3CKHA 3ACIA 2VMFA 4DUXA 4XUPA 2XHNA 1JHJA 1US3A 3T2PA 3T0BA 1JU4A 3WF0A 3U37A 3VDCA 2BGPA 3MV01 3DYMA 1UMIA 3GM8A 5HXMA 5JXGA 1K3IA 2W46A 2ZXQA 2CDPA 4CUCA 2W3JA 1WKYA 3I3BA 1UY1A 3WNNA 4E8CA 3I2JA 4MGQA 1W9SA 2W87A 5F7UA 1KGYA 2ID4A 2DCJA 3OGVA 4GZ9A 3D3AA 3LE0A 4JKKA 4QX2A 1K42A 1JZ5A 2ZEYA 3K4ZA 2E32A 1NUKA 3CIHA 5LA2A 2QQJA 2EIBA 2WZEA 3NNGA 3WNPA 1T2XA 3ACFA 1JZ2A 2WO1A 2W94A 4DXSA 1JZ3A 2B9VA 2Y8KA 2JDAA 1TVGA 4AAXA 4ZZ5A 3ABZA 3T08A 5JUVA 1L7QA 1OT5A 2BBAA 4D8MA 4DUVA 4LQRA 5A1AA 2J1UA 3I97A 5B4NA 2E26A 5JMOA 2PQSA 3J7HA 5FUIA 1JYWA 2VZQA 3HNYM 4CVUA 5DQ0A 4FI9A 4QAWA 3WF3A 4QX0A 2QQKA 4KMQA 4P02B 3T09A 1JYVA 3C7FA 4XUNA 4BK4A 4E8DA 1SG3A 3K46A 1W9WA 2LW8A 2ZEZA 3OG2A 3VD5A 1R64A 3WNKA 2WBKA 3NQHA 5JXIA 5JR2A 1EUTA 3HJRA 2C26A 3LQCA 2WAAA 5IFPA 2QQLA 1GQPA 3MBWA 4IUGA 3LEGA 1DP0A 2YB7A 4W8JA 4CU9A 3WNOA 1J84A 4CU8A 1EUUA 1L7RA 1US2A 3WEZA 5C70A 3IAPA 5IJRA 2V4VA 3VD9A 4P08A 2W1UA 4MOAA 1GMMA 1F4AA 3ETPA 3HPNA 3I2GA 2VZUA 3JXSA 4M4RA 5DMYA 1OH4A 1W9TA 2XONA 4W4ZA 2EIDA 5IHRA 2WZ8A 3BN6A 4HG6B 5JXHA 3CZJA 4OYUA 1JZ7A 1UY2A 2E31A 3OGRA 1UZ0A 4ET7A 2JKXA 2ZEXA 4L0PA 4QB2A 3WSOA 4D0QA 1K12A 2WABA 4LHSA 3ACGA 1NAEA 2X09A 4A44A 2VQTA 1UY3A 4P5YA 3A23A 3PUIA 2VM9A 3T2QA 1JI6A 4GWJA 2CDOA 4XUTA 5G04L 4BDVB 4QDRA 3VDAA 2RVAA 3NRUA 2WN2A 1UYZA 1DYOA 2J1RA 3WF2A 1PX3A 2VTFA 1OD3A 5IFTA 2BZDA 1SHWB 3IAQA 2W1QA 3C7EA 2VOTA 3FHAA 2BERA 3F2ZA 1CX1A 2VMDA 2OKXA 1YQ2A 2KD7A 2DCKA 3W5MA 4QX3A 4A3ZA 5CYYA 2J7MA 3I2IA 2Y64A 1OF3A 1UY4A 2W1SA 2YFZA 3NJVA 4GWIA 4DXTA 1ULOA 2VL4A 3P6BA 2YC2A 3LPGA 3VD7A 3I2KA 3MV11 4A41A 3OGSA 1GNYA 3HN3A 1MPXA 3K4AA 3WQBA 1O59A 1XNTA 1CZVA 1NKGA 2Y6GA 4XZUG 3ZM8A 3NJXA 2J1EA 1UMHA 4OZOA 2W91A 2Y6LA 1H6XA 1GU3A 3FHQA 3GXUA 2LS6A 2YFUA 5LA1A 5DN2A 3A21A 3OEBA 2HYXA 2ORZA 4UI9L 2VCAA 1XPWA 3K75B 3T0AA 2J22A 2VO5A 1F4HA 1RYYA 4QPWA 1KEXA 3A22A 3I3DA 2RJ2A 4TTGA 3OBAA 1GOGA 3K77A 4A45A 5I0DA 4DUWA 2J1AA 3VDBA 2W9XA 4YPJA 4RYDA 2X05A 2QBXA 2WQ8A 2V72A 3IB3A 4ARXA 4XUOA 3K4DA 3WF4A 2VZ3A 3FN9A 1UX7A 2W92A 4ZY9A 2WYSA 2B4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EIY B;  2W5F A;  4DEQ A;  2QQO A;  4KI5 M;  3VD3 A;  1PMJ X;  3OB8 A;  2VZR A;  3LEI A;  1GUI A;  2W1W A;  3CMG A;  4ZZ8 A;  3C8X A;  2VZT A;  5EJ1 B;  1CIY A;  2C4X A;  1GOH A;  3UET A;  3CQO A;  2ORX A;  3THC A;  3MO4 A;  5HPO A;  3ECQ A;  4OUE A;  4M4P A;  1J83 A;  3P1I A;  2QQI A;  2E33 A;  1DLC A;  1HN1 A;  1W8N A;  4RN5 A;  4QX1 A;  2WUH A;  3GDB A;  2VCC A;  1UYY A;  3T2O A;  1UYX A;  2VZ1 A;  2VME A;  4ZXE A;  5J1X A;  1WCQ A;  4PQQ A;  1CZS A;  1LNS A;  4OMD A;  4UAP A;  3III A;  1JZ4 A;  4ARY A;  3AC0 A;  3CDZ B;  2VR4 A;  3LEK A;  3CZU A;  5IYY A;  1JU3 A;  2WN3 A;  5G05 L;  3E1F 1;  4A4A A;  1XC6 A;  2Y6H A;  4A42 A;  1UXX X;  3BGA A;  4MGS A;  2VMC A;  2YC4 A;  4MAD A;  3I3E A;  1D7P M;  2J1S A;  2BGO A;  2C9K A;  2QQM A;  4OMC A;  4TXW A;  3C7H A;  1K45 A;  2J1T A;  2RV9 A;  1W0N A;  2VQU A;  2J1V A;  2VZP A;  2VJX A;  2WO2 A;  3UES A;  4PT6 A;  3IDA A;  4UOJ A;  4P00 B;  3SKV A;  1JZ8 A;  3W5N A;  2ZEW A;  2EIE A;  5LA0 A;  1XNA A;  2Y6K A;  3C7G A;  3EYP A;  5JXJ A;  4A6O A;  2HLE A;  4LKS A;  3DYP A;  1P8J A;  2EIC A;  4QB6 A;  3EB7 A;  2VCB A;  2VC9 A;  4QDS A;  3LPF A;  3SEP A;  4KWU A;  1IQD C;  2VZS A;  4Z2A A;  2L9L A;  2R7E B;  4JKM A;  4QB1 A;  3PUH A;  3SKJ E;  1UY0 A;  2V5D A;  3THD A;  4CU7 A;  4AG4 A;  1H6Y A;  1JYN A;  4CU6 A;  1TG7 A;  4PF1 A;  3A7Q A;  2Z4F A;  1PX4 A;  3HEI A;  1PMH X;  4BJ0 A;  2VZV A;  2WDB A;  1JZ6 A;  4XVH A;  1UXZ A;  5CZK A;  3DEC A;  4CUA A;  3UNP A;  2YG0 A;  1BHG A;  3I2F A;  4JKL A;  2XQX A;  4MO3 M;  3I2H A;  2W47 A;  4BK5 A;  2X10 A;  4DXR A;  3VD4 A;  1CZT A;  2DDU A;  4QDQ A;  1GOF A;  3HNM A;  4DEV A;  1SDD B;  1JYX A;  2XOM A;  2Y6J A;  3OEA A;  4LPL A;  2VZO A;  5C71 A;  3ACH A;  3MUY 1;  4CUB A;  3DYO A;  2W95 A;  5DPN A;  1ULP A;  5EJZ B;  3T0D A;  3GGL A;  3MUZ 1;  1O8P A;  2WO3 A;  3HNB M;  4JX0 A;  1O8S A;  2WAO A;  4BXS V;  3HOB A;  4JHZ A;  4W50 A;  1I5P A;  1W8O A;  3FL7 A;  1NX9 A;  5LCW L;  2JD9 A;  3WF1 A;  3WNL A;  2QQN A;  1OF4 A;  4XUQ A;  1UWW A;  3C7O A;  3WNM A;  1W99 A;  5B4X A;  5C7G A;  2JE8 A;  4XUR A;  3SEE A;  3CKH A;  3ACI A;  2VMF A;  4DUX A;  4XUP A;  2XHN A;  1JHJ A;  1US3 A;  3T2P A;  3T0B A;  1JU4 A;  3WF0 A;  3U37 A;  3VDC A;  2BGP A;  3MV0 1;  3DYM A;  1UMI A;  3GM8 A;  5HXM A;  5JXG A;  1K3I A;  2W46 A;  2ZXQ A;  2CDP A;  4CUC A;  2W3J A;  1WKY A;  3I3B A;  1UY1 A;  3WNN A;  4E8C A;  3I2J A;  4MGQ A;  1W9S A;  2W87 A;  5F7U A;  1KGY A;  2ID4 A;  2DCJ A;  3OGV A;  4GZ9 A;  3D3A A;  3LE0 A;  4JKK A;  4QX2 A;  1K42 A;  1JZ5 A;  2ZEY A;  3K4Z A;  2E32 A;  1NUK A;  3CIH A;  5LA2 A;  2QQJ A;  2EIB A;  2WZE A;  3NNG A;  3WNP A;  1T2X A;  3ACF A;  1JZ2 A;  2WO1 A;  2W94 A;  4DXS A;  1JZ3 A;  2B9V A;  2Y8K A;  2JDA A;  1TVG A;  4AAX A;  4ZZ5 A;  3ABZ A;  3T08 A;  5JUV A;  1L7Q A;  1OT5 A;  2BBA A;  4D8M A;  4DUV A;  4LQR A;  5A1A A;  2J1U A;  3I97 A;  5B4N A;  2E26 A;  5JMO A;  2PQS A;  3J7H A;  5FUI A;  1JYW A;  2VZQ A;  3HNY M;  4CVU A;  5DQ0 A;  4FI9 A;  4QAW A;  3WF3 A;  4QX0 A;  2QQK A;  4KMQ A;  4P02 B;  3T09 A;  1JYV A;  3C7F A;  4XUN A;  4BK4 A;  4E8D A;  1SG3 A;  3K46 A;  1W9W A;  2LW8 A;  2ZEZ A;  3OG2 A;  3VD5 A;  1R64 A;  3WNK A;  2WBK A;  3NQH A;  5JXI A;  5JR2 A;  1EUT A;  3HJR A;  2C26 A;  3LQC A;  2WAA A;  5IFP A;  2QQL A;  1GQP A;  3MBW A;  4IUG A;  3LEG A;  1DP0 A;  2YB7 A;  4W8J A;  4CU9 A;  3WNO A;  1J84 A;  4CU8 A;  1EUU A;  1L7R A;  1US2 A;  3WEZ A;  5C70 A;  3IAP A;  5IJR A;  2V4V A;  3VD9 A;  4P08 A;  2W1U A;  4MOA A;  1GMM A;  1F4A A;  3ETP A;  3HPN A;  3I2G A;  2VZU A;  3JXS A;  4M4R A;  5DMY A;  1OH4 A;  1W9T A;  2XON A;  4W4Z A;  2EID A;  5IHR A;  2WZ8 A;  3BN6 A;  4HG6 B;  5JXH A;  3CZJ A;  4OYU A;  1JZ7 A;  1UY2 A;  2E31 A;  3OGR A;  1UZ0 A;  4ET7 A;  2JKX A;  2ZEX A;  4L0P A;  4QB2 A;  3WSO A;  4D0Q A;  1K12 A;  2WAB A;  4LHS A;  3ACG A;  1NAE A;  2X09 A;  4A44 A;  2VQT A;  1UY3 A;  4P5Y A;  3A23 A;  3PUI A;  2VM9 A;  3T2Q A;  1JI6 A;  4GWJ A;  2CDO A;  4XUT A;  5G04 L;  4BDV B;  4QDR A;  3VDA A;  2RVA A;  3NRU A;  2WN2 A;  1UYZ A;  1DYO A;  2J1R A;  3WF2 A;  1PX3 A;  2VTF A;  1OD3 A;  5IFT A;  2BZD A;  1SHW B;  3IAQ A;  2W1Q A;  3C7E A;  2VOT A;  3FHA A;  2BER A;  3F2Z A;  1CX1 A;  2VMD A;  2OKX A;  1YQ2 A;  2KD7 A;  2DCK A;  3W5M A;  4QX3 A;  4A3Z A;  5CYY A;  2J7M A;  3I2I A;  2Y64 A;  1OF3 A;  1UY4 A;  2W1S A;  2YFZ A;  3NJV A;  4GWI A;  4DXT A;  1ULO A;  2VL4 A;  3P6B A;  2YC2 A;  3LPG A;  3VD7 A;  3I2K A;  3MV1 1;  4A41 A;  3OGS A;  1GNY A;  3HN3 A;  1MPX A;  3K4A A;  3WQB A;  1O59 A;  1XNT A;  1CZV A;  1NKG A;  2Y6G A;  4XZU G;  3ZM8 A;  3NJX A;  2J1E A;  1UMH A;  4OZO A;  2W91 A;  2Y6L A;  1H6X A;  1GU3 A;  3FHQ A;  3GXU A;  2LS6 A;  2YFU A;  5LA1 A;  5DN2 A;  3A21 A;  3OEB A;  2HYX A;  2ORZ A;  4UI9 L;  2VCA A;  1XPW A;  3K75 B;  3T0A A;  2J22 A;  2VO5 A;  1F4H A;  1RYY A;  4QPW A;  1KEX A;  3A22 A;  3I3D A;  2RJ2 A;  4TTG A;  3OBA A;  1GOG A;  3K77 A;  4A45 A;  5I0D A;  4DUW A;  2J1A A;  3VDB A;  2W9X A;  4YPJ A;  4RYD A;  2X05 A;  2QBX A;  2WQ8 A;  2V72 A;  3IB3 A;  4ARX A;  4XUO A;  3K4D A;  3WF4 A;  2VZ3 A;  3FN9 A;  1UX7 A;  2W92 A;  4ZY9 A;  2WYS A;  2B4K A; 
