4LKSA

Structure of cbm32-3 from a family 31 glycoside hydrolase from clostridium perfringens in complex with galactose
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
157
structure length
157
Chain Sequence
LYKKAGSEFALDSSKLEAIYATSEADRDYKENAVDGDENTIWHSAYQAADKLPVSITIKLDKAYDLNQIDYLPRQNSRNGHVTEYKIETSLDNENWTEVRTGNLEVNEAGNALANRGYNPIRFNTINAQYLRFTALKTLGDTNNKYASAAELVFYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Sugar binding protein
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
total genus 37
structure length 157
sequence length 157
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4lksA00
2QQJA 1GOGA 2VOTA 3ACIA 3NRUA 2W1UA 3FL7A 3VDCA 1UYXA 4A3ZA 1WCQA 3WNMA 1P8JA 3NQHA 1JYNA 1UMHA 4A45A 5JXGA 2W5FA 1ULOA 2YFZA 3ECQA 4AG4A 2LW8A 1TG7A 2WZ8A 4CVUA 2VMEA 4M4PA 2C26A 2Y64A 2QQLA 5EJZB 3WNPA 3HEIA 3T2OA 3VD7A 4DXTA 4DXSA 1UY4A 1JZ4A 3A23A 3HJRA 3BGAA 3WSOA 1NX9A 3SEEA 4D8MA 2XOMA 2Y6LA 4BK5A 2QQOA 2R7EB 4MOAA 3A21A 1JZ3A 3GXUA 3T0DA 4QDQA 3I3DA 4A42A 2C4XA 2WO3A 2RJ2A 5JXJA 3U37A 1GOHA 4LHSA 1J84A 1XNTA 2W95A 2W46A 5DPNA 2C9KA 2LS6A 3OGSA 2YFUA 1K12A 3IDAA 1BHGA 3I3EA 3WF0A 3WNKA 3HOBA 3WF3A 2V72A 1DLCA 5DMYA 2W1WA 4MGQA 2WQ8A 1SG3A 5IHRA 3UNPA 1W8OA 3T0BA 4MO3M 3A22A 3MO4A 4HG6B 1I5PA 1UZ0A 3CMGA 1H6XA 2J22A 2KD7A 3NJVA 3WF2A 2QQKA 2JKXA 1DYOA 3D3AA 4GZ9A 4PT6A 2WO1A 3MV11 1OF4A 4JKMA 3NNGA 3VD9A 1GNYA 5G04L 1XC6A 2W87A 2WAAA 4YPJA 2WYSA 5IJRA 3VDAA 5JR2A 3PUHA 4OZOA 2B4KA 1JI6A 3J7HA 3SKVA 2ORZA 4GWIA 3DYOA 3THCA 4CUBA 4FI9A 4BK4A 1KGYA 4BDVB 3K46A 3MUZ1 3MV01 2DCKA 3GM8A 3SEPA 3HNBM 4CU9A 2E33A 4ET7A 1K42A 4ZY9A 5FUIA 4XUTA 4OYUA 1JZ2A 1EUTA 4GWJA 4JX0A 2VMFA 5JUVA 4DEQA 3ZM8A 3GDBA 5IFTA 3I2IA 3FHAA 2VZUA 2XONA 4CU6A 2VC9A 3C7HA 2J1RA 3VD5A 1GOFA 3I3BA 2VZRA 2WABA 3OBAA 1NUKA 4Z2AA 4QPWA 1US3A 1WKYA 3WNLA 2OKXA 2WN2A 3K77A 2ZEZA 2J1EA 3I2JA 2EICA 3EB7A 2W3JA 2HLEA 5B4NA 4TXWA 2XQXA 2BERA 1SHWB 4UOJA 3LPGA 2W1SA 1T2XA 3NJXA 1O8SA 1GMMA 1KEXA 2X09A 3UETA 4DXRA 3E1F1 2W9XA 4ARXA 1OH4A 4OMCA 1UYZA 3A7QA 3I2KA 3VDBA 2VQUA 3FN9A 2PQSA 4KMQA 1TVGA 4P08A 1IQDC 1PX4A 2V5DA 3VD3A 1OF3A 3ETPA 2J1SA 3IAPA 5G05L 3ABZA 3I2GA 4PF1A 3CDZB 3K4AA 4XUPA 1W8NA 2VZOA 4QDRA 5C7GA 1O59A 2ORXA 5C71A 1UY0A 1JYXA 3WEZA 1DP0A 3ACGA 4BXSV 3CZJA 4P02B 3THDA 1JYVA 2VZTA 4A41A 2VZSA 4E8CA 1GQPA 2VZ1A 2VMDA 1HN1A 3WQBA 4L0PA 1UWWA 2BBAA 3ACFA 3I97A 2XHNA 4JKKA 2VR4A 2YC2A 1UY1A 4QX2A 4QAWA 4A44A 2VZQA 2J1AA 1W9TA 2WAOA 3T0AA 3IB3A 4XUNA 1YQ2A 2QQIA 2DCJA 5J1XA 2QBXA 1XPWA 2W92A 1JYWA 5B4XA 2J1TA 1W9WA 3BN6A 1UXXX 2VZPA 4CU7A 2VCAA 5LA2A 3OGVA 2VZ3A 1F4HA 3DYMA 1GUIA 2DDUA 3SKJE 5IYYA 3WNOA 4A6OA 5LA0A 2YB7A 5F7UA 4CUCA 4ZZ8A 3OEBA 1UMIA 4OMDA 4RYDA 1JZ7A 3I2HA 2ZXQA 3VD4A 3EYPA 1H6YA 2BZDA 4P5YA 2VO5A 2J1VA 2BGOA 1OD3A 3IAQA 2Y6JA 1D7PM 3C8XA 1L7QA 2E32A 1GU3A 4XVHA 3T08A 3CZUA 1JZ6A 5JXHA 2JD9A 2J7MA 3HPNA 4D0QA 4QX1A 4KWUA 5EJ1B 1W99A 3PUIA 3C7GA 3HNMA 5A1AA 4JHZA 4ZZ5A 1UX7A 4CU8A 4DUWA 4CUAA 2J1UA 2ZEXA 1K3IA 1NKGA 3LE0A 5I0DA 5HPOA 5IFPA 5JXIA 2B9VA 4XUQA 4DUVA 2VQTA 4A4AA 2CDPA 3UESA 2VJXA 4OUEA 3LQCA 2CDOA 1UY2A 3K4ZA 2WO2A 4LQRA 3C7OA 3WF4A 1RYYA 1ULPA 2Y6KA 3OGRA 4RN5A 3OG2A 3WF1A 3OEAA 3DECA 2Z4FA 3ACHA 2W91A 3HN3A 5DN2A 1MPXA 3IIIA 4QX0A 2BGPA 5HXMA 3I2FA 4PQQA 1L7RA 2EIBA 1K45A 2VCCA 4IUGA 1CX1A 3CIHA 2VCBA 2WDBA 2EIEA 4UI9L 4MGSA 2YG0A 1NAEA 2JE8A 1W0NA 2WZEA 1PMJX 2EIDA 2X05A 3P1IA 3P6BA 5EIYB 4W8JA 3CQOA 3W5NA 3LEGA 3AC0A 4XURA 4BJ0A 4KI5M 4DUXA 4ARYA 1W9SA 4TTGA 2ZEWA 2E26A 1US2A 4QB2A 2RVAA 3K75B 3GGLA 5CZKA 4XUOA 4P00B 4XZUG 2HYXA 4DEVA 3JXSA 3LPFA 1JU4A 1OT5A 3MUY1 2VMCA 1LNSA 1UYYA 2X10A 3HNYM 5CYYA 1J83A 2RV9A 2W47A 4JKLA 1JZ8A 4UAPA 3CKHA 2JDAA 4LKSA 2VM9A 2YC4A 2Y6GA 1CZSA 4E8DA 4ZXEA 3LEKA 1JU3A 3K4DA 4LPLA 1PX3A 4QB1A 1SDDB 3DYPA 3T09A 2QQMA 4QDSA 3WNNA 3MBWA 5DQ0A 4W50A 2E31A 2WUHA 1CIYA 4QB6A 4M4RA 3T2PA 3C7EA 5C70A 1R64A 4MADA 5LCWL 3C7FA 3T2QA 3OB8A 4W4ZA 2WBKA 3LEIA 2QQNA 1O8PA 1PMHX 2W1QA 2L9LA 1XNAA 3W5MA 2VL4A 2VZVA 2V4VA 1F4AA 2VTFA 3FHQA 2Y6HA 5LA1A 4QX3A 2W94A 1UY3A 5JMOA 2WN3A 2ZEYA 1CZVA 1CZTA 1JZ5A 1EUUA 1JHJA 2Y8KA 2ID4A 1UXZA 3F2ZA 4AAXA
chains in the Genus database with same CATH superfamily
1FOD2 5FLJA 5A7WA 1EY2A 1H1IA 2W1UA 3A0KA 3D0JA 3HQUA 3Q9OA 1PZ7A 4QX5A 3P3NA 3VDCA 1UYXA 2QCSB 3V0AA 4A3ZA 1WCQA 1N3OA 1RINA 3TN92 3B9CA 2ZA9A 2R042 4WZFA 4CDUB 1LB2A 5JXGA 2FDGA 4GKXA 2PLV2 4JGYB 3BU7A 3JB4C 1B35C 1EP0A 1HRV3 1K5MB 1ZVFA 2D7FA 2JDPA 4XXAA 4DXZA 4M4PA 4BQ5A 3AYCA 2OW4A 5GALA 3UGGA 3ZN4A 3IDBB 1JXNA 1H1MA 1BCXA 3OBRA 2E6VA 3WNPA 3NV3A 1Q56A 1VBE1 3T2OA 5BNNC 5D8AB 5FUNA 1PGW2 2YGLA 2I74A 1MVEA 4AHWA 2H0BA 4H2AA 4LA2A 3SLIA 4FAGA 1S0EA 1KQRA 1OVPA 2JEMA 5FZIA 5J09A 3HJRA 1D4VB 3B5LB 2FDJA 2FZ1A 2IFRA 3H3LA 4XFGA 3VKOA 3SEEA 3WVJA 3I2OA 2K9ZA 3RWNA 1URXA 4IEUA 1S0JA 5FWEA 3RI9A 5FYTA 1A6CA 3KCYA 3WW2A 4YZ4A 4MXVA 3T0DA 2JDYA 3I3DA 2GC2A 5GLTA 2WO3A 3R4SA 4FPLA 2OQ6A 3GZAA 5T55A 1Y4WA 3TRSB 4AEDA 1PGL2 2WO7A 1VRH3 3WQ7A 4LBOA 1XNTA 3NL1A 4CCDA 2FD8A 4IEPA 3S5QA 3VBOA 1DCSA 3TOJA 1JOBA 2W46A 3G7DA 5DPNA 2R0HA 2LS6A 1Q43A 1QJX2 2YFUA 1GYKA 4NAOA 3DV8A 3UKTA 4C0BA 4ISQA 1W6PA 1KD7A 4XPVA 4B8EA 3BOPA 3FBMA 3GBFA 3I3EA 4EE2A 3WNKA 2FDFA 1VE0A 1VIWB 3WUDA 3ZXLA 5ACA2 1UW8A 1WCKA 4FCAA 3ZDVA 1UKRA 2Q1ZB 5C33A 1O3RA 3RMYA 1RHI3 2W1WA 2CU5A 4P9YA 2WA3A 1UX6A 1SQ4A 2IVJA 2WQ4A 3FWEA 1T6GC 4XJ9A 3GBWA 3N9PA 4ZONA 3T1MA 4YG6A 3UNPA 1HJGA 3RG0A 4QPYA 1SLIA 2JG8C 5C8CC 3KSCA 5A3LA 4U2AA 3N9NA 1XYNA 4XFAA 3JBG3 1O5UA 3CMGA 2ZGRA 5IT6A 1A8DA 4HOOA 2JE9A 3N7KA 3LZZA 5DAPA 3I4IA 3WF2A 2JKXA 1VAVA 4PLMA 3MIEA 2EA7A 5JOXA 3KWVA 1VMJA 5FZAA 5LK5A 2BYVE 1RUH2 2AR6A 2BOJA 3W9AA 4UBHA 4FSJA 3GZUC 1YRZA 3IZOA 4QKBA 2FCTA 2E9QA 3ZFEC 1POV0 4JVAA 4H7MA 3SXWA 4ATEA 3AL6A 1AR92 3ZXAC 3NV1A 3MPBA 3V0BB 5FUPA 5G04L 4I01A 1ZRIA 2PLV3 4RA0A 3AP5A 2HWB1 5EZWA 5FY4A 1UU6A 1Q8PA 1QOSA 3PURA 2NP0A 2WSUA 4OZOA 5F5QA 3OTFA 4MZUA 5A6YA 3IIAA 2YY1A 3O1MA 1H8TB 4HZFA 5CA6A 2ZTNA 4FI9A 1KGYA 1BVP1 2ZX3A 2V4AA 4GKYA 4BDVB 3MUZ1 3MDPA 4Y1XA 5E8AA 4NRQA 4D6SA 4OHZA 1WMFA 3VBRA 4Q4W2 1AR72 2DCKA 3JD71 1AYM1 4CU9A 1BK1A 4XJ8A 3ZN6B 4ZY9A 4LO5B 5FMOS 4XUTA 3VBRB 5FIXA 1W0OA 4XAEA 1MEC1 4JX0A 2ARBA 2P6HA 5BNOC 2VMFA 4CCCA 5DZGA 4OI1A 1TME3 4MVTA 3X29B 4DEQA 4AAPA 2ZHKA 3GDBA 4XFCA 3I2IA 4Q4X2 3OCPA 2UWBA 4Y5Z0 4K8RB 2YGMA 3VD5A 2JWPA 2GSYA 3OGJA 1DGRA 1QEXA 4H14A 4XJAA 3VHNA 4AI8A 5C5UA 4HLTA 1NA1C 2XJTA 1EAH3 3ALQA 4COWA 2OQ7A 3FUQA 2B45X 3OBAA 3ZFFC 1W2UA 4QPWA 4OQ9A 3AYEA 3HD8B 1Q5OA 1JBCA 1SLAA 1ASJ3 5FPUA 2WN2A 2C1FA 1SBDA 1FMD1 1QJU1 1RUD1 1RVF2 3KCXA 3MEPA 3CLPA 4K1ZA 2W3JA 2XBO1 2HLEA 3H7JA 3POWA 5FK8A 3SCHA 3MIDA 2GP5A 4TXWA 3WT3A 2BU9A 3GBGA 4CEYA 1HX6A 3T30A 4D69A 1EYBA 4FFIA 1SHWB 2ZABA 3TAYA 3WP6A 1SFNA 5FZFA 4ONUA 4E4ZA 1GMMA 4BA6A 2YC0A 2DUPA 2VW0A 2Q4SA 3B94A 2W9XA 4IL7A 5FPAA 1OH4A 2JICA 3AVSA 5I0SA 2BWCA 1I9RA 4UFLA 5I91A 2AC1A 1O4YA 3CU7A 2Z79A 2XL7A 4Y5SA 3KT1A 3R0RA 1AX1A 5FREA 3RYPA 3VDBA 1GWLA 4KMQA 5KR7A 4K3UA 1PX4A 1S0FA 4QQOA 1ND3A 4GD4A 3KD4A 5J48A 2VW2A 1HRV2 4PIZA 2D44A 5G05L 3TEXA 5CFDB 2BRTA 2R1BA 1PIV3 3K3NA 5LA9A 2K0GA 2PN5A 4RL7A 5LB6A 2C0ZA 3S6PA 4YARA 2D97A 4XUPA 4UF0B 2RJLA 2WNVC 4G3YC 4UBGA 5FKBA 5C7GA 2ETEA 4BQ1A 2ORXA 1UY0A 1WCDJ 2ARXA 4R9BA 4CP1A 1UOGA 3WEZA 4LBQB 2GNTA 4QPGC 2IXCA 2VZTA 2OXBA 2P6CA 1NLRA 1FATA 4YVWA 1GQPA 4Y20A 2VZ1A 1UYPA 3VV1A 1CN1A 5F2SA 3VBSA 3E6CC 2PA7A 1ACCA 3IDCB 1NLSA 2YROA 3ZFGA 3ACFA 1LENA 4UT5A 5L19A 4IV1B 4AGVA 5AVAA 1RTVA 2VY0A 3DF0A 1QIQA 2YC2A 1XB9A 3VZNA 4QX2A 1H30A 2RDQA 4N90A 1W9TA 4Q4Y1 2WAOA 2BP6A 2ZKNA 1IS4A 2FCUA 5HCHA 1YI9A 4O9EA 4JGZA 1O3SA 3WLUA 5AC93 4IV1A 5FMBA 3NWKA 2E7TA 2VBDA 2E51A 4WZCA 1MZ6A 1AR61 2RS51 2QQUA 4ATFA 2C9AA 3R6SA 4KQ7A 1W0PA 1Q8SA 2DTYA 2OA2A 2JDKA 2VE1A 4GMP1 5B4XA 1ULFA 1KRIA 4EJRA 3PUQA 1LGCA 4GMP0 3V0AB 5BNOA 2FDKA 1R092 1C8M2 5BPXA 1G9BA 4J1WA 1HXS2 4CU7A 2BV4A 5HV0A 5LA2A 4GA9A 4R9AA 3DYMA 1H8VA 1MEC3 4JGZC 4QD2A 3THPA 2DDUA 3D0SA 2V5YA 4XOGA 5KXCA 1HIXA 1W8FA 2AREA 2RDRA 2VNOA 2XKOA 3ORJA 1W2OA 4HVRA 4PDWC 3OYWB 3ZYFA 3ZVXA 4E4HA 3NJYA 5LEJA 1J58A 4A6OA 5LA0A 3T1LA 4YM1A 1JHNA 4NRPA 4HANA 3OEBA 4QXBA 1UMIA 4OMDA 4Q1PA 5F3EA 3ME2A 4RYDA 4AQ6A 5J3UA 1JZ7A 4YM3A 2ZXQA 3VD4A 1H6YA 1WBFA 1IOAA 2VTXA 4XFFA 4BLIA 4XF0A 4LTAA 3OBZA 4WVMA 1MQTA 3C8XA 3S7IA 3WZ1A 1UIJA 1G9AA 2E32A 5I8SA 2ZX2A 2CL2A 2V09A 1XSQA 3LSEA 3OOXA 4LBKA 4QMAA 2ZX4A 3FLTA 1LHNA 1UPSA 4XF1A 5FY5A 1OBNA 2Q30A 2QNKA 3T4HB 1GZ9A 4RQPC 2J7MA 3JQWA 4QKNA 4D0QA 4ITCA 5FYYA 1SCRA 5JZGC 3A0NA 1ALYA 3OYWA 4K21A 2A3YA 1UU5A 1E57A 1DZRA 1Q8OA 2O8QA 3AYDA 3PUIA 3C7GA 1UQXA 4IETA 4Q0SA 4ZHNA 3MICA 1ASJ1 1RUC1 4CU8A 1O3TA 1BXHA 1S4CA 4CUAA 1G8WA 4LITA 3P5BA 1K3IA 3WCRA 1UKGA 4QGNA 3WDWA 1GZCA 4CDQC 3E97A 4FOWA 2WLPA 2Q8EA 2B9VA 4NJ4A 3VBFA 4COYA 5FP3A 5JXIA 1PK6C 4NIDA 2CDPA 3VL8A 4YZ1A 4XC9A 3UESA 2WS92 4BQ4A 3IMNA 3FFQA 5FY0A 2VQ0A 2BNOA 5FXZA 2CDOA 5FYBA 3GYDA 3P3PA 1LEDA 5FYZA 2A75A 1XRUA 1CX4A 3WF4A 3BYWA 1W6MA 2PQQA 2H0VA 2Y6KA 1TMF3 5DUUA 4AFMA 4FBFA 4RGKA 4JGYA 4KBZA 3OG2A 4YNIA 1YYNA 4DMIA 3NKTA 3BUCA 3OEAA 1AXKA 3DECA 5JOYA 2BPA2 3FMGA 2OZJA 4W65A 4UYBA 1XXNA 1ZBE3 2Y60A 1ZZ7A 4D6RA 1QJY2 1SACA 4CDUA 5DUWA 2JIJA 1V00A 1LTEA 1MS9A 1UIKA 2PHLA 4M00A 4PQQA 4YWAA 2VCCA 5ERLA 1YFXA 2CYFA 3VHPA 1NA1A 5ISLA 3ITQA 3TEYA 2FHRA 3TYJA 2BNNA 2WDBA 3BTAA 2PMWB 2R073 2ZMKA 2Q5TA 2EIEA 3LDBA 4R4XA 2G9GA 4ZS2A 3NNJA 1RUJ2 3HQXA 2HWE3 3QOPA 1H8TC 5FPZA 4UFHA 2JE8A 4DS0A 4F3JA 4SBVA 4LBQA 5C5TA 2WNUC 2ZGTA 2UWAA 1LRHA 4QX8A 1Z7S3 5A7PA 4BE3A 4BB3A 4RHV1 5FXVA 4EN8B 4EWDA 5FPBA 1VP6A 4BISA 3VB9A 3AC0A 2P3YA 3ZFGB 1NG0A 4HVQA 2ZACA 4KGQA 1E5SA 5FO7B 1R1A1 4YGDA 4D6QA 3LIGA 1W8TA 2D3PA 5F1RA 4H55A 1XYOA 4CDXB 3K75B 3GGLA 2IWGB 3M3QA 5FZKA 3OJBA 5FPXA 2GC3A 2R30A 2ZGSA 4P00B 4W6YA 4XZUG 3VZLA 1VRBA 1LOAA 3JXSA 2VPVA 1JU4A 1WD4A 2B42B 4RGAA 1CQ9A 2X10A 1RMU3 2VTXJ 3ZYJB 1J83A 3AMMA 5I93A 3FZ3A 3VBUA 1UPIA 3IN9A 5AC91 3LF7A 1PM7A 2JDAA 4LKSA 3ZYHA 2VM9A 1DQ5A 2Y6GA 1CZSA 1WA6X 3H42B 4BM8A 1EAH1 1D2SA 4DINB 1JU3A 3O1TA 5FYHA 4NHYA 5FYSA 1JUIA 1CAVA 1H4GA 2GAUA 2WT0A 4JDOA 4DY5A 3DYPA 5I8YA 1ZZ8A 2QQMA 3LWCA 3KV6A 4JQTA 4QDSA 4C8DA 3MBWA 1MZ5A 4LBMA 5DQ0A 2E31A 2XDVA 2WS93 3PJYA 4Z1VA 3RZJA 4M4RA 1ZBA3 1RHI2 3MW3A 4YW6A 4R52A 4L9BA 1SMVA 1U0AA 2MPFA 2OVUA 1RUG3 5DG1A 4PF5A 5C8CA 5KHIA 3R05A 4QKFA 3AFKA 1SFYA 5GLWA 3KZ4C 3FX3A 1O8PA 5KWRA 4LIVA 2L9LA 2PFWA 1XNAA 3W5MA 1WA4A 4FOVA 1F4AA 3HQRA 4M0HA 3DN7A 2VTFA 4QXKA 2V73A 4LO4B 3U07A 