4LKSA

Structure of cbm32-3 from a family 31 glycoside hydrolase from clostridium perfringens in complex with galactose
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
157
structure length
157
Chain Sequence
LYKKAGSEFALDSSKLEAIYATSEADRDYKENAVDGDENTIWHSAYQAADKLPVSITIKLDKAYDLNQIDYLPRQNSRNGHVTEYKIETSLDNENWTEVRTGNLEVNEAGNALANRGYNPIRFNTINAQYLRFTALKTLGDTNNKYASAAELVFYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Sugar binding protein
total genus 37
structure length 157
sequence length 157
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4lksA00
3P1IA 1J83A 1JU3A 3T2PA 1JZ4A 1OF4A 4CUAA 4CVUA 1OD3A 4Z2AA 5LCWL 3MBWA 3WF1A 3HN3A 1K45A 1JYNA 2Y6GA 1DLCA 1L7RA 1CX1A 5G05L 1GQPA 2V5DA 4L0PA 4BXSV 1W9SA 2LW8A 2VC9A 1JZ7A 4P5YA 3THCA 3T09A 2JD9A 2X10A 3LPGA 3MV11 4QB2A 2QQIA 3LEGA 1T2XA 2VJXA 3CKHA 3IDAA 1JYVA 4DEQA 1PX4A 3HOBA 1IQDC 3F2ZA 4W8JA 4E8CA 4ARYA 2VZVA 3CMGA 3ACGA 3K4AA 2EIDA 2VZUA 2QQJA 3A21A 1NX9A 2YFZA 5IYYA 2W91A 4AAXA 3I2FA 3I2KA 3A7QA 1W9TA 3NJXA 2PQSA 3J7HA 3NQHA 3C7GA 2ZEXA 1J84A 3GGLA 2J1SA 4P02B 3I3EA 4DXRA 5C7GA 1JZ5A 1TG7A 1F4AA 3WNKA 4QDQA 1UMIA 1WCQA 3OBAA 4QDRA 4A6OA 4RN5A 2E33A 2V4VA 2Y6JA 1H6YA 5JXIA 3GM8A 5IJRA 1NAEA 1JZ6A 1JZ8A 4FI9A 3EB7A 1NKGA 2ORZA 2W87A 2VQTA 3ACIA 4QX3A 3I3BA 3LE0A 3AC0A 4GWJA 3WNLA 1P8JA 3A23A 2B4KA 1O8SA 4OYUA 3C8XA 1F4HA 2CDOA 2QQKA 1W8OA 2VZOA 1UWWA 3U37A 4GWIA 1UX7A 5DQ0A 1R64A 1GOHA 2VZQA 1KEXA 5DPNA 1US3A 2J1RA 3ACHA 4ZXEA 3I2JA 1XPWA 3VDBA 1W99A 3HNYM 3WF3A 2R7EB 1JHJA 4JKKA 1XNTA 2QQNA 3VDCA 3WF2A 2WZEA 5CZKA 2VCBA 5B4NA 1GNYA 4OMCA 2ZEZA 3ECQA 1BHGA 1JZ3A 1CZTA 1DYOA 3C7EA 4A41A 4XURA 3UETA 2VM9A 1W9WA 2EIEA 1SDDB 3NNGA 3T0BA 1JI6A 3FHAA 2W9XA 1PMHX 4KI5M 5LA0A 3MO4A 4XZUG 4E8DA 4YPJA 2XHNA 2ORXA 4ZZ8A 1UYXA 3W5NA 4KMQA 1US2A 1XNAA 4W50A 3IAQA 5IFPA 3WNNA 3ZM8A 1DP0A 4JX0A 2OKXA 1GU3A 2W1UA 2Y8KA 1KGYA 1CZSA 1SG3A 2WYSA 4KWUA 3I97A 3WNMA 3SEEA 1PX3A 3EYPA 5C70A 3UESA 3WNOA 2VZPA 2VL4A 4DUVA 5JXGA 5CYYA 4LQRA 2XOMA 4QX1A 2YC2A 3HEIA 2W94A 4XUNA 4A4AA 2X09A 4DUWA 3WEZA 4QAWA 2VMEA 4QPWA 3BGAA 1UY2A 4QX2A 3THDA 2W47A 1TVGA 1PMJX 5LA1A 1LNSA 4PF1A 2VMCA 5EIYB 2J1EA 3VD9A 2B9VA 2VMDA 3WSOA 2W1QA 5J1XA 3A22A 2HLEA 2W46A 1GMMA 5IFTA 4BDVB 2WO3A 1O8PA 3VD3A 1WKYA 2YC4A 5DMYA 5I0DA 3GDBA 3PUIA 3VDAA 3C7OA 3LEIA 3MV01 4A45A 1HN1A 3ABZA 1XC6A 1H6XA 2VZSA 2WQ8A 4GZ9A 3K75B 3OEAA 2E31A 3MUZ1 1EUTA 4MGQA 5JR2A 4QB6A 2WO2A 2X05A 3HPNA 4M4RA 2WABA 1GOFA 3ETPA 5A1AA 1GUIA 2XONA 1L7QA 1K12A 2WAOA 3SKJE 1MPXA 1JZ2A 2XQXA 1O59A 2RJ2A 1OT5A 4D8MA 3OGVA 4MGSA 3BN6A 1UYZA 2E32A 3T2OA 1YQ2A 5C71A 3FHQA 2VZTA 2VO5A 5HPOA 5JXJA 2BZDA 1UY1A 3CDZB 1JYXA 4JHZA 4ZZ5A 1EUUA 4CU7A 2VOTA 2W92A 1UY0A 4IUGA 2WUHA 2J1AA 2J1VA 3T0AA 4D0QA 2WO1A 3DYOA 2ZXQA 3FL7A 2QQOA 3K77A 1ULPA 5EJZB 5EJ1B 3I2IA 3NRUA 3OG2A 2HYXA 4LPLA 2CDPA 1CZVA 4RYDA 5FUIA 3P6BA 4TXWA 3W5MA 2VCAA 2BBAA 2Z4FA 4HG6B 3CZUA 3VD7A 3IAPA 5DN2A 3SEPA 4CUCA 1UXZA 3I3DA 2Y6KA 4UOJA 2VZ3A 5JMOA 3ACFA 3VD5A 2JDAA 3WQBA 2W1WA 2WAAA 2J22A 2LS6A 4MO3M 4DXSA 2C4XA 4M4PA 2ZEWA 4JKMA 4XUTA 4CU6A 5JUVA 1UYYA 4LKSA 4CUBA 1ULOA 3C7HA 3CZJA 3HNBM 5IHRA 3JXSA 4XUPA 2DCJA 3DECA 4A3ZA 4PT6A 3T0DA 4XUOA 2EIBA 1JU4A 5HXMA 3VD4A 3DYMA 5B4XA 3OGSA 4DUXA 3LQCA 3DYPA 4BJ0A 1W0NA 3D3AA 2QQLA 2RV9A 2W1SA 3LPFA 2DDUA 3CQOA 2Y6LA 2W3JA 3LEKA 4AG4A 1K3IA 2WBKA 3HNMA 3SKVA 4QB1A 2C9KA 1UZ0A 2WN3A 2YG0A 2WDBA 4CU9A 4QX0A 2WN2A 4MOAA 4JKLA 1UY4A 3K46A 3OGRA 3HJRA 3I2GA 1K42A 2JKXA 1OF3A 3NJVA 2RVAA 3FN9A 4ET7A 2EICA 2Y64A 2YB7A 1NUKA 5G04L 2VR4A 3IIIA 3K4ZA 1RYYA 2BGOA 4QDSA 4XUQA 4DEVA 4A44A 4BK5A 2DCKA 2J7MA 4CU8A 3CIHA 2J1UA 2ZEYA 2VMFA 3T2QA 1SHWB 1W8NA 3I2HA 3OB8A 4BK4A 2ID4A 2VTFA 5JXHA 4W4ZA 1D7PM 3WF0A 4A42A 3OEBA 5LA2A 4TTGA 4OUEA 1UY3A 1GOGA 2VCCA 4UI9L 4LHSA 4DXTA 4P08A 2QBXA 2KD7A 2VQUA 3K4DA 4UAPA 3IB3A 1I5PA 4MADA 2J1TA 4OZOA 5F7UA 3GXUA 2QQMA 2E26A 4P00B 2VZRA 2V72A 4XVHA 3PUHA 2W5FA 1JYWA 3WNPA 3UNPA 4ARXA 1UXXX 2BERA 3C7FA 1OH4A 2Y6HA 3WF4A 4ZY9A 3E1F1 2VZ1A 4PQQA 3MUY1 2JE8A 2BGPA 2L9LA 2W95A 2YFUA 2WZ8A 4OMDA 3T08A 2C26A 1CIYA 1UMHA
chains in the Genus database with same CATH superfamily
4B29A 1J83A 2C9AA 1RINA 1DQ6A 1OF4A 1UN1A 1PMIA 3I59B 4CVUA 5DZFA 1YQ8A 2ES3A 1AYM2 1MS3A 1RUE1 2RMU3 5FO8B 1IPKA 2YBPA 4JGYA 1K45A 4F8AA 1GWLA 4EROA 1AR93 2Y6GA 1HRI1 1WMXA 2ZJCA 1S0DA 4O9GA 1RUJ2 4Q4V2 1UPSA 3D4KA 3UGGA 1FOD1 1GQPA 2H0BA 1GQGA 2V5DA 1REEA 5T5LA 3ZXJA 3TRSB 5J48A 4IV1C 2HWC2 3NV3A 1RVF3 4JDOA 1OD5A 4P5YA 5FYCA 3THCA 1J58A 1RHI1 3H0OA 4RL7A 3MIBA 2OX0A 2P6CA 1LOAA 2QQIA 3RWKX 2PHUA 1VMHA 2XDVA 3RZLA 4DQAA 2P4EA 3I3QA 1DGRA 1JYVA 2YDEA 1PX4A 3HT1A 3NWKA 1UW8A 3T1LA 4BMEA 3ZXAC 5I0RA 4Q5OA 3O1RA 4QXKA 2LUWA 4ITCA 4Q0VA 5BY5A 5A7QA 5FXVA 2ADEA 5JDBA 2PLV1 4GH4A 3MF6A 1Q3EA 2DTYA 3NKGA 5KXBA 2W91A 4LA2A 4CDWC 5CKNA 1WA6X 3H8XA 4IEVA 1IOAA 4XF4A 1GLHA 3TEYA 1CAVA 1NCRB 1UCXA 3GGLA 5BV6A 4S2HA 2J1SA 4J25A 5HV4A 2B45X 1RL3A 2P3KA 2HKXA 3AFGA 3IPVA 3KCYA 2VNOA 4DXRA 1V6JA 5K4LA 2YXSA 1TG7A 2DVAA 4HKLA 1MQTA 4XTMA 4AOCA 4IEZA 3ITQA 1JODA 1F2NA 1W2OA 3WNKA 4HANA 4MUVA 4F7ZA 2BU9A 1RUC3 2AC1A 4E2QA 1W90A 4XBNA 4MSVA 4RN5A 1LJ7A 1JXNA 2BVVA 4LJHA 5A7WA 3HMYA 1S2EA 5CFDC 2HBTA 1TEIA 5JAXA 4Y1VA 5EWSA 1NAEA 5FZ6A 2RDRA 1ZBA2 3PHMA 1EY2A 5DAVA 3KQRA 3R6SA 3EB7A 1LRHA 2ORZA 2W87A 4QU1A 4XMIA 5AFBA 1K5JA 2EVXA 1TME2 4RGGA 1S0BA 2WLQA 3WDUA 2QDRA 3I3BA 1XE0A 3OUJA 4IERA 1XU1A 1Z78A 3J9SA 4ES8A 4Q29A 4CDXB 1Q8VA 2WNVC 4HMZA 4FPKA 3C8XA 5FBJA 5H9QA 4K20A 2ZACA 4AVSA 1W8OA 4GWIA 3LGRA 1MZ6A 1VBB1 2PTMA 1G6NA 5JIUA 3ON7A 1QOSA 4QU2A 5DUXA 3WQ1A 2BEOA 1KEXA 5F37A 1R082 3MYXA 1US3A 1X9PA 3LB9A 2ETEA 1UMZA 1VBA2 2JB8A 4R9CA 4XBLA 3G7DA 4FPCA 5F9TA 3MICA 3ZN4A 1NLQA 1VBE1 2ZX0A 3HNYM 3ZR5A 4QGLA 2E7AA 5FQ0B 3NNFA 2KXLA 1ZREA 2FZ1A 3J7MA 2VVEA 2WZEA 2ZZQA 2XG3A 5BNNA 3ZMNA 2JICA 1HV0A 1CAWA 1GNYA 1MS1A 3DEMA 2ZEZA 3WCSA 4FPHA 4LHLA 3CJIB 2HWB2 3C7EA 3RMXA 3UKTA 4XURA 1YFUA 3ZFGA 4A41A 5GZGA 2R042 5FZDA 4OI1A 4YW3A 2VM9A 4CZSA 5ACA3 1ND3A 1AR63 2ZX3A 2E6VA 4W6WA 1JI6A 3QH6A 3PIJA 2W9XA 1ZBE1 4KI5M 1PO13 2FCUA 2YPJA 3VBRB 5EXOA 5CKMA 1HLCA 4E8DA 4V2WA 2UY8A 4UW5A 2DVBA 3DV8A 1SQ4A 2XHNA 2ORXA 1OUSA 2KR2A 4SBVA 4XXPA 1K5MC 5FKBA 1AYN2 4HL0A 1US2A 2EAKA 2UY9A 5LB6A 1QMJA 4NHKA 2WJSA 1NCQB 2BUKA 3NW4A 4XFGA 2OKXA 4L8QA 3ROUA 5CISA 1KGYA 1CZSA 2YGLA 1LHNA 1ND2A 1XJAA 3I97A 4HVQA 3UYJA 5GZCA 3PUSA 4GWNA 1KD7A 5FZCA 1MEC2 1V00A 4LBOA 4AQ6A 1W0PA 4HBNA 4QXCA 1PX3A 1SBDA 1QWRA 2WC2A 4XIKA 3ZSJA 4MZUA 1APNA 1W8HA 2VZPA 3WLUA 1ULFA 2G9GA 5JXGA 3KD4A 4Q4X2 1I9RA 2AZ5A 4XDQA 4C8DA 5JMCA 2XOMA 1EV11 5GALA 4QX1A 1H2KA 3LKJA 4XUNA 1NQDA 2BNNA 5F5IA 5FXWA 3TEXA 3T1MA 1W2NA 4FAGA 3MIDA 4OUMA 4A3XA 1WUVA 1UY2A 2CWMA 1SLLA 4GMP3 3THDA 5BNQA 1J1LA 3OGJA 5C3PA 5KHGA 4ISQA 3AMMA 1PMJX 5LA1A 4AQSA 2CSGA 2LRPA 1RUF2 4CCEA 2IUWA 2WNUB 2AR6A 4TWTA 5KHKA 1JBCA 3VBHA 4LORA 2CAVA 1F31A 5A7NA 2B9VA 1NQJA 5DUWA 5LK5A 2G4IA 3ASIA 3WP3A 1TMF1 2EXJA 2HLEA 4Y5SA 3IZOA 1GMMA 3O0VA 3O0XA 1A78A 1X7NA 2A73B 2PMWB 5HXVA 4DFSA 4GB31 3WVJA 1OXCA 2J42A 3POJA 4NROA 1WZXA 5IVBA 3THTA 1RUD1 5JPMB 5C4WB 1OLME 1LB2A 4LUKA 4OHWA 1SBEA 1XNKA 5BNPB 2RMU2 3ES4A 2GDFA 2R061 3UKNA 3VBUB 1AUYA 4YZ2A 1URXA 1AR92 2VBPA 3PMEA 5I0DA 5LRSA 3ZR6A 1KITA 1UIKA 3GF6A 3CL1A 4PBPA 1IS3A 4HN0A 5JI9A 3ABZA 1HRV3 4NJ4A 1H6XA 1W05A 1RVF2 1NZIA 4FOWA 2P3JA 2VXRA 3PU8A 4P9WA 1QJU1 3OEAA 3VBFC 4BH9A 2D5HA 2E31A 5KHIA 1AR83 1RUG1 4QB6A 1AVBA 3VUOA 4NO4A 3FX3A 1IGOA 1XXNA 5GZEA 4C91A 3AVRA 4W6YA 5LEKA 4FFHA 2H6CA 4MXWB 4AGGA 3ZYPA 2BBVA 4AEJA 4LOSA 4XF1A 2ARAA 2DCZA 2A6XA 3ILRA 1D2SA 1BYHA 5AVPA 5CADA 1WLTA 3B02A 4N8MA 2E7TA 3O5SA 4IEPA 5FY1A 1POV0 1PIV2 1R1ZA 1YCIA 5FXXA 4JGYC 2GNMA 1QIQA 1KQRA 2XJSA 3O0WA 1POV3 4KBBA 1DFQA 5LBCA 3H1WA 1O4YA 1EP0A 3FHQA 3P3NA 5JXJA 1IQAA 3LCPA 2TEPA 3AJYA 1BCXA 4JHZA 3W9AA 4ASMB 1HKDA 4JRAA 1Q43A 2VMHA 2VOTA 2YU2A 1GBGA 3VHNA 3OBZA 3POFA 4IE4A 1YFWA 2J1AA 3NJZA 4XBQA 4FPJA 2EA7A 4M00A 3NKTA 5J98B 2OIIA 3DYOA 3RJRA 1C8M3 1HJFA 4OHXA 5C9AA 3SHRA 2FDFA 4P14A 5EJ3A 1CAVB 2HYKA 3I4IA 4L92A 1BQPA 5LY1A 4GD4A 2Q1ZB 5HCAA 5EJ1B 3BIEA 3I2IA 3OG2A 2NLRA 1Y9MA 4XJ8A 4GH4C 2PQQA 2AEYA 4XQWA 1OSGA 1R091 5DAPA 2R071 2BDRA 3AX4A 2QCSB 5ABJA 3BVCA 3P6BA 5LY2A 4YVWC 4LUMA 4YZ4A 2D3RA 1OPOA 3OTFA 2IXJA 5A7WB 2Q8DA 3RQ0A 3BTYA 2RDQA 4IEWA 2PAEA 3CZUA 1QQP1 1PGSA 1YXWA 1ZZ8A 5CU1A 5DN2A 3ZLIA 4AI2A 3RZMA 2QFEA 3I3DA 2VCMA 2Y6KA 3PDQA 3URFA 4RQPA 1ULEA 3VL9A 4XFCA 3ZYJB 4Q8LA 3H3UA 2GNBA 1HN0A 1MQTC 4N9HA 5A3TA 5JIAA 1TQ5A 3O12A 3VHOA 2OQ6A 2PHRA 4WVZA 4W6XA 1VALA 4M4PA 4EN8B 1FI2A 4QPIA 5FXZA 3S5QA 4UBHA 4GULA 4JKMA 4FBFA 4XUTA 5C8CA 4N43B 5D21A 2WS92 3UGHA 4J1WA 5A3LA 4CUBA 5DG2A 1ULOA 3WHUA 4LKDA 2WFPA 3U4SA 4BPZA 1FX5A 4ZU7A 1C28A 5IHRA 2ZABA 1H1AA 5EP9A 4XUPA 1NY72 1A3KA 1C1FA 3HD8B 5D8AB 1LEMA 4PT6A 3PVEA 2EIBA 4RD7A 2QQPA 2BPA2 4CCMA 3QD6A 1PO12 4OZXA 3DYPA 2P5BA 4J6GA 3POIA 5FZFA 2YHJA 3JZVA 4I0WB 4EN6B 1CAWB 4NWWA 5A1LA 5I91A 2Q30A 5A7PA 4CA9A 2RV9A 2W1SA 5JWPA 2R0FA 1FPN2 3LEMA 1W6MA 1OOPC 2DCTA 3I8TA 1ND3B 3OOXA 1KDKA 5FWJA 3QACA 4O65A 2FZ2A 2Q0AA 5I8SA 4AG4A 3ZYIB 2Y0OA 4K40A 5DUUA 1ENXA 1WA4A 3ZDSA 2EF6A 2A6WA 2VMGA 4NRQA 4QB1A 4CP0A 1PK6A 2GMMA 3VBSA 3FWEA 3AKSA 4XF9A 2X8KA 4FXGB 4Y22A 5E8AA 1N3PA 5JR7B 1C5IA 5L73A 1CPMA 1ACCA 2GC2A 5FZGA 3ZFGC 1DQ1A 1XBFA 4BA6A 3I59A 5IK4A 1Q8SA 5JLVA 4XCBA 3BOPA 1UY4A 3K46A 1N3OA 4AQTA 2OA2A 4YG6A 1DZRA 