#chains in the Genus database with same CATH topology
 1VBD 1;  3VDD C;  5C9A B;  2JEC A;  3POW A;  4E9K A;  2W5F A;  2QQO A;  1H9W A;  1OHF A;  2WFF 2;  1GZ9 A;  3L2Y A;  1KRI A;  1W06 A;  2W1W A;  1OC1 A;  2OUJ A;  4GQ7 A;  4UW3 A;  3KMH A;  5EJ1 B;  1R1A 3;  2HWE 2;  1GOH A;  1LOD A;  2BWA A;  4HVO A;  4PI0 A;  5A6Z A;  5HPO A;  3NO8 A;  1XB9 A;  1QHD A;  4MYE A;  4OUE A;  4M4P A;  1J83 A;  5EHD A;  4COY A;  2QQI A;  5LEJ A;  2E33 A;  4ITC A;  5FZB A;  4B7E A;  2ZAH A;  4RN5 A;  5D8A B;  4NRM A;  2WUH A;  2VCC A;  3AKT A;  1DG6 A;  1KIT A;  1YFW A;  2WSV A;  4V2V A;  4R4Z A;  3T2O A;  1UYX A;  1UZV A;  2PAK A;  1QEX A;  2VZ1 A;  3NAP B;  3QCW A;  2R07 2;  2ET1 A;  2WZR 2;  3LIG A;  4AI0 A;  4PQQ A;  3GHN A;  1URX A;  3ZR6 A;  3ENR A;  4OMD A;  5FRE A;  4PIX A;  3III A;  4EN7 B;  3MPB A;  2VBD A;  4ARY A;  4YFZ A;  1JZ4 A;  3CJI C;  2QE3 A;  3CZU A;  1HKD A;  2WN3 A;  4MXW B;  3OPW A;  4GUL A;  5JCT A;  1CAX B;  5ABJ C;  3MHZ A;  5BPX A;  2D6K A;  1UXX X;  5CU1 A;  4CYD A;  5A3T A;  1S0B A;  1DQ6 A;  2JEM A;  2ZHL A;  3EMR A;  1GP6 A;  1RHI 2;  4JHT A;  4Q2F A;  4QGN A;  4XIK A;  3ZFG C;  4COV A;  2G19 A;  5C8C A;  3KLS A;  1XSQ A;  2D6N A;  4JQT A;  5K4L A;  2MNG A;  2XXZ A;  5CFD C;  1OXC A;  2R06 1;  5JSP A;  5J48 A;  1AYN 2;  4OMC A;  4TXW A;  2FDG A;  3C7H A;  3ZYJ B;  1K45 A;  3N35 A;  1DZT A;  4YM1 A;  3KSC A;  2X29 A;  4AAP A;  2WFF 1;  1NCQ C;  1UD1 A;  1UL9 A;  1N3O A;  2J1V A;  5F5C A;  2WFP A;  1SZB A;  2JIG A;  4Y4Y A;  1AR7 1;  2WO2 A;  5FZ3 A;  1RUJ 3;  1NOV A;  4PT6 A;  3BOW A;  1RJ8 A;  3V0B B;  4P00 B;  3VDD B;  1JZ8 A;  1U5Z A;  2KA3 A;  3WHU A;  4BB3 A;  2ZEW A;  2EIE A;  1YLL A;  4BWO A;  2Y6K A;  2VVD A;  3NW4 A;  5FCC A;  4AZZ A;  3RZZ A;  5C9A A;  5LA0 A;  1FMD 2;  4UT5 A;  4YW2 A;  4LOS A;  3MW4 A;  4N9H A;  4LBL A;  2WT0 A;  5EYX A;  3AP9 A;  1OH3 A;  4Y20 B;  2VQ0 A;  5EYY A;  4QQP A;  1DCS A;  3M2M A;  3QAC A;  4IV1 B;  3OY8 B;  5H9S A;  1C4R A;  3IIA A;  1D4M 1;  4YGC A;  1ODM A;  3AK0 A;  4XF1 A;  4COZ A;  4HLT A;  1TME 2;  4GH4 C;  1P8J A;  1AXK A;  2E63 A;  1UOB A;  4FXK B;  4JDO A;  5D1I A;  5LWB A;  3EB7 A;  4MX3 A;  2VCB A;  5DUU A;  2BVV A;  1COV 1;  4FCA A;  3UV9 A;  2VNV A;  5LBE A;  1GSL A;  3KT4 A;  1OA3 A;  2V4A A;  4YZ5 A;  1LOC A;  1IQA A;  2GC0 A;  2I74 A;  2VOW A;  4WZF A;  1IHM A;  1U0A A;  2VMG A;  3NAP A;  3FX3 A;  3LIH A;  4P5H A;  3AP7 A;  1RHI 1;  2A6X A;  5F5Q A;  4LO4 B;  2R7E B;  1J58 A;  4C1W A;  1ULE A;  5SV8 A;  5E1R A;  1REE A;  2V5D A;  5KHK A;  4HL0 A;  3CJI B;  3ST7 A;  5J7M A;  4AG4 A;  4AEJ A;  2FZ2 A;  1PO2 1;  2R06 3;  1AYN 1;  3TN9 2;  5KHI A;  1XE8 A;  4NID A;  1NA1 B;  4MXW A;  1XE7 A;  2XKO A;  3AMM A;  3SC7 X;  2Q8E A;  3A7Q A;  3U0Z A;  3QH6 A;  2WS9 2;  3JD7 3;  3HEI A;  3IDC B;  2WFF 3;  1WLW A;  3LSD A;  2A73 B;  1ALY A;  4X6R B;  3ME2 A;  5FZC A;  3ZN4 A;  5CZK A;  1A3K A;  4XAC A;  1AR7 3;  4OUL A;  5FZA A;  4AFA A;  2Z69 A;  3I2F A;  5A7S A;  4BCU A;  2XQX A;  1ENR A;  4LBJ A;  4IE4 A;  2WRA A;  4MO3 M;  1NCR C;  1E57 A;  4HZF A;  4AFD A;  5C6C A;  2LUW A;  1ULC A;  4Q29 A;  4ATE A;  1UPI A;  4YW1 A;  3V65 A;  4YGD A;  3ZYP A;  2DDU A;  4XFH A;  4QDQ A;  1QJE A;  3HNM A;  4DEV A;  5FPX A;  1AR8 2;  1WME A;  3POY A;  4GWN A;  1D4M 3;  3AL5 A;  4KQ7 A;  4RGA A;  5A70 A;  3BB6 A;  2BBV A;  4K3U A;  1GBG A;  1YQC A;  3OEA A;  3VDD A;  3WY6 A;  3ACH A;  2Q8O A;  1PIV 2;  4LHK A;  2Y34 A;  1COV 3;  1LHU A;  3AYD A;  4BLI A;  5EJZ B;  3THP A;  1V70 A;  3E6C C;  1CWP A;  5FLH A;  4G3Y C;  5JOX A;  1MS0 A;  3KF3 A;  4Y20 A;  5LAS A;  4CEY C;  4ASL A;  5JDB A;  4IV1 A;  1HDK A;  3MUZ 1;  1UIJ A;  3I2O A;  1UO9 A;  3HNB M;  4Q4Y 1;  4AI1 A;  4PIZ A;  3O1P A;  2HWF 2;  1PZ8 A;  1ZNP A;  1JUH A;  4NWV A;  2OXB A;  1WCU A;  3OOX A;  3GZU C;  3SHR A;  1O8S A;  1PO2 3;  2WAO A;  3VV1 A;  3WR0 A;  4BXS V;  3FWE A;  4JHZ A;  1I5P A;  1QJF A;  1YNA A;  1Y4W A;  4XJU A;  1IKQ A;  1NX9 A;  1OFS A;  2JXA A;  3OUH A;  5F5I A;  3U1X A;  1S0G A;  3D82 A;  4B1L A;  3NKG A;  4XUQ A;  4HMZ A;  5F2S A;  4Y26 A;  1H9P A;  4KBZ A;  4RA0 A;  5K7P A;  5DAX A;  5B4X A;  3CJI A;  4WVV A;  5FXX A;  1GWM A;  1R08 1;  1R09 1;  5ABJ A;  5F37 A;  1VAK A;  1NA1 A;  1WD4 A;  2YGM A;  2VMF A;  3CU7 A;  3POB A;  2ES3 A;  1RUG 1;  3B00 A;  2NPI A;  5F3C A;  1OVS A;  3GCW A;  4AVT A;  2QZ2 A;  3WF0 A;  5C4W C;  5CFD A;  3GAL A;  3WT3 A;  2CNA A;  2CSG A;  4Q4W 1;  2DU0 A;  4CCO A;  4FO9 A;  1AL0 G;  4CRQ A;  4U2A A;  1G8W A;  1UMI A;  1NCR B;  3GM8 A;  3BPZ A;  3PJY A;  5FPA A;  5JXG A;  2VU9 A;  1RUF 2;  1UIK A;  5KBF A;  1NCQ A;  2W3J A;  1WKY A;  3I3B A;  2Y33 A;  1C57 A;  1W05 A;  4OUM A;  3OBR A;  1H2N A;  2VOK A;  3T3Y A;  3M7A A;  4DNY A;  1O6U A;  5GZD A;  5A33 B;  4ZHN A;  4CDQ B;  1UCX A;  3I2J A;  4Q0V A;  1W9S A;  3PUR A;  5FKB A;  1I3H A;  1UOG A;  3ZDV A;  3R4D B;  4YM3 A;  5F7U A;  1ASJ 2;  1CAU B;  2C5D A;  2VG9 A;  4Q4Y 3;  1VRH 2;  2D43 A;  3VBR C;  3O12 A;  4FP2 A;  4JKK A;  4OHX A;  3T2T A;  1K42 A;  3HWJ A;  2G9F A;  4BQ1 A;  4CDU B;  1W28 A;  3TYJ A;  3CIH A;  3VZM A;  5IW0 A;  3NNG A;  3NST A;  5FP4 A;  4EWE A;  1C8N A;  4HET A;  5EZW A;  3W20 A;  2WO1 A;  2A71 A;  4RFT 0;  2JB8 A;  4F8A A;  2QQV A;  5FJK A;  2VY0 A;  1STM A;  3NNJ A;  2B9V A;  4LBQ D;  2XBO 2;  3BVC A;  1BEV 1;  3EJK A;  4BM8 A;  2RDQ A;  4D7T A;  1Z7S 2;  1YQ8 A;  4YZ1 A;  5I93 A;  5GKA C;  1K5M C;  1R09 3;  1R08 3;  5L36 A;  1OLR A;  1TVG A;  1ZZC A;  2GC2 A;  3HBZ A;  2JDZ A;  4M01 A;  3DKQ A;  4XYX A;  5EV7 A;  