3WW3A 3J7NA 1J3PA 3ASIA 5DAXA 4CXYA 3U4SA 2Y0IA 2OPKA 4LNVA 1CZTA 1YCIA 1Z0HA 4CCJA 1TMF1 2DV9A 3R4DB 4GJYA 4IV3B 1TNRA 4Q0QA 1GNHA 2JB4A 1W03A 1V6NA 3WW1A 5C6CA 2NYYA 1ZBE1 5FO8B 2RR13 1S0GA 1J3QA 4QU2A 3WP5A 1ZBA2 5FYUA 4RS5C 4XJUA 2QQJA 4OI2A 4AAXA 1NY72 1U5XA 1MS0A 2Z69A 3ACIA 5K0UC 3FL7A 4AVBA 1AR62 2VULA 4JV4A 1PVC1 1E5HA 3ZXKA 5CG8A 4N53A 1BKZA 2YBSA 5HCAA 5JPMB 1P8JA 4KBBA 4OHWA 4XIOA 1JYNA 2TUNA 3HBZA 3E6BA 4E27A 3ILFA 2R061 2SLIA 3ECQA 5CFCA 1V6MA 2WIIB 4AI3A 2KR2A 1M4WA 4HN1A 4Q5OA 4N7IA 3PTYA 2VMEA 3I54A 3DKWA 1Q3EA 1BBT3 1OSGA 1GKBA 1RUC3 3HEIA 5GKAC 1MS3A 1HRI1 4S2DA 2IC1A 1UY4A 1RITA 1DDLA 1O4ZA 2C24A 1SLLA 3CEWA 3DPRC 1XNBA 2I2SA 2UYBA 3A23A 3KQ4B 1UAIA 4D8MA 5EFUA 3V0BA 3WHTA 2A6YA 2Y6LA 3H1MA 4BK5A 1SZBA 1C1LA 1VB4A 3I7DA 4NPRA 1WLDA 1G9DA 1PM4A 2D6OX 3A21A 3N7JA 1JZ3A 3AJYA 5K8SA 1OVSA 4QDQA 1GP6A 4LOSA 5DDJ2 3RGBA 1X36A 3WDVA 3POFA 3U37A 5FO9B 1GOHA 1VMFA 1R081 1SLTA 2ZAAA 4CE8A 1TNFA 5SV8A 2PHDA 5KC5A 2WT2A 1W6NA 1HRI3 4AFAA 4OZXA 2XHKA 4PDWB 1YIPA 2KA3A 4XXPA 4AEDC 4DB5A 5JVVA 4BQ2A 1X50A 3VBOB 1BHGA 2QUOA 1BMV2 3I3QA 4FOYA 1GQHA 1IS3A 1HV1A 1U5IA 3HOBA 1MQTB 1UOJA 2A71A 2VU9A 4YW3A 1DLCA 1VRH2 4FP2A 4HSLA 5JIAA 2LRPA 5B2GB 5DMYA 5FQ0B 4PQ9A 3CJIA 2WQ8A 1SG3A 2CWMA 2WYFA 4FAHA 1YFUA 2A1XA 4FFFA 1UF2C 3CJIB 1OA4A 4MO3M 3RS6A 3MZHA 1NQJA 3ATGA 1V6IA 2CTVA 5FZOB 1WCUA 5KXDA 1NXMA 1R082 2XVKA 1WMEA 1RVF1 2J22A 1FNZA 1RUG1 4AQ2A 1PIV2 4XTMA 2XMLA 1YNAA 5DDJ1 4COZA 1BEV2 2IXKA 1B35A 4YZ2A 1DYOA 2OUHA 4IW3A 4LIUA 2OIIA 2BEOA 5I0RA 1LCLA 4W6WA 1SEFA 2DWRA 1W6NB 5D8AC 1OF4A 5CKNA 4JKMA 3ZXFA 3VD9A 3PVNA 5IK8A 4E9KA 3NNFA 3PVOA 4AGRA 2FQPA 1XC6A 1JODA 3PJQA 1WW5A 3PTRB 2WAAA 3VBSC 4LBLA 2WYSA 2XWBB 1DGWX 2EALA 3PUAA 4CUGA 1JH5A 1GWMA 5JR2A 4P9WA 1OXCA 4MGTA 1PK6B 5D8AA 2ORZA 4GWIA 3IT8A 4QPIC 3THCA 4CUBA 4LT5A 5D21A 4XQDA 1ST8A 2Y33A 3JD72 2XVGA 2F4LA 3PMSA 2W08A 3POGA 3UGHA 1CAUA 2VUCA 2UWCA 4KWJA 2GNDA 1LAJA 1CESA 4OHVA 1CD3G 1PVC2 1JYIA 5FUIA 2VVDA 1JZ2A 2RS32 1EUTA 3A4UA 1DU3D 4I02A 1RB8G 1NZIA 1QHDA 4F83A 4NIGA 4W6XA 1CAWB 2Q1FA 1F15A 3ZM8A 1XYPA 1LOCA 4DO0A 1N1VA 1RUE3 5IFTA 2HJIA 2HWB2 3GZTB 4XE9A 4NAMA 2XG3A 3AZYA 3FHAA 5JWPA 1HB2A 3ZIXA 1AR91 3IM0A 2XVLA 1LEMA 5AVPA 2JG8B 1V9U1 3I3BA 4LULA 5L9VA 5F6LB 2ZX0A 3BOWA 4XFIA 4NIIA 2ET1A 4OUMA 5IATA 5F5IA 1NUKA 2GP3A 5CIRA 4Z2AA 3RZHA 3WP3A 2WQZC 1WKYA 1IHMA 3DL3A 3WNLA 1ZA4A 1AR73 4BCUA 3K77A 5C4WC 4JRLA 5A3UA 3ZSLA 4FFHA 3EHKA 2WZR2 3ES1A 4IV3A 2EICA 4N9HA 2WZPP 3EB7A 2YPJA 5IK7A 1YJLA 1MZFA 2X29A 2WKKA 1W8UA 3B9IA 3S5AA 2D3RA 4UFJA 1YUDA 4A2UA 2XQXA 3PLQA 5H9SA 5JR7B 4BOWA 4JAAA 2GC1A 4UOJA 2W1SA 3NAPB 3NV4A 3NJXA 5AFEA 1ZREA 4WBBA 4BMEA 3KV4A 5EYXA 3EMRA 3FFZA 1XNDA 3DPRA 2RM22 4UFIA 2DVAA 1X9PA 3LCPA 5JPNB 1IS5A 1WD3A 3V64A 5KXBA 3GHMA 1O6UA 2R071 1H0BA 3WG4A 1KS5A 2PQSA 3OD0A 2PTMA 4Q4Y3 4CDXA 5J96B 5AC92 1F31A 2A6ZA 3QBQA 2XKPA 5A6QA 1NOVA 1OF3A 4XHXA 4Y24A 1UU4A 2TEPA 2P37A 5EXOA 1RL3A 4L2NA 3KCCA 4H7LA 3WDXA 3ABZA 2EXKA 1TE1B 1ZX5A 3MHZA 4WVZA 3NO8A 5D1IA 1PGL1 3SCFA 1G6NA 3CDZB 3VBRC 2GN7A 1KFXL 1W8NA 3JBG1 1VBA3 3AYAA 4HT1T 4O9GA 3VDDA 3ST7A 5BNOB 1AL23 1VB2A 2O14A 3RSJA 3VLBB 5CG9A 1RXGA 1DP0A 1ULDA 3TWIA 3W21A 4ASMB 3ACGA 4PIXA 3NKGA 4AXOA 2XPJA 3CZJA 2BBVA 1C3HA 1GBGA 1G7YA 4PI2A 2EVXA 4O61A 4RS5A 1R1A2 2VZSA 4E8CA 5CAZA 3BKZA 2IFWA 3F95A 4P9IA 3M3CA 1WGPA 4Q0VA 4AEMA 4IGQA 3AZZA 4FT8A 5DUXA 2VMDA 3SCGA 2MEV2 2NMOA 1C4RA 5APAA 5GZCA 1VBE2 2F17A 5KBFA 4Q8LA 2HWC3 2Q1MA 3FLPA 1SFPA 3ZFFB 4JDMA 3I97A 4IEZA 2XHNA 4XJZA 2WLQA 4QQHA 4XBNA 3ZFFA 2G1MA 1UY1A 1RMU1 3KHBA 2PLV1 5F32A 4A44A 1LODA 1UO9A 2J1AA 2RMU3 4NWWA 2P3JA 4XACA 1CWPA 3VBHB 3T0AA 2XLFA 1GANA 5GLZA 1LHVA 4Q29A 5LBCA 2MHFA 2YXSA 4P9GA 4XUNA 3AMNA 1QH7A 4RS5B 2DCJA 5J1XA 4I3PA 1FOD1 2IXJA 3KMHA 1XE8A 1WLTA 3S30A 4LJHA 4CCLA 4K8FA 1C8NA 4KG8A 4Y22A 4BMBA 1BLZA 1W9WA 2ZGNA 3BN6A 3NVCA 4NR1A 5ANQA 4D7YA 2VZPA 2VD7A 1F9KA 4Q4V3 3SH5A 3NNMA 2MEV1 4YG0A 3UGFA 1O3QA 3OGVA 1I6XA 4LHKA 1FPN1 3PIGA 5JMCA 3Q8BA 1RUD3 1UOBA 5BNQA 5IUQA 5CFDC 2WS91 1AX2A 4HK8A 5FZ3A 1S55A 3LDKA 3SKJE 3OPTA 5IYYA 4G9SB 3KF3A 2DVBA 1JMUB 1DYKA 3MF6A 4GALA 4EYUA 4IQPA 2X5IA 5FY8A 5F7UA 4P9LA 2WNVB 3JBG2 1JS9A 3UV9A 5C9AB 1RUOA 1ENRA 1L7LA 2CGNA 2W0XA 4CDWC 4MUVA 1VAKA 4LKDA 1QWRA 4BPZA 1XJAA 3EYPA 3KB5A 4OULA 2VO5A 2ZX1A 2J1VA 2BGOA 4HONA 4J6GA 5FZ6A 2JENA 3ILNA 2QQWA 3EJKA 3IAQA 4KU8A 2DVDA 2EXIA 1DIWA 3ZFEA 2K46A 1GU3A 3BIEA 4BIFA 3CZUA 2PAEA 1X7NA 1VBD1 4OI0A 3D6EA 5HBAA 3BTZA 3POBA 4M0NA 1JZ6A 5JXHA 3M3IA 3OD4A 2JKBA 3CBNA 1AL0G 4U36A 3LKJA 1RUE1 3J7MA 1LU2A 2WSVA 3RVHA 4X6QB 4XF3A 1CAXB 1FNYA 4YGCA 1PVXA 2VAUA 5EJ1B 4CP0A 2OT7A 3J7LA 1W99A 1OMIA 4RD7A 5F39A 1WW7A 3GNEA 4DUWA 1VBC2 1WMDA 4XF4A 1Z7S2 2WZR1 2ZEXA 4IESA 3WR0A 2AUYA 5FMOL 4XEZA 2DVFA 1LULA 1NKGA 1FXZA 1JW6A 3LE0A 5I0DA 2QQPA 4MGIE 5C3OA 5IFPA 2FBEA 2LTNA 2ZHNA 4B29A 5FYIA 2ZGOA 4AGGA 3AMHA 1ZRCA 1DHKB 4LHLA 5FP8A 3O1RA 1AHSA 3LQCA 1V9U2 2A3WA 1CJPA 2ZGUA 4K9SA 3ZN5A 2WC2A 2GMEA 3WNXA 3K4ZA 4LQRA 4JGZB 2HWD3 3C7OA 4QXHA 4UXAA 4FPGA 1NCRA 1W6QB 1OA3A 5FMCA 1IKPA 3EBRA 1NCRC 2CV6A 1IPSA 3OUIA 5JLVA 3Q8FA 2ADDA 3G6JB 3MFAA 3LAGA 5CU1A 1ULCA 4S2GA 5DN2A 1KDMA 1MPXA 3GJBA 1JYCA 1QOOA 1R083 4AFBA 1OLME 4V2VA 1ENSA 1K45A 1LHWA 4IUGA 3UJOA 4I30A 3MIFA 3ILRA 2VCBA 2XLGA 4UFMA 3VBSB 1DQ1A 1CPMA 4AW7A 3L2HA 3GHNA 4JTNA 4UI9L 1YQ5A 1X9TA 1S1AA 5C3RA 5A7OA 1NAEA 3E5UA 3J8F2 1BBT2 4OHXA 3WQ0A 1UN1A 1H1AA 4K20A 1LHUA 4FFGA 1PMJX 2P2KA 2EIDA 4RQPB 5FV3A 1LOBA 3P1IA 4NMIA 4W8JA 3N36A 4TLGA 3ZR6A 5JAXA 3W5NA 3E5XA 4B4PA 2C6SA 2VGDA 4KI5M 4DRVA 4DUXA 5FKCA 2A7AA 4ARYA 1S2KA 2J42A 2X8KA 4FVVA 2E7AA 2WNEA 4QB2A 2QZ3A 1GP4A 4MHRA 2DUOA 2RVAA 2YPDA 5GLVA 3I49A 3NNLA 4H3WA 2CAVA 1BEV1 3HT2A 3THTA 4TSVA 4CCNA 4CDQB 3RZGA 4DY3A 4DEVA 4HVOA 1RUG2 3LPFA 5A7SA 2AENA 2QFEA 2UURA 3KQRA 4CPBD 5CYYA 1UYYA 3HNYM 1Y3TA 2ZOEB 1Y7BA 2W47A 2JG9C 4B7EA 3O0VA 1ZZ6A 1YC61 2Y6FA 4JKLA 2B46X 4Y26A 4PDWA 4UAPA 5C3QA 4LO8A 2GNMA 4DRRA 2NLRA 2YC4A 5GLUA 2VBPA 5HCBA 3UKVA 2G19A 1XSRA 3LEKA 1Q8QA 1VRH1 4XHBA 3O14A 3K4DA 5LBEA 4QB1A 1C5IA 4PBPA 1QF3A 4LK7A 1I1EA 4WM8B 1BMV1 3RJRA 3PIJA 1LHOA 4FQ4A 4NIAA 1YLLA 2VG9A 3O12A 3POYA 4JHTA 4QB6A 5DZFA 1Y9QA 4OI4A 3U14A 3NAPC 4XMAA 4AVAA 4MV2A 4XDOA 4AYUA 1G9FA 1OLRA 4HL0A 4LE3A 4MYEA 5A3NA 5FQ0A 2XBO2 1R64A 1NQDA 5LCWL 3POIA 1VBB3 3T2QA 3OB8A 1STMA 1HQLA 3BCWA 4W4ZA 2I45A 2WBKA 2W1QA 3JQXA 2BDRA 3LEIA 1ENQA 4I0WB 4M3CF 1YJKA 2WFF3 2DBIA 5ACA3 2WNUB 4N43C 4HKWA 3NAPA 1YQCA 3FHQA 2Y6HA 5FYVA 3VKFC 5C9AA 3KVAA 3ZDSA 1H2LA 1UY3A 1QY4A 5DABA 4YW7A 5FTTC 4HKLA 4AI1A 3ZN6A 1CZVA 2CHHA 3FBYA 2IUWA 2NM1A 2XR4A 4QHZA 3ZFGC 2WRAA 3PMEA 3BU0A 2B5HA 1W05A 4C91A 3H8OA 1V6LA 2Y8KA 3H1WA 3RPQA 3U78A 2KXLA 5F5AA 1HLCA 5LW9A 4ZKTB 4CEWA 1VLNA 4UWDA 4P5HA 5F9TA 1BBT1 2RDSA 4NE9A 1GOGA 3NRUA 3E6DA 4YG3A 3Q8EA 5CKMA 1W06A 1W9FA 3W58A 4MX3A 4NUBA 5L73A 5LEKA 3KV5A 2NQYA 3WNMA 2WWUA 1EPWA 4HSJA 4DNYA 4Q4W1 3WXPA 4AI2A 3NQHA 5DAQA 3GF6A 3OBTA 1UMHA 1C57A 2X5IC 4A45A 2FDIA 4RGGA 3VZMA 1KJLA 1CAWA 1F5FA 2LW8A 2WA4A 3POEA 1V6JA 1J1TA 5FPVA 5IVYA 3BVCA 3CO2A 4B4RA 2LUWA 3WY6A 4IE0A 1MACA 2QQLA 3PVEA 5T5PA 1S0DA 1ZBE2 1LECA 1REEA 3B7MA 1BK0A 2NZ9A 4OLLA 5EJZB 1QOTA 4GH4B 1W2NA 5FY9A 3VKMA 3VD7A 3LGRA 3VBHC 1F2NA 4YW2A 4DXSA 4I09A 2YU2A 2ZHMA 5KHJA 5L9BA 1EPZA 2HBTA 3MLJA 3WX5A 1UD1A 1IG0A 1RJ8A 1RUH1 2X53S 3VUOA 2R7EB 4CEWB 4CPBA 2N7GA 4MOAA 4Z8BA 4CP9A 2RS12 3GXUA 2XJSA 2VUDA 3AP9A 5FK7A 3ZYRA 2C4XA 4G4FA 3N3HA 4MGKE 5LY2A 5T5LA 5BY5A 5JXJA 4PBOA 2AEYA 1J84A 3PDQA 4Q4X3 2W95A 1DGRN 3AK0A 2ZHLA 3LA2A 4R9CA 3W59A 2XQRA 3ZYGA 3U75A 1UCXA 2XJPA 1LOFA 3AZWA 3RNSA 5A3MA 5FZGA 4Z07A 3SITA 1IQAA 1W28A 1ND2C 3VZJA 4IV3C 3S57A 2E53A 1A8MA 1W04A 3IDAA 2QQVA 2VNGA 3RJ2X 4BIOA 2GDFA 2RE9A 4MXWA 3KHCA 2QTWB 5HXVA 2RS53 3WF0A 1ODNA 3O1OA 1S0IA 2JB8A 4CA9A 3RZKA 1VBD2 1OQ1A 2DCZA 4XAAA 1H2NA 2R0FA 2G9ZA 5FZOA 5FZ0A 5K0UB 4FTSA 4AF9A 3M3OA 2FMDA 1LGNA 2QKDA 4J1XA 2GNBA 3U0ZA 5T5JA 4I0AA 1DG6A 3HMYA 1W8OA 2VXJA 4IE6A 3A22A 2QJVA 2VMGA 3MO4A 2VCMA 4HG6B 4INDA 1I5PA 2A6XA 3VBFC 4CDQA 4IGPA 1UZ0A 5FXXA 5FJKA 1GZWA 2JECA 1LESA 2RG4A 4XMIA 5F5CA 2HEVF 1XE0A 2PHTA 1DGLA 3H8UA 1FI2A 3O1VA 4DQAA 2KD7A 2XL9A 2ZKLA 3NJVA 3HAGA 4OCTA 4FPOB 2LROA 5LWBA 5K9YA 4GZ9A 3ZKYA 4A7ZA 1CGPA 4PT6A 1VJ2A 5KHGA 1DQ6A 2WO1A 3TBDA 1Z78A 2HEYF 5SV5A 3Q8AA 3N9LA 4HK9A 3E5QA 3K2OA 3VZOA 4RQPA 1FPN2 1SLCA 1SDWA 5FZDA 5ANNA 4TN7A 4LMFA 4YPJA 3KLSA 1KJRA 5IJRA 3VDAA 5GM0A 3WCSA 4RHV2 2RS33 2B4KA 2ZGMA 2WFPA 3J7HA 3SKVA 2FDHA 1I3HA 1ODMA 2OX0A 1OHFA 4BWOA 4LKFA 3K48A 4BK4A 4CXXA 1RJ7A 4WM7B 4GQ7A 4KWKA 3JU9A 3AP4A 1WUVA 2JX9A 5C4WA 4URTA 5IVCA 5FZCA 3GM8A 5FMDA 3SEPA 4CZSA 3HNBM 4BQ3A 2E33A 1RMU2 1K42A 3O5SA 3AX4A 3N7MA 3DEMA 1NCRB 1FV3A 2QE3A 4GB32 4OYUA 4YLZA 5EPAA 1J59A 2ES3A 5TSWA 4OUSA 1PNGA 1DQ2A 1WZXA 5F8PA 5CFCB 3L9JT 1OOPA 1OPOA 1WLWA 3AMPA 3B01A 2VZUA 2YYOA 2Q8DA 3GCXA 1OUXA 3HN1A 3ZSJA 2VC9A 1E5RA 1WMXA 2A3XA 4GWMA 3BPZA 4J25A 1GOFA 3CJIC 1Y9GA 4QM8A 4ASLA 2VZRA 4RFRB 5FP9A 1US3A 4DFSA 2OUJA 4L97A 1LJ7A 2ZEZA 4LORA 2J1EA 1HDKA 3QH6A 1C8M3 5L36A 1OLMA 1RUC2 1ZM1A 2BNMA 5IVBA 2G4IA 2AEZA 5JSOA 1MR5A 4QPIA 3M2MA 2AACA 4N7UA 4MGZE 5E6HA 5FZHA 5A33A 3LPGA 1T2XA 1O8SA 3JD73 2X09A 5T50A 2IXIA 2R072 2AGSA 5E1RA 2ATFA 1QKQA 1KDKA 5JIUA 1VALA 4OMCA 1UYZA 4YVWC 2RM21 2YV8A 5DUVA 1UZWA 4Q8KA 3KVBA 3A7QA 3I2KA 4FP3A 4QPIB 4WM8A 2VQUA 3FN9A 2R6QA 1TME2 1LKNA 2PHXA 1TVGA 2VUJA 2RMU1 2WNOA 4P08A 5BNPC 1ENXA 4QGMA 1TQ5A 2O0OA 3VD3A 3TEZA 4EV0A 4XIKA 3INAA 4LUKA 3IPVB 5EV7A 2J1SA 3IAPA 3B02A 4Y1ZA 4R9DA 2ENRA 5F3CA 3K4AA 4NROA 2JIGA 3PU8A 2VZOA 3KGZA 1V70A 1O59A 2PAMA 3AB0A 4BXFA 5C71A 3ZX7A 3AXEA 1JYXA 3ES4A 4WVMB 4IXLA 4BXSV 1NLQA 1JOJA 3B3QE 3THDA 1NCQB 3PL0A 4PI0A 4FPHA 4A41A 3JZVA 4X8PA 3DXTA 3IWZA 3BALA 5FOJB 2ZMNA 1K5JA 4Y22B 3BIWE 3KF5A 3H0OA 3O0XA 1R093 1W39A 1DF0A 2WWJA 1JUHA 2YBKA 3B93A 4BYYA 1W90A 5JOZA 1W6OA 1R091 4META 4UW5A 3T4VA 3GJAA 5I0UA 5JOWA 1AR93 4RFT0 4TYSA 4N43B 2BBAA 2GH8A 3AP7A 4K7JA 5FAXA 1S0BA 5FLHA 4AZZA 3GZEA 4GH4A 1LOFC 2EXHA 1AF9A 4IEVA 2VR4A 1C28A 2RS31 2W68A 5ABJA 5C4WB 1HQWA 1QQP1 4QAWA 2VZQA 4ZU4A 2JDZA 1GNZA 1W2AX 2SBAA 4P9XA 4Q4V2 4XBQA 4DIQA 1QQP3 4XBLA 2CGOA 2BQPA 1A3KA 4QHOA 4ZU5A 1TEIA 4ASKA 4Q4Y2 3OSDA 3M3EA 4AE2A 2QVSB 4CCOA 2HKXA 1FX5A 2PXJA 3T3YA 4NIHA 3IB3A 3KT4A 3TB0A 5LRRA 1NZCA 1VBB1 4YM0A 1GQGA 1AYN3 2QQIA 1MS1A 1VBD3 4C0HA 4E4DX 2QBXA 4N53B 1XU1A 5FBJA 2FZ2A 4YM2A 5DZEA 4KWLA 4PLOA 2EXJA 2RS13 2J1TA 1GLHA 1PO12 1QGLA 2MEV3 2MNGA 