5FZ4A 1VMJA 4B1MA 4D6SA 1M4WA 1DF0A 4EN0A 4P9XA 3I2GA 1V6IA 2JKXA 4BQXA 4CDUB 1ASJ1 3WX5A 3AMPA 4Y20B 4HETA 3KMHA 1EPZA 2RVAA 1ND2B 2TBVA 2WA3A 3FN9A 4K8RB 1KS4A 1C1LA 5DUVA 3M8LA 1EAH3 2GU9A 1X82A 3LFIA 1HXS3 4QDSA 3S57A 1X33A 2DCKA 5JZGA 1H8VA 3MEPA 4BQ3A 1FXZA 1AYM3 3KM5A 4UFJA 2ZKLA 2JDUA 2DV9A 4IEQA 4QQPA 5EV7A 5CEHA 1RUJ3 1WW4A 3I2HA 4Q4V3 1W6PB 3OPTA 1UKGA 5A3PA 5BYNA 1H8TB 1XRUA 4UFMA 1LAJA 4UFHA 2ID4A 5FAXA 3OSDA 2VTFA 2ZHLA 3B94A 1IPJA 2DU0A 1XSRA 2R30A 3JBG1 3U78A 2ZA9A 5BPXA 1ZRCA 1VPHA 2F17A 3PTYA 4Q1PA 3OF1A 4TTGA 2ZS6B 2KA3A 2VCCA 4N7UA 4XACA 2KD7A 1V6LA 5K8SA 3B5LB 5IUQA 5T54A 4YG3A 1I5PA 1NCRA 1Y3TA 3W20A 3VBHB 3VZMA 1JN2P 5GLUA 2A6YA 1GP4A 1HQLA 3HQUA 4PHZA 4AEKA 2RS53 2DU1A 3PVOA 5F6KA 2MPFA 3IMNA 2YV8A 1HRV2 3K3NA 3PUHA 4K8FA 3KVBA 1JYWA 1FMD1 1UXXX 2D93A 2I45A 4XFAA 3WF4A 4CDQC 2WFF3 3MUY1 4QX7A 3FBMA 5T55A 5DG1A 4GJZA 3RYKA 2JD4A 4QT6A 1RITA 1D4VB 1UF2C 3VZJA 2JEMA 4UW3A 2WZ8A 3GHMA 4OMDA 3T08A 1H9WA 1S4CA 5A7OA 1CIYA 1S2KA 2Z2SB 3SNMA 3P1IA 1JU3A 1DHKB 1JZ4A 3PNAA 3VV1A 1U5YA 1S0GA 5FWEA 1MS0A 2HWE1 4IXLA 5F39A 5JPNB 1YEWA 3MBWA 3WF1A 3HN3A 3U07A 1ZBA3 3MIEA 1ZA7A 2QTWB 2WZR1 1DLCA 2D97A 5BXXA 1YI7A 4X8PA 1UD1A 5F3EA 5JI7A 2GP5A 2P1BA 2QVSB 2LW8A 4LLFA 1QH6A 1TME3 1UOGA 2F4LA 2VOKA 3PURA 4DRVA 1WW5A 2P34A 2ZX1A 4FPGA 3KHCA 3T09A 5IAXA 1VMFA 1YI9A 2RS32 4IEYA 3U11A 1G8WA 4YZ5A 3M3CA 3B69A 5KHJA 2ZX4A 2HEWF 2VPVA 2WNOA 4HKOA 4I0AA 4CXXA 4RS5B 5FQ0A 3LEGA 5IK5A 5A32B 1T2XA 4XILA 1W6NA 3KVAA 3CKHA 4D94A 3JU9A 4QQLA 2SLIA 1UAIA 1C8M2 2XVGA 1IQDC 1YQ6A 3LAGA 1EPWA 3C2UA 1XQNA 2SBAA 1R083 3HIFA 3L9JT 1UL9A 4YWAA 1GICA 1S1AA 3CJIA 3SMHA 1FV3A 5FZ9A 1VBA3 2OQ7A 3GBWA 3K4AA 4LKEA 3UJQA 4BMBA 1FYUA 3WP6A 4HKWA 4I09A 1RMU3 4KWKA 5IYYA 3I2FA 3FFQA 5LWBA 1CJPA 3E97A 4YZ1A 2ZGLA 3LFMA 3NJXA 4FFIA 4JRLA 2XQRA 5FYZA 3J7HA 1W6OB 2ZHNA 4S2DA 1OPMA 1J84A 4Q27A 3ZN6A 4S2GA 5FZBA 4O61A 5FY5A 1PM7A 5DAWA 5CFCC 2HWB3 3ZXEA 5L9VA 4QD2A 4HONA 4XHBA 3WXPA 1F4AA 3RI9A 1MVQA 1NCQA 4YARA 3MIGA 3ZKUA 5K7PA 3OBAA 4A6OA 3TN93 4CE8A 4RR3A 3DKQA 5FK8A 3IBMA 2BP6A 5D2AA 1MZ5A 1H6YA 2XXZA 3L2HA 3VBOB 4MGYE 4AFDA 5C9AC 3OD4A 5C3RA 5C3SA 5FMOS 2ZMLA 1YFYA 1QJY3 3EXUA 1OFSA 3WD5A 2QZ2A 2XWJB 4FI9A 4COWA 1AYN3 1NKGA 2VQAA 1JOPA 4GIQA 3E5XA 1Y4WA 1SDWA 2ZGKA 2VW0A 2Y26A 3N7LA 4Q4W1 4QX3A 5LASA 3SCHA 3WNLA 1OQDA 3WINE 3IIAA 1X36A 1QOTA 1UO9A 2JJ6A 2Q4SA 3KCXA 2OZ6A 5F32A 1JMUB 2CDOA 4H3WA 2A3WA 3NV2A 1MEC3 1UX7A 4RQPC 1YRZA 1LGCA 3GCXA 4IGQA 5FMCA 1GOHA 3WQ0A 2NPIA 2ARCA 1AX0A 3UGFA 2J1RA 1PVXA 3ACHA 4B4PA 4ZXEA 5EFUA 1KJLA 3SITA 4IQPA 1ZRIA 1C8NA 4Q4X3 4KG8A 5F1RA 2WNUA 5FKCA 3Q8AA 1NE4A 3RWNA 4QPIC 3WT3A 1PGL2 1NA1B 2K2SA 2R7EB 1QXJA 1O3TA 5C8CC 2D44A 2D3PA 1W3VA 3AZZA 2QQNA 1QJFA 5FYUA 3KF5A 2VUJA 1H4GA 3V0BB 5EYXA 1V6MA 3RS6A 3ECQA 1BMV1 1BHGA 1GP6A 1B35A 4LO6B 1HDKA 3FUOA 3U14A 3ZSEA 1ONAA 1SCSA 5ACA1 2GNTA 1RTVA 5LBEA 1OBNA 1MS8A 4Q4Y3 1MACA 3KV4A 2MEV3 2XL7A 1SFPA 3VL8A 4P9JA 3VBUA 4AI0A 5ERLA 3H3ZA 3MO4A 3ZYBA 2JKBA 1J3PA 2JG8A 2P2KA 4IGPA 5FIXA 1MVEA 1IS4A 2P3YA 4BYYA 1OA3A 1PK6B 2Y33A 4K21A 3VBSB 4ZZ8A 2BTVC 1Q8PA 4PIXA 4Y22B 1HXS2 2JG9A 5FYBA 3WHTA 3AYDA 3J8F3 4L2NA 1GZWA 3HT2A 4QWNA 4BHPA 3VKLA 4HK8A 4YSFA 4Y1ZA 1JH5A 4W50A 5SV8A 5BNOC 4TN7A 1RUOA 4LOTA 3RNSA 3WNNA 1DP0A 3NMBA 5FY0A 4B3NA 2GNDA 1YQCA 2Y8KA 3ILFA 4JDMA 2WYSA 4BE3A 1H9PA 4MXWA 3I2DA 1RUH3 4LBJA 4RHV2 4UXAA 5FZOA 4BQYA 5ANQA 2VOVA 1PO23 1I5ZA 2UWCA 1AL21 1VBD3 4XAEA 3ZXDA 4R52A 1XNDA 2CTVA 4FFGA 1Z7S3 5C70A 1Y9GA 3LA2A 4XDPA 5JZGB 4IV1B 1OQ1A 3POBA 5C3QA 4HXCA 1G9FA 4XYXA 1WLCA 2VL4A 2PELA 2B7YA 3KT4A 5CYYA 4DUVA 5JSRA 4LKFA 2IXHA 3ELNA 3ATGA 4J1XA 2YC2A 3HEIA 3WV6A 3LDKA 3VHRA 1G86A 5FO9B 4RFT0 2X09A 2DCYA 2MHFA 3CLPA 3SXWA 4EN7B 3WEZA 4QAWA 4Z1VA 5K0UB 1I1EA 1OA4A 2RS52 2RR13 4QX2A 5FRAA 1TNRA 4XJ9A 2IVJA 3OJBA 1TVGA 1PIV3 4NPMA 5LZ6A 2O8OA 4R9BA 4BU2A 4PF1A 5DAQA 5A33B 5JCTA 1DQ0A 1SLAA 2VMCA 3SH5A 1HB2A 4IETA 1DYPA 2WWUA 3VD9A 1RB8G 1YJLA 2WFF2 2I74A 4MGKE 4XFFA 2VW1A 3FLTA 2W1QA 2Z5WA 4GXLA 4LITA 1W06A 1QXRA 2R0HA 1OVPA 2Y6FA 4QPGC 3H50A 4LBKA 3RZZA 2VNRA 4GWMA 2W52A 4YYOA 3NL1A 4BCUA 3LIHA 1J1TA 1O4TA 4BDVB 1DCSA 1R092 1ENSA 1RJ8A 2WO3A 1O8PA 2ZAAA 5T5OA 1WKYA 4YW7A 3VD3A 4C0BA 1MS4A 2IFRA 4QHBA 5I0SA 4CEYB 1PGW1 2I07B 1S55A 5A3WA 5CFDB 2CHHA 3GDBA 4ZS2A 5A3UA 1F8VA 3GBFA 2WWSA 3N4MA 2AENA 1YIFA 2MNGA 2VZSA 2WSUA 2WQ8A 5A3NA 4LE3A 4NRPA 3O7OA 2VVFA 1AR73 2CWSA 4IE7A 4GZ9A 1VBC3 1RUI1 4NPLA 1COV1 4X6RB 1Z0HA 2WO2A 3NV4A 1O5LA 4EE2A 2WT2A 5DXDA 2X05A 5K9YA 4M4RA 2WLPA 3AZWA 4N43A 4WVMA 5ISLA 1X8EA 2RS11 4AGRA 2VH9A 3O14A 1O5UA 4RA0A 4AK3A 4YW1A 2WABA 3SCFA 5A1AA 1ODNA 5FZHA 4BQWA 2WINB 4AVAA 1L7QA 2WAOA 5IT6A 5IVFA 4LHNA 1MPXA 4C90A 3DL3A 4LHKA 5D8AA 4CDXC 1OT5A 5F2SA 4A7KA 3OGVA 1RMU2 5F5QA 2VUAA 2ZBJA 4H7LA 5CNAA 3BIWE 4Q8KA 5AC91 3RZHA 2JDKA 1L7LA 2E32A 3BKZA 1CWPA 1W6NB 1POV1 1FT9A 2WS93 2FDJA 4EYUA 3POSA 3R05A 3ZIWA 1YQ2A 1OQEA 5C71A 1Q8QA 3T4VA 4YM3A 2XL9A 5AVAA 3PUQA 2VD7A 2ZGNA 3CDZB 5DZEA 3OBRA 4HT1T 2P17A 1ULGA 1EUUA 3GYDA 2JWPA 2G1MA 2NM1A 2W92A 4JQTA 5GZFA 5KXEA 2VY0A 2WUHA 4WZCA 5TSWA 3AB0A 1W3XA 2J1VA 3OUHA 1GZCA 4D0QA 4XE9A 1Q8OA 2VECA 3PU3A 4LBQB 2BYVE 5CVRA 3AL6A 3TN92 3ZO0B 3O1TA 1PNGA 4AGVA 4CTEA 3CU7A 3M4FA 1VB2A 2RM21 4YFWA 4PI2A 1WBLA 4FSJA 3ZN6B 2D6OX 1LU1A 1H30A 3JD72 1LOBA 3WDWA 1QJY2 2X29A 3CJIC 3HQXA 3NRUA 5DDJ3 4YVSC 4XQ4A 5DAXA 3VHPA 3DPRB 3WCRA 4E2GA 1FPN3 5A6ZA 2HYXA 4YW5A 4E27A 1RXFA 1OFNA 4HPKB 4O9EA 4ISRA 4RYDA 2A1XA 5FYIA 4TXWA 3W5MA 2VCAA 3ZOIA 3S7EA 4CDUA 2PHFA 1W2TA 4MVTA 4RR3B 4Y20A 2Y0IA 3VBRC 4Y4YA 2QJVA 4NAMA 4P9YA 3VD7A 5FZEA 2E53A 3WOGA 4DINB 4CUCA 2ZAHA 4UOJA 3DF0A 2R1DA 2GZWA 2JIJA 1BBT1 4IE0A 4WVWA 2KM2A 3ACFA 1R1A1 4DXZA 5JMOA 1C4RA 2JDAA 3WQBA 1VP6A 1GSLA 2XUMA 3OY8A 5FUPA 5IVYA 4CCCA 1G9BA 4JTOA 1F35A 1NCQC 2A6VA 2Q8OA 5GJ6A 4M3CE 5T5PA 4DXSA 2DURA 4JGZC 2G9ZA 3A0KA 2B8MA 4EN9B 3PMSA 3USSA 2IC1A 4BOWA 1RUE3 1W6PA 3KQ4B 4ZS3A 3U1XA 1H8TA 3AM2A 4WM7A 5FLJA 5JUVA 1UYYA 1NLSA 1WWYA 4P5HA 4YGEA 2WIIB 4GMP0 4D6RA 4PLOA 4YG0A 4A7ZA 3TEZA 1GV9A 2XBO1 3HNBM 4K7JA 3LSDA 1V6KA 1DGWX 2B9UA 3NAPB 4MG2A 3OYWA 1W9FA 2VE1A 3U10A 1V9U1 2Y38A 3K51A 4CEWB 4NE9A 3VDDA 4JDNA 5AFEA 1IG0A 5HV0A 3LOBA 2PAMA 4I0BA 4ZXKA 4FQ4A 4FOVA 4PDWA 2YZ4A 4YW6A 5HXMA 1T6GC 3DYMA 4Q4Y2 2WO7A 5B4XA 2MEV2 3U75A 1UU6A 3O1OA 1V0AA 1NXD1 5KHHA 1HQNA 4BISA 5FYHA 5FZ0A 5FZKA 2YUEA 3IN9A 4BLIA 3KGZA 4Q0PA 3BOWA 4K3UA 3AP7A 4IW3A 1B35B 4AI8A 5C8WA 3I3MA 3D3AA 2QQLA 4MXVA 4C1WA 2V73A 3J8F2 4G4FA 2VTXJ 2ZMNA 4N7IA 4P9IA 3VKOA 2OW4A 5F3GA 2WNUC 3IDEA 1U0AA 3ME2A 4QM9A 3AYAA 5LATA 1GZTA 1W28A 1YC61 2IZWA 3HNMA 2HWF2 4PLNA 1W6QB 2JG8B 4QXBA 4UFIA 3SKVA 4AWDA 4NIGA 2UWAA 2Q5TA 4BXFA 2C9KA 2CAUA 1N1YA 1RUH2 5F5AA 2JIGA 2XJPA 3Q8CA 4CXWA 3MDPA 4AW7A 1PO22 4UBGA 2WDBA 1VBD2 3WDVA 4CU9A 2JG9B 3FLRA 1F5FA 1Z7S2 1GZWB 3ZSMA 4AI3A 5C4WC 3QBQA 3OGRA 3ZFFA 4L11A 4URTA 5BNPC 2B46X 3A0NA 4KBZA 2XJQA 1K42A 4INDA 4M0NA 3VBUC 2Q1MA 2JDNA 1XU2A 4COUA 2HWE2 4QX8A 3NJVA 4EZ4A 5GLVA 2CGOA 2VU9A 2Y64A 3GALA 3TNPB 2YC0A 1EAH1 5FZOB 1I6XA 1QHDA 2WZR2 1RYYA 1FNZA 4XUQA 2HWD2 2XVKA 3M70A 4I01A 1VRH1 2O14A 3AKRA 2J7MA 3H1YA 4CU8A 1XYPA 2RR12 1W8WA 4JVAA 4D3WA 4RS5A 3ZXKA 1LTEA 5F3CA 1A8MA 4FVVA 5A32A 2V09A 3BI3A 2ZGOA 2VMFA 2ZOEB 3MPBA 1HX6A 1RUJ1 2XUEA 4Q4V1 1SHWB 1GR3A 2WRAA 3KWVA 3B93A 4JAAA 5FK7A 5LA9A 1RIRA 5IWFA 4XXAA 2HWC1 3BPSA 4W4ZA 3SH4A 5JXHA 1H1MA 1CIWA 5L7OA 3JCIA 1VBB3 3IDBB 4A42A 5FDBA 2PA7A 5J36A 2QQVA 2RS33 4EQVA 4LBMA 3FBYA 4B7KA 4OUEA 3SLIA 1GOGA 5J09A 4UI9L 4Y3OA 1LKNA 2GN7A 4P9LA 4CCOA 1JUIA 2D6LX 4AEDB 2C5DA 3K4DA 4UAPA 5IAVA 5LK7B 1CR7A 1LOGA 5IVJA 1W6OA 3GJBA 1W2AX 2NZ9A 4MADA 4AHYA 3HWJA 4UWDA 2CL2A 2BV4A 2A7AA 5F7UA 2QQMA 2E26A 3W21A 1IS5A 1CN1A 2YMZA 2AEZA 1QU0A 2DUOA 4XVHA 3W59A 3WUCA 2AREA 2VTXA 3LA7A 1KXGA 1AR72 3UNPA 1VBC2 2IXCA 1W0OA 4GQ7A 2BERA 3C7FA 1PZ7A 5J7MA 2R49A 1YWKA 3VKMA 2D6PA 4Z07A 3E1F1 2VNGA 2VZ1A 1LOFA 3LSEA 4ZY9A 4QKBA 1ZBE3 3VBOA 3B9IA 4K6BA 1PZ9A 3O1UA 2L9LA 4QHOA 4A2UA 2W95A 1XOYA 5J37A 4OUSA 3BB6A 1NG0A 2UU8A 1JHNA 4Y1UA 4N90A 5I0UA 2G19A 4DB5A 4CUAA 2VUDA 3AYEA 2FD8A 1F5JA 1JS9A 1OD3A 4L9BA 3E5UA 1H2NA 4Z2AA 2OT7A 1WCKA 5FZLA 2CY6A 4UFKA 4D7SA 1CAXB 1LOEA 1ZNPA 1ZBA1 1W03A 4WVMB 1X8MA 2VUCA 3BODA 5LBBA 4LXLA 4Z82A 5T5JA 5G05L 2GC0A 5DABA 1UU4A 1W9SA 1QJX2 3AFKA 5A70A 1JZ7A 1LCLA 1POQA 1H1IA 3RGBA 3UJOA 1BEV2 4DIQA 1Y7BA 3LPGA 1NA1A 3PLQA 4QB2A 5IK7A 1DQ4A 4BM8A 2LALA 3ETQA 4N43C 3IDAA 4DZGA 4I3PA 1N47A 4Y4RA 4YW4A 5LBFA 4KH9A 4DEQA 2A3XA 3HOBA 2JENA 3N9LA 3F2ZA 3B7MA 3V0BA 3N7JA 1R081 5FY4A 4W8JA 5B2GB 1WCSA 1SLCA 4W65A 1UX6A 1VBA1 3ZIXA 4KWJA 5DDJ2 3VB9A 4LT5A 2W0XA 5F2WA 1XE8A 5HI0A 4QQHA 1PVC2 4M01A 4AAXA 3I2OA 4ZU4A 4BIOA 5GLZA 2ATFA 3A7QA 2ZGRA 4ASKA 4H7MA 1SPPB 1UYPA 2ZHMA 3N7KA 1D4M2 3C7GA 2ZEXA 4Y26A 2D5FA 5BNNC 3AMQA 4P02B 1I3HA 1XNBA 2HWB1 2O8QA 4XHXA 3NJYA 2R041 3OBTA 2RDNA 1RUNA 5C7GA 3Q9OA 1JZ5A 1BZWA 1ND3C 3BTZA 4QDQA 1F9KA 1UMIA 4PBOA 2V4AA 3MI8A 4ZONA 3IMMA 1T6BX 4QDRA 3GHNA 4XQDA 2YY1A 4U2AA 2Y6JA 1JUHA 1ULCA 2UWBA 5FZ8A 4QHZA 5FOJB 2NN8A 1RUE2 3GM8A 5IJRA 3MFCA 2R063 1D0HA 2E7QA 1YJKA 4YM2A 1HRI2 3PTRB 1GFF2 2VQTA 1QOOA 4DS0A 1FOD2 3KZ4C 3OY8B 4IV1A 2YBKA 4HVRA 1VJ2A 4R8HA 1ZYBA 1S0IA 4N53B 4ATFA 5L36A 4Y1YA 3KT1A 3V0AB 3A23A 1RHI2 1W8UA 3HBKA 4MLOA 4CDUC 1O8SA 1RUG3 3RJ2X 4D6QA 3VLBB 1ND2C 3AXDA 5FJHA 5FZ7A 2YPDA 2YROA 3B00A 2QQKA 1MEC1 2VZOA 1UWWA 