1RUG 3;  3H8U A;  3VZN A;  5JZG B;  1L7Q A;  4D8M A;  4N53 B;  4P9L A;  4DUV A;  5CKN A;  2ZX1 A;  3LFI A;  3KT1 A;  3VBU C;  1GZC A;  1PVC 2;  4JCK A;  1AX0 A;  4V2W A;  1F5J A;  4AVS A;  4Q4W 3;  1QKQ A;  1WW5 A;  2FBE A;  1QQP 3;  2WJS A;  5FUI A;  2JEN A;  3PME A;  1Q8P A;  2H0V A;  1OPM A;  5DQ0 A;  4KBB A;  4AE2 A;  1SLB A;  1FXZ A;  3KS7 A;  4Z82 A;  3WF3 A;  1WA6 X;  5C4W B;  5J37 A;  1APN A;  5C3Q A;  4A7K A;  3T09 A;  1XND A;  4CA9 A;  4OI0 A;  4AK3 A;  4AW7 A;  4LA3 A;  3C7F A;  5FZ9 A;  4E8D A;  1MEC 2;  1SG3 A;  3UJQ A;  1F35 A;  2DU1 A;  5GZE A;  2ZEZ A;  3OG2 A;  1ASJ 1;  4YVS C;  3TWI A;  3VD5 A;  3OD4 A;  1NCR A;  4QT6 A;  3WNK A;  4FOY A;  1AL2 2;  4TYS A;  1DGL A;  2FZ1 A;  4QX5 A;  3KCY A;  1QXJ A;  1RUC 2;  3VL8 A;  5JIU A;  3Q9O A;  2A6Y A;  2VEC A;  2BEO A;  1PK6 B;  2YHJ A;  1LOF A;  2NLR A;  2D5F A;  2DUP A;  2QNK A;  5A7N A;  3ZKU A;  2PAM A;  5A33 A;  3POE A;  1GQP A;  1JBC A;  4IUG A;  3N9Q A;  4IE5 A;  2ARX A;  1SLI A;  2SLI A;  2VNR A;  3KVB A;  4CU9 A;  1CAU A;  3O1T A;  1Y9Q A;  5CIS A;  1V6O A;  1PMI A;  1WW6 A;  2PAE A;  4ZXK A;  1US2 A;  4Q8K A;  1BEV 3;  2A1X A;  1MQT C;  1Z7S 1;  4L2N A;  5C70 A;  1PZ9 A;  2V4V A;  4CEY A;  1XRU A;  1QH7 A;  4NHM A;  3APB A;  3LAG A;  4JTN A;  4AGR A;  5DMY A;  5FO9 B;  3KGZ A;  2XON A;  4W4Z A;  1W0O A;  4E4H A;  1V9U 2;  2D97 A;  2EID A;  3AL6 A;  4UFI A;  3VHN A;  4QDS A;  1PVC 1;  3WUC A;  5IK8 A;  3RZJ A;  5BUV A;  3BN6 A;  2HWC 2;  1ZRC A;  3TNP B;  4NPM A;  3J7L A;  1FNZ A;  5D2A A;  1I5Z A;  4WM7 B;  3OGR A;  2GC1 A;  2QFE A;  1GAN A;  1H8T C;  1UZ0 A;  4LO6 B;  4WM8 C;  3RG0 A;  3WG2 A;  2K9Z A;  4ET7 A;  5JZG A;  2G1M A;  2YUE A;  3N7L A;  5F3I A;  3KT7 A;  2VUD A;  2ZEX A;  3URF A;  2HKX A;  2R04 1;  3L9J T;  5A3N A;  2FDH A;  4QGM A;  4XDP A;  1V00 A;  1ODN A;  5HV0 A;  3RZH A;  2RS5 2;  2F4L A;  1ASJ 3;  2GNM A;  3ACG A;  3ZFE C;  1QGL A;  4N43 C;  5L9B A;  4BIO A;  3IZO A;  4CEW C;  2KXL A;  3R6S A;  3PUI A;  4NWW A;  5DUX A;  4OI1 A;  3O5S A;  5C4W A;  4BOW A;  5LZ6 A;  2F17 A;  3FC0 A;  3H3L A;  4S2H A;  5T5O A;  2RVA A;  3ZN5 A;  2AZ5 A;  4V1P A;  2VXR A;  1UYZ A;  2UU8 A;  4WVZ A;  4YVS B;  1LRH A;  1WMF A;  1DYO A;  2BWC A;  1SCS A;  4D6Q A;  2BOJ A;  3AXE A;  4DXZ A;  5BNO B;  5DAQ A;  1LU1 A;  3ZSE A;  1W8F A;  5IVV A;  1GYK A;  3AKP A;  3ZX7 A;  1FAT A;  1H1M A;  1OSG A;  3LWC A;  3VB9 A;  3AKQ A;  4NAO A;  3IAQ A;  1BQP A;  4Y1V A;  1BK0 A;  2QDN A;  3C7E A;  4IEP A;  1PGL 2;  2XJR A;  1V9U 1;  2VMD A;  1JYT A;  4QPI B;  4UF0 B;  3MW3 A;  4RR3 C;  3VBR A;  3WVJ A;  2PQQ A;  1PVC 3;  2DCK A;  1WBF A;  1ZBE 1;  2HWC 1;  4HAN A;  4UFH A;  5CKM A;  1NQD A;  1DBN A;  2IXH A;  1FV2 A;  1SEF A;  3H0O A;  4A3Z A;  4QD2 A;  3ZOI A;  4H7L A;  4NR1 A;  1C28 A;  1NQJ A;  2EF6 A;  2R1D A;  2XML A;  2YDE A;  4QX8 A;  4UFM A;  4YNI A;  5C3O A;  5HCA A;  3I2I A;  4QGL A;  4S2G A;  5L9V A;  4XJZ A;  4Q1P A;  4Q1R A;  4M00 A;  1CVN A;  1CN1 A;  3D6E A;  5DDJ 2;  3THT A;  3VBO C;  4AVA A;  5I0T A;  4LO8 A;  2XJV A;  2D44 A;  4FTE A;  2BNM A;  1BMV 2;  3PHM A;  1RUD 1;  2R04 3;  4DXT A;  4LUL A;  2RS5 1;  3PU3 A;  3ZFF B;  3VD7 A;  3I2K A;  3MV1 1;  5FPL A;  4A41 A;  4CUG A;  1GNY A;  3WOG A;  2GN3 A;  3MEP A;  3LA7 A;  3AYA A;  4WM7 A;  1JS9 A;  3BU0 A;  1O59 A;  1XNT A;  1E5S A;  1S0C A;  4L92 A;  1W6M B;  2IVJ A;  1O3S A;  2UYB A;  3FMG A;  2GAU A;  3ZM8 A;  2BFU L;  2DUR A;  3R0R A;  3DXT A;  4XF9 A;  3ZFE B;  2WZP P;  2Y6L A;  1GU3 A;  4KU7 A;  3U10 A;  3FHQ A;  5ANN A;  4L11 A;  1IPK A;  2O8Q A;  3OYW B;  5TSW A;  1H1I A;  4YVW C;  3FLT A;  1NXD 1;  5K0U C;  1O4Y A;  2ZGK A;  2BJS A;  2VUA A;  2ZJC A;  5LA1 A;  1QY4 A;  4XF0 A;  4ZS3 A;  4FXG B;  4CDW B;  1YYN A;  2NM1 A;  1SPP A;  4IEX A;  4B7K A;  2HYX A;  1DIW A;  4JZR A;  5A3M A;  3AP5 A;  2Q30 A;  4YVS A;  1KS4 A;  2PHL A;  1XPW A;  3GBG A;  3LF7 A;  4FFI A;  4D69 A;  1RIT A;  1V9U 3;  1PGS A;  4N90 A;  1WCS A;  2J22 A;  2PN5 A;  2VO5 A;  3CF6 E;  3E6D A;  3TEX A;  2WLP A;  1RYY A;  4PLM A;  1KEX A;  1ZBE 3;  1AXY A;  2HWC 3;  4QPW A;  5E16 A;  2UWC A;  1OA4 A;  5T5L A;  3SXW A;  4IEQ A;  5IK5 A;  2JDN A;  4TTG A;  4QQL A;  1GOG A;  1HB3 A;  2XJU A;  2XL7 A;  3K77 A;  3KWV A;  4XOG A;  2HWD 3;  4F3J A;  5EP9 A;  4AFM A;  5A6X A;  2I45 A;  1OUR A;  4B4Q A;  3GF6 A;  4AQS A;  3I4I A;  4RYD A;  2WQ8 A;  4JRA A;  2Z79 A;  4UF0 A;  5IT6 A;  3B5L B;  3E5X A;  1AHS A;  3LKJ A;  5DAW A;  1BMV 1;  2XHK A;  4QKD A;  2LAL A;  1MQT A;  1RUD 3;  1XNC A;  2C1F A;  3BAL A;  3K4D A;  4CCE A;  1PHM A;  1N3P A;  2RS5 3;  3WF4 A;  2P34 A;  2NP0 A;  4HN1 A;  3PU8 A;  4ZY9 A;  5T50 A;  3JBG 1;  2B4K A;  4YWA A;  4OQ8 A;  3IPV B;  3P3P A;  2RHP A;  5EIY B;  3RVH A;  3OGG A;  3KD4 A;  5AC9 2;  4KI5 M;  4GMP 0;  5FP7 A;  1PMJ X;  4BQ2 A;  3J8F 2;  5BY5 A;  3AYE A;  4Z8B A;  4QKN A;  4PHZ A;  3ETQ A;  5FZM A;  5A7W B;  4FSJ A;  4OZX A;  4DRR A;  2ZCW A;  3HVD A;  1EY2 A;  1S0D A;  3CQO A;  4YGB A;  3ZFF A;  1AYM 1;  3THC A;  1ZYB A;  2EVX A;  2GH2 A;  3N9L A;  4DZG A;  5L73 A;  1G9A A;  1L3J A;  3P1I A;  1X7N A;  2Q5T A;  1Y3T A;  4FPY A;  4M3C F;  4QX1 A;  5FWJ A;  2H0B A;  3OJB A;  1UNB A;  1O3Q A;  2PHF A;  1W6M A;  1N1T A;  1WCK A;  2IC1 A;  2VME A;  4HSL A;  3V64 A;  1S2K A;  1WLD A;  4TSV A;  1WCQ A;  3NV4 A;  3ILN A;  3ZFE A;  4AXO A;  1GV9 A;  2OYZ A;  2XGX A;  1RUE 2;  4QU2 A;  4CEW A;  4UAP A;  2PTM A;  4XHX A;  1HRV 1;  1PGW 1;  3W9A A;  4D7Y A;  3CDZ B;  4NUB A;  4BQ4 A;  4FBF A;  5IYY A;  1JU3 A;  3FUQ A;  4CDW A;  3DUI A;  3FHI B;  5FYH A;  4OFG A;  1IG3 A;  3BU7 A;  3FFZ A;  4MGS A;  3V56 A;  2YBK A;  5C8C C;  3S30 A;  4CP9 B;  1OOP B;  3E97 A;  1ZRE A;  4IE7 A;  1D0H A;  4Y24 A;  5F6L B;  5CA6 A;  1D7P M;  2D3R A;  2W08 A;  2W68 A;  2HBT A;  2J1S A;  1F31 A;  3LDB A;  2A70 A;  3PUQ A;  4R52 A;  4YW6 A;  3WW4 A;  2WC2 A;  2HWB 2;  3RZM A;  3AMP A;  3JBG 3;  3WNX A;  2EXJ A;  2J1T A;  4GD4 A;  5FZO A;  3LEM A;  3WD5 A;  4EJR A;  2I2S A;  4MXV A;  2RV9 A;  3E5Q A;  1I9R A;  2WQZ C;  2VQU A;  4K1Z A;  3ZKY A;  2JWP A;  1S2E A;  5H9Q A;  1DHK B;  2ZGM A;  2WA3 A;  3H42 B;  4MGT A;  4H55 A;  3IDA A;  3PLQ A;  2JD4 A;  2RS1 2;  3VHP A;  3SH3 A;  5C9A C;  1AYM 3;  3M3C A;  1NE6 A;  2DBI A;  1W2N A;  2D98 A;  3IPV A;  4NIA A;  4DRV A;  4ES9 A;  1BK1 A;  1OMI A;  1UN1 A;  4AFB A;  1UYP A;  5LB6 A;  1HJF A;  2WWS A;  5E6H A;  1DLL A;  5LBF