4LO7A 4UF0A 1ZRFA 1COV1 4JRAA 3VKNA 1AJOA 2VW1A 2P1BA 4QQLA 3D8CA 5FZLA 2TBVA 3OUHA 3GALA 5J7MA 3DGTA 2CSGA 5FR3A 1OFSA 4IEYA 5A32B 4DZGA 4EWEA 3EQEA 4Q2FA 4L99A 5H9PA 3WNOA 4KU7A 4D7SA 5M0TA 4DOUA 2YB7A 1W6MB 2WL1A 4MHUA 4CUCA 1PIV1 3J9SA 1EV11 2UY8A 5E89A 4NPMA 3I2HA 2VBBA 2ZJCA 4RR3A 5BYNA 1YQ6A 1OD3A 4LO6B 5K0UA 1IS6A 2WJSA 1D7PM 4CEWC 4Q26A 2R49A 1HN0A 4RHV3 2LM3A 3O1SA 1RUNA 2Y26A 3VDDB 1ZZCA 2CAUA 5FP4A 1U12A 2D5FA 1OPMA 1QJZA 4JQRA 4FPYA 2GN3A 4LKEA 3FHIB 2HYKA 2RJKA 4R8HA 2JD9A 5F2WA 4NPLA 3I2DA 2XGXA 1YFYA 3WUCA 4P9JA 1PZ8A 3ZSEA 5KHKA 3RDIA 4QX1A 3MW2A 4KWUA 4AI0A 3FJSA 1DQ4A 5FY1A 3O1PA 1ND2B 5IK5A 1WBLA 3O1UA 4KG0A 5A32A 2HWF2 4B1LA 3R4UA 3LD8A 3H8RA 3OY8A 4JHZA 2D5HA 4ZZ5A 1Y43B 2I07B 4AFCA 4Q27A 3URFA 1HB3A 1RUD2 3TNPB 2W52A 4B4QA 4X8NA 2BFUS 1J3RA 4HFSA 5HPOA 3ZMNA 2JG8A 4E2GA 4XUQA 4EN9B 2VQTA 4A4AA 1PZ9A 1AR82 4CEYB 2GZWA 3WG2A 4I2OA 2F6BA 5CB7A 1D4M2 3CJXA 4QWNA 1O91A 2K2SA 4TZDA 5FZEA 5EQUA 3JCIA 3HR9A 1UY2A 1HRI2 2P4EA 5T5OA 2TNFA 3HWJA 4Q4X1 1AVBA 1RYYA 1ULPA 3AZXA 3LA7A 1ULEA 2DURA 3U1XA 2XB6C 3LOBA 3ELNA 2YU1A 3OGRA 4Q0PA 4RN5A 1BEV3 1RVF3 4EZHA 1GWKA 3WF1A 2Z4FA 3O7OA 2PHRA 4IE5A 5E16A 4EN0A 5C9AC 2W91A 3HN3A 3SQOA 3IIIA 4C90A 1SPPB 4QX0A 4CDWB 2R062 1AYM2 4PCRA 1W6OB 2B7YA 3ZKUA 2ADEA 4KH9A 4YW4A 3VKLA 5FYCA 3ZXEA 3ZIWA 3NSTA 1PK6A 3D5OA 5FZ7A 1CPNA 1OH3A 2R043 3MLLA 4MGSA 5C3PA 1NY71 3PHMA 2O1QA 2RR12 3H3ZA 3KV9A 1ZBA1 2WZEA 2EF6A 1ZZBA 3AKQA 4WM7C 5ABJB 2ZPXA 3P6BA 4PIYA 2X05A 2DTWA 3RI8A 1GR3A 3I8TA 3CQOA 3OPWA 4QKDA 1REFA 3LEGA 4AHYA 1E5IA 1TMF2 1W6QA 2VXRA 4O65A 1GV9A 1ZNPA 4PLNA 4NHLA 4XURA 4XQ4A 5F6KA 4Z2WA 1B09A 1D4M1 1RXFA 3ZOIA 4A7YA 3GCWA 5A1FA 2OS2A 1N1SA 1D2QA 1W9SA 2JDUA 1AR81 2CNAA 2ET7A 2ZEWA 4JTOA 4Q0UA 4QX7A 3J4UH 1US2A 2ZZJA 3T2TA 1N3PA 3WP4A 4PHZA 4CCKA 5CFCC 1QNWA 3AJZA 5EYYA 4XUOA 1NCQA 2JDMA 1N47A 1QMJA 1N1YA 2XBO3 3POSA 1OT5A 3MLKA 3MUY1 2R32A 4Y20B 1LNSA 2XJQA 3VHOA 1FMD3 1QJU3 1GSLA 4OFGA 4XZPA 2HWF1 5I0TA 3ZXDA 1W6PB 2E63A 3LEMA 3VN4A 3WOGA 1NT0A 1OKOA 4R4ZA 1RHI1 2G9FA 5BV6A 1JZ8A 3MF9A 3CKHA 4FXGB 2QDRA 3MIHA 1B35B 4AI9A 4E8DA 4ZXEA 2NN8A 1QXRA 1K5MC 1PVC3 3IPVA 5A7NA 3MPPG 3S0MA 5ACA1 5BNNA 4LPLA 2PELA 4XYXA 4N8MA 1SDDB 3PU3A 1YHFA 3BODA 4XFBA 3WNNA 4AEJA 1EAH2 5A3TA 2YHJA 1OC1A 5FZBA 2BW8A 4W50A 4Y1YA 1CIYA 1X8EA 2B9UA 3WINE 5EIYB 5FCCA 3T2PA 3ZR5A 2A6WA 3NV2A 3C7EA 4YZ5A 2ZMLA 3SNMA 1SBEA 2E7QA 4MADA 1N1TA 3C7FA 1PHMA 4CP9B 2VOVA 3VL9A 4EWAA 4IERA 1DLLA 1IPKA 5J36A 1EV12 1LGBA 2QQNA 3USSA 5LATA 4YGEA 1OQEA 3D4KA 3KS7A 1OLQA 4XQWA 2VL4A 2V4VA 4LBNA 4HMZA 5KC6A 5BNPB 5EJ3A 1RUF3 2D6MA 2YBPA 4QX3A 2W94A 4BU2A 1K5MA 5A70A 5JMOA 3VZKA 2WN3A 2BGCA 2CY6A 2WZR3 2ZEYA 5CEHA 5A6XA 1IKQA 5LY1A 4KGGA 2IXHA 2JG9A 2Z2SB 1JHJA 1COV2 3EXUA 3S7EA 1Q8VA 3LA3A 1PO23 3LFIA 2ID4A 1UXZA 4XDPA 3RFRA 5A3WA 5GZDA 2D6PA 3F2ZA 1OKQA 1X8MA 3ETQA 4YYOA 3LFMA 1NCQC 2VOTA 3SC7X 1RUJ1 2RM23 4MGYE 4CCMA 1VBB2 4IEQA 4LE4A 5EWSA 3H7YA 1NYWA 3RWKX 1F8VA 3H9AA 1CIWA 4FO9A 4GWNA 1QJX3 4HXCA 2HWD1 5GZEA 1CVNA 3AVRA 5F3IA 3IDEA 3BTYA 4B3NA 5IAXA 3WDYA 5FZ9A 2R041 2FCVA 2JG9B 4QPGA 4Q1RA 3TN91 1NXD1 2W5FA 1ULOA 2YFZA 4AG4A 2C5DA 3AMQA 3VBHA 1J1LA 1QJY1 3HIFA 1F35A 1TG7A 3QLQA 2UYAA 2Z5WA 1DZTA 1V0AA 3M70A 2WZ8A 3WW4A 4CVUA 2P34A 4WM7A 1VBA1 2C26A 2Y64A 5BNPA 1UZZA 2D6LX 5EHDA 2XH6A 2RHPA 5IWFA 3CL1A 4WM8C 1QH6A 2Q0AA 5JI9A 3TEWA 1GFF2 3ZPOA 4DXTA 1XNKA 4AVCA 3OF1A 2LALA 1ND3C 4LBQD 1POV3 1XBFA 4Y1VA 5A1LA 3BTXA 1JZ4A 4RSUA 2AYHA 1Y9MA 2RDNA 1HQNA 2D3SA 3BGAA 4LLOA 4LUMA 1XQNA 5A7WB 1NX9A 3WSOA 4AFDA 3ZO0B 4ES8A 2XOMA 4N53C 2QZ2A 2QQOA 2R1DA 4TWTA 5FRAA 3RRDA 3D82A 3I59A 5CKQA 2ZGLA 1C5HA 4YZ3A 4AOCA 1AR83 5IVJA 3OY8B 4GIQA 4A42A 2AZ5A 4RR3C 3LIHA 2RJ2A 4ZS3A 1JTZX 1GZTA 1ZA7A 4LHSA 3ZLIA 1ND2A 1ASJ2 3IBMA 1RUI2 2HH9A 1CAXA 4KNCA 4NN0A 2PHWA 2EAAA 4E2QA 1AX0A 1V6KA 2ARAA 2DU1A 2VVFA 2JXAA 1U5ZA 1YIFA 2C9KA 2P17A 3OGSA 1IG3A 4F8AA 2RMU2 2HWF3 1K12A 1TME1 1TZOA 5CFDA 1UZVA 2ILMA 4UW4A 1OQDA 4QM9A 5CISA 1U5YA 3ACLA 4MH0E 4NRMA 3UYJA 3WF3A 2V72A 1QXPA 2VH9A 3AXDA 4ZPIA 3ZXJA 4M01A 2R063 4CRQA 1BJQA 3JB8A 3I59B 4NHMA 4FXKB 4MGQA 5L7OB 1UMZA 2A5ZA 2XJRA 5IHRA 4MXWB 1X33A 2P3IA 3T0BA 5L7OA 2JDHA 2DU0A 4FQZA 4XETA 1G9CA 2X5IB 1ONAA 5T52A 1H6XA 4AEKA 2KM2A 5IW0A 5JI7A 4QHBA 4V2WA 2VOKA 5DG2A 2XUMA 2OYZA 3N9MA 1ZRRA 2QQKA 4L11A 3ZXGA 1APNA 1W8HA 1BQPA 1S0CA 1N3QA 3LSDA 3O0WA 2YZ4A 3D3AA 1H2KA 4M3CA 2ZGQA 5GZFA 1KXGA 5FBZA 5H9RA 4A7KA 3MV11 4GH4C 2P5BA 5FZMA 3MIGA 3NNGA 4QXCA 4YSFA 4AQSA 5HCFA 4IEWA 4FPEA 1GNYA 1UNBA 5FDBA 2DBNA 1MS5A 2W87A 1HXS1 4M3CE 1HW5A 1C8M1 4BHPA 5HV4A 1XE7A 3I3MA 4BLJA 2GH2A 5FY7A 3PUHA 4LXLA 4F7ZA 4P14A 2HWE2 1JI6A 1VBA2 1ZRDA 3IMMA 2WFF2 1MS4A 4Y4RA 4B7KA 2BVBA 3DYOA 2NPIA 2RS52 4GB31 3KT7A 3QACA 3K46A 4GMP3 4K6BA 4OVEA 2OPWA 3MV01 4AVVA 2BUKA 1V6OA 2JDNA 3SMHA 2HWD2 2BWAA 4ET7A 2BFUL 4JZRA 4AQTA 2PHUA 4GWJA 2HEWF 4MG2A 4AVTA 2O8OA 1DZQA 2R16A 1F5JA 5CVRA 1BZWA 2D40A 4Z82A 5JUVA 4QPGB 3RZZA 1H8TA 2ZBJA 4I0BA 2DCTA 1W9YA 2XONA 4YRDA 1PO21 4CU6A 3C7HA 4D3WA 2J1RA 1RUH3 4CYDA 4K40A 3VBFB 1AL21 3MYXA 4FOQA 1H4HA 1AZDA 5A7QA 1CR7A 3WDTA 3PVBB 5FYMA 1AUYA 2WABA 3USUB 1A34A 1DFQA 1JN2P 5ABJC 1UL9A 2IZWA 2OKXA 4EN7B 1QNYA 1AXZA 3WG1A 2GMPA 1SBFA 3U4XA 5FLIA 2VNVA 3I2JA 4FPFA 1G86A 5BNNB 4FPKA 3VBUC 4IGOA 5DDJ3 5B4NA 1HRV1 2YMZA 3WD5A 5JDBA 1DBNA 2PHFA 2BERA 1DGWA 4ZU7A 3U10A 2WR9A 5GJ6A 4COVA 1KEXA 1MVQA 2IVIB 2HWC2 1R1ZA 3UETA 4DXRA 3APBA 3E1F1 1WWYA 2BJSA 1AYN1 3MFCA 3DCQA 4ARXA 4OHYA 5IVEA 2Z42A 3SISA 2ZGKA 3K3OA 3J8F3 4YVSB 2A73B 2XXZA 2VQAA 1OOPC 3L2YA 4IEXA 5CADA 3AFGA 3AKRA 2DYCA 4UW3A 4MLOA 1LR5A 2CGPA 1IQDC 2V5DA 3B69A 4L8QA 4IEOA 1PMIA 1LOGA 4BQWA 5IK4A 4GXLA 1FOD3 3WG3A 3AKTA 4E2SA 5LK7B 5HI0A 4QT6A 3ETPA 2WNVA 3RYKA 3FUOA 2XJUA 4WVVA 4HPKA 3I2GA 4PF1A 5D2AA 4AR2A 5F37A 1COV3 2UY9A 1FMD2 1QJU2 1YWKA 3MGUA 5FZ8A 5JSRA 3IKWA 3NMBA 2VOXA 4QDRA 1AJKA 2RS11 4GAZA 3H8XA 1V9U3 2D98A 3BI3A 2VECA 5CNAA 1C1FA 3N7LA 1A78A 1FT9A 2GC0A 4P02B 1HJFA 5C8WA 1JYVA 1FPN3 1D0GA 4X6RB 3UT0A 2ZS6B 4NHKA 3WDUA 4A6SA 4NVPA 1D4M3 1HN1A 4TLFA 1BYHA 4XTPA 3WQBA 3SH3A 4CDUC 3N9OA 4L0PA 1UWWA 1OI6A 2QDNA 4URAA 3V56A 4YW1A 4AK3A 2FMYA 1SPPA 3UKNA 4JGYC 4BH9A 4CDWA 4Y5TA 2VMHA 1QDOA 4JKKA 2RR11 1MEC2 3HVDA 5A80A 1REDA 5A3OA 4XCBA 1FYUA 5JZGB 4N43A 4YW5A 5A6ZA 1RUF1 1QJEA 1XU2A 5DXDA 1HXS3 2A6VA 1AR71 4GB33 4E4SA 3LOIA 3MI8A 2EIGA 3ON7A 1QDCA 3C3VA 1RUF2 1KITA 4NO4A 5JCTA 5GZGA 4DPNA 1BVVA 3PNAA 4IDZA 1YQ2A 3RZMA 1RIRA 3JUUA 1R1A3 1XPWA 2JD4A 2W92A 1JYWA 3CHXA 1KS4A 4COUA 4YVWB 3UL2A 1UXXX 2EAKA 3UJQA 2D6NA 3RZLA 1O5LA 2VCAA 4QQPA 2VZ3A 2YUEA 1S2EA 4AHXA 1F4HA 4FTBA 4HPKB 2H6CA 1GUIA 3B00A 3TNQA 4Q4W3 1VBC3 5JZGA 5LBFA 5LZ6A 3NJZA 1O7FA 3BPSA 2JE7A 3FLRA 3AKSA 4HETA 4PJYA 2WWSA 3RMXA 1VAMA 4QU1A 4D94A 5FP7A 4ZZ8A 3OPZA 1YEWA 2ERFA 3CNAA 1ND3B 5EP9A 2A70A 4V1PA 4YFZA 2BZDA 3DKQA 5T54A 4P5YA 4XFHA 4S2FA 5IVVA 3SH4A 4BQYA 2Y6JA 4QQ2A 3TN93 4LOTA 1L7QA 5C8CB 4FPCA 4XVHA 3T08A 3WV6A 4RR3B 1QJY3 3AKPA 1POQA 1IGOA 5J98B 3VHRA 3DUIA 1D0HA 3K51A 4WV8A 1HKDA 1AYN2 3HPNA 4D7TA 2XJVA 2AH2A 4LR4A 4ORFA 2HWC1 5FZ1A 3C2UA 1CAVB 4ISRA 1QJX1 3USUA 1QXJA 5E88A 1YFWA 2VUAA 1L3JA 3ZSKA 1RUJ3 3HNMA 1OURA 1S2BA 5A1AA 1LOEA 2H6BA 3ZFEB 2ZAHA 2Y0OA 1UX7A 1VBE3 4YVSA 3LB9A 4CDXC 2J1UA 4KL1A 4LK6A 3VGIA 1GP5A 3OGGA 1QU0A 1RUI3 1GICA 5FWJA 1IZ3A 3ZYBA 3ZSMA 5L7OC 1XOYA 3M4FA 4DUVA 3H3UA 1H2MA 4CP2A 4HN0A 2VJXA 4OUEA 1AL22 1KFUL 3N35A 1I5ZA 1AYM3 1W2TA 1WLCA 3ZYIB 1YO8A 1PO22 1RGSA 1NE6A 1PGW1 2WO2A 5FPLA 2B8MA 4GJZA 4UFKA 2OZ6A 3QD6A 4O7XA 5CBLA 5BXXA 5IVFA 1PO11 2Q8CA 4CCEA 2VVEA 3AL5A 1ULGA 2D6KA 4LEJA 3H50A 3UK9A 3WHUA 4HBNA 1SLBA 3ACHA 4AVSA 2B39A 3J8F1 5C3SA 3ZPYA 3Q8CA 4Y33A 3QH7A 2BGPA 1WW4A 5HXMA 3I2FA 2GU9A 2GALA 1L7RA 3MW4A 4XJWA 2EIBA 5T3NA 4OQ8A 1CX1A 1OD5A 3CIHA 5LBBA 4CSWA 1DQ0A 3CF6E 3W20A 4XABA 5DAWA 2UU8A 1PNFA 3POJA 2DFBA 2DFCA 2WINB 1LU1A 1W8WA 4JC1A 4Q4V1 1QQP2 1ZZ9A 5FFOC 1QJFA 4EROA 4HKOA 1VR3A 1X82A 5JSPA 4FTEA 5KHHA 3VDDC 1NA1B 3AM2A 3WQ1A 4WVWA 1XNCA 2XLAA 2YG0A 4Z92B 1SCSA 5FOBB 1T6BX 1W0NA 2WFF1 4GULA 4EZ4A 3OUJA 1OA2A 4M3CB 2HWE1 1JOPA 4N9IA 4XW3A 5DAVA 5FXWA 4AL9A 2Y38A 3NW4A 1HB4A 1UZYA 2PYTA 2Y34A 3HT1A 1HB1A 2ZZQA 4K1YA 4LHNA 1OUSA 2WT1A 3RQ0A 3J26N 4AHZA 5AFBA 1FAYA 5FJHA 5I8TA 3N4MA 1O4TA 3DXUA 1DYPA 2D93A 3QCWA 4BJ0A 2Q8OA 1GZWB 2IXLA 2XWJB 3LDRA 2WNUA 1W3VA 5LASA 4XILA 4YFWA 4BQXA 4QGLA 4TTGA 3AZVA 3ENRA 2E26A 2VNRA 3ROUA 1AXYA 2YDEA 2GMMA 5CZKA 5A3PA 4NOTA 3HBKA 4L92A 2W2IA 2HYXA 3KM5A 2ZCWA 4JCKA 1JYTA 1Z7S1 3M1HA 5FZ4A 1VBC1 4Y3OA 1NE4A 2VMCA 1CONA 2VMIA 4ZXKA 3EO6A 2RV9A 4CEYC 1MS8A 1EV13 4Y4YA 3MIBA 4EN6B 3RYRA 2JJ6A 5H9QA 4XF9A 5A33B 2BOIA 4LA3A 1WW6A 4B1MA 1H9WA 2HWB3 1W8ZA 1RUE2 2P3KA 4S2HA 2CWSA 4JDNA 1PX3A 2DF7A 4EQVA 2BVVA 3T09A 3VBUB 2D43A 3U11A 3N9QA 4LLFA 2W39A 4AWDA 2WUHA 3V65A 1ZYBA 1UOFA 3M7AA 2DVGA 3DPRB 3SHRA 4XDQA 5C70A 4UW6A 4ES9A 1RUI1 4FPJA 5BUVA 4XCAA 1AR63 3H1YA 4C1XA 1FV2A 1YQ8A 4Y1UA 4YVSC 1PMHX 3FC0A 3ZYPA 1M06G 1OOPB 2ZGPA 2ARCA 3ZMOA 2VOWA 2VZVA 4A3XA 1OFNA 3AP6A 5L9RA 1WCSA 5IAVA 1H9PA 1CJDA 4IV1C 4NWVA 1YXWA 5K4LA 4BZ4A 5LA1A 3PUSA 1PGSA 4YGBA 4CXWA 1YI7A 1POV1 4IE4A 3BB6A 4MSVA 4SLIA 5F3GA 5K7PA 2PAKA 2NMNA 1PO13 4I3GA 3FE5A 4IE7A 4AEDB 1JZ5A 1CAUB 1EUUA 5KXEA 2HBUA 1HV0A 2BTVC 3VBOC 1VPHA 1MZEA 4LBJA 2DUQA 3M8LA 4NHXA 1VMHA 2DCYA 3KGLA 4C1WA 5LRSA 2XUEA 1MQTC 1W3XA 1IPJA 2F4PA 4CTEA 5J37A 1RC6A
chains in the Genus database with same CATH topology