2JDYA 4RHV3 4WM7B 1XYNA 5DQ0A 3U37A 1OLMA 1R64A 3TB0A 1DBNA 5K0UA 2VZQA 3TYJA 1JOBA 5DPNA 4GJYA 3OYWB 2O1QA 1AZDA 2IFWA 4XJWA 4Q4X1 1UOJA 3FMGA 3VDDB 3ZYRA 3I2JA 2PLV2 5FYYA 5A33A 4OFGA 5F3IA 1X9TA 2YYOA 4NHXA 4PDWB 5L9RA 4M3CF 3VZLA 1H8TC 4CP2A 2ARXA 3SQOA 3ZMOA 2D7FA 3VDCA 4FTBA 2ZGTA 4AEMA 2P6HA 4KWLA 5T3NA 2D3SA 5EPAA 3WP4A 2VCBA 2O0OA 4OMCA 4IEOA 1JZ3A 3HQRA 4TZDA 1QGLA 1DYOA 2PAKA 1M06G 3UETA 3UT0A 1RUF1 3AKPA 2Q8CA 1BJQA 2ET7A 2EIEA 1SDDB 3H8UA 4HFSA 3T0BA 3AP5A 1GQHA 2D40A 1PMHX 1ODMA 5FYVA 3AZXA 3VBHC 4CEYA 4E4ZA 4XZUG 5CFDA 1W39A 3ZDVA 1XYOA 5C5UA 1VE0A 2WSVA 3USUB 5E16A 5H9PA 2BRTA 5FR3A 1O3SA 1XNCA 5FZMA 4K1ZA 4OI0A 4A6SA 2EAAA 1AJKA 4XF3A 1R093 2HEYF 3IAQA 4COVA 2RMU1 3LIGA 3ZFFB 4NIHA 1UIJA 2XJUA 3S6PA 1IKPA 2QQWA 4FPOB 4JX0A 1AR91 2W1UA 4ATEA 1COV2 1EYBA 1SG3A 5LEJA 3UKVA 3M7AA 1TNFA 1QQP3 2OZJA 2XJRA 1JTZX 4XJUA 2OS2A 2IXKA 3WNMA 5C6CA 1RVF1 3MF9A 4NWVA 3SEEA 1VBB2 1ZRDA 2GH8A 4ASLA 2WT1A 1YIPA 3UESA 3WNOA 1A8DA 4WM8B 2EALA 2EIGA 4FO9A 4HVOA 1KFUL 3JUUA 3WW4A 4LQRA 4IV3B 1LHUA 4XDOA 4COZA 3JB8A 1CVNA 1VBE2 4V1PA 5FPXA 3VZKA 4DUWA 2BNOA 1XB9A 3ZYGA 2PYTA 5L7OB 2ENRA 4COYA 2VMEA 2D6MA 2PHLA 3BGAA 1AXYA 3FLPA 3H7YA 1PIV1 1AHSA 1W8TA 3INAA 1WCDJ 5T52A 4QGNA 3UL2A 4RS5C 1LNSA 3ACLA 4CCKA 4UYBA 2AH2A 3MFAA 4LBQA 2A6ZA 4YFZA 1NT0A 4OI4A 5F6LB 1IHMA 5EIYB 2DVGA 4TSVA 5A6QA 4LBLA 4DRRA 1ZBE2 2VMDA 3MLKA 4OQ9A 4UW6A 5I93A 3WSOA 4FTEA 3BUCA 4KQ7A 3VN4A 4EJRA 3DPRA 2XKOA 2XH6A 5GM0A 4XOGA 4HPKA 4NAOA 3ZFEB 5CFCB 2Q1FA 2C1FA 3RI8A 5FREA 3DCQA 1RUC1 2QUOA 5FPBA 4U36A 3WG3A 4AFAA 4KGGA 1D0GA 5J96B 3GJAA 4K1YA 2YC4A 5KXCA 3U4XA 3ZSKA 1JOJA 3JD73 1QY4A 4R9DA 3ES1A 3N3HA 1SLBA 2OXBA 4LO8A 4FPEA 2XGXA 3N9PA 4CRQA 3PVBB 2HH9A 1DU3D 2VBBA 3TNQA 3I49A 2X53S 2DVFA 3POYA 4NHLA 1U12A 3S0MA 1R1A2 4OHYA 5ABJC 4XABA 3MUZ1 2PXJA 5KXDA 4IE5A 4MGQA 1NXMA 5JR2A 5FYSA 3VKNA 3VBOC 1LOFC 4NVPA 3QH7A 4Y5TA 4XETA 1EV12 1QDCA 1ZRRA 4XZPA 4NIDA 1PM4A 3Q8FA 1GOFA 1SCRA 2BFUL 1GUIA 2VGDA 4UT5A 1HB1A 3NAPA 1YLLA 2R1BA 3ZKYA 4LBQD 3MLLA 1K12A 3SKJE 3DXUA 4CP1A 4CEWA 1JZ2A 3AMNA 2XBO2 1DZQA 2X5IB 2XHKA 2JDMA 4JCKA 5E6HA 4AHWA 1V9U2 3LF7A 1DQ2A 4PQ9A 3QCWA 5FP7A 3MHZA 1OHFA 1QJEA 1UYZA 2WS91 1OA2A 3BN6A 3H42B 5FY9A 4CPBA 4DY5A 2JDPA 3BCWA 4NOTA 4YW2A 2YU1A 4MGIE 4ZPIA 2VO5A 4DO0A 1NY71 2BZDA 1JYXA 3C3VA 4ZZ5A 1AX2A 1TMF2 1HW5A 5IVCA 1AR61 1UY0A 3KB5A 3TEWA 1CJDA 1G7YA 2FMDA 2H6BA 2IXIA 4GB32 1NA1C 3PL0A 1O91A 3T0AA 3VKFC 2WO1A 3POGA 1N3QA 1PO11 1RUD2 1A34A 1W6QA 2D98A 3FL7A 4GAZA 4D7YA 3WP5A 2BVBA 4M3CB 1ULPA 2PHXA 5E89A 2R062 3N36A 1HJGA 5BUVA 1BVP1 1GYKA 2DBNA 2P37A 3JB4C 4LPLA 4TLFA 4AQ2A 4CYDA 4HOOA 2CDPA 3M3IA 1O7FA 3ZXLA 1S0JA 1VAKA 5EQUA 3VBFA 3WNXA 1U5IA 1UKRA 4RFRB 4XIOA 1QJU2 2Z4FA 4HG6B 1KS5A 5BNOB 1FMD3 1GNHA 1MR5A 1RUG2 2HWF3 3VZNA 3NO8A 5M0TA 3IAPA 2FMYA 4XTPA 3X29B 1PK6C 1UXZA 3AMHA 3IDCB 1QEXA 2YGMA 3VBSC 3FE5A 3ZN5A 3EHKA 4IL7A 3VD5A 5JSPA 4TLGA 2C0ZA 4CPBD 1DLLA 1Q56A 2QNKA 4GKYA 2F6BA 2ZZJA 2GAUA 3CO2A 1LHVA 1VRH2 2VBDA 1W9YA 2WNEA 2ZPXA 4LO5B 3OPZA 2C4XA 2HWE3 5FPLA 4CCDA 1QNWA 2WQZC 4I2OA 4PIYA 1Y9QA 4KG0A 2I2SA 3GNEA 4YRDA 1DDLA 5FYTA 4MGZE 2QKDA 4E4SA 2WZR3 2GC3A 1A6CA 2HWD3 3C7HA 3CZJA 4YM0A 4E4DX 4GMP1 2OYZA 5JZGC 2ZMKA 4OVEA 2DCJA 3AXEA 1RC6A 1IS6A 2V5YA 2PHWA 2XWBB 5IW0A 1UOBA 2W08A 1KFXL 2HBUA 4AEDA 3CF6E 4XUOA 1LULA 1JU4A 3VD4A 1GANA 3RG0A 4CDWB 4LTAA 5CAZA 1LGNA 1WMDA 3OGSA 4AVTA 4YGCA 2CV6A 4DNYA 3WW1A 3B3QE 5K0UC 2OPKA 1L3JA 4R4XA 2BOJA 5I8YA 2UYBA 1D2QA 5L19A 2WWJA 4CP9B 4QPGB 3CNAA 3DKWA 4BQ2A 3BTAA 2ZKNA 3DGTA 3KCCA 5LRRA 3IKWA 1QDOA 3V65A 1CAUB 4LMFA 2VOWA 1U5ZA 1CPNA 5FPAA 2R072 1FNYA 2Y6LA 4S2FA 1HIXA 2WQ4A 2W3JA 3LEKA 4FPFA 4YVWA 1NCRC 1TE1B 1K3IA 1OKOA 1YHFA 2WYFA 4XFIA 4META 4QPYA 3N9NA 1QQP2 4HN1A 1HQWA 1VIWB 3DN7A 5A3OA 1HRV1 4RSUA 1CESA 3JQWA 4BQ4A 4NHMA 4MHUA 4MOAA 5FLIA 1AR81 3KLSA 5A7SA 5F5CA 3HJRA 4XFHA 1CAXA 5LW9A 2WNVB 4CEYC 4I30A 3LZZA 4JV4A 1DGRN 3LWCA 3SC7X 3WG1A 2N7GA 4ET7A 3KHBA 1MZFA 5FP9A 1TZOA 4AAPA 2VR4A 3IIIA 3K4ZA 1LECA 4XCAA 4DEVA 2LROA 4BK5A 2HEVF 3WY6A 4LULA 3M3OA 3CIHA 4XJZA 4Q4W3 3OD0A 2ZEYA 3N9OA 4IGOA 3T2QA 2QQUA 3MIHA 1W8NA 3ZXGA 4JZRA 4G9SB 3R4SA 3VZOA 1SMVA 4BK4A 4Y33A 1QJX3 2JDZA 4QMAA 3WF0A 2Z42A 1IPSA 3LA3A 4Q0QA 3T2TA 5HBAA 1KDMA 5J3UA 2RS31 4KU8A 1X50A 3H8RA 1BEV3 3OEBA 5FPVA 4ZHNA 2ZCWA 1J3RA 3AYCA 1OH3A 3AZVA 4EZHA 4LHSA 1OOPA 4OI2A 2RG4A 3I7DA 5FMBA 2W2IA 2FDIA 3VGIA 1C8M1 2VQUA 1RGSA 4FPYA 1SPPA 3DUIA 3IB3A 3K3OA 1ZZ7A 2ARBA 2IWGB 4MYEA 1Q5OA 3SCGA 2UURA 5JOWA 2A70A 4P00B 2VZRA 4KNCA 4P9GA 3KV5A 5JOXA 3H8OA 2CGPA 4BZ4A 1BK0A 1C57A 1CD3G 3MIFA 1PVC3 4YVSB 1K5MB 1WW6A 3WNPA 4XF0A 2VQ0A 5HCFA 5JSOA 3GZEA 2JB4A 5D1IA 4ARXA 1OH4A 2Y6HA 3H1MA 4I02A 1D4M3 1N1SA 1UPIA 4PQQA 5FZ1A 4AI9A 4FOYA 1ASJ2 4FP2A 2BGPA 4DPNA 1AF9A 1BVVA 5KWRA 3DPRC 2HJIA 2C26A 1UMHA 3WDTA 2JXAA 3T2PA 4AI1A 3FJSA 4N53A 4Z2WA 3V0AA 1GP5A 1LR5A 1NYWA 2RJKA 5FJKA 4RR3C 4UF0B 4XW3A 4Y24A 4CCJA 3FC0A 5LCWL 1G9DA 5DZGA 2XB6C 5C33A 1LENA 4JGZB 1F15A 1HB3A 5JOZA 1JYNA 2K0GA 1L7RA 1HRI3 2R16A 4QKNA 5FZIA 1CX1A 3T30A 1FATA 4L0PA 4FOQA 4PJYA 2GH2A 4BXSV 1FOD3 4FTSA 2VC9A 1AL23 2ET1A 4LR4A 1H2MA 3BU0A 3K48A 3JBG2 3ZPYA 3E6CC 4QXHA 5APAA 2WT0A 1RHI3 1BKZA 1J3QA 2JD9A 2X10A 4OULA 5SV5A 5KR7A 3MV11 4PI0A 3KT7A 3O1MA 4OHVA 5CIRA 2VJXA 1VLNA 3NSTA 3WDYA 1VB4A 4AHZA 4AFCA 2DYCA 3FHIB 4C0HA 4Q26A 1QXPA 2GN3A 3D6EA 3NAPC 1NE6A 1YFXA 1ZA4A 2NYYA 2FHRA 5FTTC 4E8CA 4ARYA 2VZVA 2BQPA 4F83A 2GMPA 4PCRA 1PZ8A 3CMGA 3ACGA 4CEWC 2EIDA 2CU5A 5FUNA 2VZUA 2QQJA 3D82A 2PLV3 1STMA 3A21A 2A3YA 1PGL1 1NX9A 1UNBA 1UZYA 1WW7A 2YFZA 3PIGA 2WR9A 5KC6A 3RZKA 2NMOA 3I2KA 5H9RA 2YBSA 1W9TA 2FDKA 1O3QA 1FMD2 2PQSA 3EMRA 3NQHA 4CDQA 3GZTB 4QM8A 4ZU5A 2DFBA 4L97A 3USUA 1SLTA 3O1VA 4JC1A 3N9QA 1B35C 2DF7A 4AFBA 4AVVA 2DFCA 3I3EA 4IESA 1J59A 5GLWA 1WMEA 3M2MA 2BJSA 4ONUA 1AL0G 5CBLA 1REDA 1LOCA 4LLOA 2DTWA 1CX4A 4KL1A 4NR1A 1C5HA 4FFFA 1WCQA 3F95A 3VBFB 1H2LA 5GKAC 2E33A 2V4VA 1ENRA 2ZTNA 4TYSA 4QX5A 4XC9A 2JG8C 5JVVA 4FP3A 5IK8A 5A3MA 4B4RA 5JXIA 3UK9A 3NNLA 1JZ6A 1S2BA 5FV3A 1JZ8A 1ALYA 1HXS1 2B5HA 3J7NA 4LO7A 3ACIA 4LK6A 4FXKB 1G9CA 2JG9C 1W2UA 2EXKA 4PIZA 3A4UA 1QNYA 1WGPA 1VRBA 4AL9A 2B42B 1AYM1 1B09A 4HZFA 4WM8A 2LTNA 1SLIA 1E5RA 3LE0A 4GWJA 3AC0A 1KRIA 3KV6A 3LDBA 1P8JA 2JE7A 3LDRA 1RUI3 4AVBA 4IV3A 3NVCA 2B4KA 1COV3 2AYHA 4OYUA 4HSJA 1F4HA 4RHV1 2Q8EA 4JGYB 3WR0A 2VOXA 3RPQA 2RS13 2BWCA 3OCPA 3M3EA 3ZX7A 4DMIA 2FCTA 2ILMA 4MHRA 3CHXA 4QQ2A 3WW3A 1AJOA 5A80A 2DWRA 3HN1A 3TWIA 2WKKA 2R6QA 1XPWA 1YQ5A 2FBEA 3VDBA 4URAA 1IG3A 2DUPA 5E88A 4OQ8A 1W99A 3T4HB 3ZXFA 1VBE3 3GCWA 2FDHA 3WF3A 3FZ3A 1JHJA 1MZEA 1SACA 4JKKA 5AC93 5HCHA 1XNTA 3WF2A 1NLRA 1XE7A 2RS51 3WUDA 1XSQA 5CZKA 1JYTA 3NNMA 5B4NA 1JYIA 4ES9A 3ZFEA 5CFCA 1CZTA 2VG9A 1UOFA 3TBDA 1DGWA 4LA3A 1UU5A 3S30A 3TOJA 4GH4B 1W9WA 2PN5A 2F4PA 2PFWA 2WZPP 4AEDC 3NNGA 3CEWA 2W39A 4KU7A 3FHAA 3MW4A 2XVLA 1OMIA 1RUC2 2WFF1 3FFZA 1UQXA 4LNVA 3NV1A 4YVWB 5LA0A 1ZM1A 4O7XA 3ORJA 1GWKA 3AL5A 2DUQA 1WD3A 2RM23 2DBIA 2RJLA 4YPJA 3ZSLA 1WLDA 1DIWA 4QKFA 4AE2A 1UYXA 4ZKTB 3BU7A 3IPVB 4X8NA 3W5NA 3L2YA 2NQYA 4KMQA 1SFNA 1SBFA 5FO7B 3WZ1A 3RYRA 1YO8A 1IZ3A 1XNAA 1MQTB 3B01A 3MW2A 5IFPA 4Q4W2 3ZM8A 1VAVA 3AKTA 4RGAA 5FFOC 1GU3A 1QH7A 1V70A 4KWUA 4HK9A 5F8PA 5CG8A 4YZ3A 1TME1 1GNZA 1DGLA 4Z92B 3SISA 1BBT3 3KGLA 5FOBB 1AX1A 5IATA 1R1A3 3EYPA 5FPZA 3BALA 2X5IA 3RDIA 4XAAA 3RMYA 3PJYA 3RRDA 3E5QA 2Y60A 3ENRA 2FCVA 4JQRA 2AACA 3QLQA 3NNJA 1GKBA 2WA4A 3B9CA 3ZYFA 2P3IA 1WBFA 3J4UH 3N9MA 1EV13 4CCLA 2W94A 1C3HA 2GALA 4IEUA 4NHYA 4A4AA 1VR3A 2NMNA 2UYAA 1UZWA 1LODA 3AP6A 2XBO3 4QPWA 3KSCA 3WDXA 2ERFA 5D8AC 3RZGA 5GLTA 4B4QA 2W47A 1BMV2 1OLQA 1RMU1 1O4ZA 1V9U3 1V6NA 2QZ3A 5A6XA 4EWAA 3D0JA 3OGGA 3PUAA 1OOPB 5ACA2 4IDZA 2K9ZA 1AR62 5FYMA 5A1FA 3MZHA 2J1EA 1VAMA 4M3CA 4AXOA 4Q0SA 3P5BA 1S0CA 5J1XA 3A22A 4YM1A 2W46A 4HSLA 1DZTA 1TMF3 5BNNB 3S5AA 5C5TA 5GZDA 4DY3A 2CYFA 4GB33 4BIFA 4PF5A 5FPUA 3ZFGB 2ZX2A 3HAGA 5IFTA 3TN91 2A71A 4E9KA 4N9IA 4Y1XA 1SFYA 1RUD3 4MX3A 5BNOA 4H14A 4FT8A 2VVDA 3MGUA 4OCTA 3JD71 2ZGPA 4WZFA 3UV9A 2ZGQA 1QJY1 5DMYA 4AR2A 2D6KA 4Q1RA 1AYN1 3PUIA 3CJXA 1ZVFA 3C7OA 3VDAA 3LEIA 1SEFA 1RJ7A 3MV01 4A45A 4B7EA 1HN1A 4ORFA 1XC6A 2IXLA 4FCAA 4IEXA 4K9SA 1AL22 4BB3A 3PVNA 3K75B 5FP4A 3HVDA 1QJU3 4D7TA 1EUTA 3BYWA 2OVUA 2JE9A 1E57A 4B8EA 1HB4A 2CGNA 2B39A 3HPNA 3ZPOA 3BPZA 4BLJA 4AF9A 3J7LA 3ILNA 4OLLA 3IT8A 1DYKA 4BQ1A 3WG4A 3LD8A 3D0SA 3ETPA 2XONA 4QKDA 2XLGA 3WG2A 2XLAA 4NPRA 3HBZA 1RXGA 2AGSA 3ZVXA 1ZZ9A 3AP9A 1QF3A 3D8CA 2XQXA 4N53C 1VRH3 4NN0A 1O59A 2RJ2A 5FP8A 1N1VA 4D8MA 1W8FA 1ZX5A 3LOIA 4MGSA 1H4HA 2A5ZA 3AVSA 4CDWA 1OI6A 4JHTA 3Q8BA 4XJAA 1G9AA 4WM7C 1E5HA 2JECA 1UZVA 3GZUC 3D5OA 3T2OA 1LEDA 4FAHA 2XJVA 2VZTA 5HPOA 2VW2A 2QE3A 3O1SA 2VMIA 1CGPA 5FMDA 1UY1A 2HWC3 4YLZA 4CP9A 4EWEA 4QPGA 5ANNA 2RE9A 5FZAA 4CCNA 3H3LA 4SLIA 3VDDC 1MS5A 1UZZA 3APBA 4CU7A 1LHWA 1WD4A 4IUGA 3BTXA 1CAUA 3IM0A 4Q4Y1 3AK0A 3OUIA 2MEV1 4PDWC 3Q8EA 4WV8A 2TNFA 1OVSA 1QJZA 5I8TA 1YNAA 3KV9A 3KF3A 4R9AA 2PHDA 2ZXQA 2QQOA 4H2AA 5H9SA 3K77A 1JYCA 3AJZA 3R4UA 4V2VA 4CDQB 1IKQA 3S7IA 4DOUA 4E4HA 3ZYHA 4L99A 2XMLA 1PGW2 5EJZB 1HV1A 2GSYA 3J8F1 4YGBA 5CG9A 3H7JA 3V64A 1GZ9A 1PHMA 2E9QA 1CZVA 2BWAA 4I3GA 2R073 5FUIA 4AVCA 1N1TA 2JDHA 2WNVA 2BBAA 2GMEA 5KBFA 2HWF1 1LESA 1AR82 1OKQA 1RUI2 3DXTA 1RUH1 3SEPA 1ZZCA 1BXHA 1NZCA 3GBGA 1PO21 4XPVA 3I54A 1V6OA 1OUXA 1VBD1 