A;  1NZC A;  4EZ4 A;  1BKZ A;  3JZV A;  3VKF C;  2IXJ A;  4RHV 1;  2YC0 A;  2R1B A;  2A3W A;  5GZC A;  1Z0H A;  4LK6 A;  2ZHM A;  5A7W A;  4FAH A;  5J36 A;  5L7O B;  3JQW A;  1VBB 1;  3I54 A;  4LKS A;  5I0R A;  4NHK A;  1S1A A;  2EIC A;  2WSU A;  1U5X A;  3NL1 A;  5FRA A;  4WVW A;  3R4S A;  5D8A C;  1XE0 A;  2MEV 2;  2OQ7 A;  2WT2 A;  1HRV 3;  2GMP A;  2RMU 1;  2XQR A;  1LU2 A;  3DCQ A;  2BQP A;  3NV2 A;  2A6W A;  3RNS A;  1CAV B;  4YLZ A;  4TLG A;  4NVP A;  5JPN B;  1WMX A;  1C8M 1;  1PZ7 A;  1A8M A;  2VZS A;  3I8T A;  4FPF A;  4LOR A;  4LUM A;  4BMB A;  4Z2A A;  4XQD A;  4HVQ A;  4XFC A;  3OSD A;  3QLQ A;  4Y5T A;  5KHJ A;  5LW9 A;  1Y9M A;  1QIQ A;  3SKJ E;  2YGL A;  4R8H A;  5DXD A;  4YVW A;  5K0U A;  2O8O A;  3EO6 A;  5A7Q A;  4BE3 A;  1DFQ A;  3QH7 A;  5GZF A;  5IAV A;  1TG7 A;  3S6P A;  4QU1 A;  4ASM B;  3SNM A;  1OUX A;  1CQ9 A;  4GAL A;  4NPL A;  1ZBA 2;  1W6P B;  4IDZ A;  4CP9 A;  1OOP A;  2WDB A;  2DVB A;  3FFQ A;  3M8L A;  1DZQ A;  3DEC A;  3JQX A;  3KCX A;  4IND A;  3MYX A;  3AKR A;  2D7F A;  1F5F A;  3HIF A;  2DUQ A;  2RS1 1;  1QOS A;  4JKL A;  3H9A A;  2GNB A;  5GM0 A;  4Q27 A;  5FZ0 A;  5JSR A;  1ENQ A;  4BHP A;  1DGR A;  4ONU A;  4DXR A;  5BYN A;  5FXZ A;  4RHV 3;  1T6B X;  1WMD A;  2ZGR A;  5C33 A;  2ZKL A;  1CIW A;  2CGP A;  2GZW A;  1HRI 2;  1SDD B;  1RTV A;  1VBB 3;  2WKK A;  4NHY A;  1UKR A;  4Q0Q A;  1JYX A;  2XOM A;  2UWB A;  2Y6J A;  1OVP A;  5C71 A;  5T5J A;  3C2U A;  2Q1F A;  2RMU 3;  1VP6 A;  3VBH B;  1RMU 1;  1BJQ A;  4D3W A;  1HXS 1;  1H4H A;  2ZGT A;  4J1W A;  3ZSM A;  2DTW A;  4IV1 C;  3A4U A;  1V6L A;  4FQ4 A;  1DZR A;  4P9W A;  1KJR A;  1C8M 3;  3MFC A;  1DYK A;  2BP6 A;  2WNE A;  5L7O A;  3I59 B;  2XVK A;  2WO3 A;  4JX0 A;  5FK7 A;  5ACA 1;  3B9C A;  2ZKN A;  4NN0 A;  4YZ3 A;  3CNA A;  1FOD 2;  3TOJ A;  5KWR A;  2EAL A;  3B69 A;  3GZA A;  2PMW B;  3WDT A;  4QQH A;  4LKD A;  1VAL A;  1CAV A;  1PO1 1;  5A1F A;  3HOB A;  4NHX A;  2W52 A;  3HQR A;  4GIQ A;  4W50 A;  4DFS A;  4F83 A;  4JVA A;  1XNK A;  4X8P A;  3N7J A;  4AR2 A;  3CEW A;  5LCW L;  3WF1 A;  1RVF 1;  3SLI A;  2HEW F;  4H7M A;  4C0B A;  2QQN A;  5BV6 A;  3C7O A;  3L2H A;  4MHU A;  4NOT A;  1VBA 2;  5K9Y A;  5C7G A;  4XFI A;  5FAX A;  2GMM A;  2B7Y A;  3KB5 A;  2LM3 A;  1NA1 C;  4DIQ A;  2RS1 3;  2RDN A;  1GZW B;  1YI7 A;  3S5Q A;  1VRB A;  1I1E A;  1VMF A;  3CKH A;  3ACI A;  2CAU A;  3AVS A;  4JV4 A;  3PVN A;  4K7J A;  4DUX A;  1V6I A;  4XUP A;  3WDU A;  2OII A;  4BZ4 A;  4EZH A;  1JU4 A;  2DBN A;  1Q8V A;  3ON7 A;  5APA A;  5BXX A;  1LB2 A;  5LY1 A;  3VDC A;  1TNR A;  2Q8D A;  3ZXK A;  1YEW A;  1HRI 1;  1VBD 3;  4XFG A;  3WG1 A;  2YBS A;  2GME A;  3MV0 1;  3PTR B;  3HAG A;  5JWP A;  2HBU A;  3PNA A;  4MET A;  2NMO A;  4F7Z A;  2D6O X;  2ENR A;  4BQ5 A;  1WW4 A;  1AXZ A;  2CDP A;  3PDQ A;  1FX5 A;  1KDK A;  3JB4 C;  5CBL A;  1RMU 3;  2HWE 1;  3WNN A;  4E8C A;  1HXS 3;  4YZ2 A;  3SCF A;  2W39 A;  2WII B;  5I0S A;  3AYC A;  3PUS A;  3F95 A;  4MGQ A;  3MLK A;  4C8D A;  1LOB A;  1UZY A;  5A6Q A;  2XPJ A;  2DCJ A;  5ACA 3;  4AHX A;  2V09 A;  2HEY F;  3D3A A;  2ZZQ A;  3LCP A;  3LE0 A;  4QX2 A;  1N1Y A;  2A3X A;  2EAK A;  1JZ5 A;  2VCM A;  3N4M A;  5FZD A;  2R07 1;  4XET A;  5FUN A;  3VBH A;  2WZR 1;  2P3Y A;  3D0S A;  1PO1 3;  1NUK A;  1IZ3 A;  3MIE A;  4FPC A;  5FY0 A;  2XWJ B;  2EIB A;  1ST8 A;  2P1B A;  2JDU A;  2QZ3 A;  3LB9 A;  1RVF 3;  4LXL A;  3I59 A;  1JZ2 A;  4XFF A;  4CXW A;  2K0G A;  1VBA 1;  5D8A A;  4DXS A;  1JZ3 A;  1YFU A;  4G4F A;  3RI8 A;  3RZL A;  5FZF A;  3AB0 A;  2Y8K A;  4YW5 A;  1LR5 A;  2VW2 A;  4HON A;  2ADE A;  3VBF B;  2VBP A;  1CD3 G;  1YI9 A;  2VTX A;  3KV5 A;  1AR9 2;  2AEN A;  4ZZ5 A;  3ABZ A;  4XXA A;  2RS3 2;  2X53 S;  1CJP A;  3ZPO A;  1QMJ A;  5ANQ A;  4NRQ A;  1QF3 A;  1AVB A;  1C5H A;  1YC6 1;  2MHF A;  1RUO A;  5HCB A;  3W59 A;  5C3S A;  1VLN A;  2ARC A;  4B4P A;  5FOJ B;  2E26 A;  4ASK A;  2K2S A;  1CAX A;  2PQS A;  1HRI 3;  3J7H A;  4KWL A;  5DZE A;  4C0H A;  5JMO A;  5CAD A;  3HNY M;  1GZW A;  1QJU 2;  3MF6 A;  4XTM A;  3A0N A;  5F3G A;  4Q0S A;  3HT2 A;  3RMX A;  1CES A;  1YCI A;  1KJL A;  2CV6 A;  4QAW A;  1UKG A;  3MW2 A;  4QX0 A;  2QQK A;  3LSE A;  3UK9 A;  5FDB A;  1JYI A;  2HWE 3;  4RS5 B;  5BNN C;  2B42 B;  4YM0 A;  4XHB A;  4GB3 2;  1AUY A;  2X8K A;  4AOC A;  1LTE A;  3T1L A;  2LTN A;  5LK5 A;  2LW8 A;  1MZE A;  3MGU A;  5FJH A;  1FMD 1;  3ZYG A;  4DPN A;  3DV8 A;  4P9G A;  5HXV A;  2VUC A;  4LBN A;  5FYZ A;  3Q8A A;  2DYC A;  1LOF C;  1EUT A;  1F15 A;  2CWS A;  2ZBJ A;  2R07 3;  3HD8 B;  4LBM A;  3HJR A;  2WZR 3;  2WLQ A;  4O9E A;  1RUI 2;  4CDQ C;  1TME 1;  2ARE A;  3V0B A;  3CHX A;  2K46 A;  2D3P A;  2E7A A;  2ZGO A;  2YU1 A;  4PQ9 A;  1W8Z A;  5FY4 A;  1DP0 A;  2VVE A;  3POG A;  3WNO A;  2OX0 A;  1MZF A;  4TWT A;  1VBA 3;  2OW4 A;  2WWJ A;  4CDU C;  3GZT B;  3ZR5 A;  4GAZ A;  4BU2 A;  4QHO A;  1UU5 A;  2YV8 A;  3OY8 A;  4P08 A;  2W1U A;  4MOA A;  1RHI 3;  4GMP 1;  4IV3 C;  4EV0 A;  5IK4 A;  2H6C A;  2UWA A;  1JOJ A;  2G9G A;  3OPZ A;  3TN9 1;  2DVF A;  1VR3 A;  1AYN 3;  2CWM A;  1VMH A;  3UGF A;  5JI9 A;  5KXB A;  2WS9 1;  2OT7 A;  2E6V A;  4HG6 B;  5EJ3 A;  2Q1M A;  1GQG A;  1TZO A;  3HR9 A;  3LDK A;  4OYU A;  5JXH A;  1UOF A;  4NMI A;  4XJ8 A;  1UMZ A;  1LES A;  2DVA A;  3AP6 A;  3PL0 A;  5JZG C;  3MLJ A;  4N53 C;  1JXN A;  1E5H A;  4YRD A;  5IAT A;  2OPK A;  4XE9 A;  3WQ7 A;  1W8T A;  4QB2 A;  4YGE A;  3WSO A;  4NE9 A;  2XB6 C;  1SDW A;  2HYK A;  1TMF 2;  1F9K A;  1FMD 3;  2X09 A;  4A44 A;  1ZZ9 A;  2CGO A;  2VQT A;  3A23 A;  5BNN B;  1W8U A;  4KNC A;  3KV6 A;  4NO4 A;  2ZGQ A;  4P9I A;  5LBB A;  4FTS A;  1AR8 1;  4AI9 A;  1W8H A;  1H2L A;  3FE5 A;  4CE8 A;  4RS5 A;  3NRU A;  4HT1 T;  4COW A;  1TME 3;  2RG4 A;  1KFU L;  3ORJ A;  4HVR A;  1PIV 1;  3BOD A;  1QDC A;  1YIP A;  2FDJ A;  2A7A A;  1YHF A;  5E8A A;  2J42 A;  5FYI A;  4ZU5 A;  4COU A;  4YG6 A;  5EFU A;  4IEU A;  5FMC A;  4AED B;  5F2W A;  3WG4 A;  1YJL A;  2J1R A;  2RDS A;  3D8C A;  2AC1 A;  4E2Q A;  1LED A;  3VZK A;  3NKT A;  4E27 A;  1EV1 2;  2FDI A;  1PK6 C;  4ZPI A;  1OD3 A;  5AVP A;  1J59 A;  3J7N A;  1MS1 A;  1W9Y A;  1ZA7 A;  2DCZ A;  4L9B A;  4GMP 3;  2HWF 1;  2W1Q A;  4ISR A;  3ZXJ A;  1QOT A;  3POS A;  5FBJ A;  1CX1 A;  3EQE A;  3U14 A;  1YQ2 A;  4B3N A;  5BNP C;  3TN9 3;  2KD7 A;  3B3Q E;  3GYD A;  4AL9 A;  3W5M A;  2XUE A;  2WS9 3;  2P6C A;  