2QQJA 1GOGA 2VOTA 3ACIA 3NRUA 2W1UA 3FL7A 3VDCA 1UYXA 4A3ZA 1WCQA 3WNMA 1P8JA 3NQHA 1JYNA 1UMHA 4A45A 5JXGA 2W5FA 1ULOA 2YFZA 3ECQA 4AG4A 2LW8A 1TG7A 2WZ8A 4CVUA 2VMEA 4M4PA 2C26A 2Y64A 2QQLA 5EJZB 3WNPA 3HEIA 3T2OA 3VD7A 4DXTA 4DXSA 1UY4A 1JZ4A 3A23A 3HJRA 3BGAA 3WSOA 1NX9A 3SEEA 4D8MA 2XOMA 2Y6LA 4BK5A 2QQOA 2R7EB 4MOAA 3A21A 1JZ3A 3GXUA 3T0DA 4QDQA 3I3DA 4A42A 2C4XA 2WO3A 2RJ2A 5JXJA 3U37A 1GOHA 4LHSA 1J84A 1XNTA 2W95A 2W46A 5DPNA 2C9KA 2LS6A 3OGSA 2YFUA 1K12A 3IDAA 1BHGA 3I3EA 3WF0A 3WNKA 3HOBA 3WF3A 2V72A 1DLCA 5DMYA 2W1WA 4MGQA 2WQ8A 1SG3A 5IHRA 3UNPA 1W8OA 3T0BA 4MO3M 3A22A 3MO4A 4HG6B 1I5PA 1UZ0A 3CMGA 1H6XA 2J22A 2KD7A 3NJVA 3WF2A 2QQKA 2JKXA 1DYOA 3D3AA 4GZ9A 4PT6A 2WO1A 3MV11 1OF4A 4JKMA 3NNGA 3VD9A 1GNYA 5G04L 1XC6A 2W87A 2WAAA 4YPJA 2WYSA 5IJRA 3VDAA 5JR2A 3PUHA 4OZOA 2B4KA 1JI6A 3J7HA 3SKVA 2ORZA 4GWIA 3DYOA 3THCA 4CUBA 4FI9A 4BK4A 1KGYA 4BDVB 3K46A 3MUZ1 3MV01 2DCKA 3GM8A 3SEPA 3HNBM 4CU9A 2E33A 4ET7A 1K42A 4ZY9A 5FUIA 4XUTA 4OYUA 1JZ2A 1EUTA 4GWJA 4JX0A 2VMFA 5JUVA 4DEQA 3ZM8A 3GDBA 5IFTA 3I2IA 3FHAA 2VZUA 2XONA 4CU6A 2VC9A 3C7HA 2J1RA 3VD5A 1GOFA 3I3BA 2VZRA 2WABA 3OBAA 1NUKA 4Z2AA 4QPWA 1US3A 1WKYA 3WNLA 2OKXA 2WN2A 3K77A 2ZEZA 2J1EA 3I2JA 2EICA 3EB7A 2W3JA 2HLEA 5B4NA 4TXWA 2XQXA 2BERA 1SHWB 4UOJA 3LPGA 2W1SA 1T2XA 3NJXA 1O8SA 1GMMA 1KEXA 2X09A 3UETA 4DXRA 3E1F1 2W9XA 4ARXA 1OH4A 4OMCA 1UYZA 3A7QA 3I2KA 3VDBA 2VQUA 3FN9A 2PQSA 4KMQA 1TVGA 4P08A 1IQDC 1PX4A 2V5DA 3VD3A 1OF3A 3ETPA 2J1SA 3IAPA 5G05L 3ABZA 3I2GA 4PF1A 3CDZB 3K4AA 4XUPA 1W8NA 2VZOA 4QDRA 5C7GA 1O59A 2ORXA 5C71A 1UY0A 1JYXA 3WEZA 1DP0A 3ACGA 4BXSV 3CZJA 4P02B 3THDA 1JYVA 2VZTA 4A41A 2VZSA 4E8CA 1GQPA 2VZ1A 2VMDA 1HN1A 3WQBA 4L0PA 1UWWA 2BBAA 3ACFA 3I97A 2XHNA 4JKKA 2VR4A 2YC2A 1UY1A 4QX2A 4QAWA 4A44A 2VZQA 2J1AA 1W9TA 2WAOA 3T0AA 3IB3A 4XUNA 1YQ2A 2QQIA 2DCJA 5J1XA 2QBXA 1XPWA 2W92A 1JYWA 5B4XA 2J1TA 1W9WA 3BN6A 1UXXX 2VZPA 4CU7A 2VCAA 5LA2A 3OGVA 2VZ3A 1F4HA 3DYMA 1GUIA 2DDUA 3SKJE 5IYYA 3WNOA 4A6OA 5LA0A 2YB7A 5F7UA 4CUCA 4ZZ8A 3OEBA 1UMIA 4OMDA 4RYDA 1JZ7A 3I2HA 2ZXQA 3VD4A 3EYPA 1H6YA 2BZDA 4P5YA 2VO5A 2J1VA 2BGOA 1OD3A 3IAQA 2Y6JA 1D7PM 3C8XA 1L7QA 2E32A 1GU3A 4XVHA 3T08A 3CZUA 1JZ6A 5JXHA 2JD9A 2J7MA 3HPNA 4D0QA 4QX1A 4KWUA 5EJ1B 1W99A 3PUIA 3C7GA 3HNMA 5A1AA 4JHZA 4ZZ5A 1UX7A 4CU8A 4DUWA 4CUAA 2J1UA 2ZEXA 1K3IA 1NKGA 3LE0A 5I0DA 5HPOA 5IFPA 5JXIA 2B9VA 4XUQA 4DUVA 2VQTA 4A4AA 2CDPA 3UESA 2VJXA 4OUEA 3LQCA 2CDOA 1UY2A 3K4ZA 2WO2A 4LQRA 3C7OA 3WF4A 1RYYA 1ULPA 2Y6KA 3OGRA 4RN5A 3OG2A 3WF1A 3OEAA 3DECA 2Z4FA 3ACHA 2W91A 3HN3A 5DN2A 1MPXA 3IIIA 4QX0A 2BGPA 5HXMA 3I2FA 4PQQA 1L7RA 2EIBA 1K45A 2VCCA 4IUGA 1CX1A 3CIHA 2VCBA 2WDBA 2EIEA 4UI9L 4MGSA 2YG0A 1NAEA 2JE8A 1W0NA 2WZEA 1PMJX 2EIDA 2X05A 3P1IA 3P6BA 5EIYB 4W8JA 3CQOA 3W5NA 3LEGA 3AC0A 4XURA 4BJ0A 4KI5M 4DUXA 4ARYA 1W9SA 4TTGA 2ZEWA 2E26A 1US2A 4QB2A 2RVAA 3K75B 3GGLA 5CZKA 4XUOA 4P00B 4XZUG 2HYXA 4DEVA 3JXSA 3LPFA 1JU4A 1OT5A 3MUY1 2VMCA 1LNSA 1UYYA 2X10A 3HNYM 5CYYA 1J83A 2RV9A 2W47A 4JKLA 1JZ8A 4UAPA 3CKHA 2JDAA 4LKSA 2VM9A 2YC4A 2Y6GA 1CZSA 4E8DA 4ZXEA 3LEKA 1JU3A 3K4DA 4LPLA 1PX3A 4QB1A 1SDDB 3DYPA 3T09A 2QQMA 4QDSA 3WNNA 3MBWA 5DQ0A 4W50A 2E31A 2WUHA 1CIYA 4QB6A 4M4RA 3T2PA 3C7EA 5C70A 1R64A 4MADA 5LCWL 3C7FA 3T2QA 3OB8A 4W4ZA 2WBKA 3LEIA 2QQNA 1O8PA 1PMHX 2W1QA 2L9LA 1XNAA 3W5MA 2VL4A 2VZVA 2V4VA 1F4AA 2VTFA 3FHQA 2Y6HA 5LA1A 4QX3A 2W94A 1UY3A 5JMOA 2WN3A 2ZEYA 1CZVA 1CZTA 1JZ5A 1EUUA 1JHJA 2Y8KA 2ID4A 1UXZA 3F2ZA 4AAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQJ A;  1GOG A;  2VOT A;  3ACI A;  3NRU A;  2W1U A;  3FL7 A;  3VDC A;  1UYX A;  4A3Z A;  1WCQ A;  3WNM A;  1P8J A;  3NQH A;  1JYN A;  1UMH A;  4A45 A;  5JXG A;  2W5F A;  1ULO A;  2YFZ A;  3ECQ A;  4AG4 A;  2LW8 A;  1TG7 A;  2WZ8 A;  4CVU A;  2VME A;  4M4P A;  2C26 A;  2Y64 A;  2QQL A;  5EJZ B;  3WNP A;  3HEI A;  3T2O A;  3VD7 A;  4DXT A;  4DXS A;  1UY4 A;  1JZ4 A;  3A23 A;  3HJR A;  3BGA A;  3WSO A;  1NX9 A;  3SEE A;  4D8M A;  2XOM A;  2Y6L A;  4BK5 A;  2QQO A;  2R7E B;  4MOA A;  3A21 A;  1JZ3 A;  3GXU A;  3T0D A;  4QDQ A;  3I3D A;  4A42 A;  2C4X A;  2WO3 A;  2RJ2 A;  5JXJ A;  3U37 A;  1GOH A;  4LHS A;  1J84 A;  1XNT A;  2W95 A;  2W46 A;  5DPN A;  2C9K A;  2LS6 A;  3OGS A;  2YFU A;  1K12 A;  3IDA A;  1BHG A;  3I3E A;  3WF0 A;  3WNK A;  3HOB A;  3WF3 A;  2V72 A;  1DLC A;  5DMY A;  2W1W A;  4MGQ A;  2WQ8 A;  1SG3 A;  5IHR A;  3UNP A;  1W8O A;  3T0B A;  4MO3 M;  3A22 A;  3MO4 A;  4HG6 B;  1I5P A;  1UZ0 A;  3CMG A;  1H6X A;  2J22 A;  2KD7 A;  3NJV A;  3WF2 A;  2QQK A;  2JKX A;  1DYO A;  3D3A A;  4GZ9 A;  4PT6 A;  2WO1 A;  3MV1 1;  1OF4 A;  4JKM A;  3NNG A;  3VD9 A;  1GNY A;  5G04 L;  1XC6 A;  2W87 A;  2WAA A;  4YPJ A;  2WYS A;  5IJR A;  3VDA A;  5JR2 A;  3PUH A;  4OZO A;  2B4K A;  1JI6 A;  3J7H A;  3SKV A;  2ORZ A;  4GWI A;  3DYO A;  3THC A;  4CUB A;  4FI9 A;  4BK4 A;  1KGY A;  4BDV B;  3K46 A;  3MUZ 1;  3MV0 1;  2DCK A;  3GM8 A;  3SEP A;  3HNB M;  4CU9 A;  2E33 A;  4ET7 A;  1K42 A;  4ZY9 A;  5FUI A;  4XUT A;  4OYU A;  1JZ2 A;  1EUT A;  4GWJ A;  4JX0 A;  2VMF A;  5JUV A;  4DEQ A;  3ZM8 A;  3GDB A;  5IFT A;  3I2I A;  3FHA A;  2VZU A;  2XON A;  4CU6 A;  2VC9 A;  3C7H A;  2J1R A;  3VD5 A;  1GOF A;  3I3B A;  2VZR A;  2WAB A;  3OBA A;  1NUK A;  4Z2A A;  4QPW A;  1US3 A;  1WKY A;  3WNL A;  2OKX A;  2WN2 A;  3K77 A;  2ZEZ A;  2J1E A;  3I2J A;  2EIC A;  3EB7 A;  2W3J A;  2HLE A;  5B4N A;  4TXW A;  2XQX A;  2BER A;  1SHW B;  4UOJ A;  3LPG A;  2W1S A;  1T2X A;  3NJX A;  1O8S A;  1GMM A;  1KEX A;  2X09 A;  3UET A;  4DXR A;  3E1F 1;  2W9X A;  4ARX A;  1OH4 A;  4OMC A;  1UYZ A;  3A7Q A;  3I2K A;  3VDB A;  2VQU A;  3FN9 A;  2PQS A;  4KMQ A;  1TVG A;  4P08 A;  1IQD C;  1PX4 A;  2V5D A;  3VD3 A;  1OF3 A;  3ETP A;  2J1S A;  3IAP A;  5G05 L;  3ABZ A;  3I2G A;  4PF1 A;  3CDZ B;  3K4A A;  4XUP A;  1W8N A;  2VZO A;  4QDR A;  5C7G A;  1O59 A;  2ORX A;  5C71 A;  1UY0 A;  1JYX A;  3WEZ A;  1DP0 A;  3ACG A;  4BXS V;  3CZJ A;  4P02 B;  3THD A;  1JYV A;  2VZT A;  4A41 A;  2VZS A;  4E8C A;  1GQP A;  2VZ1 A;  2VMD A;  1HN1 A;  3WQB A;  4L0P A;  1UWW A;  2BBA A;  3ACF A;  3I97 A;  2XHN A;  4JKK A;  2VR4 A;  2YC2 A;  1UY1 A;  4QX2 A;  4QAW A;  4A44 A;  2VZQ A;  2J1A A;  1W9T A;  2WAO A;  3T0A A;  3IB3 A;  4XUN A;  1YQ2 A;  2QQI A;  2DCJ A;  5J1X A;  2QBX A;  1XPW A;  2W92 A;  1JYW A;  5B4X A;  2J1T A;  1W9W A;  3BN6 A;  1UXX X;  2VZP A;  4CU7 A;  2VCA A;  5LA2 A;  3OGV A;  2VZ3 A;  1F4H A;  3DYM A;  1GUI A;  2DDU A;  3SKJ E;  5IYY A;  3WNO A;  4A6O A;  5LA0 A;  2YB7 A;  5F7U A;  4CUC A;  4ZZ8 A;  3OEB A;  1UMI A;  4OMD A;  4RYD A;  1JZ7 A;  3I2H A;  2ZXQ A;  3VD4 A;  3EYP A;  1H6Y A;  2BZD A;  4P5Y A;  2VO5 A;  2J1V A;  2BGO A;  1OD3 A;  3IAQ A;  2Y6J A;  1D7P M;  3C8X A;  1L7Q A;  2E32 A;  1GU3 A;  4XVH A;  3T08 A;  3CZU A;  1JZ6 A;  5JXH A;  2JD9 A;  2J7M A;  3HPN A;  4D0Q A;  4QX1 A;  4KWU A;  5EJ1 B;  1W99 A;  3PUI A;  3C7G A;  3HNM A;  5A1A A;  4JHZ A;  4ZZ5 A;  1UX7 A;  4CU8 A;  4DUW A;  4CUA A;  2J1U A;  2ZEX A;  1K3I A;  1NKG A;  3LE0 A;  5I0D A;  5HPO A;  5IFP A;  5JXI A;  2B9V A;  4XUQ A;  4DUV A;  2VQT A;  4A4A A;  2CDP A;  3UES A;  2VJX A;  4OUE A;  3LQC A;  2CDO A;  1UY2 A;  3K4Z A;  2WO2 A;  4LQR A;  3C7O A;  3WF4 A;  1RYY A;  1ULP A;  2Y6K A;  3OGR A;  4RN5 A;  3OG2 A;  3WF1 A;  3OEA A;  3DEC A;  2Z4F A;  3ACH A;  2W91 A;  3HN3 A;  5DN2 A;  1MPX A;  3III A;  4QX0 A;  2BGP A;  5HXM A;  3I2F A;  4PQQ A;  1L7R A;  2EIB A;  1K45 A;  2VCC A;  4IUG A;  1CX1 A;  3CIH A;  2VCB A;  2WDB A;  2EIE A;  4UI9 L;  4MGS A;  2YG0 A;  1NAE A;  2JE8 A;  1W0N A;  2WZE A;  1PMJ X;  2EID A;  2X05 A;  3P1I A;  3P6B A;  5EIY B;  4W8J A;  3CQO A;  3W5N A;  3LEG A;  3AC0 A;  4XUR A;  4BJ0 A;  4KI5 M;  4DUX A;  4ARY A;  1W9S A;  4TTG A;  2ZEW A;  2E26 A;  1US2 A;  4QB2 A;  2RVA A;  3K75 B;  3GGL A;  5CZK A;  4XUO A;  4P00 B;  4XZU G;  2HYX A;  4DEV A;  3JXS A;  3LPF A;  1JU4 A;  1OT5 A;  3MUY 1;  2VMC A;  1LNS A;  1UYY A;  2X10 A;  3HNY M;  5CYY A;  1J83 A;  2RV9 A;  2W47 A;  4JKL A;  1JZ8 A;  4UAP A;  3CKH A;  2JDA A;  4LKS A;  2VM9 A;  2YC4 A;  2Y6G A;  1CZS A;  4E8D A;  4ZXE A;  3LEK A;  1JU3 A;  3K4D A;  4LPL A;  1PX3 A;  4QB1 A;  1SDD B;  3DYP A;  3T09 A;  2QQM A;  4QDS A;  3WNN A;  3MBW A;  5DQ0 A;  4W50 A;  2E31 A;  2WUH A;  1CIY A;  4QB6 A;  4M4R A;  3T2P A;  3C7E A;  5C70 A;  1R64 A;  4MAD A;  5LCW L;  3C7F A;  3T2Q A;  3OB8 A;  4W4Z A;  2WBK A;  3LEI A;  2QQN A;  1O8P A;  1PMH X;  2W1Q A;  2L9L A;  1XNA A;  3W5M A;  2VL4 A;  2VZV A;  2V4V A;  1F4A A;  2VTF A;  3FHQ A;  2Y6H A;  5LA1 A;  4QX3 A;  2W94 A;  1UY3 A;  5JMO A;  2WN3 A;  2ZEY A;  1CZV A;  1CZT A;  1JZ5 A;  1EUU A;  1JHJ A;  2Y8K A;  2ID4 A;  1UXZ A;  3F2Z A;  4AAX A; 
#chains in the Genus database with same CATH topology
 1FOD 2;  5FLJ A;  5A7W A;  1EY2 A;  1H1I A;  2W1U A;  3A0K A;  3D0J A;  3HQU A;  3Q9O A;  1PZ7 A;  4QX5 A;  3P3N A;  3VDC A;  1UYX A;  2QCS B;  3V0A A;  4A3Z A;  1WCQ A;  1N3O A;  1RIN A;  3TN9 2;  3B9C A;  2ZA9 A;  2R04 2;  4WZF A;  4CDU B;  1LB2 A;  5JXG A;  2FDG A;  4GKX A;  2PLV 2;  4JGY B;  3BU7 A;  3JB4 C;  1B35 C;  1EP0 A;  1HRV 3;  1K5M B;  1ZVF A;  2D7F A;  2JDP A;  4XXA A;  4DXZ A;  4M4P A;  4BQ5 A;  3AYC A;  2OW4 A;  5GAL A;  3UGG A;  3ZN4 A;  3IDB B;  1JXN A;  1H1M A;  1BCX A;  3OBR A;  2E6V A;  3WNP A;  3NV3 A;  1Q56 A;  1VBE 1;  3T2O A;  5BNN C;  5D8A B;  5FUN A;  1PGW 2;  2YGL A;  2I74 A;  1MVE A;  4AHW A;  2H0B A;  4H2A A;  4LA2 A;  3SLI A;  4FAG A;  1S0E A;  1KQR A;  1OVP A;  2JEM A;  5FZI A;  5J09 A;  3HJR A;  1D4V B;  3B5L B;  2FDJ A;  2FZ1 A;  2IFR A;  3H3L A;  4XFG A;  3VKO A;  3SEE A;  3WVJ A;  3I2O A;  2K9Z A;  3RWN A;  1URX A;  4IEU A;  1S0J A;  5FWE A;  3RI9 A;  5FYT A;  1A6C A;  3KCY A;  3WW2 A;  4YZ4 A;  4MXV A;  3T0D A;  2JDY A;  3I3D A;  2GC2 A;  5GLT A;  2WO3 A;  3R4S A;  4FPL A;  2OQ6 A;  3GZA A;  5T55 A;  1Y4W A;  3TRS B;  4AED A;  1PGL 2;  2WO7 A;  1VRH 3;  3WQ7 A;  4LBO A;  1XNT A;  3NL1 A;  4CCD A;  2FD8 A;  4IEP A;  3S5Q A;  3VBO A;  1DCS A;  3TOJ A;  1JOB A;  2W46 A;  3G7D A;  5DPN A;  2R0H A;  2LS6 A;  1Q43 A;  1QJX 2;  2YFU A;  1GYK A;  4NAO A;  3DV8 A;  3UKT A;  4C0B A;  4ISQ A;  1W6P A;  1KD7 A;  4XPV A;  4B8E A;  3BOP A;  3FBM A;  3GBF A;  3I3E A;  4EE2 A;  3WNK A;  2FDF A;  1VE0 A;  1VIW B;  3WUD A;  3ZXL A;  5ACA 2;  1UW8 A;  1WCK A;  4FCA A;  3ZDV A;  1UKR A;  2Q1Z B;  5C33 A;  1O3R A;  3RMY A;  1RHI 3;  2W1W A;  2CU5 A;  4P9Y A;  2WA3 A;  1UX6 A;  1SQ4 A;  2IVJ A;  2WQ4 A;  3FWE A;  1T6G C;  4XJ9 A;  3GBW A;  3N9P A;  4ZON A;  3T1M A;  4YG6 A;  3UNP A;  1HJG A;  3RG0 A;  4QPY A;  1SLI A;  2JG8 C;  5C8C C;  3KSC A;  5A3L A;  4U2A A;  3N9N A;  1XYN A;  4XFA A;  3JBG 3;  1O5U A;  3CMG A;  2ZGR A;  5IT6 A;  1A8D A;  4HOO A;  2JE9 A;  3N7K A;  3LZZ A;  5DAP A;  3I4I A;  3WF2 A;  2JKX A;  1VAV A;  4PLM A;  3MIE A;  2EA7 A;  5JOX A;  3KWV A;  1VMJ A;  5FZA A;  5LK5 A;  2BYV E;  1RUH 2;  2AR6 A;  2BOJ A;  3W9A A;  4UBH A;  4FSJ A;  3GZU C;  1YRZ A;  3IZO A;  4QKB A;  2FCT A;  2E9Q A;  3ZFE C;  1POV 0;  4JVA A;  4H7M A;  3SXW A;  4ATE A;  3AL6 A;  1AR9 2;  3ZXA C;  3NV1 A;  3MPB A;  3V0B B;  5FUP A;  5G04 L;  4I01 A;  1ZRI A;  2PLV 3;  4RA0 A;  3AP5 A;  2HWB 1;  5EZW A;  5FY4 A;  1UU6 A;  1Q8P A;  1QOS A;  3PUR A;  2NP0 A;  2WSU A;  4OZO A;  5F5Q A;  3OTF A;  4MZU A;  5A6Y A;  3IIA A;  2YY1 A;  3O1M A;  1H8T B;  4HZF A;  5CA6 A;  2ZTN