2VZ3A 2RS12 3FUQA 5EYYA 3THPA 3EO6A 1Z7S1 2OUJA 2W1WA 4LO4B 3IWZA 2WAAA 2ZGMA 4CSWA 2J22A 2LS6A 2D43A 3ZFFC 4MO3M 4CDXA 3RSJA 1OLRA 3WW2A 2ZEWA 5JOYA 4MV2A 1AXKA 2GC1A 2Z69A 4UFLA 4CU6A 5AC92 4LKSA 1WMFA 3MPPG 1W04A 4LIVA 1LGBA 2IVIB 3SH3A 2HWD1 2RHPA 1H0BA 3ALQA 2CNAA 1WLWA 2RR11 3H9AA 3R4DB 4M0HA 1FAYA 3HR9A 3JXSA 1REFA 4WM8C 5IVEA 2BFUS 1DQ5A 1E5IA 1KJRA 1W8ZA 5FY8A 1S0FA 4A7YA 3DECA 4A3ZA 3O1PA 3JQXA 4IV3C 2RDSA 4CXYA 5T50A 2TUNA 3QOPA 2VNVA 4NMIA 5FY7A 3RZJA 2QDNA 4G3YC 4XFBA 4C1XA 4LBNA 2BGCA 4GALA 3LQCA 3KS7A 4B1LA 3N7MA 4DUXA 3ST7A 2ZHKA 5L7OC 4NUBA 3M1HA 1ST8A 4WVVA 4XEZA 2K46A 2RM22 3AKQA 4BJ0A 5FP3A 1W0NA 4Z8BA 1QKQA 3CBNA 1K5MA 4FQZA 4YVSA 4LEJA 1YYNA 2WL1A 4GKXA 4F3JA 1NOVA 3LPFA 3MW3A 4IE6A 5EZWA 2DDUA 1BLZA 4NRMA 1SZBA 1BK1A 3CQOA 2Z79A 4D69A 3K2OA 2W68A 4LK7A 4FPLA 2WBKA 1DG6A 3VBRA 1LHOA 5EHDA 2VAUA 2NP0A 2VXJA 1GWMA 5C9AB 1UZ0A 4GA9A 3MLJA 4R4ZA 5HCBA 2ZGUA 3ZFEC 2XLFA 3TAYA 2WN3A 2YG0A 1AR71 1BBT2 3EJKA 3M3QA 2R043 3E6DA 1VBC1 3P3PA 4QX0A 5CB7A 4BQ5A 5KC5A 4YGDA 2WN2A 4JKLA 2XJTA 5CKQA 4UF0A 5CA6A 1WCUA 1U5XA 3W58A 5ABJB 4JGZA 5IVVA 2DVDA 1OF3A 2H0VA 1ASJ3 2A75A 3OPWA 1O3RA 2G9FA 2EICA 2YB7A 1NUKA 1OURA 1O6UA 5G04L 5FBZA 2D6NA 4KGQA 2XKPA 4RQPB 3GZAA 2BGOA 1JW6A 4JTNA 1S0EA 3RVHA 4A44A 4X6QB 3T3YA 2R32A 4UW4A 4EV0A 1CONA 4Q2FA 1YUDA 1ENQA 1MS9A 3RYPA 3POEA 2Y34A 3EBRA 2J1UA 1AXZA 1PNFA 4HLTA 4QPIB 2FQPA 2VULA 1ZRFA 4CUGA 4EWDA 5A6YA 3OB8A 5C3OA 4AFMA 4AHXA 5C8CB 1QJX1 2PHTA 4WBBA 2BOIA 1D7PM 2BW8A 4XMAA 3E6BA 1ULDA 3POWA 4H55A 1BEV1 3R0RA 3JBG3 2X5IC 2EXHA 3EQEA 4LIUA 4PLMA 2ADDA 5L9BA 4AZZA 4RGKA 5LA2A 4NIIA 2BNMA 5FLHA 1UY3A 3V56A 4NIAA 2EXIA 4DXTA 3U0ZA 4P08A 2QBXA 1CQ9A 1ZZBA 5E1RA 5I0TA 3WQ7A 4LE4A 4E2SA 3RFRA 2J1TA 3AP4A 2OPWA 4OZOA 4MH0E 1ZZ6A 3GXUA 4YNIA 5DDJ1 5FZ3A 2V72A 1FPN1 3J26N 4AYUA 4MGTA 2LM3A 2XPJA 1PVC1 1FV2A 4OHZA 2W5FA 3G6JB 2ZGSA 3AZYA 1RUF3 1E5SA 1W6MB 3N35A 4Y5Z0 1OC1A 2E63A 2OUHA 3PJQA 5C4WA 5FMOL 2C6SA 2JX9A 5BNPA 1D4M1 4QGMA 2XR4A 2JE8A 4Q0UA 4QQOA 4BWOA 2AUYA 2C24A 1Y43B 2GP3A 2YFUA 5FCCA 1LU2A 2FDGA 3T0DA 2E51A 1EAH2
chains in the Genus database with same CATH topology
3P1IA 1J83A 1JU3A 3T2PA 1JZ4A 1OF4A 4CUAA 4CVUA 1OD3A 4Z2AA 5LCWL 3MBWA 3WF1A 3HN3A 1K45A 1JYNA 2Y6GA 1DLCA 1L7RA 1CX1A 5G05L 1GQPA 2V5DA 4L0PA 4BXSV 1W9SA 2LW8A 2VC9A 1JZ7A 4P5YA 3THCA 3T09A 2JD9A 2X10A 3LPGA 3MV11 4QB2A 2QQIA 3LEGA 1T2XA 2VJXA 3CKHA 3IDAA 1JYVA 4DEQA 1PX4A 3HOBA 1IQDC 3F2ZA 4W8JA 4E8CA 4ARYA 2VZVA 3CMGA 3ACGA 3K4AA 2EIDA 2VZUA 2QQJA 3A21A 1NX9A 2YFZA 5IYYA 2W91A 4AAXA 3I2FA 3I2KA 3A7QA 1W9TA 3NJXA 2PQSA 3J7HA 3NQHA 3C7GA 2ZEXA 1J84A 3GGLA 2J1SA 4P02B 3I3EA 4DXRA 5C7GA 1JZ5A 1TG7A 1F4AA 3WNKA 4QDQA 1UMIA 1WCQA 3OBAA 4QDRA 4A6OA 4RN5A 2E33A 2V4VA 2Y6JA 1H6YA 5JXIA 3GM8A 5IJRA 1NAEA 1JZ6A 1JZ8A 4FI9A 3EB7A 1NKGA 2ORZA 2W87A 2VQTA 3ACIA 4QX3A 3I3BA 3LE0A 3AC0A 4GWJA 3WNLA 1P8JA 3A23A 2B4KA 1O8SA 4OYUA 3C8XA 1F4HA 2CDOA 2QQKA 1W8OA 2VZOA 1UWWA 3U37A 4GWIA 1UX7A 5DQ0A 1R64A 1GOHA 2VZQA 1KEXA 5DPNA 1US3A 2J1RA 3ACHA 4ZXEA 3I2JA 1XPWA 3VDBA 1W99A 3HNYM 3WF3A 2R7EB 1JHJA 4JKKA 1XNTA 2QQNA 3VDCA 3WF2A 2WZEA 5CZKA 2VCBA 5B4NA 1GNYA 4OMCA 2ZEZA 3ECQA 1BHGA 1JZ3A 1CZTA 1DYOA 3C7EA 4A41A 4XURA 3UETA 2VM9A 1W9WA 2EIEA 1SDDB 3NNGA 3T0BA 1JI6A 3FHAA 2W9XA 1PMHX 4KI5M 5LA0A 3MO4A 4XZUG 4E8DA 4YPJA 2XHNA 2ORXA 4ZZ8A 1UYXA 3W5NA 4KMQA 1US2A 1XNAA 4W50A 3IAQA 5IFPA 3WNNA 3ZM8A 1DP0A 4JX0A 2OKXA 1GU3A 2W1UA 2Y8KA 1KGYA 1CZSA 1SG3A 2WYSA 4KWUA 3I97A 3WNMA 3SEEA 1PX3A 3EYPA 5C70A 3UESA 3WNOA 2VZPA 2VL4A 4DUVA 5JXGA 5CYYA 4LQRA 2XOMA 4QX1A 2YC2A 3HEIA 2W94A 4XUNA 4A4AA 2X09A 4DUWA 3WEZA 4QAWA 2VMEA 4QPWA 3BGAA 1UY2A 4QX2A 3THDA 2W47A 1TVGA 1PMJX 5LA1A 1LNSA 4PF1A 2VMCA 5EIYB 2J1EA 3VD9A 2B9VA 2VMDA 3WSOA 2W1QA 5J1XA 3A22A 2HLEA 2W46A 1GMMA 5IFTA 4BDVB 2WO3A 1O8PA 3VD3A 1WKYA 2YC4A 5DMYA 5I0DA 3GDBA 3PUIA 3VDAA 3C7OA 3LEIA 3MV01 4A45A 1HN1A 3ABZA 1XC6A 1H6XA 2VZSA 2WQ8A 4GZ9A 3K75B 3OEAA 2E31A 3MUZ1 1EUTA 4MGQA 5JR2A 4QB6A 2WO2A 2X05A 3HPNA 4M4RA 2WABA 1GOFA 3ETPA 5A1AA 1GUIA 2XONA 1L7QA 1K12A 2WAOA 3SKJE 1MPXA 1JZ2A 2XQXA 1O59A 2RJ2A 1OT5A 4D8MA 3OGVA 4MGSA 3BN6A 1UYZA 2E32A 3T2OA 1YQ2A 5C71A 3FHQA 2VZTA 2VO5A 5HPOA 5JXJA 2BZDA 1UY1A 3CDZB 1JYXA 4JHZA 4ZZ5A 1EUUA 4CU7A 2VOTA 2W92A 1UY0A 4IUGA 2WUHA 2J1AA 2J1VA 3T0AA 4D0QA 2WO1A 3DYOA 2ZXQA 3FL7A 2QQOA 3K77A 1ULPA 5EJZB 5EJ1B 3I2IA 3NRUA 3OG2A 2HYXA 4LPLA 2CDPA 1CZVA 4RYDA 5FUIA 3P6BA 4TXWA 3W5MA 2VCAA 2BBAA 2Z4FA 4HG6B 3CZUA 3VD7A 3IAPA 5DN2A 3SEPA 4CUCA 1UXZA 3I3DA 2Y6KA 4UOJA 2VZ3A 5JMOA 3ACFA 3VD5A 2JDAA 3WQBA 2W1WA 2WAAA 2J22A 2LS6A 4MO3M 4DXSA 2C4XA 4M4PA 2ZEWA 4JKMA 4XUTA 4CU6A 5JUVA 1UYYA 4LKSA 4CUBA 1ULOA 3C7HA 3CZJA 3HNBM 5IHRA 3JXSA 4XUPA 2DCJA 3DECA 4A3ZA 4PT6A 3T0DA 4XUOA 2EIBA 1JU4A 5HXMA 3VD4A 3DYMA 5B4XA 3OGSA 4DUXA 3LQCA 3DYPA 4BJ0A 1W0NA 3D3AA 2QQLA 2RV9A 2W1SA 3LPFA 2DDUA 3CQOA 2Y6LA 2W3JA 3LEKA 4AG4A 1K3IA 2WBKA 3HNMA 3SKVA 4QB1A 2C9KA 1UZ0A 2WN3A 2YG0A 2WDBA 4CU9A 4QX0A 2WN2A 4MOAA 4JKLA 1UY4A 3K46A 3OGRA 3HJRA 3I2GA 1K42A 2JKXA 1OF3A 3NJVA 2RVAA 3FN9A 4ET7A 2EICA 2Y64A 2YB7A 1NUKA 5G04L 2VR4A 3IIIA 3K4ZA 1RYYA 2BGOA 4QDSA 4XUQA 4DEVA 4A44A 4BK5A 2DCKA 2J7MA 4CU8A 3CIHA 2J1UA 2ZEYA 2VMFA 3T2QA 1SHWB 1W8NA 3I2HA 3OB8A 4BK4A 2ID4A 2VTFA 5JXHA 4W4ZA 1D7PM 3WF0A 4A42A 3OEBA 5LA2A 4TTGA 4OUEA 1UY3A 1GOGA 2VCCA 4UI9L 4LHSA 4DXTA 4P08A 2QBXA 2KD7A 2VQUA 3K4DA 4UAPA 3IB3A 1I5PA 4MADA 2J1TA 4OZOA 5F7UA 3GXUA 2QQMA 2E26A 4P00B 2VZRA 2V72A 4XVHA 3PUHA 2W5FA 1JYWA 3WNPA 3UNPA 4ARXA 1UXXX 2BERA 3C7FA 1OH4A 2Y6HA 3WF4A 4ZY9A 3E1F1 2VZ1A 4PQQA 3MUY1 2JE8A 2BGPA 2L9LA 2W95A 2YFUA 2WZ8A 4OMDA 3T08A 2C26A 1CIYA 1UMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1I A;  1J83 A;  1JU3 A;  3T2P A;  1JZ4 A;  1OF4 A;  4CUA A;  4CVU A;  1OD3 A;  4Z2A A;  5LCW L;  3MBW A;  3WF1 A;  3HN3 A;  1K45 A;  1JYN A;  2Y6G A;  1DLC A;  1L7R A;  1CX1 A;  5G05 L;  1GQP A;  2V5D A;  4L0P A;  4BXS V;  1W9S A;  2LW8 A;  2VC9 A;  1JZ7 A;  4P5Y A;  3THC A;  3T09 A;  2JD9 A;  2X10 A;  3LPG A;  3MV1 1;  4QB2 A;  2QQI A;  3LEG A;  1T2X A;  2VJX A;  3CKH A;  3IDA A;  1JYV A;  4DEQ A;  1PX4 A;  3HOB A;  1IQD C;  3F2Z A;  4W8J A;  4E8C A;  4ARY A;  2VZV A;  3CMG A;  3ACG A;  3K4A A;  2EID A;  2VZU A;  2QQJ A;  3A21 A;  1NX9 A;  2YFZ A;  5IYY A;  2W91 A;  4AAX A;  3I2F A;  3I2K A;  3A7Q A;  1W9T A;  3NJX A;  2PQS A;  3J7H A;  3NQH A;  3C7G A;  2ZEX A;  1J84 A;  3GGL A;  2J1S A;  4P02 B;  3I3E A;  4DXR A;  5C7G A;  1JZ5 A;  1TG7 A;  1F4A A;  3WNK A;  4QDQ A;  1UMI A;  1WCQ A;  3OBA A;  4QDR A;  4A6O A;  4RN5 A;  2E33 A;  2V4V A;  2Y6J A;  1H6Y A;  5JXI A;  3GM8 A;  5IJR A;  1NAE A;  1JZ6 A;  1JZ8 A;  4FI9 A;  3EB7 A;  1NKG A;  2ORZ A;  2W87 A;  2VQT A;  3ACI A;  4QX3 A;  3I3B A;  3LE0 A;  3AC0 A;  4GWJ A;  3WNL A;  1P8J A;  3A23 A;  2B4K A;  1O8S A;  4OYU A;  3C8X A;  1F4H A;  2CDO A;  2QQK A;  1W8O A;  2VZO A;  1UWW A;  3U37 A;  4GWI A;  1UX7 A;  5DQ0 A;  1R64 A;  1GOH A;  2VZQ A;  1KEX A;  5DPN A;  1US3 A;  2J1R A;  3ACH A;  4ZXE A;  3I2J A;  1XPW A;  3VDB A;  1W99 A;  3HNY M;  3WF3 A;  2R7E B;  1JHJ A;  4JKK A;  1XNT A;  2QQN A;  3VDC A;  3WF2 A;  2WZE A;  5CZK A;  2VCB A;  5B4N A;  1GNY A;  4OMC A;  2ZEZ A;  3ECQ A;  1BHG A;  1JZ3 A;  1CZT A;  1DYO A;  3C7E A;  4A41 A;  4XUR A;  3UET A;  2VM9 A;  1W9W A;  2EIE A;  1SDD B;  3NNG A;  3T0B A;  1JI6 A;  3FHA A;  2W9X A;  1PMH X;  4KI5 M;  5LA0 A;  3MO4 A;  4XZU G;  4E8D A;  4YPJ A;  2XHN A;  2ORX A;  4ZZ8 A;  1UYX A;  3W5N A;  4KMQ A;  1US2 A;  1XNA A;  4W50 A;  3IAQ A;  5IFP A;  3WNN A;  3ZM8 A;  1DP0 A;  4JX0 A;  2OKX A;  1GU3 A;  2W1U A;  2Y8K A;  1KGY A;  1CZS A;  1SG3 A;  2WYS A;  4KWU A;  3I97 A;  3WNM A;  3SEE A;  1PX3 A;  3EYP A;  5C70 A;  3UES A;  3WNO A;  2VZP A;  2VL4 A;  4DUV A;  5JXG A;  5CYY A;  4LQR A;  2XOM A;  4QX1 A;  2YC2 A;  3HEI A;  2W94 A;  4XUN A;  4A4A A;  2X09 A;  4DUW A;  3WEZ A;  4QAW A;  2VME A;  4QPW A;  3BGA A;  1UY2 A;  4QX2 A;  3THD A;  2W47 A;  1TVG A;  1PMJ X;  5LA1 A;  1LNS A;  4PF1 A;  2VMC A;  5EIY B;  2J1E A;  3VD9 A;  2B9V A;  2VMD A;  3WSO A;  2W1Q A;  5J1X A;  3A22 A;  2HLE A;  2W46 A;  1GMM A;  5IFT A;  4BDV B;  2WO3 A;  1O8P A;  3VD3 A;  1WKY A;  2YC4 A;  5DMY A;  5I0D A;  3GDB A;  3PUI A;  3VDA A;  3C7O A;  3LEI A;  3MV0 1;  4A45 A;  1HN1 A;  3ABZ A;  1XC6 A;  1H6X A;  2VZS A;  2WQ8 A;  4GZ9 A;  3K75 B;  3OEA A;  2E31 A;  3MUZ 1;  1EUT A;  4MGQ A;  5JR2 A;  4QB6 A;  2WO2 A;  2X05 A;  3HPN A;  4M4R A;  2WAB A;  1GOF A;  3ETP A;  5A1A A;  1GUI A;  2XON A;  1L7Q A;  1K12 A;  2WAO A;  3SKJ E;  1MPX A;  1JZ2 A;  2XQX A;  1O59 A;  2RJ2 A;  1OT5 A;  4D8M A;  3OGV A;  4MGS A;  3BN6 A;  1UYZ A;  2E32 A;  3T2O A;  1YQ2 A;  5C71 A;  3FHQ A;  2VZT A;  2VO5 A;  5HPO A;  5JXJ A;  2BZD A;  1UY1 A;  3CDZ B;  1JYX A;  4JHZ A;  4ZZ5 A;  1EUU A;  4CU7 A;  2VOT A;  2W92 A;  1UY0 A;  4IUG A;  2WUH A;  2J1A A;  2J1V A;  3T0A A;  4D0Q A;  2WO1 A;  3DYO A;  2ZXQ A;  3FL7 A;  2QQO A;  3K77 A;  1ULP A;  5EJZ B;  5EJ1 B;  3I2I A;  3NRU A;  3OG2 A;  2HYX A;  4LPL A;  2CDP A;  1CZV A;  4RYD A;  5FUI A;  3P6B A;  4TXW A;  3W5M A;  2VCA A;  2BBA A;  2Z4F A;  4HG6 B;  3CZU A;  3VD7 A;  3IAP A;  5DN2 A;  3SEP A;  4CUC A;  1UXZ A;  3I3D A;  2Y6K A;  4UOJ A;  2VZ3 A;  5JMO A;  3ACF A;  3VD5 A;  2JDA A;  3WQB A;  2W1W A;  2WAA A;  2J22 A;  2LS6 A;  4MO3 M;  