1MS9 A;  5F39 A;  1VB2 A;  4IV3 B;  1ZRR A;  2P17 A;  1CPN A;  5CYY A;  1W2U A;  4LHL A;  1HN0 A;  3PVB B;  1OF3 A;  1UY4 A;  2VPV A;  3TRS B;  2BOI A;  2JG8 B;  3P6B A;  2Z2S B;  1NLR A;  2VVF A;  3R4U A;  5A1L A;  2GP3 A;  3OGS A;  4WM7 C;  3T30 A;  3K4A A;  4Q4V 2;  1JTZ X;  3DXU A;  3SCH A;  2GH8 A;  1SLC A;  5J96 B;  2C0Z A;  1SLA A;  4NPR A;  4XFA A;  1EYB A;  1NKG A;  2XR4 A;  1W90 A;  2JE7 A;  2ZPX A;  1AR8 3;  3DKW A;  2Y6G A;  1HW5 A;  4LE3 A;  3ZSL A;  4E2G A;  1RB8 G;  4BA6 A;  3PVE A;  4XMA A;  3WCS A;  1RUF 1;  3B93 A;  4OZO A;  1HB2 A;  1PIV 3;  2VE1 A;  4MZU A;  2VXJ A;  1UPS A;  3C3V A;  4KU8 A;  2CL2 A;  1S55 A;  3J4U H;  5FMB A;  5EWS A;  3RDI A;  2YXS A;  1TQ5 A;  3WDW A;  3NV3 A;  1EV1 1;  2Y60 A;  3GXU A;  4FPH A;  4OHW A;  2RR1 2;  5BNN A;  3ALQ A;  5T55 A;  3BTX A;  1QNY A;  1QWR A;  3PIG A;  5HCF A;  3UJO A;  1VRH 1;  2HWF 3;  2VCA A;  5FIX A;  5GJ6 A;  2UYA A;  5BNO C;  3KZ4 C;  2V73 A;  3T0A A;  2CY6 A;  4D7S A;  2DCY A;  1B09 A;  4E2S A;  2LRP A;  3A22 A;  1JW6 A;  5I91 A;  3ZSK A;  2SBA A;  4CDQ A;  1UOJ A;  1MS5 A;  2D6M A;  3ITQ A;  2NQY A;  2WA4 A;  3OBA A;  1LOG A;  4HKW A;  5FPZ A;  1GWK A;  5BNP B;  4ATF A;  1GP5 A;  2XBO 1;  2W0X A;  3MIC A;  1J1T A;  1O7F A;  4QPI C;  4YPJ A;  2QBX A;  2X05 A;  2EXK A;  2V72 A;  4IXL A;  4PF5 A;  4CDU A;  4ARX A;  2Y0I A;  1VIW B;  2XJS A;  3N3H A;  4QM8 A;  4JDN A;  4NHL A;  3UKV A;  4Z2W A;  4CCL A;  5F5A A;  5I8Y A;  4HFS A;  2VZ3 A;  2WQ4 A;  3SH5 A;  4I0B A;  4XF3 A;  5JPM B;  4IV3 A;  3B9I A;  1XU1 A;  1HJG A;  3B01 A;  3RYP A;  4FPL A;  3NNM A;  4KG0 A;  3PIJ A;  1SBF A;  2IZW A;  5FPB A;  3T1M A;  4C90 A;  4AHW A;  1LUL A;  1PM4 A;  3OB8 A;  1CAW B;  1GUI A;  3WDX A;  4E4D X;  1CON A;  4ZZ8 A;  1H1A A;  1X36 A;  3ZFF C;  3C8X A;  3H3U A;  2VZT A;  4K40 A;  1CIY A;  1RUF 3;  2C4X A;  2QVS B;  2JDH A;  3P3N A;  2ORX A;  3LGR A;  5CVR A;  3MO4 A;  3UET A;  1CR7 A;  3ECQ A;  3USU B;  3RYK A;  1NG0 A;  4XBN A;  5JVV A;  4N53 A;  1MR5 A;  1POV 1;  1HN1 A;  1GKB A;  1W8N A;  3OGJ A;  5L19 A;  1EV1 3;  2YU2 A;  1MEC 1;  3GDB A;  3Q8F A;  4EN8 B;  1QJY 2;  4QXC A;  1RXG A;  4OVE A;  1NXM A;  1XOY A;  1WW7 A;  4ZXE A;  1VRH 3;  1G9F A;  1AL2 1;  2Q0A A;  1WCD J;  2GNT A;  2YPD A;  4FQZ A;  5DUW A;  5LY2 A;  1RUC 1;  5J1X A;  1CZS A;  4NII A;  3H8O A;  1LNS A;  4W6X A;  2GAL A;  5DAP A;  1H30 A;  3O0W A;  1XYP A;  4UBH A;  1XQN A;  1S0I A;  1WLT A;  2PFW A;  2VR4 A;  4BIF A;  4CDW C;  4IL7 A;  1LEN A;  4IW3 A;  1Z78 A;  1NY7 2;  2ZX4 A;  3E1F 1;  1RXF A;  3NJY A;  3UKN A;  2XJT A;  1XC6 A;  2YZ4 A;  4A4A A;  2Y6H A;  3AXD A;  2FCU A;  3BGA A;  4B29 A;  2JDK A;  3VLB B;  2XBO 3;  1LCL A;  3KCC A;  1Q56 A;  1Z7S 3;  5JAX A;  1VAM A;  4BLJ A;  4BXF A;  3OD0 A;  1PK6 A;  3N9P A;  4PIY A;  5CAZ A;  2BGO A;  1BYH A;  5GLU A;  2IFW A;  2QQM A;  4IEZ A;  3WLU A;  3BKZ A;  3S57 A;  2BU9 A;  3ES1 A;  2AYH A;  4AVC A;  1J3R A;  1HB4 A;  2PHR A;  1AX1 A;  4IER A;  5FTT C;  3NNL A;  4LOT A;  5CFC C;  1FI2 A;  4JRL A;  4IQP A;  4YW3 A;  5BNP A;  3WW1 A;  1GIC A;  3KHB A;  5KC5 A;  4CSW A;  1LEM A;  1F8V A;  1ULG A;  4QX7 A;  4UOJ A;  3SKV A;  3W5N A;  1C5I A;  3FUO A;  2TUN A;  1W3V A;  2O14 A;  4MGZ E;  2WNV B;  1POV 3;  4XBQ A;  3EYP A;  2PLV 2;  3ELN A;  5FO8 B;  4W65 A;  1QJY 1;  1MEC 3;  1O5U A;  1C3H A;  4EE2 A;  2R16 A;  3JU9 A;  3I2D A;  3QOP A;  3M3I A;  1AL2 3;  4LR4 A;  4A6O A;  1RUC 3;  2HLE A;  3DYP A;  2D6L X;  2ET7 A;  4M3C E;  5IUQ A;  3VL9 A;  5LK7 B;  3USU A;  4BH9 A;  2VC9 A;  4IGQ A;  2D3S A;  3NMB A;  2D93 A;  1LHV A;  3NV1 A;  3S0M A;  1QJZ A;  4XBL A;  1ULD A;  4W6W A;  2IUW A;  4YG0 A;  1RL3 A;  4XDQ A;  4RGG A;  1YO8 A;  5T5P A;  3SEP A;  4KWU A;  3T4V A;  1TE1 B;  1VE0 A;  5FZ6 A;  4EN6 B;  2L9L A;  1RUN A;  3LD8 A;  1Q5O A;  3CLP A;  4LBK A;  4Z07 A;  5CG8 A;  4QB1 A;  5F1R A;  2QQW A;  3PUH A;  1PM7 A;  2TBV A;  1W04 A;  3AZW A;  3M3E A;  4QXK A;  5FYS A;  4CU7 A;  1HQN A;  5FYT A;  4CCN A;  4CU6 A;  3H3Z A;  3UL2 A;  1MS8 A;  1X33 A;  5K8S A;  1PGL 1;  2YRO A;  4I3P A;  4AGG A;  1JN2 P;  1KQR A;  2Z4F A;  5FZ4 A;  1PX4 A;  4J25 A;  1OOP C;  1YUD A;  5BNO A;  1IOA A;  4XAB A;  1PMH X;  4BJ0 A;  3MDP A;  4Q0P A;  2VZV A;  2DF7 A;  2ZHN A;  1JZ6 A;  4XVH A;  5F3E A;  4AI3 A;  3RZG A;  4D94 A;  5D21 A;  3RS6 A;  1IKP A;  4FPG A;  1BHG A;  2OZ6 A;  4QHB A;  3OCP A;  4JGZ C;  3TEY A;  4PJY A;  3FJS A;  5DDJ 1;  5CFC B;  3O1V A;  3S7I A;  4IE0 A;  4MLO A;  2W47 A;  4BK5 A;  3DN7 A;  1BBT 2;  4QPI A;  1A78 A;  5A80 A;  4HN0 A;  4HSJ A;  5IVF A;  1D0G A;  1CZT A;  5E89 A;  2CU5 A;  4BQY A;  1M06 G;  4LKF A;  2VUJ A;  4LTA A;  1QJX 2;  3LOI A;  4GWM A;  4XAA A;  2FCV A;  3H50 A;  3N7M A;  4K8F A;  2BV4 A;  4DIN B;  5CEH A;  4QKB A;  2FDF A;  1SBE A;  4Z92 B;  1OQD A;  2PA7 A;  1XJA A;  4LPL A;  4PI2 A;  4CUB A;  2ZMK A;  2KM2 A;  4TLF A;  2W95 A;  3T4H B;  1DQ4 A;  1ULP A;  5DPN A;  3T0D A;  3N9N A;  1VBC 2;  4S2D A;  4N9I A;  4YM2 A;  1NZI A;  5L7O C;  2TNF A;  4LK7 A;  4Y1X A;  1O8P A;  3O1R A;  3G7D A;  4K6B A;  4FOQ A;  4AI8 A;  3OF1 A;  5FMO S;  4UFJ A;  4ZU4 A;  3MPP G;  1S0E A;  2AEY A;  1F2N A;  3M3Q A;  2CHH A;  2D6P A;  4MGI E;  4YG3 A;  3OYW A;  2JD9 A;  4NRP A;  3WNL A;  1GZT A;  1EAH 2;  1LGC A;  5M0T A;  1W2A X;  1OF4 A;  4P14 A;  1UWW A;  3AJY A;  3RZK A;  2E9Q A;  4GJZ A;  1W99 A;  4LO7 A;  4LIU A;  4Q5O A;  2JE8 A;  4EYU A;  3FZ3 A;  3N9O A;  3SEE A;  2WIN B;  2JDP A;  3WHT A;  5T52 A;  2GC3 A;  5DDJ 3;  3POJ A;  1U5Y A;  4OCT A;  1O91 A;  4HBN A;  5FZ7 A;  2XHN A;  1US3 A;  3BUC A;  4LT5 A;  3LZZ A;  3NWK A;  3Q8B A;  3T0B A;  4B8E A;  1KD7 A;  4QQ2 A;  4P9Y A;  1SFN A;  4XJ9 A;  2X5I B;  1UF2 C;  2BGP A;  4AFC A;  4JGZ B;  3LOB A;  3DYM A;  2NZ9 A;  2P4E A;  3ZVX A;  4M0H A;  5AC9 1;  1J3P A;  2FHR A;  1OKQ A;  2WL1 A;  1OLM E;  3J8F 1;  1K3I A;  2W46 A;  3CJX A;  5CFC A;  1JOP A;  3HQU A;  2O0O A;  2BVB A;  4JAA A;  2C6S A;  5IAX A;  5JOW A;  2D5H A;  1UY1 A;  4WVM B;  1OA2 A;  1WA4 A;  4Z1V A;  4L99 A;  1AF9 A;  4NRO A;  1ZZB A;  1W8W A;  1SLT A;  5SV5 A;  1KGY A;  2VTX J;  4LEJ A;  4RSU A;  2BRT A;  4NJ4 A;  4BQ3 A;  4TN7 A;  3BYW A;  1UU4 A;  4XXP A;  1CGP A;  1WD3 A;  4A7Z A;  4KGQ A;  5A3O A;  3VBH C;  1KS5 A;  4E4Z A;  2ZEY A;  2E32 A;  1BXH A;  1PNG A;  2JJ6 A;  3CO2 A;  4K1Y A;  4K8R B;  4N8M A;  4QPG C;  3ROU A;  5BNQ A;  3MF9 A;  4YW4 A;  1RUE 1;  1U12 A;  