A;  4FI9 A;  1KGY A;  1BVP 1;  2ZX3 A;  2V4A A;  4GKY A;  4BDV B;  3MUZ 1;  3MDP A;  4Y1X A;  5E8A A;  4NRQ A;  4D6S A;  4OHZ A;  1WMF A;  3VBR A;  4Q4W 2;  1AR7 2;  2DCK A;  3JD7 1;  1AYM 1;  4CU9 A;  1BK1 A;  4XJ8 A;  3ZN6 B;  4ZY9 A;  4LO5 B;  5FMO S;  4XUT A;  3VBR B;  5FIX A;  1W0O A;  4XAE A;  1MEC 1;  4JX0 A;  2ARB A;  2P6H A;  5BNO C;  2VMF A;  4CCC A;  5DZG A;  4OI1 A;  1TME 3;  4MVT A;  3X29 B;  4DEQ A;  4AAP A;  2ZHK A;  3GDB A;  4XFC A;  3I2I A;  4Q4X 2;  3OCP A;  2UWB A;  4Y5Z 0;  4K8R B;  2YGM A;  3VD5 A;  2JWP A;  2GSY A;  3OGJ A;  1DGR A;  1QEX A;  4H14 A;  4XJA A;  3VHN A;  4AI8 A;  5C5U A;  4HLT A;  1NA1 C;  2XJT A;  1EAH 3;  3ALQ A;  4COW A;  2OQ7 A;  3FUQ A;  2B45 X;  3OBA A;  3ZFF C;  1W2U A;  4QPW A;  4OQ9 A;  3AYE A;  3HD8 B;  1Q5O A;  1JBC A;  1SLA A;  1ASJ 3;  5FPU A;  2WN2 A;  2C1F A;  1SBD A;  1FMD 1;  1QJU 1;  1RUD 1;  1RVF 2;  3KCX A;  3MEP A;  3CLP A;  4K1Z A;  2W3J A;  2XBO 1;  2HLE A;  3H7J A;  3POW A;  5FK8 A;  3SCH A;  3MID A;  2GP5 A;  4TXW A;  3WT3 A;  2BU9 A;  3GBG A;  4CEY A;  1HX6 A;  3T30 A;  4D69 A;  1EYB A;  4FFI A;  1SHW B;  2ZAB A;  3TAY A;  3WP6 A;  1SFN A;  5FZF A;  4ONU A;  4E4Z A;  1GMM A;  4BA6 A;  2YC0 A;  2DUP A;  2VW0 A;  2Q4S A;  3B94 A;  2W9X A;  4IL7 A;  5FPA A;  1OH4 A;  2JIC A;  3AVS A;  5I0S A;  2BWC A;  1I9R A;  4UFL A;  5I91 A;  2AC1 A;  1O4Y A;  3CU7 A;  2Z79 A;  2XL7 A;  4Y5S A;  3KT1 A;  3R0R A;  1AX1 A;  5FRE A;  3RYP A;  3VDB A;  1GWL A;  4KMQ A;  5KR7 A;  4K3U A;  1PX4 A;  1S0F A;  4QQO A;  1ND3 A;  4GD4 A;  3KD4 A;  5J48 A;  2VW2 A;  1HRV 2;  4PIZ A;  2D44 A;  5G05 L;  3TEX A;  5CFD B;  2BRT A;  2R1B A;  1PIV 3;  3K3N A;  5LA9 A;  2K0G A;  2PN5 A;  4RL7 A;  5LB6 A;  2C0Z A;  3S6P A;  4YAR A;  2D97 A;  4XUP A;  4UF0 B;  2RJL A;  2WNV C;  4G3Y C;  4UBG A;  5FKB A;  5C7G A;  2ETE A;  4BQ1 A;  2ORX A;  1UY0 A;  1WCD J;  2ARX A;  4R9B A;  4CP1 A;  1UOG A;  3WEZ A;  4LBQ B;  2GNT A;  4QPG C;  2IXC A;  2VZT A;  2OXB A;  2P6C A;  1NLR A;  1FAT A;  4YVW A;  1GQP A;  4Y20 A;  2VZ1 A;  1UYP A;  3VV1 A;  1CN1 A;  5F2S A;  3VBS A;  3E6C C;  2PA7 A;  1ACC A;  3IDC B;  1NLS A;  2YRO A;  3ZFG A;  3ACF A;  1LEN A;  4UT5 A;  5L19 A;  4IV1 B;  4AGV A;  5AVA A;  1RTV A;  2VY0 A;  3DF0 A;  1QIQ A;  2YC2 A;  1XB9 A;  3VZN A;  4QX2 A;  1H30 A;  2RDQ A;  4N90 A;  1W9T A;  4Q4Y 1;  2WAO A;  2BP6 A;  2ZKN A;  1IS4 A;  2FCU A;  5HCH A;  1YI9 A;  4O9E A;  4JGZ A;  1O3S A;  3WLU A;  5AC9 3;  4IV1 A;  5FMB A;  3NWK A;  2E7T A;  2VBD A;  2E51 A;  4WZC A;  1MZ6 A;  1AR6 1;  2RS5 1;  2QQU A;  4ATF A;  2C9A A;  3R6S A;  4KQ7 A;  1W0P A;  1Q8S A;  2DTY A;  2OA2 A;  2JDK A;  2VE1 A;  4GMP 1;  5B4X A;  1ULF A;  1KRI A;  4EJR A;  3PUQ A;  1LGC A;  4GMP 0;  3V0A B;  5BNO A;  2FDK A;  1R09 2;  1C8M 2;  5BPX A;  1G9B A;  4J1W A;  1HXS 2;  4CU7 A;  2BV4 A;  5HV0 A;  5LA2 A;  4GA9 A;  4R9A A;  3DYM A;  1H8V A;  1MEC 3;  4JGZ C;  4QD2 A;  3THP A;  2DDU A;  3D0S A;  2V5Y A;  4XOG A;  5KXC A;  1HIX A;  1W8F A;  2ARE A;  2RDR A;  2VNO A;  2XKO A;  3ORJ A;  1W2O A;  4HVR A;  4PDW C;  3OYW B;  3ZYF A;  3ZVX A;  4E4H A;  3NJY A;  5LEJ A;  1J58 A;  4A6O A;  5LA0 A;  3T1L A;  4YM1 A;  1JHN A;  4NRP A;  4HAN A;  3OEB A;  4QXB A;  1UMI A;  4OMD A;  4Q1P A;  5F3E A;  3ME2 A;  4RYD A;  4AQ6 A;  5J3U A;  1JZ7 A;  4YM3 A;  2ZXQ A;  3VD4 A;  1H6Y A;  1WBF A;  1IOA A;  2VTX A;  4XFF A;  4BLI A;  4XF0 A;  4LTA A;  3OBZ A;  4WVM A;  1MQT A;  3C8X A;  3S7I A;  3WZ1 A;  1UIJ A;  1G9A A;  2E32 A;  5I8S A;  2ZX2 A;  2CL2 A;  2V09 A;  1XSQ A;  3LSE A;  3OOX A;  4LBK A;  4QMA A;  2ZX4 A;  3FLT A;  1LHN A;  1UPS A;  4XF1 A;  5FY5 A;  1OBN A;  2Q30 A;  2QNK A;  3T4H B;  1GZ9 A;  4RQP C;  2J7M A;  3JQW A;  4QKN A;  4D0Q A;  4ITC A;  5FYY A;  1SCR A;  5JZG C;  3A0N A;  1ALY A;  3OYW A;  4K21 A;  2A3Y A;  1UU5 A;  1E57 A;  1DZR A;  1Q8O A;  2O8Q A;  3AYD A;  3PUI A;  3C7G A;  1UQX A;  4IET A;  4Q0S A;  4ZHN A;  3MIC A;  1ASJ 1;  1RUC 1;  4CU8 A;  1O3T A;  1BXH A;  1S4C A;  4CUA A;  1G8W A;  4LIT A;  3P5B A;  1K3I A;  3WCR A;  1UKG A;  4QGN A;  3WDW A;  1GZC A;  4CDQ C;  3E97 A;  4FOW A;  2WLP A;  2Q8E A;  2B9V A;  4NJ4 A;  3VBF A;  4COY A;  5FP3 A;  5JXI A;  1PK6 C;  4NID A;  2CDP A;  3VL8 A;  4YZ1 A;  4XC9 A;  3UES A;  2WS9 2;  4BQ4 A;  3IMN A;  3FFQ A;  5FY0 A;  2VQ0 A;  2BNO A;  5FXZ A;  2CDO A;  5FYB A;  3GYD A;  3P3P A;  1LED A;  5FYZ A;  2A75 A;  1XRU A;  1CX4 A;  3WF4 A;  3BYW A;  1W6M A;  2PQQ A;  2H0V A;  2Y6K A;  1TMF 3;  5DUU A;  4AFM A;  4FBF A;  4RGK A;  4JGY A;  4KBZ A;  3OG2 A;  4YNI A;  1YYN A;  4DMI A;  3NKT A;  3BUC A;  3OEA A;  1AXK A;  3DEC A;  5JOY A;  2BPA 2;  3FMG A;  2OZJ A;  4W65 A;  4UYB A;  1XXN A;  1ZBE 3;  2Y60 A;  1ZZ7 A;  4D6R A;  1QJY 2;  1SAC A;  4CDU A;  5DUW A;  2JIJ A;  1V00 A;  1LTE A;  1MS9 A;  1UIK A;  2PHL A;  4M00 A;  4PQQ A;  4YWA A;  2VCC A;  5ERL A;  1YFX A;  2CYF A;  3VHP A;  1NA1 A;  5ISL A;  3ITQ A;  3TEY A;  2FHR A;  3TYJ A;  2BNN A;  2WDB A;  3BTA A;  2PMW B;  2R07 3;  2ZMK A;  2Q5T A;  2EIE A;  3LDB A;  4R4X A;  2G9G A;  4ZS2 A;  3NNJ A;  1RUJ 2;  3HQX A;  2HWE 3;  3QOP A;  1H8T C;  5FPZ A;  4UFH A;  2JE8 A;  4DS0 A;  4F3J A;  4SBV A;  4LBQ A;  5C5T A;  2WNU C;  2ZGT A;  2UWA A;  1LRH A;  4QX8 A;  1Z7S 3;  5A7P A;  4BE3 A;  4BB3 A;  4RHV 1;  5FXV A;  4EN8 B;  4EWD A;  5FPB A;  1VP6 A;  4BIS A;  3VB9 A;  3AC0 A;  2P3Y A;  3ZFG B;  1NG0 A;  4HVQ A;  2ZAC A;  4KGQ A;  1E5S A;  5FO7 B;  1R1A 1;  4YGD A;  4D6Q A;  3LIG A;  1W8T A;  2D3P A;  5F1R A;  4H55 A;  1XYO A;  4CDX B;  3K75 B;  3GGL A;  2IWG B;  3M3Q A;  5FZK A;  3OJB A;  5FPX A;  2GC3 A;  2R30 A;  2ZGS A;  4P00 B;  4W6Y A;  4XZU G;  3VZL A;  1VRB A;  1LOA A;  3JXS A;  2VPV A;  1JU4 A;  1WD4 A;  2B42 B;  4RGA A;  1CQ9 A;  2X10 A;  1RMU 3;  2VTX J;  3ZYJ B;  1J83 A;  3AMM A;  5I93 A;  3FZ3 A;  3VBU A;  1UPI A;  3IN9 A;  5AC9 1;  3LF7 A;  1PM7 A;  2JDA A;  4LKS A;  3ZYH A;  2VM9 A;  1DQ5 A;  2Y6G A;  1CZS A;  1WA6 X;  3H42 B;  4BM8 A;  1EAH 1;  1D2S A;  4DIN B;  1JU3 A;  3O1T A;  5FYH A;  4NHY A;  5FYS A;  1JUI A;  1CAV A;  1H4G A;  2GAU A;  2WT0 A;  4JDO A;  4DY5 A;  3DYP A;  5I8Y A;  1ZZ8 A;  2QQM A;  3LWC A;  3KV6 A;  4JQT A;  4QDS A;  4C8D A;  3MBW A;  1MZ5 A;  4LBM A;  5DQ0 A;  2E31 A;  2XDV A;  2WS9 3;  3PJY A;  4Z1V A;  3RZJ A;  4M4R A;  1ZBA 3;  1RHI 2;  3MW3 A;  4YW6 A;  4R52 A;  4L9B A;  1SMV A;  1U0A A;  2MPF A;  2OVU A;  1RUG 3;  5DG1 A;  4PF5 A;  5C8C A;  5KHI A;  3R05 A;  4QKF A;  3AFK A;  1SFY A;  5GLW A;  3KZ4 C;  3FX3 A;  1O8P A;  5KWR A;  4LIV A;  2L9L A;  2PFW A;  1XNA A;  3W5M A;  1WA4 A;  4FOV A;  1F4A A;  3HQR A;  4M0H A;  3DN7 A;  2VTF A;  4QXK A;  2V73 A;  4LO4 B;  3U07 A;  3WW3 A;  3J7N A;  1J3P A;  3ASI A;  5DAX A;  4CXY A;  3U4S A;  2Y0I A;  2OPK A;  4LNV A;  1CZT A;  1YCI A;  1Z0H A;  4CCJ A;  1TMF 1;  2DV9 A;  3R4D B;  4GJY A;  4IV3 B;  1TNR A;  4Q0Q A;  1GNH A;  2JB4 A;  1W03 A;  1V6N A;  3WW1 A;  5C6C A;  2NYY A;  1ZBE 1;  5FO8 B;  2RR1 3;  1S0G A;  1J3Q A;  4QU2 A;  3WP5 A;  1ZBA 2;  5FYU A;  4RS5 C;  4XJU A;  2QQJ A;  4OI2 A;  4AAX A;  1NY7 2;  1U5X A;  1MS0 A;  2Z69 A;  3ACI A;  5K0U C;  3FL7 A;  4AVB A;  1AR6 2;  2VUL A;  4JV4 A;  1PVC 1;  1E5H A;  3ZXK A;  5CG8 A;  4N53 A;  1BKZ A;  2YBS A;  5HCA A;  5JPM B;  1P8J A;  4KBB A;  4OHW A;  4XIO A;  1JYN A;  2TUN A;  3HBZ A;  3E6B A;  4E27 A;  3ILF A;  2R06 1;  2SLI A;  3ECQ A;  5CFC A;  1V6M A;  2WII B;  4AI3 A;  2KR2 A;  1M4W A;  4HN1 A;  4Q5O A;  4N7I A;  3PTY A;  2VME A;  3I54 A;  3DKW A;  1Q3E A;  1BBT 3;  1OSG A;  1GKB A;  1RUC 3;  3HEI A;  5GKA C;  1MS3 A;  1HRI 1;  4S2D A;  2IC1 A;  1UY4 A;  1RIT A;  1DDL A;  1O4Z A;  2C24 A;  1SLL A;  3CEW A;  3DPR C;  1XNB A;  2I2S A;  2UYB A;  3A23 A;  3KQ4 B;  1UAI A;  4D8M A;  5EFU A;  3V0B A;  3WHT A;  2A6Y A;  2Y6L A;  3H1M A;  4BK5 A;  1SZB A;  1C1L A;  1VB4 A;  3I7D A;  4NPR A;  1WLD A;  1G9D A;  1PM4 A;  2D6O X;  3A21 A;  3N7J A;  1JZ3 A;  3AJY A;  5K8S A;  1OVS A;  4QDQ A;  1GP6 A;  4LOS A;  5DDJ 2;  3RGB A;  1X36 A;  3WDV A;  3POF A;  3U37 A;  5FO9 B;  1GOH A;  1VMF A;  1R08 1;  1SLT A;  2ZAA A;  4CE8 A;  1TNF A;  5SV8 A;  2PHD A;  5KC5 A;  2WT2 A;  1W6N A;  1HRI 3;  4AFA A;  4OZX A;  2XHK A;  4PDW B;  1YIP A;  2KA3 A;  4XXP A;  4AED C;  4DB5 A;  5JVV A;  4BQ2 A;  1X50 A;  3VBO B;  1BHG A;  2QUO A;  1BMV 2;  3I3Q A;  4FOY A;  1GQH A;  1IS3 A;  1HV1 A;  1U5I A;  3HOB A;  1MQT B;  1UOJ A;  2A71 A;  2VU9 A;  4YW3 A;  1DLC A;  1VRH 2;  4FP2 A;  4HSL A;  5JIA A;  2LRP A;  5B2G B;  5DMY A;  5FQ0 B;  4PQ9 A;  3CJI A;  2WQ8 A;  1SG3 A;  2CWM A;  2WYF A;  4FAH A;  1YFU A;  2A1X A;  4FFF A;  1UF2 C;  3CJI B;  1OA4 A;  4MO3 M;  3RS6 A;  3MZH A;  1NQJ A;  3ATG A;  1V6I A;  2CTV A;  5FZO B;  1WCU A;  5KXD A;  1NXM A;  1R08 2;  2XVK A;  1WME A;  1RVF 1;  2J22 A;  1FNZ A;  1RUG 1;  4AQ2 A;  1PIV 2;  4XTM A;  2XML A;  1YNA A;  5DDJ 1;  4COZ A;  1BEV 2;  2IXK A;  1B35 A;  4YZ2 A;  1DYO A;  2OUH A;  4IW3 A;  4LIU A;  2OII A;  2BEO A;  5I0R A;  1LCL A;  4W6W A;  1SEF A;  2DWR A;  1W6N B;  5D8A C;  1OF4 A;  5CKN A;  4JKM A;  3ZXF A;  3VD9 A;  3PVN A;  5IK8 A;  4E9K A;  3NNF A;  3PVO A;  4AGR A;  2FQP A;  1XC6 A;  1JOD A;  3PJQ A;  1WW5 A;  3PTR B;  2WAA A;  3VBS C;  4LBL A;  2WYS A;  2XWB B;  1DGW X;  2EAL A;  3PUA A;  4CUG A;  1JH5 A;  1GWM A;  5JR2 A;  4P9W A;  1OXC A;  4MGT A;  1PK6 B;  5D8A A;  2ORZ A;  4GWI A;  3IT8 A;  4QPI C;  3THC A;  4CUB A;  4LT5 A;  5D21 A;  4XQD A;  1ST8 A;  2Y33 A;  3JD7 2;  2XVG A;  2F4L A;  3PMS A;  2W08 A;  3POG A;  3UGH A;  1CAU A;  2VUC A;  2UWC A;  4KWJ A;  2GND A;  1LAJ A;  1CES A;  4OHV A;  1CD3 G;  1PVC 2;  1JYI A;  5FUI A;  2VVD A;  1JZ2 A;  2RS3 2;  1EUT A;  3A4U A;  1DU3 D;  4I02 A;  1RB8 G;  1NZI A;  1QHD A;  4F83 A;  4NIG A;  4W6X A;  1CAW B;  2Q1F A;  1F15 A;  3ZM8 A;  1XYP A;  1LOC A;  4DO0 A;  1N1V A;  1RUE 3;  5IFT A;  2HJI A;  2HWB 2;  3GZT B;  4XE9 A;  4NAM A;  2XG3 A;  3AZY A;  3FHA A;  5JWP A;  1HB2 A;  3ZIX A;  1AR9 1;  3IM0 A;  2XVL A;  1LEM A;  5AVP A;  2JG8 B;  1V9U 1;  3I3B A;  4LUL A;  5L9V A;  5F6L B;  2ZX0 A;  3BOW A;  4XFI A;  4NII A;  2ET1 A;  4OUM A;  5IAT A;  5F5I A;  1NUK A;  2GP3 A;  5CIR A;  4Z2A A;  3RZH A;  3WP3 A;  2WQZ C;  1WKY A;  1IHM A;  3DL3 A;  3WNL A;  1ZA4 A;  1AR7 3;  4BCU A;  3K77 A;  5C4W C;  4JRL A;  5A3U A;  3ZSL A;  4FFH A;  3EHK A;  2WZR 2;  3ES1 A;  4IV3 A;  2EIC A;  