4DXS A;  2C4X A;  4M4P A;  2ZEW A;  4JKM A;  4XUT A;  4CU6 A;  5JUV A;  1UYY A;  4LKS A;  4CUB A;  1ULO A;  3C7H A;  3CZJ A;  3HNB M;  5IHR A;  3JXS A;  4XUP A;  2DCJ A;  3DEC A;  4A3Z A;  4PT6 A;  3T0D A;  4XUO A;  2EIB A;  1JU4 A;  5HXM A;  3VD4 A;  3DYM A;  5B4X A;  3OGS A;  4DUX A;  3LQC A;  3DYP A;  4BJ0 A;  1W0N A;  3D3A A;  2QQL A;  2RV9 A;  2W1S A;  3LPF A;  2DDU A;  3CQO A;  2Y6L A;  2W3J A;  3LEK A;  4AG4 A;  1K3I A;  2WBK A;  3HNM A;  3SKV A;  4QB1 A;  2C9K A;  1UZ0 A;  2WN3 A;  2YG0 A;  2WDB A;  4CU9 A;  4QX0 A;  2WN2 A;  4MOA A;  4JKL A;  1UY4 A;  3K46 A;  3OGR A;  3HJR A;  3I2G A;  1K42 A;  2JKX A;  1OF3 A;  3NJV A;  2RVA A;  3FN9 A;  4ET7 A;  2EIC A;  2Y64 A;  2YB7 A;  1NUK A;  5G04 L;  2VR4 A;  3III A;  3K4Z A;  1RYY A;  2BGO A;  4QDS A;  4XUQ A;  4DEV A;  4A44 A;  4BK5 A;  2DCK A;  2J7M A;  4CU8 A;  3CIH A;  2J1U A;  2ZEY A;  2VMF A;  3T2Q A;  1SHW B;  1W8N A;  3I2H A;  3OB8 A;  4BK4 A;  2ID4 A;  2VTF A;  5JXH A;  4W4Z A;  1D7P M;  3WF0 A;  4A42 A;  3OEB A;  5LA2 A;  4TTG A;  4OUE A;  1UY3 A;  1GOG A;  2VCC A;  4UI9 L;  4LHS A;  4DXT A;  4P08 A;  2QBX A;  2KD7 A;  2VQU A;  3K4D A;  4UAP A;  3IB3 A;  1I5P A;  4MAD A;  2J1T A;  4OZO A;  5F7U A;  3GXU A;  2QQM A;  2E26 A;  4P00 B;  2VZR A;  2V72 A;  4XVH A;  3PUH A;  2W5F A;  1JYW A;  3WNP A;  3UNP A;  4ARX A;  1UXX X;  2BER A;  3C7F A;  1OH4 A;  2Y6H A;  3WF4 A;  4ZY9 A;  3E1F 1;  2VZ1 A;  4PQQ A;  3MUY 1;  2JE8 A;  2BGP A;  2L9L A;  2W95 A;  2YFU A;  2WZ8 A;  4OMD A;  3T08 A;  2C26 A;  1CIY A;  1UMH A; 
#chains in the Genus database with same CATH topology
 4B29 A;  1J83 A;  2C9A A;  1RIN A;  1DQ6 A;  1OF4 A;  1UN1 A;  1PMI A;  3I59 B;  4CVU A;  5DZF A;  1YQ8 A;  2ES3 A;  1AYM 2;  1MS3 A;  1RUE 1;  2RMU 3;  5FO8 B;  1IPK A;  2YBP A;  4JGY A;  1K45 A;  4F8A A;  1GWL A;  4ERO A;  1AR9 3;  2Y6G A;  1HRI 1;  1WMX A;  2ZJC A;  1S0D A;  4O9G A;  1RUJ 2;  4Q4V 2;  1UPS A;  3D4K A;  3UGG A;  1FOD 1;  1GQP A;  2H0B A;  1GQG A;  2V5D A;  1REE A;  5T5L A;  3ZXJ A;  3TRS B;  5J48 A;  4IV1 C;  2HWC 2;  3NV3 A;  1RVF 3;  4JDO A;  1OD5 A;  4P5Y A;  5FYC A;  3THC A;  1J58 A;  1RHI 1;  3H0O A;  4RL7 A;  3MIB A;  2OX0 A;  2P6C A;  1LOA A;  2QQI A;  3RWK X;  2PHU A;  1VMH A;  2XDV A;  3RZL A;  4DQA A;  2P4E A;  3I3Q A;  1DGR A;  1JYV A;  2YDE A;  1PX4 A;  3HT1 A;  3NWK A;  1UW8 A;  3T1L A;  4BME A;  3ZXA C;  5I0R A;  4Q5O A;  3O1R A;  4QXK A;  2LUW A;  4ITC A;  4Q0V A;  5BY5 A;  5A7Q A;  5FXV A;  2ADE A;  5JDB A;  2PLV 1;  4GH4 A;  3MF6 A;  1Q3E A;  2DTY A;  3NKG A;  5KXB A;  2W91 A;  4LA2 A;  4CDW C;  5CKN A;  1WA6 X;  3H8X A;  4IEV A;  1IOA A;  4XF4 A;  1GLH A;  3TEY A;  1CAV A;  1NCR B;  1UCX A;  3GGL A;  5BV6 A;  4S2H A;  2J1S A;  4J25 A;  5HV4 A;  2B45 X;  1RL3 A;  2P3K A;  2HKX A;  3AFG A;  3IPV A;  3KCY A;  2VNO A;  4DXR A;  1V6J A;  5K4L A;  2YXS A;  1TG7 A;  2DVA A;  4HKL A;  1MQT A;  4XTM A;  4AOC A;  4IEZ A;  3ITQ A;  1JOD A;  1F2N A;  1W2O A;  3WNK A;  4HAN A;  4MUV A;  4F7Z A;  2BU9 A;  1RUC 3;  2AC1 A;  4E2Q A;  1W90 A;  4XBN A;  4MSV A;  4RN5 A;  1LJ7 A;  1JXN A;  2BVV A;  4LJH A;  5A7W A;  3HMY A;  1S2E A;  5CFD C;  2HBT A;  1TEI A;  5JAX A;  4Y1V A;  5EWS A;  1NAE A;  5FZ6 A;  2RDR A;  1ZBA 2;  3PHM A;  1EY2 A;  5DAV A;  3KQR A;  3R6S A;  3EB7 A;  1LRH A;  2ORZ A;  2W87 A;  4QU1 A;  4XMI A;  5AFB A;  1K5J A;  2EVX A;  1TME 2;  4RGG A;  1S0B A;  2WLQ A;  3WDU A;  2QDR A;  3I3B A;  1XE0 A;  3OUJ A;  4IER A;  1XU1 A;  1Z78 A;  3J9S A;  4ES8 A;  4Q29 A;  4CDX B;  1Q8V A;  2WNV C;  4HMZ A;  4FPK A;  3C8X A;  5FBJ A;  5H9Q A;  4K20 A;  2ZAC A;  4AVS A;  1W8O A;  4GWI A;  3LGR A;  1MZ6 A;  1VBB 1;  2PTM A;  1G6N A;  5JIU A;  3ON7 A;  1QOS A;  4QU2 A;  5DUX A;  3WQ1 A;  2BEO A;  1KEX A;  5F37 A;  1R08 2;  3MYX A;  1US3 A;  1X9P A;  3LB9 A;  2ETE A;  1UMZ A;  1VBA 2;  2JB8 A;  4R9C A;  4XBL A;  3G7D A;  4FPC A;  5F9T A;  3MIC A;  3ZN4 A;  1NLQ A;  1VBE 1;  2ZX0 A;  3HNY M;  3ZR5 A;  4QGL A;  2E7A A;  5FQ0 B;  3NNF A;  2KXL A;  1ZRE A;  2FZ1 A;  3J7M A;  2VVE A;  2WZE A;  2ZZQ A;  2XG3 A;  5BNN A;  3ZMN A;  2JIC A;  1HV0 A;  1CAW A;  1GNY A;  1MS1 A;  3DEM A;  2ZEZ A;  3WCS A;  4FPH A;  4LHL A;  3CJI B;  2HWB 2;  3C7E A;  3RMX A;  3UKT A;  4XUR A;  1YFU A;  3ZFG A;  4A41 A;  5GZG A;  2R04 2;  5FZD A;  4OI1 A;  4YW3 A;  2VM9 A;  4CZS A;  5ACA 3;  1ND3 A;  1AR6 3;  2ZX3 A;  2E6V A;  4W6W A;  1JI6 A;  3QH6 A;  3PIJ A;  2W9X A;  1ZBE 1;  4KI5 M;  1PO1 3;  2FCU A;  2YPJ A;  3VBR B;  5EXO A;  5CKM A;  1HLC A;  4E8D A;  4V2W A;  2UY8 A;  4UW5 A;  2DVB A;  3DV8 A;  1SQ4 A;  2XHN A;  2ORX A;  1OUS A;  2KR2 A;  4SBV A;  4XXP A;  1K5M C;  5FKB A;  1AYN 2;  4HL0 A;  1US2 A;  2EAK A;  2UY9 A;  5LB6 A;  1QMJ A;  4NHK A;  2WJS A;  1NCQ B;  2BUK A;  3NW4 A;  4XFG A;  2OKX A;  4L8Q A;  3ROU A;  5CIS A;  1KGY A;  1CZS A;  2YGL A;  1LHN A;  1ND2 A;  1XJA A;  3I97 A;  4HVQ A;  3UYJ A;  5GZC A;  3PUS A;  4GWN A;  1KD7 A;  5FZC A;  1MEC 2;  1V00 A;  4LBO A;  4AQ6 A;  1W0P A;  4HBN A;  4QXC A;  1PX3 A;  1SBD A;  1QWR A;  2WC2 A;  4XIK A;  3ZSJ A;  4MZU A;  1APN A;  1W8H A;  2VZP A;  3WLU A;  1ULF A;  2G9G A;  5JXG A;  3KD4 A;  4Q4X 2;  1I9R A;  2AZ5 A;  4XDQ A;  4C8D A;  5JMC A;  2XOM A;  1EV1 1;  5GAL A;  4QX1 A;  1H2K A;  3LKJ A;  4XUN A;  1NQD A;  2BNN A;  5F5I A;  5FXW A;  3TEX A;  3T1M A;  1W2N A;  4FAG A;  3MID A;  4OUM A;  4A3X A;  1WUV A;  1UY2 A;  2CWM A;  1SLL A;  4GMP 3;  3THD A;  5BNQ A;  1J1L A;  3OGJ A;  5C3P A;  5KHG A;  4ISQ A;  3AMM A;  1PMJ X;  5LA1 A;  4AQS A;  2CSG A;  2LRP A;  1RUF 2;  4CCE A;  2IUW A;  2WNU B;  2AR6 A;  4TWT A;  5KHK A;  1JBC A;  3VBH A;  4LOR A;  2CAV A;  1F31 A;  5A7N A;  2B9V A;  1NQJ A;  5DUW A;  5LK5 A;  2G4I A;  3ASI A;  3WP3 A;  1TMF 1;  2EXJ A;  2HLE A;  4Y5S A;  3IZO A;  1GMM A;  3O0V A;  3O0X A;  1A78 A;  1X7N A;  2A73 B;  2PMW B;  5HXV A;  4DFS A;  4GB3 1;  3WVJ A;  1OXC A;  2J42 A;  3POJ A;  4NRO A;  1WZX A;  5IVB A;  3THT A;  1RUD 1;  5JPM B;  5C4W B;  1OLM E;  1LB2 A;  4LUK A;  4OHW A;  1SBE A;  1XNK A;  5BNP B;  2RMU 2;  3ES4 A;  2GDF A;  2R06 1;  3UKN A;  3VBU B;  1AUY A;  4YZ2 A;  1URX A;  1AR9 2;  2VBP A;  3PME A;  5I0D A;  5LRS A;  3ZR6 A;  1KIT A;  1UIK A;  3GF6 A;  3CL1 A;  4PBP A;  1IS3 A;  4HN0 A;  5JI9 A;  3ABZ A;  1HRV 3;  4NJ4 A;  1H6X A;  1W05 A;  1RVF 2;  1NZI A;  4FOW A;  2P3J A;  2VXR A;  3PU8 A;  4P9W A;  1QJU 1;  3OEA A;  3VBF C;  4BH9 A;  2D5H A;  2E31 A;  5KHI A;  1AR8 3;  1RUG 1;  4QB6 A;  1AVB A;  3VUO A;  4NO4 A;  3FX3 A;  1IGO A;  1XXN A;  5GZE A;  4C91 A;  3AVR A;  4W6Y A;  5LEK A;  4FFH A;  2H6C A;  4MXW B;  4AGG A;  3ZYP A;  2BBV A;  4AEJ A;  4LOS A;  4XF1 A;  2ARA A;  2DCZ A;  2A6X A;  3ILR A;  1D2S A;  1BYH A;  5AVP A;  5CAD A;  1WLT A;  3B02 A;  4N8M A;  2E7T A;  3O5S A;  4IEP A;  5FY1 A;  1POV 0;  1PIV 2;  1R1Z A;  1YCI A;  5FXX A;  4JGY C;  2GNM A;  1QIQ A;  1KQR A;  2XJS A;  3O0W A;  1POV 3;  4KBB A;  1DFQ A;  5LBC A;  3H1W A;  1O4Y A;  1EP0 A;  3FHQ A;  3P3N A;  5JXJ A;  1IQA A;  3LCP A;  2TEP A;  3AJY A;  1BCX A;  4JHZ A;  3W9A A;  4ASM B;  1HKD A;  4JRA A;  1Q43 A;  2VMH A;  2VOT A;  2YU2 A;  1GBG A;  3VHN A;  3OBZ A;  3POF A;  4IE4 A;  1YFW A;  2J1A A;  3NJZ A;  4XBQ A;  4FPJ A;  2EA7 A;  4M00 A;  3NKT A;  5J98 B;  2OII A;  3DYO A;  3RJR A;  1C8M 3;  1HJF A;  4OHX A;  5C9A A;  3SHR A;  2FDF A;  4P14 A;  5EJ3 A;  1CAV B;  2HYK A;  3I4I A;  4L92 A;  1BQP A;  5LY1 A;  4GD4 A;  2Q1Z B;  5HCA A;  5EJ1 B;  3BIE A;  3I2I A;  3OG2 A;  2NLR A;  1Y9M A;  4XJ8 A;  4GH4 C;  2PQQ A;  2AEY A;  4XQW A;  1OSG A;  1R09 1;  5DAP A;  2R07 1;  2BDR A;  3AX4 A;  2QCS B;  5ABJ A;  3BVC A;  3P6B A;  5LY2 A;  4YVW C;  4LUM A;  4YZ4 A;  2D3R A;  1OPO A;  3OTF A;  2IXJ A;  5A7W B;  2Q8D A;  3RQ0 A;  3BTY A;  2RDQ A;  4IEW A;  2PAE A;  3CZU A;  1QQP 1;  1PGS A;  1YXW A;  1ZZ8 A;  5CU1 A;  5DN2 A;  3ZLI A;  4AI2 A;  3RZM A;  2QFE A;  3I3D A;  2VCM A;  2Y6K A;  3PDQ A;  3URF A;  4RQP A;  1ULE A;  3VL9 A;  4XFC A;  3ZYJ B;  4Q8L A;  3H3U A;  2GNB A;  1HN0 A;  1MQT C;  4N9H A;  5A3T A;  5JIA A;  1TQ5 A;  3O12 A;  3VHO A;  2OQ6 A;  2PHR A;  4WVZ A;  4W6X A;  1VAL A;  4M4P A;  4EN8 B;  1FI2 A;  4QPI A;  5FXZ A;  3S5Q A;  4UBH A;  4GUL A;  4JKM A;  4FBF A;  4XUT A;  5C8C A;  4N43 B;  5D21 A;  2WS9 2;  3UGH A;  4J1W A;  5A3L A;  4CUB A;  5DG2 A;  1ULO A;  3WHU A;  4LKD A;  2WFP A;  3U4S A;  4BPZ A;  1FX5 A;  4ZU7 A;  1C28 A;  5IHR A;  2ZAB A;  1H1A A;  5EP9 A;  4XUP A;  1NY7 2;  1A3K A;  1C1F A;  3HD8 B;  5D8A B;  1LEM A;  4PT6 A;  3PVE A;  2EIB A;  4RD7 A;  2QQP A;  2BPA 2;  4CCM A;  3QD6 A;  1PO1 2;  4OZX A;  3DYP A;  2P5B A;  4J6G A;  3POI A;  5FZF A;  2YHJ A;  3JZV A;  4I0W B;  4EN6 B;  1CAW B;  4NWW A;  5A1L A;  5I91 A;  2Q30 A;  5A7P A;  4CA9 A;  2RV9 A;  2W1S A;  5JWP A;  2R0F A;  1FPN 2;  3LEM A;  1W6M A;  1OOP C;  2DCT A;  3I8T A;  1ND3 B;  3OOX A;  1KDK A;  5FWJ A;  3QAC A;  4O65 A;  2FZ2 A;  2Q0A A;  5I8S A;  4AG4 A;  3ZYI B;  2Y0O A;  4K40 A;  5DUU A;  1ENX A;  1WA4 A;  3ZDS A;  2EF6 A;  2A6W A;  2VMG A;  4NRQ A;  4QB1 A;  4CP0 A;  1PK6 A;  2GMM A;  3VBS A;  3FWE A;  3AKS A;  4XF9 A;  2X8K A;  4FXG B;  4Y22 A;  5E8A A;  1N3P A;  5JR7 B;  1C5I A;  5L73 A;  1CPM A;  1ACC A;  2GC2 A;  5FZG A;  3ZFG C;  1DQ1 A;  1XBF A;  4BA6 A;  3I59 A;  5IK4 A;  1Q8S