3O7O A;  1T2X A;  4CCM A;  1BVP 1;  3LA2 A;  1AX2 A;  2Q8C A;  1CX4 A;  2TEP A;  1FPN 2;  1FT9 A;  3GJB A;  4LIT A;  2JDA A;  2OS2 A;  2RE9 A;  2VOX A;  1YWK A;  3VHR A;  3WP6 A;  3E5U A;  2W2I A;  4Y4R A;  2O1Q A;  3ZYB A;  3AMQ A;  1DQ5 A;  1FAY A;  4AAX A;  1EPZ A;  2XJQ A;  3Q8C A;  5FYB A;  3FBM A;  4JQR A;  5FLI A;  5LEK A;  2R0F A;  2BBA A;  1A6C A;  1W3X A;  4Y33 A;  1ZRD A;  3WP3 A;  3J7M A;  3N36 A;  2J1U A;  3I97 A;  5B4N A;  2HWB 1;  3D0J A;  4XC9 A;  3ZIW A;  3EXU A;  1JYW A;  2IFR A;  3J9S A;  5LRR A;  1QXP A;  5AC9 3;  1RUJ 2;  4CVU A;  3SMH A;  4CP2 A;  4NIG A;  3J8F 3;  3NNF A;  3ZXD A;  1Y9G A;  2VW0 A;  4B4R A;  4M3C B;  3RJR A;  4XMI A;  1OLQ A;  2JE9 A;  1XU2 A;  2H6B A;  2CYF A;  1OQE A;  4XUN A;  5JIA A;  3ZXA C;  2QQP A;  3ZYR A;  2NMN A;  2VQA A;  4FPK A;  2P3I A;  3AZY A;  4JGZ A;  1OBN A;  3RGB A;  1Q8S A;  1NLQ A;  1R64 A;  5FQ0 B;  3NQH A;  1QH6 A;  4UW5 A;  3NJZ A;  1PVX A;  4QM9 A;  3M4F A;  4J1X A;  4SLI A;  5KR7 A;  2C26 A;  1OI6 A;  1B35 B;  3B94 A;  3LQC A;  4Y1Y A;  2WAA A;  5IFP A;  2ZMN A;  2ERF A;  3GBF A;  1RUE 3;  3SH4 A;  3MBW A;  4EN0 A;  2R32 A;  4AHZ A;  2MEV 1;  2ZA9 A;  2BFU S;  3LEG A;  4EQV A;  1LJ7 A;  2YB7 A;  2F4P A;  1OKO A;  4CU8 A;  4XZP A;  1EUU A;  3DPR B;  1UAI A;  2Q1Z B;  2GU9 A;  4K9S A;  4N7I A;  4WZC A;  1FPN 1;  4QPG B;  3WEZ A;  3GHM A;  3H1M A;  1IS3 A;  5IJR A;  2BPA 2;  3WQ0 A;  3JXS A;  3HPN A;  2R06 2;  4M4R A;  1OH4 A;  2FDK A;  4A2U A;  4MSV A;  1J1L A;  5CG9 A;  2RJK A;  1IS5 A;  1SFP A;  3O14 A;  2QTW B;  2GDF A;  3JD7 2;  4PDW B;  4J6G A;  4R4X A;  1POV 0;  2HWB 3;  5HI0 A;  3VBF C;  4XFB A;  3AX4 A;  5T54 A;  1O5L A;  1AR7 2;  1ZBA 1;  1RUJ 1;  1UU6 A;  2R6Q A;  4MGY E;  3UKT A;  1W6N B;  2Y38 A;  3UYJ A;  3VBS B;  4C91 A;  4BIS A;  1HQW A;  1MVQ A;  4ES8 A;  2XLF A;  1IPJ A;  2UUR A;  2JKX A;  4YW7 A;  1SCR A;  5JR7 B;  1JMU B;  2C9A A;  3U11 A;  4L0P A;  2ZX0 A;  2VW1 A;  2DCT A;  5F9T A;  1JUI A;  4QXB A;  1XNB A;  3WG3 A;  5HV4 A;  5IVC A;  4FFF A;  4LHS A;  4BQX A;  1YFX A;  3H7J A;  4MV2 A;  1A8D A;  5F32 A;  1W6P A;  3KV4 A;  1C1F A;  1D4M 2;  3NVC A;  4Q4X 2;  5FKC A;  1HQL A;  2PHU A;  2VM9 A;  3T2Q A;  4RS5 C;  4M3C A;  1EPW A;  4BDV B;  3I7D A;  3AFK A;  4QDR A;  3RSJ A;  1COV 2;  1UZW A;  2JDM A;  1JOB A;  3AM2 A;  3RMY A;  3VZO A;  4CPB A;  1DQ2 A;  3VN4 A;  4HK8 A;  2MEV 3;  1SMV A;  5GZG A;  1X8M A;  1BLZ A;  4BPZ A;  1FV3 A;  3ZN6 B;  1LGB A;  5FQ0 A;  3IBM A;  1D4V B;  1PX3 A;  1FPN 3;  1ENX A;  5DG2 A;  5IFT A;  1WLC A;  2AH2 A;  4QPY A;  4UFL A;  4WV8 A;  1VAV A;  4H14 A;  1B35 A;  1LHW A;  1PO2 2;  1W39 A;  1LAJ A;  4R9C A;  2VOT A;  1FOD 1;  2PHT A;  3FHA A;  4P9J A;  5FZE A;  3F2Z A;  4LBO A;  1PNF A;  5FXV A;  4HOO A;  4XJA A;  1SFY A;  3BCW A;  3JD7 1;  4LBQ B;  4AVV A;  4IGO A;  5FZ1 A;  3DPR A;  4URT A;  1E5R A;  1J3Q A;  4QPG A;  1L7L A;  1ZX5 A;  3ZXG A;  1ZBA 3;  4AGV A;  2A6V A;  2B5H A;  3WQ1 A;  2ETE A;  4MH0 E;  2Y64 A;  3MZH A;  3H7Y A;  4ZON A;  4DB5 A;  3BIW E;  1ZRI A;  5JI7 A;  2W1S A;  5KHH A;  2YFZ A;  3NJV A;  2JB4 A;  1XXN A;  2Y26 A;  4PDW A;  4XCA A;  4NIH A;  1ULO A;  2ZAB A;  4Y1Z A;  3R05 A;  1NYW A;  2YC2 A;  3MIF A;  5FR3 A;  3LFM A;  4FTB A;  3HN3 A;  4X6Q B;  1MPX A;  3VGI A;  3VBS A;  3IT8 A;  1W6N A;  4IES A;  4Q4X 1;  5FY5 A;  1DF0 A;  1VBE 2;  4I0W B;  2ATF A;  2IXL A;  3ES4 A;  2PEL A;  1CZV A;  4SBV A;  5FPV A;  4IEW A;  5IWF A;  2J1E A;  1MAC A;  1UMH A;  4LUK A;  1H0B A;  3ZMO A;  1H6X A;  3ZXL A;  3PJQ A;  5C3R A;  3GNE A;  1HB1 A;  4IE6 A;  4K20 A;  3J26 N;  4OHY A;  5EXO A;  3INA A;  1CPM A;  1RGS A;  2LS6 A;  3ILF A;  4Q4Y 2;  4DQA A;  1G6N A;  5IVJ A;  4HKO A;  5DN2 A;  1O4T A;  3A21 A;  3HQX A;  3OEB A;  1O4Z A;  2XG3 A;  1XYO A;  4UI9 L;  4EN9 B;  5ABJ B;  1FOD 3;  4WBB A;  5JR2 A;  1AZD A;  3K75 B;  3M1H A;  4AED C;  3ZFG B;  3ZN6 A;  3RPQ A;  3IN9 A;  1LKN A;  3TEW A;  3IWZ A;  2A75 A;  1QU0 A;  5L9R A;  5CFD B;  3I3D A;  5DUV A;  3M3O A;  4A3X A;  2ZGS A;  4A45 A;  4KGG A;  4DUW A;  2W9X A;  4XW3 A;  1R08 2;  1R09 2;  2WO7 A;  5EPA A;  3LDR A;  1ND2 C;  3VZL A;  4HPK B;  1NCQ B;  2ZZJ A;  5F6K A;  1RUG 2;  1ZZ6 A;  3MIG A;  4LBQ A;  2WYF A;  2DWR A;  4S2F A;  1AR9 1;  3VZJ A;  1CJD A;  1X50 A;  3GZE A;  4QQO A;  3TBD A;  2RS3 1;  3SQO A;  3FN9 A;  3W21 A;  1GNZ A;  4AEK A;  3KHC A;  4AI2 A;  1JHN A;  4IEO A;  4CPB D;  3CBN A;  4Q4W 2;  1LHO A;  1QQP 2;  3K2O A;  1VBE 1;  4FFH A;  4DEQ A;  4Q4X 3;  5FYY A;  3S5A A;  1OD5 A;  3VD3 A;  4PLO A;  2CAV A;  2VZR A;  3LEI A;  3VUO A;  5IVE A;  3VKM A;  1OLM A;  3CMG A;  3ZO0 B;  2JG8 C;  1OQ1 A;  4G9S B;  1QJU 1;  5FZH A;  3VBF A;  3KF5 A;  3WIN E;  2VOV A;  3TEZ A;  4O7X A;  1RJ7 A;  2QQU A;  4D6R A;  4KWK A;  4GH4 B;  5AVA A;  1DLC A;  2BGC A;  5CIR A;  3ZDS A;  4GB3 1;  2UY8 A;  1Q43 A;  2B9U A;  2P2K A;  2PXJ A;  5FO7 B;  1UYY A;  2MPF A;  3ZPY A;  1N47 A;  4CCC A;  5JSO A;  1W6Q B;  1YQ5 A;  2Z42 A;  3GBW A;  1VPH A;  2ZAA A;  2B45 X;  4OHV A;  4UW6 A;  1X82 A;  3UGH A;  2DVD A;  1R1Z A;  1UX6 A;  2XL9 A;  1Q8O A;  1RUI 1;  3BPS A;  1WUV A;  3ZMN A;  1QNW A;  3AC0 A;  4R9D A;  5FZK A;  3LEK A;  2GSY A;  5FYV A;  2VD7 A;  4JC1 A;  2OUH A;  3MLL A;  5G05 L;  4RQP C;  2VH9 A;  1BEV 2;  4DOU A;  3O1M A;  2ZGN A;  4A42 A;  3JUU A;  4UBG A;  3O1U A;  1SBD A;  4CTE A;  2VMC A;  4KH9 A;  5KXE A;  5FV3 A;  2XKP A;  2YC4 A;  4Y22 B;  1GR3 A;  4ERO A;  3AP4 A;  4MAD A;  1V6N A;  1EP0 A;  2A3Y A;  3I3E A;  3ZFG A;  4CZS A;  4FFG A;  1D2S A;  2B8M A;  2XJP A;  1UW8 A;  3ASI A;  4I02 A;  1AR9 3;  1ONA A;  1W2O A;  2C9K A;  3KGL A;  4A6S A;  2WWU A;  2RS3 3;  3OUJ A;  1RUH 2;  4LLF A;  2QUO A;  1MZ6 A;  1QQP 1;  2VMI A;  3HT1 A;  2JIJ A;  3IDE A;  5IVY A;  5B2G B;  1ND2 B;  3QBQ A;  5HCH A;  1OUS A;  1VBE 3;  1GWL A;  5I8T A;  1W0N A;  3KVA A;  4LA2 A;  2VUL A;  3D5O A;  4HPK A;  1H2M A;  5JLV A;  2XDV A;  2VZP A;  1A34 A;  2VJX A;  3IDB B;  4Q0U A;  2ZX2 A;  1QJU 3;  2ZOE B;  1D2Q A;  3UES A;  3VKL A;  5FP8 A;  2NN8 A;  4Y3O A;  3PTY A;  5FY8 A;  3MID A;  1KXG A;  2QKD A;  4BME A;  5A3U A;  5J3U A;  1XNA A;  3AJZ A;  3C7G A;  1BCX A;  3V0A B;  4P9X A;  1T6G C;  4GB3 3;  1AJO A;  5FY7 A;  5JXJ A;  5T3N A;  1TMF 1;  4XDO A;  2WR9 A;  5FZL A;  4CEY B;  5CNA A;  1C1L A;  4CCD A;  5C5U A;  2WNO A;  2FMY A;  5DZG A;  4XTP A;  4BYY A;  1WZX A;  3B7M A;  4QB6 A;  1IPS A;  2FCT A;  2Q4S