4N9H A;  2WZP P;  3EB7 A;  2YPJ A;  5IK7 A;  1YJL A;  1MZF A;  2X29 A;  2WKK A;  1W8U A;  3B9I A;  3S5A A;  2D3R A;  4UFJ A;  1YUD A;  4A2U A;  2XQX A;  3PLQ A;  5H9S A;  5JR7 B;  4BOW A;  4JAA A;  2GC1 A;  4UOJ A;  2W1S A;  3NAP B;  3NV4 A;  3NJX A;  5AFE A;  1ZRE A;  4WBB A;  4BME A;  3KV4 A;  5EYX A;  3EMR A;  3FFZ A;  1XND A;  3DPR A;  2RM2 2;  4UFI A;  2DVA A;  1X9P A;  3LCP A;  5JPN B;  1IS5 A;  1WD3 A;  3V64 A;  5KXB A;  3GHM A;  1O6U A;  2R07 1;  1H0B A;  3WG4 A;  1KS5 A;  2PQS A;  3OD0 A;  2PTM A;  4Q4Y 3;  4CDX A;  5J96 B;  5AC9 2;  1F31 A;  2A6Z A;  3QBQ A;  2XKP A;  5A6Q A;  1NOV A;  1OF3 A;  4XHX A;  4Y24 A;  1UU4 A;  2TEP A;  2P37 A;  5EXO A;  1RL3 A;  4L2N A;  3KCC A;  4H7L A;  3WDX A;  3ABZ A;  2EXK A;  1TE1 B;  1ZX5 A;  3MHZ A;  4WVZ A;  3NO8 A;  5D1I A;  1PGL 1;  3SCF A;  1G6N A;  3CDZ B;  3VBR C;  2GN7 A;  1KFX L;  1W8N A;  3JBG 1;  1VBA 3;  3AYA A;  4HT1 T;  4O9G A;  3VDD A;  3ST7 A;  5BNO B;  1AL2 3;  1VB2 A;  2O14 A;  3RSJ A;  3VLB B;  5CG9 A;  1RXG A;  1DP0 A;  1ULD A;  3TWI A;  3W21 A;  4ASM B;  3ACG A;  4PIX A;  3NKG A;  4AXO A;  2XPJ A;  3CZJ A;  2BBV A;  1C3H A;  1GBG A;  1G7Y A;  4PI2 A;  2EVX A;  4O61 A;  4RS5 A;  1R1A 2;  2VZS A;  4E8C A;  5CAZ A;  3BKZ A;  2IFW A;  3F95 A;  4P9I A;  3M3C A;  1WGP A;  4Q0V A;  4AEM A;  4IGQ A;  3AZZ A;  4FT8 A;  5DUX A;  2VMD A;  3SCG A;  2MEV 2;  2NMO A;  1C4R A;  5APA A;  5GZC A;  1VBE 2;  2F17 A;  5KBF A;  4Q8L A;  2HWC 3;  2Q1M A;  3FLP A;  1SFP A;  3ZFF B;  4JDM A;  3I97 A;  4IEZ A;  2XHN A;  4XJZ A;  2WLQ A;  4QQH A;  4XBN A;  3ZFF A;  2G1M A;  1UY1 A;  1RMU 1;  3KHB A;  2PLV 1;  5F32 A;  4A44 A;  1LOD A;  1UO9 A;  2J1A A;  2RMU 3;  4NWW A;  2P3J A;  4XAC A;  1CWP A;  3VBH B;  3T0A A;  2XLF A;  1GAN A;  5GLZ A;  1LHV A;  4Q29 A;  5LBC A;  2MHF A;  2YXS A;  4P9G A;  4XUN A;  3AMN A;  1QH7 A;  4RS5 B;  2DCJ A;  5J1X A;  4I3P A;  1FOD 1;  2IXJ A;  3KMH A;  1XE8 A;  1WLT A;  3S30 A;  4LJH A;  4CCL A;  4K8F A;  1C8N A;  4KG8 A;  4Y22 A;  4BMB A;  1BLZ A;  1W9W A;  2ZGN A;  3BN6 A;  3NVC A;  4NR1 A;  5ANQ A;  4D7Y A;  2VZP A;  2VD7 A;  1F9K A;  4Q4V 3;  3SH5 A;  3NNM A;  2MEV 1;  4YG0 A;  3UGF A;  1O3Q A;  3OGV A;  1I6X A;  4LHK A;  1FPN 1;  3PIG A;  5JMC A;  3Q8B A;  1RUD 3;  1UOB A;  5BNQ A;  5IUQ A;  5CFD C;  2WS9 1;  1AX2 A;  4HK8 A;  5FZ3 A;  1S55 A;  3LDK A;  3SKJ E;  3OPT A;  5IYY A;  4G9S B;  3KF3 A;  2DVB A;  1JMU B;  1DYK A;  3MF6 A;  4GAL A;  4EYU A;  4IQP A;  2X5I A;  5FY8 A;  5F7U A;  4P9L A;  2WNV B;  3JBG 2;  1JS9 A;  3UV9 A;  5C9A B;  1RUO A;  1ENR A;  1L7L A;  2CGN A;  2W0X A;  4CDW C;  4MUV A;  1VAK A;  4LKD A;  1QWR A;  4BPZ A;  1XJA A;  3EYP A;  3KB5 A;  4OUL A;  2VO5 A;  2ZX1 A;  2J1V A;  2BGO A;  4HON A;  4J6G A;  5FZ6 A;  2JEN A;  3ILN A;  2QQW A;  3EJK A;  3IAQ A;  4KU8 A;  2DVD A;  2EXI A;  1DIW A;  3ZFE A;  2K46 A;  1GU3 A;  3BIE A;  4BIF A;  3CZU A;  2PAE A;  1X7N A;  1VBD 1;  4OI0 A;  3D6E A;  5HBA A;  3BTZ A;  3POB A;  4M0N A;  1JZ6 A;  5JXH A;  3M3I A;  3OD4 A;  2JKB A;  3CBN A;  1AL0 G;  4U36 A;  3LKJ A;  1RUE 1;  3J7M A;  1LU2 A;  2WSV A;  3RVH A;  4X6Q B;  4XF3 A;  1CAX B;  1FNY A;  4YGC A;  1PVX A;  2VAU A;  5EJ1 B;  4CP0 A;  2OT7 A;  3J7L A;  1W99 A;  1OMI A;  4RD7 A;  5F39 A;  1WW7 A;  3GNE A;  4DUW A;  1VBC 2;  1WMD A;  4XF4 A;  1Z7S 2;  2WZR 1;  2ZEX A;  4IES A;  3WR0 A;  2AUY A;  5FMO L;  4XEZ A;  2DVF A;  1LUL A;  1NKG A;  1FXZ A;  1JW6 A;  3LE0 A;  5I0D A;  2QQP A;  4MGI E;  5C3O A;  5IFP A;  2FBE A;  2LTN A;  2ZHN A;  4B29 A;  5FYI A;  2ZGO A;  4AGG A;  3AMH A;  1ZRC A;  1DHK B;  4LHL A;  5FP8 A;  3O1R A;  1AHS A;  3LQC A;  1V9U 2;  2A3W A;  1CJP A;  2ZGU A;  4K9S A;  3ZN5 A;  2WC2 A;  2GME A;  3WNX A;  3K4Z A;  4LQR A;  4JGZ B;  2HWD 3;  3C7O A;  4QXH A;  4UXA A;  4FPG A;  1NCR A;  1W6Q B;  1OA3 A;  5FMC A;  1IKP A;  3EBR A;  1NCR C;  2CV6 A;  1IPS A;  3OUI A;  5JLV A;  3Q8F A;  2ADD A;  3G6J B;  3MFA A;  3LAG A;  5CU1 A;  1ULC A;  4S2G A;  5DN2 A;  1KDM A;  1MPX A;  3GJB A;  1JYC A;  1QOO A;  1R08 3;  4AFB A;  1OLM E;  4V2V A;  1ENS A;  1K45 A;  1LHW A;  4IUG A;  3UJO A;  4I30 A;  3MIF A;  3ILR A;  2VCB A;  2XLG A;  4UFM A;  3VBS B;  1DQ1 A;  1CPM A;  4AW7 A;  3L2H A;  3GHN A;  4JTN A;  4UI9 L;  1YQ5 A;  1X9T A;  1S1A A;  5C3R A;  5A7O A;  1NAE A;  3E5U A;  3J8F 2;  1BBT 2;  4OHX A;  3WQ0 A;  1UN1 A;  1H1A A;  4K20 A;  1LHU A;  4FFG A;  1PMJ X;  2P2K A;  2EID A;  4RQP B;  5FV3 A;  1LOB A;  3P1I A;  4NMI A;  4W8J A;  3N36 A;  4TLG A;  3ZR6 A;  5JAX A;  3W5N A;  3E5X A;  4B4P A;  2C6S A;  2VGD A;  4KI5 M;  4DRV A;  4DUX A;  5FKC A;  2A7A A;  4ARY A;  1S2K A;  2J42 A;  2X8K A;  4FVV A;  2E7A A;  2WNE A;  4QB2 A;  2QZ3 A;  1GP4 A;  4MHR A;  2DUO A;  2RVA A;  2YPD A;  5GLV A;  3I49 A;  3NNL A;  4H3W A;  2CAV A;  1BEV 1;  3HT2 A;  3THT A;  4TSV A;  4CCN A;  4CDQ B;  3RZG A;  4DY3 A;  4DEV A;  4HVO A;  1RUG 2;  3LPF A;  5A7S A;  2AEN A;  2QFE A;  2UUR A;  3KQR A;  4CPB D;  5CYY A;  1UYY A;  3HNY M;  1Y3T A;  2ZOE B;  1Y7B A;  2W47 A;  2JG9 C;  4B7E A;  3O0V A;  1ZZ6 A;  1YC6 1;  2Y6F A;  4JKL A;  2B46 X;  4Y26 A;  4PDW A;  4UAP A;  5C3Q A;  4LO8 A;  2GNM A;  4DRR A;  2NLR A;  2YC4 A;  5GLU A;  2VBP A;  5HCB A;  3UKV A;  2G19 A;  1XSR A;  3LEK A;  1Q8Q A;  1VRH 1;  4XHB A;  3O14 A;  3K4D A;  5LBE A;  4QB1 A;  1C5I A;  4PBP A;  1QF3 A;  4LK7 A;  1I1E A;  4WM8 B;  1BMV 1;  3RJR A;  3PIJ A;  1LHO A;  4FQ4 A;  4NIA A;  1YLL A;  2VG9 A;  3O12 A;  3POY A;  4JHT A;  4QB6 A;  5DZF A;  1Y9Q A;  4OI4 A;  3U14 A;  3NAP C;  4XMA A;  4AVA A;  4MV2 A;  4XDO A;  4AYU A;  1G9F A;  1OLR A;  4HL0 A;  4LE3 A;  4MYE A;  5A3N A;  5FQ0 A;  2XBO 2;  1R64 A;  1NQD A;  5LCW L;  3POI A;  1VBB 3;  3T2Q A;  3OB8 A;  1STM A;  1HQL A;  3BCW A;  4W4Z A;  2I45 A;  2WBK A;  2W1Q A;  3JQX A;  2BDR A;  3LEI A;  1ENQ A;  4I0W B;  4M3C F;  1YJK A;  2WFF 3;  2DBI A;  5ACA 3;  2WNU B;  4N43 C;  4HKW A;  3NAP A;  1YQC A;  3FHQ A;  2Y6H A;  5FYV A;  3VKF C;  5C9A A;  3KVA A;  3ZDS A;  1H2L A;  1UY3 A;  1QY4 A;  5DAB A;  4YW7 A;  5FTT C;  4HKL A;  4AI1 A;  3ZN6 A;  1CZV A;  2CHH A;  3FBY A;  2IUW A;  2NM1 A;  2XR4 A;  4QHZ A;  3ZFG C;  2WRA A;  3PME A;  3BU0 A;  2B5H A;  1W05 A;  4C91 A;  3H8O A;  1V6L A;  2Y8K A;  3H1W A;  3RPQ A;  3U78 A;  2KXL A;  5F5A A;  1HLC A;  5LW9 A;  4ZKT B;  4CEW A;  1VLN A;  4UWD A;  4P5H A;  5F9T A;  1BBT 1;  2RDS A;  4NE9 A;  1GOG A;  3NRU A;  3E6D A;  4YG3 A;  3Q8E A;  5CKM A;  1W06 A;  1W9F A;  3W58 A;  4MX3 A;  4NUB A;  5L73 A;  5LEK A;  3KV5 A;  2NQY A;  3WNM A;  2WWU A;  1EPW A;  4HSJ A;  4DNY A;  4Q4W 1;  3WXP A;  4AI2 A;  3NQH A;  5DAQ A;  3GF6 A;  3OBT A;  1UMH A;  1C57 A;  2X5I C;  4A45 A;  2FDI A;  4RGG A;  3VZM A;  1KJL A;  1CAW A;  1F5F A;  2LW8 A;  2WA4 A;  3POE A;  1V6J A;  1J1T A;  5FPV A;  5IVY A;  3BVC A;  3CO2 A;  4B4R A;  2LUW A;  3WY6 A;  4IE0 A;  1MAC A;  2QQL A;  3PVE A;  5T5P A;  1S0D A;  1ZBE 2;  1LEC A;  1REE A;  3B7M A;  1BK0 A;  2NZ9 A;  4OLL A;  5EJZ B;  1QOT A;  4GH4 B;  1W2N A;  5FY9 A;  3VKM A;  3VD7 A;  3LGR A;  3VBH C;  1F2N A;  4YW2 A;  4DXS A;  4I09 A;  2YU2 A;  2ZHM A;  5KHJ A;  5L9B A;  1EPZ A;  2HBT A;  3MLJ A;  3WX5 A;  1UD1 A;  1IG0 A;  1RJ8 A;  1RUH 1;  2X53 S;  3VUO A;  2R7E B;  4CEW B;  4CPB A;  2N7G A;  4MOA A;  4Z8B A;  4CP9 A;  2RS1 2;  3GXU A;  2XJS A;  2VUD A;  3AP9 A;  5FK7 A;  3ZYR A;  2C4X A;  4G4F A;  3N3H A;  4MGK E;  5LY2 A;  5T5L A;  5BY5 A;  5JXJ A;  4PBO A;  2AEY A;  1J84 A;  3PDQ A;  4Q4X 3;  2W95 A;  1DGR N;  3AK0 A;  2ZHL A;  3LA2 A;  4R9C A;  3W59 A;  2XQR A;  3ZYG A;  3U75 A;  1UCX A;  2XJP A;  1LOF A;  3AZW A;  3RNS A;  5A3M A;  5FZG A;  4Z07 A;  3SIT A;  1IQA A;  1W28 A;  1ND2 C;  3VZJ A;  4IV3 C;  3S57 A;  2E53 A;  1A8M A;  1W04 A;  3IDA A;  2QQV A;  2VNG A;  3RJ2 X;  4BIO A;  2GDF A;  2RE9 A;  4MXW A;  3KHC A;  2QTW B;  5HXV A;  2RS5 3;  3WF0 A;  1ODN A;  3O1O A;  1S0I A;  2JB8 A;  4CA9 A;  3RZK A;  1VBD 2;  1OQ1 A;  2DCZ A;  4XAA A;  1H2N A;  2R0F A;  2G9Z A;  5FZO A;  5FZ0 A;  5K0U B;  4FTS A;  4AF9 A;  3M3O A;  2FMD A;  1LGN A;  2QKD A;  4J1X A;  2GNB A;  3U0Z A;  5T5J A;  4I0A A;  1DG6 A;  3HMY A;  1W8O A;  2VXJ A;  4IE6 A;  3A22 A;  2QJV A;  2VMG A;  3MO4 A;  2VCM A;  4HG6 B;  4IND A;  1I5P A;  2A6X A;  3VBF C;  4CDQ A;  4IGP A;  1UZ0 A;  5FXX A;  5FJK A;  1GZW A;  2JEC A;  1LES A;  2RG4 A;  4XMI A;  5F5C A;  2HEV F;  1XE0 A;  2PHT A;  1DGL A;  3H8U A;  1FI2 A;  3O1V A;  4DQA A;  2KD7 A;  2XL9 A;  2ZKL A;  3NJV A;  3HAG A;  4OCT A;  4FPO B;  2LRO A;  5LWB A;  5K9Y A;  4GZ9 A;  3ZKY A;  4A7Z A;  1CGP A;  4PT6 A;  1VJ2 A;  5KHG A;  1DQ6 A;  2WO1 A;  3TBD A;  1Z78 A;  2HEY F;  5SV5 A;  3Q8A A;  3N9L A;  4HK9 A;  3E5Q A;  3K2O A;  3VZO A;  4RQP A;  1FPN 2;  1SLC A;  1SDW A;  5FZD A;  5ANN A;  4TN7 A;  4LMF A;  4YPJ A;  3KLS A;  1KJR A;  5IJR A;  3VDA A;  5GM0 A;  3WCS A;  4RHV 2;  2RS3 3;  2B4K A;  2ZGM A;  2WFP A;  3J7H A;  3SKV A;  2FDH A;  1I3H A;  1ODM A;  2OX0 A;  1OHF A;  4BWO A;  4LKF A;  3K48 A;  4BK4 A;  4CXX A;  1RJ7 A;  4WM7 B;  4GQ7 A;  4KWK A;  3JU9 A;  3AP4 A;  1WUV A;  2JX9 A;  5C4W A;  4URT A;  5IVC A;  5FZC A;  3GM8 A;  5FMD A;  3SEP A;  4CZS A;  3HNB M;  4BQ3 A;  2E33 A;  1RMU 2;  1K42 A;  3O5S A;  3AX4 A;  3N7M A;  3DEM A;  1NCR B;  1FV3 A;  2QE3 A;  4GB3 2;  4OYU A;  4YLZ A;  5EPA A;  1J59 A;  2ES3 A;  5TSW A;  4OUS A;  1PNG A;  1DQ2 A;  1WZX A;  5F8P A;  5CFC B;  3L9J T;  1OOP A;  1OPO A;  1WLW A;  3AMP A;  3B01 A;  2VZU A;  2YYO A;  2Q8D A;  3GCX A;  1OUX A;  3HN1 A;  3ZSJ A;  2VC9 A;  1E5R A;  1WMX A;  2A3X A;  4GWM A;  3BPZ A;  4J25 A;  1GOF A;  3CJI C;  1Y9G A;  4QM8 A;  4ASL A;  2VZR A;  4RFR B;  5FP9 A;  1US3 A;  4DFS A;  2OUJ A;  4L97 A;  1LJ7 A;  2ZEZ A;  4LOR A;  2J1E A;  1HDK A;  3QH6 A;  1C8M 3;  5L36 A;  1OLM A;  1RUC 2;  1ZM1 A;  2BNM A;  5IVB A;  2G4I A;  2AEZ A;  5JSO A;  1MR5 A;  4QPI A;  3M2M A;  2AAC A;  4N7U A;  4MGZ E;  5E6H A;  5FZH A;  5A33 A;  3LPG A;  1T2X A;  1O8S A;  3JD7 3;  2X09 A;  5T50 A;  2IXI A;  2R07 2;  2AGS A;  5E1R A;  2ATF A;  1QKQ A;  1KDK A;  5JIU A;  1VAL A;  4OMC A;  1UYZ A;  4YVW C;  2RM2 1;  2YV8 A;  5DUV A;  1UZW A;  4Q8K A;  3KVB A;  3A7Q A;  3I2K A;  4FP3 A;  4QPI B;  4WM8 A;  2VQU A;  3FN9 A;  2R6Q A;  1TME 2;  1LKN A;  2PHX A;  1TVG A;  2VUJ A;  2RMU 1;  2WNO A;  4P08 A;  5BNP C;  1ENX A;  4QGM A;  1TQ5 A;  2O0O A;  3VD3 A;  3TEZ A;  