A;  5JLV A;  4XCB A;  3BOP A;  1UY4 A;  3K46 A;  1N3O A;  4AQT A;  2OA2 A;  4YG6 A;  1DZR A;  5FZ4 A;  1VMJ A;  4B1M A;  4D6S A;  1M4W A;  1DF0 A;  4EN0 A;  4P9X A;  3I2G A;  1V6I A;  2JKX A;  4BQX A;  4CDU B;  1ASJ 1;  3WX5 A;  3AMP A;  4Y20 B;  4HET A;  3KMH A;  1EPZ A;  2RVA A;  1ND2 B;  2TBV A;  2WA3 A;  3FN9 A;  4K8R B;  1KS4 A;  1C1L A;  5DUV A;  3M8L A;  1EAH 3;  2GU9 A;  1X82 A;  3LFI A;  1HXS 3;  4QDS A;  3S57 A;  1X33 A;  2DCK A;  5JZG A;  1H8V A;  3MEP A;  4BQ3 A;  1FXZ A;  1AYM 3;  3KM5 A;  4UFJ A;  2ZKL A;  2JDU A;  2DV9 A;  4IEQ A;  4QQP A;  5EV7 A;  5CEH A;  1RUJ 3;  1WW4 A;  3I2H A;  4Q4V 3;  1W6P B;  3OPT A;  1UKG A;  5A3P A;  5BYN A;  1H8T B;  1XRU A;  4UFM A;  1LAJ A;  4UFH A;  2ID4 A;  5FAX A;  3OSD A;  2VTF A;  2ZHL A;  3B94 A;  1IPJ A;  2DU0 A;  1XSR A;  2R30 A;  3JBG 1;  3U78 A;  2ZA9 A;  5BPX A;  1ZRC A;  1VPH A;  2F17 A;  3PTY A;  4Q1P A;  3OF1 A;  4TTG A;  2ZS6 B;  2KA3 A;  2VCC A;  4N7U A;  4XAC A;  2KD7 A;  1V6L A;  5K8S A;  3B5L B;  5IUQ A;  5T54 A;  4YG3 A;  1I5P A;  1NCR A;  1Y3T A;  3W20 A;  3VBH B;  3VZM A;  1JN2 P;  5GLU A;  2A6Y A;  1GP4 A;  1HQL A;  3HQU A;  4PHZ A;  4AEK A;  2RS5 3;  2DU1 A;  3PVO A;  5F6K A;  2MPF A;  3IMN A;  2YV8 A;  1HRV 2;  3K3N A;  3PUH A;  4K8F A;  3KVB A;  1JYW A;  1FMD 1;  1UXX X;  2D93 A;  2I45 A;  4XFA A;  3WF4 A;  4CDQ C;  2WFF 3;  3MUY 1;  4QX7 A;  3FBM A;  5T55 A;  5DG1 A;  4GJZ A;  3RYK A;  2JD4 A;  4QT6 A;  1RIT A;  1D4V B;  1UF2 C;  3VZJ A;  2JEM A;  4UW3 A;  2WZ8 A;  3GHM A;  4OMD A;  3T08 A;  1H9W A;  1S4C A;  5A7O A;  1CIY A;  1S2K A;  2Z2S B;  3SNM A;  3P1I A;  1JU3 A;  1DHK B;  1JZ4 A;  3PNA A;  3VV1 A;  1U5Y A;  1S0G A;  5FWE A;  1MS0 A;  2HWE 1;  4IXL A;  5F39 A;  5JPN B;  1YEW A;  3MBW A;  3WF1 A;  3HN3 A;  3U07 A;  1ZBA 3;  3MIE A;  1ZA7 A;  2QTW B;  2WZR 1;  1DLC A;  2D97 A;  5BXX A;  1YI7 A;  4X8P A;  1UD1 A;  5F3E A;  5JI7 A;  2GP5 A;  2P1B A;  2QVS B;  2LW8 A;  4LLF A;  1QH6 A;  1TME 3;  1UOG A;  2F4L A;  2VOK A;  3PUR A;  4DRV A;  1WW5 A;  2P34 A;  2ZX1 A;  4FPG A;  3KHC A;  3T09 A;  5IAX A;  1VMF A;  1YI9 A;  2RS3 2;  4IEY A;  3U11 A;  1G8W A;  4YZ5 A;  3M3C A;  3B69 A;  5KHJ A;  2ZX4 A;  2HEW F;  2VPV A;  2WNO A;  4HKO A;  4I0A A;  4CXX A;  4RS5 B;  5FQ0 A;  3LEG A;  5IK5 A;  5A32 B;  1T2X A;  4XIL A;  1W6N A;  3KVA A;  3CKH A;  4D94 A;  3JU9 A;  4QQL A;  2SLI A;  1UAI A;  1C8M 2;  2XVG A;  1IQD C;  1YQ6 A;  3LAG A;  1EPW A;  3C2U A;  1XQN A;  2SBA A;  1R08 3;  3HIF A;  3L9J T;  1UL9 A;  4YWA A;  1GIC A;  1S1A A;  3CJI A;  3SMH A;  1FV3 A;  5FZ9 A;  1VBA 3;  2OQ7 A;  3GBW A;  3K4A A;  4LKE A;  3UJQ A;  4BMB A;  1FYU A;  3WP6 A;  4HKW A;  4I09 A;  1RMU 3;  4KWK A;  5IYY A;  3I2F A;  3FFQ A;  5LWB A;  1CJP A;  3E97 A;  4YZ1 A;  2ZGL A;  3LFM A;  3NJX A;  4FFI A;  4JRL A;  2XQR A;  5FYZ A;  3J7H A;  1W6O B;  2ZHN A;  4S2D A;  1OPM A;  1J84 A;  4Q27 A;  3ZN6 A;  4S2G A;  5FZB A;  4O61 A;  5FY5 A;  1PM7 A;  5DAW A;  5CFC C;  2HWB 3;  3ZXE A;  5L9V A;  4QD2 A;  4HON A;  4XHB A;  3WXP A;  1F4A A;  3RI9 A;  1MVQ A;  1NCQ A;  4YAR A;  3MIG A;  3ZKU A;  5K7P A;  3OBA A;  4A6O A;  3TN9 3;  4CE8 A;  4RR3 A;  3DKQ A;  5FK8 A;  3IBM A;  2BP6 A;  5D2A A;  1MZ5 A;  1H6Y A;  2XXZ A;  3L2H A;  3VBO B;  4MGY E;  4AFD A;  5C9A C;  3OD4 A;  5C3R A;  5C3S A;  5FMO S;  2ZML A;  1YFY A;  1QJY 3;  3EXU A;  1OFS A;  3WD5 A;  2QZ2 A;  2XWJ B;  4FI9 A;  4COW A;  1AYN 3;  1NKG A;  2VQA A;  1JOP A;  4GIQ A;  3E5X A;  1Y4W A;  1SDW A;  2ZGK A;  2VW0 A;  2Y26 A;  3N7L A;  4Q4W 1;  4QX3 A;  5LAS A;  3SCH A;  3WNL A;  1OQD A;  3WIN E;  3IIA A;  1X36 A;  1QOT A;  1UO9 A;  2JJ6 A;  2Q4S A;  3KCX A;  2OZ6 A;  5F32 A;  1JMU B;  2CDO A;  4H3W A;  2A3W A;  3NV2 A;  1MEC 3;  1UX7 A;  4RQP C;  1YRZ A;  1LGC A;  3GCX A;  4IGQ A;  5FMC A;  1GOH A;  3WQ0 A;  2NPI A;  2ARC A;  1AX0 A;  3UGF A;  2J1R A;  1PVX A;  3ACH A;  4B4P A;  4ZXE A;  5EFU A;  1KJL A;  3SIT A;  4IQP A;  1ZRI A;  1C8N A;  4Q4X 3;  4KG8 A;  5F1R A;  2WNU A;  5FKC A;  3Q8A A;  1NE4 A;  3RWN A;  4QPI C;  3WT3 A;  1PGL 2;  1NA1 B;  2K2S A;  2R7E B;  1QXJ A;  1O3T A;  5C8C C;  2D44 A;  2D3P A;  1W3V A;  3AZZ A;  2QQN A;  1QJF A;  5FYU A;  3KF5 A;  2VUJ A;  1H4G A;  3V0B B;  5EYX A;  1V6M A;  3RS6 A;  3ECQ A;  1BMV 1;  1BHG A;  1GP6 A;  1B35 A;  4LO6 B;  1HDK A;  3FUO A;  3U14 A;  3ZSE A;  1ONA A;  1SCS A;  5ACA 1;  2GNT A;  1RTV A;  5LBE A;  1OBN A;  1MS8 A;  4Q4Y 3;  1MAC A;  3KV4 A;  2MEV 3;  2XL7 A;  1SFP A;  3VL8 A;  4P9J A;  3VBU A;  4AI0 A;  5ERL A;  3H3Z A;  3MO4 A;  3ZYB A;  2JKB A;  1J3P A;  2JG8 A;  2P2K A;  4IGP A;  5FIX A;  1MVE A;  1IS4 A;  2P3Y A;  4BYY A;  1OA3 A;  1PK6 B;  2Y33 A;  4K21 A;  3VBS B;  4ZZ8 A;  2BTV C;  1Q8P A;  4PIX A;  4Y22 B;  1HXS 2;  2JG9 A;  5FYB A;  3WHT A;  3AYD A;  3J8F 3;  4L2N A;  1GZW A;  3HT2 A;  4QWN A;  4BHP A;  3VKL A;  4HK8 A;  4YSF A;  4Y1Z A;  1JH5 A;  4W50 A;  5SV8 A;  5BNO C;  4TN7 A;  1RUO A;  4LOT A;  3RNS A;  3WNN A;  1DP0 A;  3NMB A;  5FY0 A;  4B3N A;  2GND A;  1YQC A;  2Y8K A;  3ILF A;  4JDM A;  2WYS A;  4BE3 A;  1H9P A;  4MXW A;  3I2D A;  1RUH 3;  4LBJ A;  4RHV 2;  4UXA A;  5FZO A;  4BQY A;  5ANQ A;  2VOV A;  1PO2 3;  1I5Z A;  2UWC A;  1AL2 1;  1VBD 3;  4XAE A;  3ZXD A;  4R52 A;  1XND A;  2CTV A;  4FFG A;  1Z7S 3;  5C70 A;  1Y9G A;  3LA2 A;  4XDP A;  5JZG B;  4IV1 B;  1OQ1 A;  3POB A;  5C3Q A;  4HXC A;  1G9F A;  4XYX A;  1WLC A;  2VL4 A;  2PEL A;  2B7Y A;  3KT4 A;  5CYY A;  4DUV A;  5JSR A;  4LKF A;  2IXH A;  3ELN A;  3ATG A;  4J1X A;  2YC2 A;  3HEI A;  3WV6 A;  3LDK A;  3VHR A;  1G86 A;  5FO9 B;  4RFT 0;  2X09 A;  2DCY A;  2MHF A;  3CLP A;  3SXW A;  4EN7 B;  3WEZ A;  4QAW A;  4Z1V A;  5K0U B;  1I1E A;  1OA4 A;  2RS5 2;  2RR1 3;  4QX2 A;  5FRA A;  1TNR A;  4XJ9 A;  2IVJ A;  3OJB A;  1TVG A;  1PIV 3;  4NPM A;  5LZ6 A;  2O8O A;  4R9B A;  4BU2 A;  4PF1 A;  5DAQ A;  5A33 B;  5JCT A;  1DQ0 A;  1SLA A;  2VMC A;  3SH5 A;  1HB2 A;  4IET A;  1DYP A;  2WWU A;  3VD9 A;  1RB8 G;  1YJL A;  2WFF 2;  2I74 A;  4MGK E;  4XFF A;  2VW1 A;  3FLT A;  2W1Q A;  2Z5W A;  4GXL A;  4LIT A;  1W06 A;  1QXR A;  2R0H A;  1OVP A;  2Y6F A;  4QPG C;  3H50 A;  4LBK A;  3RZZ A;  2VNR A;  4GWM A;  2W52 A;  4YYO A;  3NL1 A;  4BCU A;  3LIH A;  1J1T A;  1O4T A;  4BDV B;  1DCS A;  1R09 2;  1ENS A;  1RJ8 A;  2WO3 A;  1O8P A;  2ZAA A;  5T5O A;  1WKY A;  4YW7 A;  3VD3 A;  4C0B A;  1MS4 A;  2IFR A;  4QHB A;  5I0S A;  4CEY B;  1PGW 1;  2I07 B;  1S55 A;  5A3W A;  5CFD B;  2CHH A;  3GDB A;  4ZS2 A;  5A3U A;  1F8V A;  3GBF A;  2WWS A;  3N4M A;  2AEN A;  1YIF A;  2MNG A;  2VZS A;  2WSU A;  2WQ8 A;  5A3N A;  4LE3 A;  4NRP A;  3O7O A;  2VVF A;  1AR7 3;  2CWS A;  4IE7 A;  4GZ9 A;  1VBC 3;  1RUI 1;  4NPL A;  1COV 1;  4X6R B;  1Z0H A;  2WO2 A;  3NV4 A;  1O5L A;  4EE2 A;  2WT2 A;  5DXD A;  2X05 A;  5K9Y A;  4M4R A;  2WLP A;  3AZW A;  4N43 A;  4WVM A;  5ISL A;  1X8E A;  2RS1 1;  4AGR A;  2VH9 A;  3O14 A;  1O5U A;  4RA0 A;  4AK3 A;  4YW1 A;  2WAB A;  3SCF A;  5A1A A;  1ODN A;  5FZH A;  4BQW A;  2WIN B;  4AVA A;  1L7Q A;  2WAO A;  5IT6 A;  5IVF A;  4LHN A;  1MPX A;  4C90 A;  3DL3 A;  4LHK A;  5D8A A;  4CDX C;  1OT5 A;  5F2S A;  4A7K A;  3OGV A;  1RMU 2;  5F5Q A;  2VUA A;  2ZBJ A;  4H7L A;  5CNA A;  3BIW E;  4Q8K A;  5AC9 1;  3RZH A;  2JDK A;  1L7L A;  2E32 A;  3BKZ A;  1CWP A;  1W6N B;  1POV 1;  1FT9 A;  2WS9 3;  2FDJ A;  4EYU A;  3POS A;  3R05 A;  3ZIW A;  1YQ2 A;  1OQE A;  5C71 A;  1Q8Q A;  3T4V A;  4YM3 A;  2XL9 A;  5AVA A;  3PUQ A;  2VD7 A;  2ZGN A;  3CDZ B;  5DZE A;  3OBR A;  4HT1 T;  2P17 A;  1ULG A;  1EUU A;  3GYD A;  2JWP A;  2G1M A;  2NM1 A;  2W92 A;  4JQT A;  5GZF A;  5KXE A;  2VY0 A;  2WUH A;  4WZC A;  5TSW A;  3AB0 A;  1W3X A;  2J1V A;  3OUH A;  1GZC A;  4D0Q A;  4XE9 A;  1Q8O A;  2VEC A;  3PU3 A;  4LBQ B;  2BYV E;  5CVR A;  3AL6 A;  3TN9 2;  3ZO0 B;  3O1T A;  1PNG A;  4AGV A;  4CTE A;  3CU7 A;  3M4F A;  1VB2 A;  2RM2 1;  4YFW A;  4PI2 A;  1WBL A;  4FSJ A;  3ZN6 B;  2D6O X;  1LU1 A;  1H30 A;  3JD7 2;  1LOB A;  3WDW A;  1QJY 2;  2X29 A;  3CJI C;  3HQX A;  3NRU A;  5DDJ 3;  4YVS C;  4XQ4 A;  5DAX A;  3VHP A;  3DPR B;  3WCR A;  4E2G A;  1FPN 3;  5A6Z A;  2HYX A;  4YW5 A;  4E27 A;  1RXF A;  1OFN A;  4HPK B;  4O9E A;  4ISR A;  4RYD A;  2A1X A;  5FYI A;  4TXW A;  3W5M A;  2VCA A;  3ZOI A;  3S7E A;  4CDU A;  2PHF A;  1W2T A;  4MVT A;  4RR3 B;  4Y20 A;  2Y0I A;  3VBR C;  4Y4Y A;  2QJV A;  4NAM A;  4P9Y A;  3VD7 A;  5FZE A;  2E53 A;  3WOG A;  4DIN B;  4CUC A;  2ZAH A;  4UOJ A;  3DF0 A;  2R1D A;  2GZW A;  2JIJ A;  1BBT 1;  4IE0 A;  4WVW A;  2KM2 A;  3ACF A;  1R1A 1;  4DXZ A;  5JMO A;  1C4R A;  2JDA A;  3WQB A;  1VP6 A;  1GSL A;  2XUM A;  3OY8 A;  5FUP A;  5IVY A;  4CCC A;  1G9B A;  4JTO A;  1F35 A;  1NCQ C;  2A6V A;  2Q8O A;  5GJ6 A;  4M3C E;  5T5P A;  4DXS A;  2DUR A;  4JGZ C;  2G9Z A;  3A0K A;  2B8M A;  4EN9 B;  3PMS A;  3USS A;  2IC1 A;  4BOW A;  1RUE 3;  1W6P A;  3KQ4 B;  4ZS3 A;  3U1X A;  1H8T A;  3AM2 A;  4WM7 A;  5FLJ A;  5JUV A;  1UYY A;  1NLS A;  1WWY A;  4P5H A;  4YGE A;  2WII B;  4GMP 0;  4D6R A;  4PLO A;  4YG0 A;  4A7Z A;  3TEZ A;  1GV9 A;  2XBO 1;  3HNB M;  4K7J A;  3LSD A;  1V6K A;  1DGW X;  2B9U A;  3NAP B;  4MG2 A;  3OYW A;  1W9F A;  2VE1 A;  3U10 A;  1V9U 1;  2Y38 A;  3K51 A;  4CEW B;  4NE9 A;  3VDD A;  4JDN A;  5AFE A;  1IG0 