A;  1RUI 3;  2WNU C;  4GH4 A;  4YFW A;  4AQ2 A;  3LPF A;  2BNN A;  4PBP A;  2XLG A;  1RED A;  2ZHK A;  2ZX3 A;  3PUA A;  1IQD C;  1W6Q A;  3VKN A;  2A5Z A;  2P3J A;  3WZ1 A;  1E5I A;  3ILR A;  4JKM A;  2HH9 A;  2IXI A;  4U36 A;  1UY0 A;  3AMH A;  2JKB A;  4XCB A;  3THD A;  1JZ7 A;  1H6Y A;  2DTY A;  1JYN A;  3S7E A;  4I01 A;  3OBZ A;  4AWD A;  3ATG A;  3X29 B;  1ZZ7 A;  4RQP B;  2NYY A;  3HBK A;  1RUH 1;  4PF1 A;  4OLL A;  2A6Z A;  2XUM A;  4QHZ A;  4H3W A;  4AHY A;  3MI8 A;  4IET A;  1NT0 A;  1YJK A;  3EBR A;  4Q26 A;  5FOB B;  4AED A;  3U4X A;  2R49 A;  3RWK X;  2XVG A;  4FP3 A;  4XIO A;  4Y22 A;  5EQU A;  1UXZ A;  4H2A A;  4CUA A;  3UNP A;  1GNH A;  1YRZ A;  2AAC A;  1S0F A;  2YG0 A;  3RWN A;  1Y7B A;  1K5J A;  4JTO A;  4HXC A;  4CXY A;  1W9F A;  2D40 A;  2R04 2;  2OVU A;  2YPJ A;  3DL3 A;  3TB0 A;  1DYP A;  3HN1 A;  3I2H A;  3U75 A;  4LNV A;  2X10 A;  1ND2 A;  4I3G A;  1W2T A;  2ARB A;  4YYO A;  5FMO L;  2DUO A;  3VD4 A;  5FXW A;  1IS4 A;  4XF4 A;  1TMF 3;  2LRO A;  2HJI A;  3DF0 A;  4CXX A;  1GOF A;  4Q4V 1;  5ISL A;  1WGP A;  3H1W A;  2JX9 A;  4DMI A;  1IG0 A;  2FMD A;  4QXH A;  2DFB A;  2VZO A;  1DQ1 A;  2WNV C;  3MUY 1;  3WDV A;  3DYO A;  4GA9 A;  3VBR B;  1M4W A;  2EA7 A;  4FT8 A;  5E88 A;  2DFC A;  5I8S A;  2JG8 A;  4OI2 A;  3GGL A;  4TZD A;  1S4C A;  1DGW A;  2VNG A;  4GKY A;  4MHR A;  4E4S A;  4XAE A;  1H2K A;  1GFF 2;  4XQ4 A;  1H4G A;  1KFX L;  2WNU B;  1KDM A;  2F6B A;  2RR1 1;  1V6M A;  4FOW A;  1SQ4 A;  1DGW X;  5FZ8 A;  1ENS A;  3WUD A;  2PHD A;  1G9B A;  1JH5 A;  1ZBE 2;  1LGN A;  1RUH 3;  1W8O A;  3WV6 A;  4DY3 A;  1K5M B;  5FY1 A;  2B39 A;  3FL7 A;  2PHX A;  2GN7 A;  4JGY C;  5LAT A;  4KWJ A;  4EWA A;  4X8N A;  2BW8 A;  2HWD 2;  2FQP A;  2N7G A;  4Y1U A;  5GLZ A;  2RDR A;  3MIH A;  3WNM A;  5H9P A;  3VBU B;  5A3P A;  4Y5Z 0;  3KM5 A;  4I30 A;  4XUR A;  3UGG A;  3CL1 A;  3EHK A;  4EWD A;  3AMN A;  4RQP A;  3OUI A;  1RUD 2;  3K51 A;  4XIL A;  4MGK E;  2E7Q A;  5DZF A;  2FD8 A;  1TNF A;  1JHJ A;  3K48 A;  4L8Q A;  3DGT A;  4GXL A;  3T2P A;  2ZS6 B;  1JOD A;  3WP4 A;  4B1M A;  1VJ2 A;  5H9R A;  4UXA A;  1G9C A;  3U37 A;  1SAC A;  2VMH A;  2RM2 2;  4RD7 A;  3WP5 A;  5J09 A;  4Q4V 3;  1SPP B;  4R9B A;  3IKW A;  5HXM A;  1MS3 A;  2VAU A;  3M70 A;  4BQW A;  3RQ0 A;  1POQ A;  1UQX A;  2ZXQ A;  3FBY A;  4CUC A;  2ZML A;  2GND A;  1OPO A;  5C8W A;  1LOE A;  4LLO A;  1S2B A;  1BVV A;  2R0H A;  3AZX A;  1V0A A;  4IEV A;  2AUY A;  2ZGU A;  5CB7 A;  3POF A;  1NE4 A;  3AKS A;  3DEM A;  3WW2 A;  1DGR N;  3ZIX A;  2W87 A;  3UT0 A;  1N3Q A;  2ID4 A;  1G7Y A;  1ND3 C;  3O0V A;  3OGV A;  1GQH A;  3KQR A;  2G4I A;  4M0N A;  3ZXE A;  2OQ6 A;  2JIC A;  4GZ9 A;  3U07 A;  2RR1 3;  4IGP A;  2Z5W A;  4LO5 B;  1CAW A;  1U5I A;  3K4Z A;  5KHG A;  3PVO A;  3ZYF A;  1LOA A;  3TNQ A;  2XWB B;  1MQT B;  4KG8 A;  5LA2 A;  2QQJ A;  2XVL A;  3PMS A;  5HBA A;  2IVI B;  1VMJ A;  2WZE A;  3HMY A;  3JCI A;  3WNP A;  4DO0 A;  1I6X A;  2OA2 A;  3ACF A;  3IMN A;  2HWD 1;  3WCR A;  5LRS A;  2BTV C;  1Y43 B;  2E51 A;  2W94 A;  2WNU A;  2AR6 A;  2ARA A;  1NY7 1;  4R9A A;  4LE4 A;  2OZJ A;  2BUK A;  5JMC A;  5FK8 A;  2P6H A;  1AR6 2;  4AQ6 A;  5GLT A;  4LHN A;  3WX5 A;  5FZI A;  2XLA A;  4JGY B;  4DY5 A;  3ZLI A;  5A3L A;  1WWY A;  4ZKT B;  3T08 A;  1K5M A;  3OTF A;  4URA A;  5JUV A;  3BTA A;  1MS4 A;  1OT5 A;  3JBG 2;  1HV1 A;  1H8T B;  3FLR A;  4LQR A;  4QMA A;  4WM8 B;  5A1A A;  2VNO A;  2XH6 A;  2RM2 1;  5FPU A;  2JG9 C;  3B02 A;  3OPT A;  3VBU A;  5A6Y A;  4K21 A;  4JDM A;  4YAR A;  2VZQ A;  4W6Y A;  3Q8E A;  4ORF A;  4CDX C;  2B46 X;  4FI9 A;  5FUP A;  3BI3 A;  4N43 B;  3BTY A;  1AYM 2;  4CEW B;  3KV9 A;  4KMQ A;  4P02 B;  1BZW A;  3BOP A;  4O9G A;  1JYV A;  5A3W A;  2X5I C;  2BNO A;  4BK4 A;  5FP9 A;  4CCK A;  2I07 B;  2PHW A;  3K46 A;  1HIX A;  5AFB A;  5IK7 A;  1W9W A;  4XJW A;  4O61 A;  2PLV 1;  1FYU A;  4GKX A;  1G86 A;  3P5B A;  3I49 A;  2WBK A;  1QJY 3;  5AFE A;  5CKQ A;  2QJV A;  5JXI A;  3H8R A;  5FFO C;  2EXH A;  2ZAC A;  1O3R A;  1X8E A;  1YIF A;  1GLH A;  2Y6F A;  5FLJ A;  1HRV 2;  1PGW 2;  1AJK A;  3AFG A;  1DDL A;  2QQL A;  3QD6 A;  3I3Q A;  2YMZ A;  1ND3 B;  2GP5 A;  3SIS A;  3AZZ A;  3OBT A;  1IS6 A;  4W8J A;  1W03 A;  2WNV A;  5FZO B;  1J84 A;  1N1S A;  1L7R A;  4LIV A;  4RFR B;  4RR3 B;  2C24 A;  5FMD A;  1AR6 1;  5C3P A;  5IVB A;  3G6J B;  3IAP A;  4NAM A;  4A7Y A;  3VD9 A;  4GJY A;  4PLN A;  3O1S A;  4HK9 A;  1GMM A;  1F4A A;  3ETP A;  1QOO A;  3I2G A;  2G9Z A;  2VZU A;  1WBL A;  3AZV A;  3AVR A;  1W6O B;  5LA9 A;  5A7P A;  1W9T A;  1RIR A;  4QWN A;  2P5B A;  2UY9 A;  2JDY A;  3LA3 A;  4MUV A;  3U4S A;  3N9M A;  3VBO B;  1V6J A;  5GLW A;  2RM2 3;  5IHR A;  4CP1 A;  5J98 B;  2WZ8 A;  4LMF A;  5DG1 A;  1ZA4 A;  1ZVF A;  3USS A;  4OHZ A;  1O3T A;  3CZJ A;  3TAY A;  3V0A A;  3D4K A;  1HLC A;  3VHO A;  2PYT A;  4DS0 A;  4JGY A;  1HX6 A;  1UY2 A;  1X9T A;  2E31 A;  5FBZ A;  1OFN A;  4D6S A;  2VGD A;  3SIT A;  3RRD A;  1H8T A;  4QKF A;  4WM8 A;  2JG9 B;  2ZGP A;  4D0Q A;  2OPW A;  4FAG A;  3O1O A;  2IXK A;  2ZTN A;  4ISQ A;  1K12 A;  1VB4 A;  1BBT 1;  4CDX B;  4RHV 2;  2WAB A;  5KC6 A;  2BDR A;  2PLV 3;  2EAA A;  2RJL A;  1NAE A;  5FYM A;  1DU3 D;  4PCR A;  1UY3 A;  1LHN A;  1Q8Q A;  1VBB 2;  2CTV A;  4N43 A;  4P5Y A;  1QJX 1;  4C1X A;  4I0A A;  1JI6 A;  4GWJ A;  4I09 A;  4YVW B;  5K0U B;  5LBC A;  2CDO A;  1XYN A;  4XUT A;  2HEV F;  5G04 L;  3VDA A;  3H8X A;  2RMU 2;  2WN2 A;  3K3O A;  2YBP A;  1R1A 2;  3WXP A;  3FLP A;  3K3N A;  1IGO A;  2EXI A;  4OQ9 A;  3RI9 A;  2AEZ A;  4IEY A;  1H8V A;  1MZ5 A;  1NLS A;  3KQ4 B;  1C8M 2;  1HV0 A;  5FWE A;  4AEM A;  3WF2 A;  1VBC 1;  2BYV E;  2IXC A;  5FY9 A;  5A7O A;  2ADD A;  2VTF A;  1AR6 3;  1B35 C;  3POI A;  4Q8L A;  5DAB A;  5JOZ A;  2BZD A;  4MG2 A;  3BIE A;  4AVB A;  1SHW B;  1X9P A;  2DVG A;  2EIG A;  3GCX A;  1JYC A;  4FPE A;  4FPJ A;  2BER A;  1ND3 A;  2OKX A;  3DPR C;  4RL7 A;  1YQ6 A;  1Q3E A;  2V5Y A;  4LJH A;  3WW3 A;  2AGS A;  1FNY A;  1ZM1 A;  4L97 A;  1YFY A;  4OI4 A;  4OUS A;  4RR3 A;  3MFA A;  5A32 B;  3W58 A;  5ERL A;  3ZYH A;  3ZYI B;  2ZGL A;  4QX3 A;  4AYU A;  2YY1 A;  2E7T A;  1ZZ8 A;  4XPV A;  1TEI A;  1EAH 1;  3RJ2 X;  2DV9 A;  3BTZ A;  4XQW A;  4Y5S A;  4XEZ A;  2J7M A;  1W6O A;  1QXR A;  3GJA A;  1RIN A;  3A0K A;  4CP0 A;  4PDW C;  4ZU7 A;  1G9D A;  4O65 A;  5F8P A;  1S0J A;  4FOV A;  4GWI A;  