4EV0 A;  4XIK A;  3INA A;  4LUK A;  3IPV B;  5EV7 A;  2J1S A;  3IAP A;  3B02 A;  4Y1Z A;  4R9D A;  2ENR A;  5F3C A;  3K4A A;  4NRO A;  2JIG A;  3PU8 A;  2VZO A;  3KGZ A;  1V70 A;  1O59 A;  2PAM A;  3AB0 A;  4BXF A;  5C71 A;  3ZX7 A;  3AXE A;  1JYX A;  3ES4 A;  4WVM B;  4IXL A;  4BXS V;  1NLQ A;  1JOJ A;  3B3Q E;  3THD A;  1NCQ B;  3PL0 A;  4PI0 A;  4FPH A;  4A41 A;  3JZV A;  4X8P A;  3DXT A;  3IWZ A;  3BAL A;  5FOJ B;  2ZMN A;  1K5J A;  4Y22 B;  3BIW E;  3KF5 A;  3H0O A;  3O0X A;  1R09 3;  1W39 A;  1DF0 A;  2WWJ A;  1JUH A;  2YBK A;  3B93 A;  4BYY A;  1W90 A;  5JOZ A;  1W6O A;  1R09 1;  4MET A;  4UW5 A;  3T4V A;  3GJA A;  5I0U A;  5JOW A;  1AR9 3;  4RFT 0;  4TYS A;  4N43 B;  2BBA A;  2GH8 A;  3AP7 A;  4K7J A;  5FAX A;  1S0B A;  5FLH A;  4AZZ A;  3GZE A;  4GH4 A;  1LOF C;  2EXH A;  1AF9 A;  4IEV A;  2VR4 A;  1C28 A;  2RS3 1;  2W68 A;  5ABJ A;  5C4W B;  1HQW A;  1QQP 1;  4QAW A;  2VZQ A;  4ZU4 A;  2JDZ A;  1GNZ A;  1W2A X;  2SBA A;  4P9X A;  4Q4V 2;  4XBQ A;  4DIQ A;  1QQP 3;  4XBL A;  2CGO A;  2BQP A;  1A3K A;  4QHO A;  4ZU5 A;  1TEI A;  4ASK A;  4Q4Y 2;  3OSD A;  3M3E A;  4AE2 A;  2QVS B;  4CCO A;  2HKX A;  1FX5 A;  2PXJ A;  3T3Y A;  4NIH A;  3IB3 A;  3KT4 A;  3TB0 A;  5LRR A;  1NZC A;  1VBB 1;  4YM0 A;  1GQG A;  1AYN 3;  2QQI A;  1MS1 A;  1VBD 3;  4C0H A;  4E4D X;  2QBX A;  4N53 B;  1XU1 A;  5FBJ A;  2FZ2 A;  4YM2 A;  5DZE A;  4KWL A;  4PLO A;  2EXJ A;  2RS1 3;  2J1T A;  1GLH A;  1PO1 2;  1QGL A;  2MEV 3;  2MNG A;  4LO7 A;  4UF0 A;  1ZRF A;  1COV 1;  4JRA A;  3VKN A;  1AJO A;  2VW1 A;  2P1B A;  4QQL A;  3D8C A;  5FZL A;  2TBV A;  3OUH A;  3GAL A;  5J7M A;  3DGT A;  2CSG A;  5FR3 A;  1OFS A;  4IEY A;  5A32 B;  4DZG A;  4EWE A;  3EQE A;  4Q2F A;  4L99 A;  5H9P A;  3WNO A;  4KU7 A;  4D7S A;  5M0T A;  4DOU A;  2YB7 A;  1W6M B;  2WL1 A;  4MHU A;  4CUC A;  1PIV 1;  3J9S A;  1EV1 1;  2UY8 A;  5E89 A;  4NPM A;  3I2H A;  2VBB A;  2ZJC A;  4RR3 A;  5BYN A;  1YQ6 A;  1OD3 A;  4LO6 B;  5K0U A;  1IS6 A;  2WJS A;  1D7P M;  4CEW C;  4Q26 A;  2R49 A;  1HN0 A;  4RHV 3;  2LM3 A;  3O1S A;  1RUN A;  2Y26 A;  3VDD B;  1ZZC A;  2CAU A;  5FP4 A;  1U12 A;  2D5F A;  1OPM A;  1QJZ A;  4JQR A;  4FPY A;  2GN3 A;  4LKE A;  3FHI B;  2HYK A;  2RJK A;  4R8H A;  2JD9 A;  5F2W A;  4NPL A;  3I2D A;  2XGX A;  1YFY A;  3WUC A;  4P9J A;  1PZ8 A;  3ZSE A;  5KHK A;  3RDI A;  4QX1 A;  3MW2 A;  4KWU A;  4AI0 A;  3FJS A;  1DQ4 A;  5FY1 A;  3O1P A;  1ND2 B;  5IK5 A;  1WBL A;  3O1U A;  4KG0 A;  5A32 A;  2HWF 2;  4B1L A;  3R4U A;  3LD8 A;  3H8R A;  3OY8 A;  4JHZ A;  2D5H A;  4ZZ5 A;  1Y43 B;  2I07 B;  4AFC A;  4Q27 A;  3URF A;  1HB3 A;  1RUD 2;  3TNP B;  2W52 A;  4B4Q A;  4X8N A;  2BFU S;  1J3R A;  4HFS A;  5HPO A;  3ZMN A;  2JG8 A;  4E2G A;  4XUQ A;  4EN9 B;  2VQT A;  4A4A A;  1PZ9 A;  1AR8 2;  4CEY B;  2GZW A;  3WG2 A;  4I2O A;  2F6B A;  5CB7 A;  1D4M 2;  3CJX A;  4QWN A;  1O91 A;  2K2S A;  4TZD A;  5FZE A;  5EQU A;  3JCI A;  3HR9 A;  1UY2 A;  1HRI 2;  2P4E A;  5T5O A;  2TNF A;  3HWJ A;  4Q4X 1;  1AVB A;  1RYY A;  1ULP A;  3AZX A;  3LA7 A;  1ULE A;  2DUR A;  3U1X A;  2XB6 C;  3LOB A;  3ELN A;  2YU1 A;  3OGR A;  4Q0P A;  4RN5 A;  1BEV 3;  1RVF 3;  4EZH A;  1GWK A;  3WF1 A;  2Z4F A;  3O7O A;  2PHR A;  4IE5 A;  5E16 A;  4EN0 A;  5C9A C;  2W91 A;  3HN3 A;  3SQO A;  3III A;  4C90 A;  1SPP B;  4QX0 A;  4CDW B;  2R06 2;  1AYM 2;  4PCR A;  1W6O B;  2B7Y A;  3ZKU A;  2ADE A;  4KH9 A;  4YW4 A;  3VKL A;  5FYC A;  3ZXE A;  3ZIW A;  3NST A;  1PK6 A;  3D5O A;  5FZ7 A;  1CPN A;  1OH3 A;  2R04 3;  3MLL A;  4MGS A;  5C3P A;  1NY7 1;  3PHM A;  2O1Q A;  2RR1 2;  3H3Z A;  3KV9 A;  1ZBA 1;  2WZE A;  2EF6 A;  1ZZB A;  3AKQ A;  4WM7 C;  5ABJ B;  2ZPX A;  3P6B A;  4PIY A;  2X05 A;  2DTW A;  3RI8 A;  1GR3 A;  3I8T A;  3CQO A;  3OPW A;  4QKD A;  1REF A;  3LEG A;  4AHY A;  1E5I A;  1TMF 2;  1W6Q A;  2VXR A;  4O65 A;  1GV9 A;  1ZNP A;  4PLN A;  4NHL A;  4XUR A;  4XQ4 A;  5F6K A;  4Z2W A;  1B09 A;  1D4M 1;  1RXF A;  3ZOI A;  4A7Y A;  3GCW A;  5A1F A;  2OS2 A;  1N1S A;  1D2Q A;  1W9S A;  2JDU A;  1AR8 1;  2CNA A;  2ET7 A;  2ZEW A;  4JTO A;  4Q0U A;  4QX7 A;  3J4U H;  1US2 A;  2ZZJ A;  3T2T A;  1N3P A;  3WP4 A;  4PHZ A;  4CCK A;  5CFC C;  1QNW A;  3AJZ A;  5EYY A;  4XUO A;  1NCQ A;  2JDM A;  1N47 A;  1QMJ A;  1N1Y A;  2XBO 3;  3POS A;  1OT5 A;  3MLK A;  3MUY 1;  2R32 A;  4Y20 B;  1LNS A;  2XJQ A;  3VHO A;  1FMD 3;  1QJU 3;  1GSL A;  4OFG A;  4XZP A;  2HWF 1;  5I0T A;  3ZXD A;  1W6P B;  2E63 A;  3LEM A;  3VN4 A;  3WOG A;  1NT0 A;  1OKO A;  4R4Z A;  1RHI 1;  2G9F A;  5BV6 A;  1JZ8 A;  3MF9 A;  3CKH A;  4FXG B;  2QDR A;  3MIH A;  1B35 B;  4AI9 A;  4E8D A;  4ZXE A;  2NN8 A;  1QXR A;  1K5M C;  1PVC 3;  3IPV A;  5A7N A;  3MPP G;  3S0M A;  5ACA 1;  5BNN A;  4LPL A;  2PEL A;  4XYX A;  4N8M A;  1SDD B;  3PU3 A;  1YHF A;  3BOD A;  4XFB A;  3WNN A;  4AEJ A;  1EAH 2;  5A3T A;  2YHJ A;  1OC1 A;  5FZB A;  2BW8 A;  4W50 A;  4Y1Y A;  1CIY A;  1X8E A;  2B9U A;  3WIN E;  5EIY B;  5FCC A;  3T2P A;  3ZR5 A;  2A6W A;  3NV2 A;  3C7E A;  4YZ5 A;  2ZML A;  3SNM A;  1SBE A;  2E7Q A;  4MAD A;  1N1T A;  3C7F A;  1PHM A;  4CP9 B;  2VOV A;  3VL9 A;  4EWA A;  4IER A;  1DLL A;  1IPK A;  5J36 A;  1EV1 2;  1LGB A;  2QQN A;  3USS A;  5LAT A;  4YGE A;  1OQE A;  3D4K A;  3KS7 A;  1OLQ A;  4XQW A;  2VL4 A;  2V4V A;  4LBN A;  4HMZ A;  5KC6 A;  5BNP B;  5EJ3 A;  1RUF 3;  2D6M A;  2YBP A;  4QX3 A;  2W94 A;  4BU2 A;  1K5M A;  5A70 A;  5JMO A;  3VZK A;  2WN3 A;  2BGC A;  2CY6 A;  2WZR 3;  2ZEY A;  5CEH A;  5A6X A;  1IKQ A;  5LY1 A;  4KGG A;  2IXH A;  2JG9 A;  2Z2S B;  1JHJ A;  1COV 2;  3EXU A;  3S7E A;  1Q8V A;  3LA3 A;  1PO2 3;  3LFI A;  2ID4 A;  1UXZ A;  4XDP A;  3RFR A;  5A3W A;  5GZD A;  2D6P A;  3F2Z A;  1OKQ A;  1X8M A;  3ETQ A;  4YYO A;  3LFM A;  1NCQ C;  2VOT A;  3SC7 X;  1RUJ 1;  2RM2 3;  4MGY E;  4CCM A;  1VBB 2;  4IEQ A;  4LE4 A;  5EWS A;  3H7Y A;  1NYW A;  3RWK X;  1F8V A;  3H9A A;  1CIW A;  4FO9 A;  4GWN A;  1QJX 3;  4HXC A;  2HWD 1;  5GZE A;  1CVN A;  3AVR A;  5F3I A;  3IDE A;  3BTY A;  4B3N A;  5IAX A;  3WDY A;  5FZ9 A;  2R04 1;  2FCV A;  2JG9 B;  4QPG A;  4Q1R A;  3TN9 1;  1NXD 1;  2W5F A;  1ULO A;  2YFZ A;  4AG4 A;  2C5D A;  3AMQ A;  3VBH A;  1J1L A;  1QJY 1;  3HIF A;  1F35 A;  1TG7 A;  3QLQ A;  2UYA A;  2Z5W A;  1DZT A;  1V0A A;  3M70 A;  2WZ8 A;  3WW4 A;  4CVU A;  2P34 A;  4WM7 A;  1VBA 1;  2C26 A;  2Y64 A;  5BNP A;  1UZZ A;  2D6L X;  5EHD A;  2XH6 A;  2RHP A;  5IWF A;  3CL1 A;  4WM8 C;  1QH6 A;  2Q0A A;  5JI9 A;  3TEW A;  1GFF 2;  3ZPO A;  4DXT A;  1XNK A;  4AVC A;  3OF1 A;  2LAL A;  1ND3 C;  4LBQ D;  1POV 3;  1XBF A;  4Y1V A;  5A1L A;  3BTX A;  1JZ4 A;  4RSU A;  2AYH A;  1Y9M A;  2RDN A;  1HQN A;  2D3S A;  3BGA A;  4LLO A;  4LUM A;  1XQN A;  5A7W B;  1NX9 A;  3WSO A;  4AFD A;  3ZO0 B;  4ES8 A;  2XOM A;  4N53 C;  2QZ2 A;  2QQO A;  2R1D A;  4TWT A;  5FRA A;  3RRD A;  3D82 A;  3I59 A;  5CKQ A;  2ZGL A;  1C5H A;  4YZ3 A;  4AOC A;  1AR8 3;  5IVJ A;  3OY8 B;  4GIQ A;  4A42 A;  2AZ5 A;  4RR3 C;  3LIH A;  2RJ2 A;  4ZS3 A;  1JTZ X;  1GZT A;  1ZA7 A;  4LHS A;  3ZLI A;  1ND2 A;  1ASJ 2;  3IBM A;  1RUI 2;  2HH9 A;  1CAX A;  4KNC A;  4NN0 A;  2PHW A;  2EAA A;  4E2Q A;  1AX0 A;  1V6K A;  2ARA A;  2DU1 A;  2VVF A;  2JXA A;  1U5Z A;  1YIF A;  2C9K A;  2P17 A;  3OGS A;  1IG3 A;  4F8A A;  2RMU 2;  2HWF 3;  1K12 A;  1TME 1;  1TZO A;  5CFD A;  1UZV A;  2ILM A;  4UW4 A;  1OQD A;  4QM9 A;  5CIS A;  1U5Y A;  3ACL A;  4MH0 E;  4NRM A;  3UYJ A;  3WF3 A;  2V72 A;  1QXP A;  2VH9 A;  3AXD A;  4ZPI A;  3ZXJ A;  4M01 A;  2R06 3;  4CRQ A;  1BJQ A;  3JB8 A;  3I59 B;  4NHM A;  4FXK B;  4MGQ A;  5L7O B;  1UMZ A;  2A5Z A;  2XJR A;  5IHR A;  4MXW B;  1X33 A;  2P3I A;  3T0B A;  5L7O A;  2JDH A;  2DU0 A;  4FQZ A;  4XET A;  1G9C A;  2X5I B;  1ONA A;  5T52 A;  1H6X A;  4AEK A;  2KM2 A;  5IW0 A;  5JI7 A;  4QHB A;  4V2W A;  2VOK A;  5DG2 A;  2XUM A;  2OYZ A;  3N9M A;  1ZRR A;  2QQK A;  4L11 A;  3ZXG A;  1APN A;  1W8H A;  1BQP A;  1S0C A;  1N3Q A;  3LSD A;  3O0W A;  2YZ4 A;  3D3A A;  1H2K A;  4M3C A;  2ZGQ A;  5GZF A;  1KXG A;  5FBZ A;  5H9R A;  4A7K A;  3MV1 1;  4GH4 C;  2P5B A;  5FZM A;  3MIG A;  3NNG A;  4QXC A;  4YSF A;  4AQS A;  5HCF A;  4IEW A;  4FPE A;  1GNY A;  1UNB A;  5FDB A;  2DBN A;  1MS5 A;  2W87 A;  1HXS 1;  4M3C E;  1HW5 A;  1C8M 1;  4BHP A;  5HV4 A;  1XE7 A;  3I3M A;  4BLJ A;  2GH2 A;  5FY7 A;  3PUH A;  4LXL A;  4F7Z A;  4P14 A;  2HWE 2;  1JI6 A;  1VBA 2;  1ZRD A;  3IMM A;  2WFF 2;  1MS4 A;  4Y4R A;  4B7K A;  2BVB A;  3DYO A;  2NPI A;  2RS5 2;  4GB3 1;  3KT7 A;  3QAC A;  3K46 A;  4GMP 3;  4K6B A;  4OVE A;  2OPW A;  3MV0 1;  4AVV A;  2BUK A;  1V6O A;  2JDN A;  3SMH A;  2HWD 2;  2BWA A;  4ET7 A;  2BFU L;  4JZR A;  4AQT A;  2PHU A;  4GWJ A;  2HEW F;  4MG2 A;  4AVT A;  2O8O A;  1DZQ A;  2R16 A;  1F5J A;  5CVR A;  1BZW A;  2D40 A;  4Z82 A;  5JUV A;  4QPG B;  3RZZ A;  1H8T A;  2ZBJ A;  4I0B A;  2DCT A;  1W9Y A;  2XON A;  4YRD A;  1PO2 1;  4CU6 A;  3C7H A;  4D3W A;  2J1R A;  1RUH 3;  4CYD A;  4K40 A;  3VBF B;  1AL2 1;  3MYX A;  4FOQ A;  1H4H A;  1AZD A;  5A7Q A;  1CR7 A;  3WDT A;  3PVB B;  5FYM A;  1AUY A;  2WAB A;  3USU B;  1A34 A;  1DFQ A;  1JN2 P;  5ABJ C;  1UL9 A;  2IZW A;  2OKX A;  4EN7 B;  1QNY A;  1AXZ A;  3WG1 A;  2GMP A;  1SBF A;  3U4X A;  5FLI A;  2VNV A;  3I2J A;  4FPF A;  1G86 A;  5BNN B;  4FPK A;  3VBU C;  4IGO A;  5DDJ 3;  5B4N A;  1HRV 1;  2YMZ A;  3WD5 A;  5JDB A;  1DBN A;  2PHF A;  2BER A;  1DGW A;  4ZU7 A;  3U10 A;  2WR9 A;  5GJ6 A;  4COV A;  1KEX A;  1MVQ A;  2IVI B;  2HWC 2;  1R1Z A;  3UET A;  4DXR A;  3APB A;  3E1F 1;  1WWY A;  2BJS A;  1AYN 1;  3MFC A;  3DCQ A;  4ARX A;  4OHY A;  5IVE A;  2Z42 A;  3SIS A;  2ZGK A;  3K3O A;  3J8F 3;  4YVS B;  2A73 B;  2XXZ A;  2VQA A;  1OOP C;  3L2Y A;  4IEX A;  5CAD A;  3AFG A;  3AKR A;  2DYC A;  4UW3 A;  4MLO A;  1LR5 A;  2CGP A;  1IQD C;  2V5D A;  3B69 A;  4L8Q A;  4IEO A;  1PMI A;  1LOG A;  4BQW A;  5IK4 A;  4GXL A;  1FOD 3;  3WG3 A;  3AKT A;  4E2S A;  5LK7 B;  5HI0 A;  4QT6 A;  3ETP A;  2WNV A;  3RYK A;  3FUO A;  2XJU A;  4WVV A;  4HPK A;  3I2G A;  4PF1 A;  5D2A A;  4AR2 A;  5F37 A;  1COV 3;  2UY9 A;  1FMD 2;  1QJU 2;  1YWK A;  3MGU A;  5FZ8 A;  5JSR A;  3IKW A;  3NMB A;  2VOX A;  4QDR A;  1AJK A;  2RS1 1;  4GAZ A;  3H8X A;  1V9U 3;  2D98 A;  3BI3 A;  2VEC A;  5CNA A;  1C1F A;  3N7L A;  1A78 A;  1FT9 A;  2GC0 A;  4P02 B;  1HJF