A;  5HV0 A;  3LOB A;  2PAM A;  4I0B A;  4ZXK A;  4FQ4 A;  4FOV A;  4PDW A;  2YZ4 A;  4YW6 A;  5HXM A;  1T6G C;  3DYM A;  4Q4Y 2;  2WO7 A;  5B4X A;  2MEV 2;  3U75 A;  1UU6 A;  3O1O A;  1V0A A;  1NXD 1;  5KHH A;  1HQN A;  4BIS A;  5FYH A;  5FZ0 A;  5FZK A;  2YUE A;  3IN9 A;  4BLI A;  3KGZ A;  4Q0P A;  3BOW A;  4K3U A;  3AP7 A;  4IW3 A;  1B35 B;  4AI8 A;  5C8W A;  3I3M A;  3D3A A;  2QQL A;  4MXV A;  4C1W A;  2V73 A;  3J8F 2;  4G4F A;  2VTX J;  2ZMN A;  4N7I A;  4P9I A;  3VKO A;  2OW4 A;  5F3G A;  2WNU C;  3IDE A;  1U0A A;  3ME2 A;  4QM9 A;  3AYA A;  5LAT A;  1GZT A;  1W28 A;  1YC6 1;  2IZW A;  3HNM A;  2HWF 2;  4PLN A;  1W6Q B;  2JG8 B;  4QXB A;  4UFI A;  3SKV A;  4AWD A;  4NIG A;  2UWA A;  2Q5T A;  4BXF A;  2C9K A;  2CAU A;  1N1Y A;  1RUH 2;  5F5A A;  2JIG A;  2XJP A;  3Q8C A;  4CXW A;  3MDP A;  4AW7 A;  1PO2 2;  4UBG A;  2WDB A;  1VBD 2;  3WDV A;  4CU9 A;  2JG9 B;  3FLR A;  1F5F A;  1Z7S 2;  1GZW B;  3ZSM A;  4AI3 A;  5C4W C;  3QBQ A;  3OGR A;  3ZFF A;  4L11 A;  4URT A;  5BNP C;  2B46 X;  3A0N A;  4KBZ A;  2XJQ A;  1K42 A;  4IND A;  4M0N A;  3VBU C;  2Q1M A;  2JDN A;  1XU2 A;  4COU A;  2HWE 2;  4QX8 A;  3NJV A;  4EZ4 A;  5GLV A;  2CGO A;  2VU9 A;  2Y64 A;  3GAL A;  3TNP B;  2YC0 A;  1EAH 1;  5FZO B;  1I6X A;  1QHD A;  2WZR 2;  1RYY A;  1FNZ A;  4XUQ A;  2HWD 2;  2XVK A;  3M70 A;  4I01 A;  1VRH 1;  2O14 A;  3AKR A;  2J7M A;  3H1Y A;  4CU8 A;  1XYP A;  2RR1 2;  1W8W A;  4JVA A;  4D3W A;  4RS5 A;  3ZXK A;  1LTE A;  5F3C A;  1A8M A;  4FVV A;  5A32 A;  2V09 A;  3BI3 A;  2ZGO A;  2VMF A;  2ZOE B;  3MPB A;  1HX6 A;  1RUJ 1;  2XUE A;  4Q4V 1;  1SHW B;  1GR3 A;  2WRA A;  3KWV A;  3B93 A;  4JAA A;  5FK7 A;  5LA9 A;  1RIR A;  5IWF A;  4XXA A;  2HWC 1;  3BPS A;  4W4Z A;  3SH4 A;  5JXH A;  1H1M A;  1CIW A;  5L7O A;  3JCI A;  1VBB 3;  3IDB B;  4A42 A;  5FDB A;  2PA7 A;  5J36 A;  2QQV A;  2RS3 3;  4EQV A;  4LBM A;  3FBY A;  4B7K A;  4OUE A;  3SLI A;  1GOG A;  5J09 A;  4UI9 L;  4Y3O A;  1LKN A;  2GN7 A;  4P9L A;  4CCO A;  1JUI A;  2D6L X;  4AED B;  2C5D A;  3K4D A;  4UAP A;  5IAV A;  5LK7 B;  1CR7 A;  1LOG A;  5IVJ A;  1W6O A;  3GJB A;  1W2A X;  2NZ9 A;  4MAD A;  4AHY A;  3HWJ A;  4UWD A;  2CL2 A;  2BV4 A;  2A7A A;  5F7U A;  2QQM A;  2E26 A;  3W21 A;  1IS5 A;  1CN1 A;  2YMZ A;  2AEZ A;  1QU0 A;  2DUO A;  4XVH A;  3W59 A;  3WUC A;  2ARE A;  2VTX A;  3LA7 A;  1KXG A;  1AR7 2;  3UNP A;  1VBC 2;  2IXC A;  1W0O A;  4GQ7 A;  2BER A;  3C7F A;  1PZ7 A;  5J7M A;  2R49 A;  1YWK A;  3VKM A;  2D6P A;  4Z07 A;  3E1F 1;  2VNG A;  2VZ1 A;  1LOF A;  3LSE A;  4ZY9 A;  4QKB A;  1ZBE 3;  3VBO A;  3B9I A;  4K6B A;  1PZ9 A;  3O1U A;  2L9L A;  4QHO A;  4A2U A;  2W95 A;  1XOY A;  5J37 A;  4OUS A;  3BB6 A;  1NG0 A;  2UU8 A;  1JHN A;  4Y1U A;  4N90 A;  5I0U A;  2G19 A;  4DB5 A;  4CUA A;  2VUD A;  3AYE A;  2FD8 A;  1F5J A;  1JS9 A;  1OD3 A;  4L9B A;  3E5U A;  1H2N A;  4Z2A A;  2OT7 A;  1WCK A;  5FZL A;  2CY6 A;  4UFK A;  4D7S A;  1CAX B;  1LOE A;  1ZNP A;  1ZBA 1;  1W03 A;  4WVM B;  1X8M A;  2VUC A;  3BOD A;  5LBB A;  4LXL A;  4Z82 A;  5T5J A;  5G05 L;  2GC0 A;  5DAB A;  1UU4 A;  1W9S A;  1QJX 2;  3AFK A;  5A70 A;  1JZ7 A;  1LCL A;  1POQ A;  1H1I A;  3RGB A;  3UJO A;  1BEV 2;  4DIQ A;  1Y7B A;  3LPG A;  1NA1 A;  3PLQ A;  4QB2 A;  5IK7 A;  1DQ4 A;  4BM8 A;  2LAL A;  3ETQ A;  4N43 C;  3IDA A;  4DZG A;  4I3P A;  1N47 A;  4Y4R A;  4YW4 A;  5LBF A;  4KH9 A;  4DEQ A;  2A3X A;  3HOB A;  2JEN A;  3N9L A;  3F2Z A;  3B7M A;  3V0B A;  3N7J A;  1R08 1;  5FY4 A;  4W8J A;  5B2G B;  1WCS A;  1SLC A;  4W65 A;  1UX6 A;  1VBA 1;  3ZIX A;  4KWJ A;  5DDJ 2;  3VB9 A;  4LT5 A;  2W0X A;  5F2W A;  1XE8 A;  5HI0 A;  4QQH A;  1PVC 2;  4M01 A;  4AAX A;  3I2O A;  4ZU4 A;  4BIO A;  5GLZ A;  2ATF A;  3A7Q A;  2ZGR A;  4ASK A;  4H7M A;  1SPP B;  1UYP A;  2ZHM A;  3N7K A;  1D4M 2;  3C7G A;  2ZEX A;  4Y26 A;  2D5F A;  5BNN C;  3AMQ A;  4P02 B;  1I3H A;  1XNB A;  2HWB 1;  2O8Q A;  4XHX A;  3NJY A;  2R04 1;  3OBT A;  2RDN A;  1RUN A;  5C7G A;  3Q9O A;  1JZ5 A;  1BZW A;  1ND3 C;  3BTZ A;  4QDQ A;  1F9K A;  1UMI A;  4PBO A;  2V4A A;  3MI8 A;  4ZON A;  3IMM A;  1T6B X;  4QDR A;  3GHN A;  4XQD A;  2YY1 A;  4U2A A;  2Y6J A;  1JUH A;  1ULC A;  2UWB A;  5FZ8 A;  4QHZ A;  5FOJ B;  2NN8 A;  1RUE 2;  3GM8 A;  5IJR A;  3MFC A;  2R06 3;  1D0H A;  2E7Q A;  1YJK A;  4YM2 A;  1HRI 2;  3PTR B;  1GFF 2;  2VQT A;  1QOO A;  4DS0 A;  1FOD 2;  3KZ4 C;  3OY8 B;  4IV1 A;  2YBK A;  4HVR A;  1VJ2 A;  4R8H A;  1ZYB A;  1S0I A;  4N53 B;  4ATF A;  5L36 A;  4Y1Y A;  3KT1 A;  3V0A B;  3A23 A;  1RHI 2;  1W8U A;  3HBK A;  4MLO A;  4CDU C;  1O8S A;  1RUG 3;  3RJ2 X;  4D6Q A;  3VLB B;  1ND2 C;  3AXD A;  5FJH A;  5FZ7 A;  2YPD A;  2YRO A;  3B00 A;  2QQK A;  1MEC 1;  2VZO A;  1UWW A;  2JDY A;  4RHV 3;  4WM7 B;  1XYN A;  5DQ0 A;  3U37 A;  1OLM A;  1R64 A;  3TB0 A;  1DBN A;  5K0U A;  2VZQ A;  3TYJ A;  1JOB A;  5DPN A;  4GJY A;  3OYW B;  2O1Q A;  1AZD A;  2IFW A;  4XJW A;  4Q4X 1;  1UOJ A;  3FMG A;  3VDD B;  3ZYR A;  3I2J A;  2PLV 2;  5FYY A;  5A33 A;  4OFG A;  5F3I A;  1X9T A;  2YYO A;  4NHX A;  4PDW B;  5L9R A;  4M3C F;  3VZL A;  1H8T C;  4CP2 A;  2ARX A;  3SQO A;  3ZMO A;  2D7F A;  3VDC A;  4FTB A;  2ZGT A;  4AEM A;  2P6H A;  4KWL A;  5T3N A;  2D3S A;  5EPA A;  3WP4 A;  2VCB A;  2O0O A;  4OMC A;  4IEO A;  1JZ3 A;  3HQR A;  4TZD A;  1QGL A;  1DYO A;  2PAK A;  1M06 G;  3UET A;  3UT0 A;  1RUF 1;  3AKP A;  2Q8C A;  1BJQ A;  2ET7 A;  2EIE A;  1SDD B;  3H8U A;  4HFS A;  3T0B A;  3AP5 A;  1GQH A;  2D40 A;  1PMH X;  1ODM A;  5FYV A;  3AZX A;  3VBH C;  4CEY A;  4E4Z A;  4XZU G;  5CFD A;  1W39 A;  3ZDV A;  1XYO A;  5C5U A;  1VE0 A;  2WSV A;  3USU B;  5E16 A;  5H9P A;  2BRT A;  5FR3 A;  1O3S A;  1XNC A;  5FZM A;  4K1Z A;  4OI0 A;  4A6S A;  2EAA A;  1AJK A;  4XF3 A;  1R09 3;  2HEY F;  3IAQ A;  4COV A;  2RMU 1;  3LIG A;  3ZFF B;  4NIH A;  1UIJ A;  2XJU A;  3S6P A;  1IKP A;  2QQW A;  4FPO B;  4JX0 A;  1AR9 1;  2W1U A;  4ATE A;  1COV 2;  1EYB A;  1SG3 A;  5LEJ A;  3UKV A;  3M7A A;  1TNF A;  1QQP 3;  2OZJ A;  2XJR A;  1JTZ X;  4XJU A;  2OS2 A;  2IXK A;  3WNM A;  5C6C A;  1RVF 1;  3MF9 A;  4NWV A;  3SEE A;  1VBB 2;  1ZRD A;  2GH8 A;  4ASL A;  2WT1 A;  1YIP A;  3UES A;  3WNO A;  1A8D A;  4WM8 B;  2EAL A;  2EIG A;  4FO9 A;  4HVO A;  1KFU L;  3JUU A;  3WW4 A;  4LQR A;  4IV3 B;  1LHU A;  4XDO A;  4COZ A;  3JB8 A;  1CVN A;  1VBE 2;  4V1P A;  5FPX A;  3VZK A;  4DUW A;  2BNO A;  1XB9 A;  3ZYG A;  2PYT A;  5L7O B;  2ENR A;  4COY A;  2VME A;  2D6M A;  2PHL A;  3BGA A;  1AXY A;  3FLP A;  3H7Y A;  1PIV 1;  1AHS A;  1W8T A;  3INA A;  1WCD J;  5T52 A;  4QGN A;  3UL2 A;  4RS5 C;  1LNS A;  3ACL A;  4CCK A;  4UYB A;  2AH2 A;  3MFA A;  4LBQ A;  2A6Z A;  4YFZ A;  1NT0 A;  4OI4 A;  5F6L B;  1IHM A;  5EIY B;  2DVG A;  4TSV A;  5A6Q A;  4LBL A;  4DRR A;  1ZBE 2;  2VMD A;  3MLK A;  4OQ9 A;  4UW6 A;  5I93 A;  3WSO A;  4FTE A;  3BUC A;  4KQ7 A;  3VN4 A;  4EJR A;  3DPR A;  2XKO A;  2XH6 A;  5GM0 A;  4XOG A;  4HPK A;  4NAO A;  3ZFE B;  5CFC B;  2Q1F A;  2C1F A;  3RI8 A;  5FRE A;  3DCQ A;  1RUC 1;  2QUO A;  5FPB A;  4U36 A;  3WG3 A;  4AFA A;  4KGG A;  1D0G A;  5J96 B;  3GJA A;  4K1Y A;  2YC4 A;  5KXC A;  3U4X A;  3ZSK A;  1JOJ A;  3JD7 3;  1QY4 A;  4R9D A;  3ES1 A;  3N3H A;  1SLB A;  2OXB A;  4LO8 A;  4FPE A;  2XGX A;  3N9P A;  4CRQ A;  3PVB B;  2HH9 A;  1DU3 D;  2VBB A;  3TNQ A;  3I49 A;  2X53 S;  2DVF A;  3POY A;  4NHL A;  1U12 A;  3S0M A;  1R1A 2;  4OHY A;  5ABJ C;  4XAB A;  3MUZ 1;  2PXJ A;  5KXD A;  4IE5 A;  4MGQ A;  1NXM A;  5JR2 A;  5FYS A;  3VKN A;  3VBO C;  1LOF C;  4NVP A;  3QH7 A;  4Y5T A;  4XET A;  1EV1 2;  1QDC A;  1ZRR A;  4XZP A;  4NID A;  1PM4 A;  3Q8F A;  1GOF A;  1SCR A;  2BFU L;  1GUI A;  2VGD A;  4UT5 A;  1HB1 A;  3NAP A;  1YLL A;  2R1B A;  3ZKY A;  4LBQ D;  3MLL A;  1K12 A;  3SKJ E;  3DXU A;  4CP1 A;  4CEW A;  1JZ2 A;  3AMN A;  2XBO 2;  1DZQ A;  2X5I B;  2XHK A;  2JDM A;  4JCK A;  5E6H A;  4AHW A;  1V9U 2;  3LF7 A;  1DQ2 A;  4PQ9 A;  3QCW A;  5FP7 A;  3MHZ A;  1OHF A;  1QJE A;  1UYZ A;  2WS9 1;  1OA2 A;  3BN6 A;  3H42 B;  5FY9 A;  4CPB A;  4DY5 A;  2JDP A;  3BCW A;  4NOT A;  4YW2 A;  2YU1 A;  4MGI E;  4ZPI A;  2VO5 A;  4DO0 A;  1NY7 1;  2BZD A;  1JYX A;  3C3V A;  4ZZ5 A;  1AX2 A;  1TMF 2;  1HW5 A;  5IVC A;  1AR6 1;  1UY0 A;  3KB5 A;  3TEW A;  1CJD A;  1G7Y A;  2FMD A;  2H6B A;  2IXI A;  4GB3 2;  1NA1 C;  3PL0 A;  1O91 A;  3T0A A;  3VKF C;  2WO1 A;  3POG A;  1N3Q A;  1PO1 1;  1RUD 2;  1A34 A;  1W6Q A;  2D98 A;  3FL7 A;  4GAZ A;  4D7Y A;  3WP5 A;  2BVB A;  4M3C B;  1ULP A;  2PHX A;  5E89 A;  2R06 2;  3N36 A;  1HJG A;  5BUV A;  1BVP 1;  1GYK A;  2DBN A;  2P37 A;  3JB4 C;  4LPL A;  4TLF A;  4AQ2 A;  4CYD A;  4HOO A;  2CDP A;  3M3I A;  1O7F A;  3ZXL A;  1S0J A;  1VAK A;  5EQU A;  3VBF A;  3WNX A;  1U5I A;  1UKR A;  4RFR B;  4XIO A;  1QJU 2;  2Z4F A;  4HG6 B;  1KS5 A;  5BNO B;  1FMD 3;  1GNH A;  1MR5 A;  1RUG 2;  2HWF 3;  3VZN A;  3NO8 A;  5M0T A;  3IAP A;  2FMY A;  4XTP A;  3X29 B;  1PK6 C;  1UXZ A;  3AMH A;  3IDC B;  1QEX A;  2YGM A;  3VBS C;  3FE5 A;  3ZN5 A;  3EHK A;  4IL7 A;  3VD5 A;  5JSP A;  4TLG A;  2C0Z A;  4CPB D;  1DLL A;  1Q56 A;  2QNK A;  4GKY A;  2F6B A;  2ZZJ A;  2GAU A;  3CO2 A;  1LHV A;  1VRH 2;  2VBD A;  1W9Y A;  2WNE A;  2ZPX A;  4LO5 B;  3OPZ A;  2C4X A;  2HWE 3;  5FPL