3VBO A;  2P37 A;  2VL4 A;  3RYR A;  3LPG A;  5DAV A;  4UW4 A;  3VBS C;  1BBT 3;  4PBO A;  4CCJ A;  5JOY A;  2Y0O A;  1ULF A;  1ZRF A;  3WQB A;  1VBD 2;  1DQ0 A;  4AQT A;  1GP4 A;  4HKL A;  1QJX 3;  3N7K A;  5FZG A;  3RFR A;  5FYU A;  4LKE A;  4XZU G;  2JG9 A;  3IMM A;  3NJX A;  4KL1 A;  5KXD A;  1R1A 1;  1RMU 2;  2IWG B;  3H1Y A;  3NAP C;  1HXS 2;  2E53 A;  2W91 A;  2ILM A;  4UFK A;  3ZXF A;  2YYO A;  1LEC A;  4CDX A;  4RGK A;  2CGN A;  2VBB A;  4UWD A;  3O0X A;  3U78 A;  1VBC 3;  4FPO B;  5ACA 2;  4N7U A;  2YFU A;  4YZ4 A;  2QDR A;  1UZZ A;  2QCS B;  2X5I A;  3WDY A;  5FP3 A;  3I3M A;  3IM0 A;  3VKO A;  2ORZ A;  1YXW A;  1PO1 2;  4YSF A;  5C8C B;  5GLV A;  1SLL A;  4I2O A;  1N1V A;  1REF A;  1F4H A;  4WVM A;  1RVF 2;  2WT1 A;  5I0U A;  1ACC A;  2R30 A;  2RJ2 A;  4MVT A;  1XSR A;  5C5T A;  3JB8 A;  3MIB A;  1EAH 3;  1W0P A;  5I0D A;  3SCG A;  2J1A A;  2KR2 A;  5GAL A;  5KXC A;  1V6K A;  4FVV A;  3VDB A;  2P3K A;  3ACL A;  1RC6 A;  3IB3 A;  4UYB A;  5FYC A;  4XUO A;  3ZSJ A;  4ZS2 A;  1QDO A;  4AF9 A;  1MVE A;  5A32 A;  3E6B A;  1XBF A;  1UX7 A;  2W92 A;  2WYS A; 
#chains in the Genus database with same CATH homology
 5EIY B;  2W5F A;  4DEQ A;  2QQO A;  4KI5 M;  3VD3 A;  1PMJ X;  3OB8 A;  2VZR A;  3LEI A;  1GUI A;  2W1W A;  3CMG A;  4ZZ8 A;  3C8X A;  2VZT A;  5EJ1 B;  1CIY A;  2C4X A;  1GOH A;  3UET A;  3CQO A;  2ORX A;  3THC A;  3MO4 A;  5HPO A;  3ECQ A;  4OUE A;  4M4P A;  1J83 A;  3P1I A;  2QQI A;  2E33 A;  1DLC A;  1HN1 A;  1W8N A;  4RN5 A;  4QX1 A;  2WUH A;  3GDB A;  2VCC A;  1UYY A;  3T2O A;  1UYX A;  2VZ1 A;  2VME A;  4ZXE A;  5J1X A;  1WCQ A;  4PQQ A;  1CZS A;  1LNS A;  4OMD A;  4UAP A;  3III A;  1JZ4 A;  4ARY A;  3AC0 A;  3CDZ B;  2VR4 A;  3LEK A;  3CZU A;  5IYY A;  1JU3 A;  2WN3 A;  5G05 L;  3E1F 1;  4A4A A;  1XC6 A;  2Y6H A;  4A42 A;  1UXX X;  3BGA A;  4MGS A;  2VMC A;  2YC4 A;  4MAD A;  3I3E A;  1D7P M;  2J1S A;  2BGO A;  2C9K A;  2QQM A;  4OMC A;  4TXW A;  3C7H A;  1K45 A;  2J1T A;  2RV9 A;  1W0N A;  2VQU A;  2J1V A;  2VZP A;  2VJX A;  2WO2 A;  3UES A;  4PT6 A;  3IDA A;  4UOJ A;  4P00 B;  3SKV A;  1JZ8 A;  3W5N A;  2ZEW A;  2EIE A;  5LA0 A;  1XNA A;  2Y6K A;  3C7G A;  3EYP A;  5JXJ A;  4A6O A;  2HLE A;  4LKS A;  3DYP A;  1P8J A;  2EIC A;  4QB6 A;  3EB7 A;  2VCB A;  2VC9 A;  4QDS A;  3LPF A;  3SEP A;  4KWU A;  1IQD C;  2VZS A;  4Z2A A;  2L9L A;  2R7E B;  4JKM A;  4QB1 A;  3PUH A;  3SKJ E;  1UY0 A;  2V5D A;  3THD A;  4CU7 A;  4AG4 A;  1H6Y A;  1JYN A;  4CU6 A;  1TG7 A;  4PF1 A;  3A7Q A;  2Z4F A;  1PX4 A;  3HEI A;  1PMH X;  4BJ0 A;  2VZV A;  2WDB A;  1JZ6 A;  4XVH A;  1UXZ A;  5CZK A;  3DEC A;  4CUA A;  3UNP A;  2YG0 A;  1BHG A;  3I2F A;  4JKL A;  2XQX A;  4MO3 M;  3I2H A;  2W47 A;  4BK5 A;  2X10 A;  4DXR A;  3VD4 A;  1CZT A;  2DDU A;  4QDQ A;  1GOF A;  3HNM A;  4DEV A;  1SDD B;  1JYX A;  2XOM A;  2Y6J A;  3OEA A;  4LPL A;  2VZO A;  5C71 A;  3ACH A;  3MUY 1;  4CUB A;  3DYO A;  2W95 A;  5DPN A;  1ULP A;  5EJZ B;  3T0D A;  3GGL A;  3MUZ 1;  1O8P A;  2WO3 A;  3HNB M;  4JX0 A;  1O8S A;  2WAO A;  4BXS V;  3HOB A;  4JHZ A;  4W50 A;  1I5P A;  1W8O A;  3FL7 A;  1NX9 A;  5LCW L;  2JD9 A;  3WF1 A;  3WNL A;  2QQN A;  1OF4 A;  4XUQ A;  1UWW A;  3C7O A;  3WNM A;  1W99 A;  5B4X A;  5C7G A;  2JE8 A;  4XUR A;  3SEE A;  3CKH A;  3ACI A;  2VMF A;  4DUX A;  4XUP A;  2XHN A;  1JHJ A;  1US3 A;  3T2P A;  3T0B A;  1JU4 A;  3WF0 A;  3U37 A;  3VDC A;  2BGP A;  3MV0 1;  3DYM A;  1UMI A;  3GM8 A;  5HXM A;  5JXG A;  1K3I A;  2W46 A;  2ZXQ A;  2CDP A;  4CUC A;  2W3J A;  1WKY A;  3I3B A;  1UY1 A;  3WNN A;  4E8C A;  3I2J A;  4MGQ A;  1W9S A;  2W87 A;  5F7U A;  1KGY A;  2ID4 A;  2DCJ A;  3OGV A;  4GZ9 A;  3D3A A;  3LE0 A;  4JKK A;  4QX2 A;  1K42 A;  1JZ5 A;  2ZEY A;  3K4Z A;  2E32 A;  1NUK A;  3CIH A;  5LA2 A;  2QQJ A;  2EIB A;  2WZE A;  3NNG A;  3WNP A;  1T2X A;  3ACF A;  1JZ2 A;  2WO1 A;  2W94 A;  4DXS A;  1JZ3 A;  2B9V A;  2Y8K A;  2JDA A;  1TVG A;  4AAX A;  4ZZ5 A;  3ABZ A;  3T08 A;  5JUV A;  1L7Q A;  1OT5 A;  2BBA A;  4D8M A;  4DUV A;  4LQR A;  5A1A A;  2J1U A;  3I97 A;  5B4N A;  2E26 A;  5JMO A;  2PQS A;  3J7H A;  5FUI A;  1JYW A;  2VZQ A;  3HNY M;  4CVU A;  5DQ0 A;  4FI9 A;  4QAW A;  3WF3 A;  4QX0 A;  2QQK A;  4KMQ A;  4P02 B;  3T09 A;  1JYV A;  3C7F A;  4XUN A;  4BK4 A;  4E8D A;  1SG3 A;  3K46 A;  1W9W A;  2LW8 A;  2ZEZ A;  3OG2 A;  3VD5 A;  1R64 A;  3WNK A;  2WBK A;  3NQH A;  5JXI A;  5JR2 A;  1EUT A;  3HJR A;  2C26 A;  3LQC A;  2WAA A;  5IFP A;  2QQL A;  1GQP A;  3MBW A;  4IUG A;  3LEG A;  1DP0 A;  2YB7 A;  4W8J A;  4CU9 A;  3WNO A;  1J84 A;  4CU8 A;  1EUU A;  1L7R A;  1US2 A;  3WEZ A;  5C70 A;  3IAP A;  5IJR A;  2V4V A;  3VD9 A;  4P08 A;  2W1U A;  4MOA A;  1GMM A;  1F4A A;  3ETP A;  3HPN A;  3I2G A;  2VZU A;  3JXS A;  4M4R A;  5DMY A;  1OH4 A;  1W9T A;  2XON A;  4W4Z A;  2EID A;  5IHR A;  2WZ8 A;  3BN6 A;  4HG6 B;  5JXH A;  3CZJ A;  4OYU A;  1JZ7 A;  1UY2 A;  2E31 A;  3OGR A;  1UZ0 A;  4ET7 A;  2JKX A;  2ZEX A;  4L0P A;  4QB2 A;  3WSO A;  4D0Q A;  1K12 A;  2WAB A;  4LHS A;  3ACG A;  1NAE A;  2X09 A;  4A44 A;  2VQT A;  1UY3 A;  4P5Y A;  3A23 A;  3PUI A;  2VM9 A;  3T2Q A;  1JI6 A;  4GWJ A;  2CDO A;  4XUT A;  5G04 L;  4BDV B;  4QDR A;  3VDA A;  2RVA A;  3NRU A;  2WN2 A;  1UYZ A;  1DYO A;  2J1R A;  3WF2 A;  1PX3 A;  2VTF A;  1OD3 A;  5IFT A;  2BZD A;  1SHW B;  3IAQ A;  2W1Q A;  3C7E A;  2VOT A;  3FHA A;  2BER A;  3F2Z A;  1CX1 A;  2VMD A;  2OKX A;  1YQ2 A;  2KD7 A;  2DCK A;  3W5M A;  4QX3 A;  4A3Z A;  5CYY A;  2J7M A;  3I2I A;  2Y64 A;  1OF3 A;  1UY4 A;  2W1S A;  2YFZ A;  3NJV A;  4GWI A;  4DXT A;  1ULO A;  2VL4 A;  3P6B A;  2YC2 A;  3LPG A;  3VD7 A;  3I2K A;  3MV1 1;  4A41 A;  3OGS A;  1GNY A;  3HN3 A;  1MPX A;  3K4A A;  3WQB A;  1O59 A;  1XNT A;  1CZV A;  1NKG A;  2Y6G A;  4XZU G;  3ZM8 A;  3NJX A;  2J1E A;  1UMH A;  4OZO A;  2W91 A;  2Y6L A;  1H6X A;  1GU3 A;  3FHQ A;  3GXU A;  2LS6 A;  2YFU A;  5LA1 A;  5DN2 A;  3A21 A;  3OEB A;  2HYX A;  2ORZ A;  4UI9 L;  2VCA A;  1XPW A;  3K75 B;  3T0A A;  2J22 A;  2VO5 A;  1F4H A;  1RYY A;  4QPW A;  1KEX A;  3A22 A;  3I3D A;  2RJ2 A;  4TTG A;  3OBA A;  1GOG A;  3K77 A;  4A45 A;  5I0D A;  4DUW A;  2J1A A;  3VDB A;  2W9X A;  4YPJ A;  4RYD A;  2X05 A;  2QBX A;  2WQ8 A;  2V72 A;  3IB3 A;  4ARX A;  4XUO A;  3K4D A;  3WF4 A;  2VZ3 A;  3FN9 A;  1UX7 A;  2W92 A;  4ZY9 A;  2WYS A;  2B4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...