A;  5C8W A;  1JYV A;  1FPN 3;  1D0G A;  4X6R B;  3UT0 A;  2ZS6 B;  4NHK A;  3WDU A;  4A6S A;  4NVP A;  1D4M 3;  1HN1 A;  4TLF A;  1BYH A;  4XTP A;  3WQB A;  3SH3 A;  4CDU C;  3N9O A;  4L0P A;  1UWW A;  1OI6 A;  2QDN A;  4URA A;  3V56 A;  4YW1 A;  4AK3 A;  2FMY A;  1SPP A;  3UKN A;  4JGY C;  4BH9 A;  4CDW A;  4Y5T A;  2VMH A;  1QDO A;  4JKK A;  2RR1 1;  1MEC 2;  3HVD A;  5A80 A;  1RED A;  5A3O A;  4XCB A;  1FYU A;  5JZG B;  4N43 A;  4YW5 A;  5A6Z A;  1RUF 1;  1QJE A;  1XU2 A;  5DXD A;  1HXS 3;  2A6V A;  1AR7 1;  4GB3 3;  4E4S A;  3LOI A;  3MI8 A;  2EIG A;  3ON7 A;  1QDC A;  3C3V A;  1RUF 2;  1KIT A;  4NO4 A;  5JCT A;  5GZG A;  4DPN A;  1BVV A;  3PNA A;  4IDZ A;  1YQ2 A;  3RZM A;  1RIR A;  3JUU A;  1R1A 3;  1XPW A;  2JD4 A;  2W92 A;  1JYW A;  3CHX A;  1KS4 A;  4COU A;  4YVW B;  3UL2 A;  1UXX X;  2EAK A;  3UJQ A;  2D6N A;  3RZL A;  1O5L A;  2VCA A;  4QQP A;  2VZ3 A;  2YUE A;  1S2E A;  4AHX A;  1F4H A;  4FTB A;  4HPK B;  2H6C A;  1GUI A;  3B00 A;  3TNQ A;  4Q4W 3;  1VBC 3;  5JZG A;  5LBF A;  5LZ6 A;  3NJZ A;  1O7F A;  3BPS A;  2JE7 A;  3FLR A;  3AKS A;  4HET A;  4PJY A;  2WWS A;  3RMX A;  1VAM A;  4QU1 A;  4D94 A;  5FP7 A;  4ZZ8 A;  3OPZ A;  1YEW A;  2ERF A;  3CNA A;  1ND3 B;  5EP9 A;  2A70 A;  4V1P A;  4YFZ A;  2BZD A;  3DKQ A;  5T54 A;  4P5Y A;  4XFH A;  4S2F A;  5IVV A;  3SH4 A;  4BQY A;  2Y6J A;  4QQ2 A;  3TN9 3;  4LOT A;  1L7Q A;  5C8C B;  4FPC A;  4XVH A;  3T08 A;  3WV6 A;  4RR3 B;  1QJY 3;  3AKP A;  1POQ A;  1IGO A;  5J98 B;  3VHR A;  3DUI A;  1D0H A;  3K51 A;  4WV8 A;  1HKD A;  1AYN 2;  3HPN A;  4D7T A;  2XJV A;  2AH2 A;  4LR4 A;  4ORF A;  2HWC 1;  5FZ1 A;  3C2U A;  1CAV B;  4ISR A;  1QJX 1;  3USU A;  1QXJ A;  5E88 A;  1YFW A;  2VUA A;  1L3J A;  3ZSK A;  1RUJ 3;  3HNM A;  1OUR A;  1S2B A;  5A1A A;  1LOE A;  2H6B A;  3ZFE B;  2ZAH A;  2Y0O A;  1UX7 A;  1VBE 3;  4YVS A;  3LB9 A;  4CDX C;  2J1U A;  4KL1 A;  4LK6 A;  3VGI A;  1GP5 A;  3OGG A;  1QU0 A;  1RUI 3;  1GIC A;  5FWJ A;  1IZ3 A;  3ZYB A;  3ZSM A;  5L7O C;  1XOY A;  3M4F A;  4DUV A;  3H3U A;  1H2M A;  4CP2 A;  4HN0 A;  2VJX A;  4OUE A;  1AL2 2;  1KFU L;  3N35 A;  1I5Z A;  1AYM 3;  1W2T A;  1WLC A;  3ZYI B;  1YO8 A;  1PO2 2;  1RGS A;  1NE6 A;  1PGW 1;  2WO2 A;  5FPL A;  2B8M A;  4GJZ A;  4UFK A;  2OZ6 A;  3QD6 A;  4O7X A;  5CBL A;  5BXX A;  5IVF A;  1PO1 1;  2Q8C A;  4CCE A;  2VVE A;  3AL5 A;  1ULG A;  2D6K A;  4LEJ A;  3H50 A;  3UK9 A;  3WHU A;  4HBN A;  1SLB A;  3ACH A;  4AVS A;  2B39 A;  3J8F 1;  5C3S A;  3ZPY A;  3Q8C A;  4Y33 A;  3QH7 A;  2BGP A;  1WW4 A;  5HXM A;  3I2F A;  2GU9 A;  2GAL A;  1L7R A;  3MW4 A;  4XJW A;  2EIB A;  5T3N A;  4OQ8 A;  1CX1 A;  1OD5 A;  3CIH A;  5LBB A;  4CSW A;  1DQ0 A;  3CF6 E;  3W20 A;  4XAB A;  5DAW A;  2UU8 A;  1PNF A;  3POJ A;  2DFB A;  2DFC A;  2WIN B;  1LU1 A;  1W8W A;  4JC1 A;  4Q4V 1;  1QQP 2;  1ZZ9 A;  5FFO C;  1QJF A;  4ERO A;  4HKO A;  1VR3 A;  1X82 A;  5JSP A;  4FTE A;  5KHH A;  3VDD C;  1NA1 B;  3AM2 A;  3WQ1 A;  4WVW A;  1XNC A;  2XLA A;  2YG0 A;  4Z92 B;  1SCS A;  5FOB B;  1T6B X;  1W0N A;  2WFF 1;  4GUL A;  4EZ4 A;  3OUJ A;  1OA2 A;  4M3C B;  2HWE 1;  1JOP A;  4N9I A;  4XW3 A;  5DAV A;  5FXW A;  4AL9 A;  2Y38 A;  3NW4 A;  1HB4 A;  1UZY A;  2PYT A;  2Y34 A;  3HT1 A;  1HB1 A;  2ZZQ A;  4K1Y A;  4LHN A;  1OUS A;  2WT1 A;  3RQ0 A;  3J26 N;  4AHZ A;  5AFB A;  1FAY A;  5FJH A;  5I8T A;  3N4M A;  1O4T A;  3DXU A;  1DYP A;  2D93 A;  3QCW A;  4BJ0 A;  2Q8O A;  1GZW B;  2IXL A;  2XWJ B;  3LDR A;  2WNU A;  1W3V A;  5LAS A;  4XIL A;  4YFW A;  4BQX A;  4QGL A;  4TTG A;  3AZV A;  3ENR A;  2E26 A;  2VNR A;  3ROU A;  1AXY A;  2YDE A;  2GMM A;  5CZK A;  5A3P A;  4NOT A;  3HBK A;  4L92 A;  2W2I A;  2HYX A;  3KM5 A;  2ZCW A;  4JCK A;  1JYT A;  1Z7S 1;  3M1H A;  5FZ4 A;  1VBC 1;  4Y3O A;  1NE4 A;  2VMC A;  1CON A;  2VMI A;  4ZXK A;  3EO6 A;  2RV9 A;  4CEY C;  1MS8 A;  1EV1 3;  4Y4Y A;  3MIB A;  4EN6 B;  3RYR A;  2JJ6 A;  5H9Q A;  4XF9 A;  5A33 B;  2BOI A;  4LA3 A;  1WW6 A;  4B1M A;  1H9W A;  2HWB 3;  1W8Z A;  1RUE 2;  2P3K A;  4S2H A;  2CWS A;  4JDN A;  1PX3 A;  2DF7 A;  4EQV A;  2BVV A;  3T09 A;  3VBU B;  2D43 A;  3U11 A;  3N9Q A;  4LLF A;  2W39 A;  4AWD A;  2WUH A;  3V65 A;  1ZYB A;  1UOF A;  3M7A A;  2DVG A;  3DPR B;  3SHR A;  4XDQ A;  5C70 A;  4UW6 A;  4ES9 A;  1RUI 1;  4FPJ A;  5BUV A;  4XCA A;  1AR6 3;  3H1Y A;  4C1X A;  1FV2 A;  1YQ8 A;  4Y1U A;  4YVS C;  1PMH X;  3FC0 A;  3ZYP A;  1M06 G;  1OOP B;  2ZGP A;  2ARC A;  3ZMO A;  2VOW A;  2VZV A;  4A3X A;  1OFN A;  3AP6 A;  5L9R A;  1WCS A;  5IAV A;  1H9P A;  1CJD A;  4IV1 C;  4NWV A;  1YXW A;  5K4L A;  4BZ4 A;  5LA1 A;  3PUS A;  1PGS A;  4YGB A;  4CXW A;  1YI7 A;  1POV 1;  4IE4 A;  3BB6 A;  4MSV A;  4SLI A;  5F3G A;  5K7P A;  2PAK A;  2NMN A;  1PO1 3;  4I3G A;  3FE5 A;  4IE7 A;  4AED B;  1JZ5 A;  1CAU B;  1EUU A;  5KXE A;  2HBU A;  1HV0 A;  2BTV C;  3VBO C;  1VPH A;  1MZE A;  4LBJ A;  2DUQ A;  3M8L A;  4NHX A;  1VMH A;  2DCY A;  3KGL A;  4C1W A;  5LRS A;  2XUE A;  1MQT C;  1W3X A;  1IPJ A;  2F4P A;  4CTE A;  5J37 A;  1RC6 A; 
#chains in the Genus database with same CATH homology
 2QQJ A;  1GOG A;  2VOT A;  3ACI A;  3NRU A;  2W1U A;  3FL7 A;  3VDC A;  1UYX A;  4A3Z A;  1WCQ A;  3WNM A;  1P8J A;  3NQH A;  1JYN A;  1UMH A;  4A45 A;  5JXG A;  2W5F A;  1ULO A;  2YFZ A;  3ECQ A;  4AG4 A;  2LW8 A;  1TG7 A;  2WZ8 A;  4CVU A;  2VME A;  4M4P A;  2C26 A;  2Y64 A;  2QQL A;  5EJZ B;  3WNP A;  3HEI A;  3T2O A;  3VD7 A;  4DXT A;  4DXS A;  1UY4 A;  1JZ4 A;  3A23 A;  3HJR A;  3BGA A;  3WSO A;  1NX9 A;  3SEE A;  4D8M A;  2XOM A;  2Y6L A;  4BK5 A;  2QQO A;  2R7E B;  4MOA A;  3A21 A;  1JZ3 A;  3GXU A;  3T0D A;  4QDQ A;  3I3D A;  4A42 A;  2C4X A;  2WO3 A;  2RJ2 A;  5JXJ A;  3U37 A;  1GOH A;  4LHS A;  1J84 A;  1XNT A;  2W95 A;  2W46 A;  5DPN A;  2C9K A;  2LS6 A;  3OGS A;  2YFU A;  1K12 A;  3IDA A;  1BHG A;  3I3E A;  3WF0 A;  3WNK A;  3HOB A;  3WF3 A;  2V72 A;  1DLC A;  5DMY A;  2W1W A;  4MGQ A;  2WQ8 A;  1SG3 A;  5IHR A;  3UNP A;  1W8O A;  3T0B A;  4MO3 M;  3A22 A;  3MO4 A;  4HG6 B;  1I5P A;  1UZ0 A;  3CMG A;  1H6X A;  2J22 A;  2KD7 A;  3NJV A;  3WF2 A;  2QQK A;  2JKX A;  1DYO A;  3D3A A;  4GZ9 A;  4PT6 A;  2WO1 A;  3MV1 1;  1OF4 A;  4JKM A;  3NNG A;  3VD9 A;  1GNY A;  5G04 L;  1XC6 A;  2W87 A;  2WAA A;  4YPJ A;  2WYS A;  5IJR A;  3VDA A;  5JR2 A;  3PUH A;  4OZO A;  2B4K A;  1JI6 A;  3J7H A;  3SKV A;  2ORZ A;  4GWI A;  3DYO A;  3THC A;  4CUB A;  4FI9 A;  4BK4 A;  1KGY A;  4BDV B;  3K46 A;  3MUZ 1;  3MV0 1;  2DCK A;  3GM8 A;  3SEP A;  3HNB M;  4CU9 A;  2E33 A;  4ET7 A;  1K42 A;  4ZY9 A;  5FUI A;  4XUT A;  4OYU A;  1JZ2 A;  1EUT A;  4GWJ A;  4JX0 A;  2VMF A;  5JUV A;  4DEQ A;  3ZM8 A;  3GDB A;  5IFT A;  3I2I A;  3FHA A;  2VZU A;  2XON A;  4CU6 A;  2VC9 A;  3C7H A;  2J1R A;  3VD5 A;  1GOF A;  3I3B A;  2VZR A;  2WAB A;  3OBA A;  1NUK A;  4Z2A A;  4QPW A;  1US3 A;  1WKY A;  3WNL A;  2OKX A;  2WN2 A;  3K77 A;  2ZEZ A;  2J1E A;  3I2J A;  2EIC A;  3EB7 A;  2W3J A;  2HLE A;  5B4N A;  4TXW A;  2XQX A;  2BER A;  1SHW B;  4UOJ A;  3LPG A;  2W1S A;  1T2X A;  3NJX A;  1O8S A;  1GMM A;  1KEX A;  2X09 A;  3UET A;  4DXR A;  3E1F 1;  2W9X A;  4ARX A;  1OH4 A;  4OMC A;  1UYZ A;  3A7Q A;  3I2K A;  3VDB A;  2VQU A;  3FN9 A;  2PQS A;  4KMQ A;  1TVG A;  4P08 A;  1IQD C;  1PX4 A;  2V5D A;  3VD3 A;  1OF3 A;  3ETP A;  2J1S A;  3IAP A;  5G05 L;  3ABZ A;  3I2G A;  4PF1 A;  3CDZ B;  3K4A A;  4XUP A;  1W8N A;  2VZO A;  4QDR A;  5C7G A;  1O59 A;  2ORX A;  5C71 A;  1UY0 A;  1JYX A;  3WEZ A;  1DP0 A;  3ACG A;  4BXS V;  3CZJ A;  4P02 B;  3THD A;  1JYV A;  2VZT A;  4A41 A;  2VZS A;  4E8C A;  1GQP A;  2VZ1 A;  2VMD A;  1HN1 A;  3WQB A;  4L0P A;  1UWW A;  2BBA A;  3ACF A;  3I97 A;  2XHN A;  4JKK A;  2VR4 A;  2YC2 A;  1UY1 A;  4QX2 A;  4QAW A;  4A44 A;  2VZQ A;  2J1A A;  1W9T A;  2WAO A;  3T0A A;  3IB3 A;  4XUN A;  1YQ2 A;  2QQI A;  2DCJ A;  5J1X A;  2QBX A;  1XPW A;  2W92 A;  1JYW A;  5B4X A;  2J1T A;  1W9W A;  3BN6 A;  1UXX X;  2VZP A;  4CU7 A;  2VCA A;  5LA2 A;  3OGV A;  2VZ3 A;  1F4H A;  3DYM A;  1GUI A;  2DDU A;  3SKJ E;  5IYY A;  3WNO A;  4A6O A;  5LA0 A;  2YB7 A;  5F7U A;  4CUC A;  4ZZ8 A;  3OEB A;  1UMI A;  4OMD A;  4RYD A;  1JZ7 A;  3I2H A;  2ZXQ A;  3VD4 A;  3EYP A;  1H6Y A;  2BZD A;  4P5Y A;  2VO5 A;  2J1V A;  2BGO A;  1OD3 A;  3IAQ A;  2Y6J A;  1D7P M;  3C8X A;  1L7Q A;  2E32 A;  1GU3 A;  4XVH A;  3T08 A;  3CZU A;  1JZ6 A;  5JXH A;  2JD9 A;  2J7M A;  3HPN A;  4D0Q A;  4QX1 A;  4KWU A;  5EJ1 B;  1W99 A;  3PUI A;  3C7G A;  3HNM A;  5A1A A;  4JHZ A;  4ZZ5 A;  1UX7 A;  4CU8 A;  4DUW A;  4CUA A;  2J1U A;  2ZEX A;  1K3I A;  1NKG A;  3LE0 A;  5I0D A;  5HPO A;  5IFP A;  5JXI A;  2B9V A;  4XUQ A;  4DUV A;  2VQT A;  4A4A A;  2CDP A;  3UES A;  2VJX A;  4OUE A;  3LQC A;  2CDO A;  1UY2 A;  3K4Z A;  2WO2 A;  4LQR A;  3C7O A;  3WF4 A;  1RYY A;  1ULP A;  2Y6K A;  3OGR A;  4RN5 A;  3OG2 A;  3WF1 A;  3OEA A;  3DEC A;  2Z4F A;  3ACH A;  2W91 A;  3HN3 A;  5DN2 A;  1MPX A;  3III A;  4QX0 A;  2BGP A;  5HXM A;  3I2F A;  4PQQ A;  1L7R A;  2EIB A;  1K45 A;  2VCC A;  4IUG A;  1CX1 A;  3CIH A;  2VCB A;  2WDB A;  2EIE A;  4UI9 L;  4MGS A;  2YG0 A;  1NAE A;  2JE8 A;  1W0N A;  2WZE A;  1PMJ X;  2EID A;  2X05 A;  3P1I A;  3P6B A;  5EIY B;  4W8J A;  3CQO A;  3W5N A;  3LEG A;  3AC0 A;  4XUR A;  4BJ0 A;  4KI5 M;  4DUX A;  4ARY A;  1W9S A;  4TTG A;  2ZEW A;  2E26 A;  1US2 A;  4QB2 A;  2RVA A;  3K75 B;  3GGL A;  5CZK A;  4XUO A;  4P00 B;  4XZU G;  2HYX A;  4DEV A;  3JXS A;  3LPF A;  1JU4 A;  1OT5 A;  3MUY 1;  2VMC A;  1LNS A;  1UYY A;  2X10 A;  3HNY M;  5CYY A;  1J83 A;  2RV9 A;  2W47 A;  4JKL A;  1JZ8 A;  4UAP A;  3CKH A;  2JDA A;  4LKS A;  2VM9 A;  2YC4 A;  2Y6G A;  1CZS A;  4E8D A;  4ZXE A;  3LEK A;  1JU3 A;  3K4D A;  4LPL A;  1PX3 A;  4QB1 A;  1SDD B;  3DYP A;  3T09 A;  2QQM A;  4QDS A;  3WNN A;  3MBW A;  5DQ0 A;  4W50 A;  2E31 A;  2WUH A;  1CIY A;  4QB6 A;  4M4R A;  3T2P A;  3C7E A;  5C70 A;  1R64 A;  4MAD A;  5LCW L;  3C7F A;  3T2Q A;  3OB8 A;  4W4Z A;  2WBK A;  3LEI A;  2QQN A;  1O8P A;  1PMH X;  2W1Q A;  2L9L A;  1XNA A;  3W5M A;  2VL4 A;  2VZV A;  2V4V A;  1F4A A;  2VTF A;  3FHQ A;  2Y6H A;  5LA1 A;  4QX3 A;  2W94 A;  1UY3 A;  5JMO A;  2WN3 A;  2ZEY A;  1CZV A;  1CZT A;  1JZ5 A;  1EUU A;  1JHJ A;  2Y8K A;  2ID4 A;  1UXZ A;  3F2Z A;  4AAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...