A;  4CCD A;  1QNW A;  2WQZ C;  4I2O A;  4PIY A;  1Y9Q A;  4KG0 A;  2I2S A;  3GNE A;  4YRD A;  1DDL A;  5FYT A;  4MGZ E;  2QKD A;  4E4S A;  2WZR 3;  2GC3 A;  1A6C A;  2HWD 3;  3C7H A;  3CZJ A;  4YM0 A;  4E4D X;  4GMP 1;  2OYZ A;  5JZG C;  2ZMK A;  4OVE A;  2DCJ A;  3AXE A;  1RC6 A;  1IS6 A;  2V5Y A;  2PHW A;  2XWB B;  5IW0 A;  1UOB A;  2W08 A;  1KFX L;  2HBU A;  4AED A;  3CF6 E;  4XUO A;  1LUL A;  1JU4 A;  3VD4 A;  1GAN A;  3RG0 A;  4CDW B;  4LTA A;  5CAZ A;  1LGN A;  1WMD A;  3OGS A;  4AVT A;  4YGC A;  2CV6 A;  4DNY A;  3WW1 A;  3B3Q E;  5K0U C;  2OPK A;  1L3J A;  4R4X A;  2BOJ A;  5I8Y A;  2UYB A;  1D2Q A;  5L19 A;  2WWJ A;  4CP9 B;  4QPG B;  3CNA A;  3DKW A;  4BQ2 A;  3BTA A;  2ZKN A;  3DGT A;  3KCC A;  5LRR A;  3IKW A;  1QDO A;  3V65 A;  1CAU B;  4LMF A;  2VOW A;  1U5Z A;  1CPN A;  5FPA A;  2R07 2;  1FNY A;  2Y6L A;  4S2F A;  1HIX A;  2WQ4 A;  2W3J A;  3LEK A;  4FPF A;  4YVW A;  1NCR C;  1TE1 B;  1K3I A;  1OKO A;  1YHF A;  2WYF A;  4XFI A;  4MET A;  4QPY A;  3N9N A;  1QQP 2;  4HN1 A;  1HQW A;  1VIW B;  3DN7 A;  5A3O A;  1HRV 1;  4RSU A;  1CES A;  3JQW A;  4BQ4 A;  4NHM A;  4MHU A;  4MOA A;  5FLI A;  1AR8 1;  3KLS A;  5A7S A;  5F5C A;  3HJR A;  4XFH A;  1CAX A;  5LW9 A;  2WNV B;  4CEY C;  4I30 A;  3LZZ A;  4JV4 A;  1DGR N;  3LWC A;  3SC7 X;  3WG1 A;  2N7G A;  4ET7 A;  3KHB A;  1MZF A;  5FP9 A;  1TZO A;  4AAP A;  2VR4 A;  3III A;  3K4Z A;  1LEC A;  4XCA A;  4DEV A;  2LRO A;  4BK5 A;  2HEV F;  3WY6 A;  4LUL A;  3M3O A;  3CIH A;  4XJZ A;  4Q4W 3;  3OD0 A;  2ZEY A;  3N9O A;  4IGO A;  3T2Q A;  2QQU A;  3MIH A;  1W8N A;  3ZXG A;  4JZR A;  4G9S B;  3R4S A;  3VZO A;  1SMV A;  4BK4 A;  4Y33 A;  1QJX 3;  2JDZ A;  4QMA A;  3WF0 A;  2Z42 A;  1IPS A;  3LA3 A;  4Q0Q A;  3T2T A;  5HBA A;  1KDM A;  5J3U A;  2RS3 1;  4KU8 A;  1X50 A;  3H8R A;  1BEV 3;  3OEB A;  5FPV A;  4ZHN A;  2ZCW A;  1J3R A;  3AYC A;  1OH3 A;  3AZV A;  4EZH A;  4LHS A;  1OOP A;  4OI2 A;  2RG4 A;  3I7D A;  5FMB A;  2W2I A;  2FDI A;  3VGI A;  1C8M 1;  2VQU A;  1RGS A;  4FPY A;  1SPP A;  3DUI A;  3IB3 A;  3K3O A;  1ZZ7 A;  2ARB A;  2IWG B;  4MYE A;  1Q5O A;  3SCG A;  2UUR A;  5JOW A;  2A70 A;  4P00 B;  2VZR A;  4KNC A;  4P9G A;  3KV5 A;  5JOX A;  3H8O A;  2CGP A;  4BZ4 A;  1BK0 A;  1C57 A;  1CD3 G;  3MIF A;  1PVC 3;  4YVS B;  1K5M B;  1WW6 A;  3WNP A;  4XF0 A;  2VQ0 A;  5HCF A;  5JSO A;  3GZE A;  2JB4 A;  5D1I A;  4ARX A;  1OH4 A;  2Y6H A;  3H1M A;  4I02 A;  1D4M 3;  1N1S A;  1UPI A;  4PQQ A;  5FZ1 A;  4AI9 A;  4FOY A;  1ASJ 2;  4FP2 A;  2BGP A;  4DPN A;  1AF9 A;  1BVV A;  5KWR A;  3DPR C;  2HJI A;  2C26 A;  1UMH A;  3WDT A;  2JXA A;  3T2P A;  4AI1 A;  3FJS A;  4N53 A;  4Z2W A;  3V0A A;  1GP5 A;  1LR5 A;  1NYW A;  2RJK A;  5FJK A;  4RR3 C;  4UF0 B;  4XW3 A;  4Y24 A;  4CCJ A;  3FC0 A;  5LCW L;  1G9D A;  5DZG A;  2XB6 C;  5C33 A;  1LEN A;  4JGZ B;  1F15 A;  1HB3 A;  5JOZ A;  1JYN A;  2K0G A;  1L7R A;  1HRI 3;  2R16 A;  4QKN A;  5FZI A;  1CX1 A;  3T30 A;  1FAT A;  4L0P A;  4FOQ A;  4PJY A;  2GH2 A;  4BXS V;  1FOD 3;  4FTS A;  2VC9 A;  1AL2 3;  2ET1 A;  4LR4 A;  1H2M A;  3BU0 A;  3K48 A;  3JBG 2;  3ZPY A;  3E6C C;  4QXH A;  5APA A;  2WT0 A;  1RHI 3;  1BKZ A;  1J3Q A;  2JD9 A;  2X10 A;  4OUL A;  5SV5 A;  5KR7 A;  3MV1 1;  4PI0 A;  3KT7 A;  3O1M A;  4OHV A;  5CIR A;  2VJX A;  1VLN A;  3NST A;  3WDY A;  1VB4 A;  4AHZ A;  4AFC A;  2DYC A;  3FHI B;  4C0H A;  4Q26 A;  1QXP A;  2GN3 A;  3D6E A;  3NAP C;  1NE6 A;  1YFX A;  1ZA4 A;  2NYY A;  2FHR A;  5FTT C;  4E8C A;  4ARY A;  2VZV A;  2BQP A;  4F83 A;  2GMP A;  4PCR A;  1PZ8 A;  3CMG A;  3ACG A;  4CEW C;  2EID A;  2CU5 A;  5FUN A;  2VZU A;  2QQJ A;  3D82 A;  2PLV 3;  1STM A;  3A21 A;  2A3Y A;  1PGL 1;  1NX9 A;  1UNB A;  1UZY A;  1WW7 A;  2YFZ A;  3PIG A;  2WR9 A;  5KC6 A;  3RZK A;  2NMO A;  3I2K A;  5H9R A;  2YBS A;  1W9T A;  2FDK A;  1O3Q A;  1FMD 2;  2PQS A;  3EMR A;  3NQH A;  4CDQ A;  3GZT B;  4QM8 A;  4ZU5 A;  2DFB A;  4L97 A;  3USU A;  1SLT A;  3O1V A;  4JC1 A;  3N9Q A;  1B35 C;  2DF7 A;  4AFB A;  4AVV A;  2DFC A;  3I3E A;  4IES A;  1J59 A;  5GLW A;  1WME A;  3M2M A;  2BJS A;  4ONU A;  1AL0 G;  5CBL A;  1RED A;  1LOC A;  4LLO A;  2DTW A;  1CX4 A;  4KL1 A;  4NR1 A;  1C5H A;  4FFF A;  1WCQ A;  3F95 A;  3VBF B;  1H2L A;  5GKA C;  2E33 A;  2V4V A;  1ENR A;  2ZTN A;  4TYS A;  4QX5 A;  4XC9 A;  2JG8 C;  5JVV A;  4FP3 A;  5IK8 A;  5A3M A;  4B4R A;  5JXI A;  3UK9 A;  3NNL A;  1JZ6 A;  1S2B A;  5FV3 A;  1JZ8 A;  1ALY A;  1HXS 1;  2B5H A;  3J7N A;  4LO7 A;  3ACI A;  4LK6 A;  4FXK B;  1G9C A;  2JG9 C;  1W2U A;  2EXK A;  4PIZ A;  3A4U A;  1QNY A;  1WGP A;  1VRB A;  4AL9 A;  2B42 B;  1AYM 1;  1B09 A;  4HZF A;  4WM8 A;  2LTN A;  1SLI A;  1E5R A;  3LE0 A;  4GWJ A;  3AC0 A;  1KRI A;  3KV6 A;  3LDB A;  1P8J A;  2JE7 A;  3LDR A;  1RUI 3;  4AVB A;  4IV3 A;  3NVC A;  2B4K A;  1COV 3;  2AYH A;  4OYU A;  4HSJ A;  1F4H A;  4RHV 1;  2Q8E A;  4JGY B;  3WR0 A;  2VOX A;  3RPQ A;  2RS1 3;  2BWC A;  3OCP A;  3M3E A;  3ZX7 A;  4DMI A;  2FCT A;  2ILM A;  4MHR A;  3CHX A;  4QQ2 A;  3WW3 A;  1AJO A;  5A80 A;  2DWR A;  3HN1 A;  3TWI A;  2WKK A;  2R6Q A;  1XPW A;  1YQ5 A;  2FBE A;  3VDB A;  4URA A;  1IG3 A;  2DUP A;  5E88 A;  4OQ8 A;  1W99 A;  3T4H B;  3ZXF A;  1VBE 3;  3GCW A;  2FDH A;  3WF3 A;  3FZ3 A;  1JHJ A;  1MZE A;  1SAC A;  4JKK A;  5AC9 3;  5HCH A;  1XNT A;  3WF2 A;  1NLR A;  1XE7 A;  2RS5 1;  3WUD A;  1XSQ A;  5CZK A;  1JYT A;  3NNM A;  5B4N A;  1JYI A;  4ES9 A;  3ZFE A;  5CFC A;  1CZT A;  2VG9 A;  1UOF A;  3TBD A;  1DGW A;  4LA3 A;  1UU5 A;  3S30 A;  3TOJ A;  4GH4 B;  1W9W A;  2PN5 A;  2F4P A;  2PFW A;  2WZP P;  4AED C;  3NNG A;  3CEW A;  2W39 A;  4KU7 A;  3FHA A;  3MW4 A;  2XVL A;  1OMI A;  1RUC 2;  2WFF 1;  3FFZ A;  1UQX A;  4LNV A;  3NV1 A;  4YVW B;  5LA0 A;  1ZM1 A;  4O7X A;  3ORJ A;  1GWK A;  3AL5 A;  2DUQ A;  1WD3 A;  2RM2 3;  2DBI A;  2RJL A;  4YPJ A;  3ZSL A;  1WLD A;  1DIW A;  4QKF A;  4AE2 A;  1UYX A;  4ZKT B;  3BU7 A;  3IPV B;  4X8N A;  3W5N A;  3L2Y A;  2NQY A;  4KMQ A;  1SFN A;  1SBF A;  5FO7 B;  3WZ1 A;  3RYR A;  1YO8 A;  1IZ3 A;  1XNA A;  1MQT B;  3B01 A;  3MW2 A;  5IFP A;  4Q4W 2;  3ZM8 A;  1VAV A;  3AKT A;  4RGA A;  5FFO C;  1GU3 A;  1QH7 A;  1V70 A;  4KWU A;  4HK9 A;  5F8P A;  5CG8 A;  4YZ3 A;  1TME 1;  1GNZ A;  1DGL A;  4Z92 B;  3SIS A;  1BBT 3;  3KGL A;  5FOB B;  1AX1 A;  5IAT A;  1R1A 3;  3EYP A;  5FPZ A;  3BAL A;  2X5I A;  3RDI A;  4XAA A;  3RMY A;  3PJY A;  3RRD A;  3E5Q A;  2Y60 A;  3ENR A;  2FCV A;  4JQR A;  2AAC A;  3QLQ A;  3NNJ A;  1GKB A;  2WA4 A;  3B9C A;  3ZYF A;  2P3I A;  1WBF A;  3J4U H;  3N9M A;  1EV1 3;  4CCL A;  2W94 A;  1C3H A;  2GAL A;  4IEU A;  4NHY A;  4A4A A;  1VR3 A;  2NMN A;  2UYA A;  1UZW A;  1LOD A;  3AP6 A;  2XBO 3;  4QPW A;  3KSC A;  3WDX A;  2ERF A;  5D8A C;  3RZG A;  5GLT A;  4B4Q A;  2W47 A;  1BMV 2;  1OLQ A;  1RMU 1;  1O4Z A;  1V9U 3;  1V6N A;  2QZ3 A;  5A6X A;  4EWA A;  3D0J A;  3OGG A;  3PUA A;  1OOP B;  5ACA 2;  4IDZ A;  2K9Z A;  1AR6 2;  5FYM A;  5A1F A;  3MZH A;  2J1E A;  1VAM A;  4M3C A;  4AXO A;  4Q0S A;  3P5B A;  1S0C A;  5J1X A;  3A22 A;  4YM1 A;  2W46 A;  4HSL A;  1DZT A;  1TMF 3;  5BNN B;  3S5A A;  5C5T A;  5GZD A;  4DY3 A;  2CYF A;  4GB3 3;  4BIF A;  4PF5 A;  5FPU A;  3ZFG B;  2ZX2 A;  3HAG A;  5IFT A;  3TN9 1;  2A71 A;  4E9K A;  4N9I A;  4Y1X A;  1SFY A;  1RUD 3;  4MX3 A;  5BNO A;  4H14 A;  4FT8 A;  2VVD A;  3MGU A;  4OCT A;  3JD7 1;  2ZGP A;  4WZF A;  3UV9 A;  2ZGQ A;  1QJY 1;  5DMY A;  4AR2 A;  2D6K A;  4Q1R A;  1AYN 1;  3PUI A;  3CJX A;  1ZVF A;  3C7O A;  3VDA A;  3LEI A;  1SEF A;  1RJ7 A;  3MV0 1;  4A45 A;  4B7E A;  1HN1 A;  4ORF A;  1XC6 A;  2IXL A;  4FCA A;  4IEX A;  4K9S A;  1AL2 2;  4BB3 A;  3PVN A;  3K75 B;  5FP4 A;  3HVD A;  1QJU 3;  4D7T A;  1EUT A;  3BYW A;  2OVU A;  2JE9 A;  1E57 A;  4B8E A;  1HB4 A;  2CGN A;  2B39 A;  3HPN A;  3ZPO A;  3BPZ A;  4BLJ A;  4AF9 A;  3J7L A;  3ILN A;  4OLL A;  3IT8 A;  1DYK A;  4BQ1 A;  3WG4 A;  3LD8 A;  3D0S A;  3ETP A;  2XON A;  4QKD A;  2XLG A;  3WG2 A;  2XLA A;  4NPR A;  3HBZ A;  1RXG A;  2AGS A;  3ZVX A;  1ZZ9 A;  3AP9 A;  1QF3 A;  3D8C A;  2XQX A;  4N53 C;  1VRH 3;  4NN0 A;  1O59 A;  2RJ2 A;  5FP8 A;  1N1V A;  4D8M A;  1W8F A;  1ZX5 A;  3LOI A;  4MGS A;  1H4H A;  2A5Z A;  3AVS A;  4CDW A;  1OI6 A;  4JHT A;  3Q8B A;  4XJA A;  1G9A A;  4WM7 C;  1E5H A;  2JEC A;  1UZV A;  3GZU C;  3D5O A;  3T2O A;  1LED A;  4FAH A;  2XJV A;  2VZT A;  5HPO A;  2VW2 A;  2QE3 A;  3O1S A;  2VMI A;  1CGP A;  5FMD A;  1UY1 A;  2HWC 3;  4YLZ A;  4CP9 A;  4EWE A;  4QPG A;  5ANN A;  2RE9 A;  5FZA A;  4CCN A;  3H3L A;  4SLI A;  3VDD C;  1MS5 A;  1UZZ A;  3APB A;  4CU7 A;  1LHW A;  1WD4 A;  4IUG A;  3BTX A;  1CAU A;  3IM0 A;  4Q4Y 1;  3AK0 A;  3OUI A;  2MEV 1;  4PDW C;  3Q8E A;  4WV8 A;  2TNF A;  1OVS A;  1QJZ A;  5I8T A;  1YNA A;  3KV9 A;  3KF3 A;  4R9A A;  2PHD A;  2ZXQ A;  2QQO A;  4H2A A;  5H9S A;  3K77 A;  1JYC A;  3AJZ A;  3R4U A;  4V2V A;  4CDQ B;  1IKQ A;  3S7I A;  4DOU A;  4E4H A;  3ZYH A;  4L99 A;  2XML A;  1PGW 2;  5EJZ B;  1HV1 A;  2GSY A;  3J8F 1;  4YGB A;  5CG9 A;  3H7J A;  3V64 A;  1GZ9 A;  1PHM A;  2E9Q A;  1CZV A;  2BWA A;  4I3G A;  2R07 3;  5FUI A;  4AVC A;  1N1T A;  2JDH A;  2WNV A;  2BBA A;  2GME A;  5KBF A;  2HWF 1;  1LES A;  1AR8 2;  1OKQ A;  1RUI 2;  3DXT A;  1RUH 1;  3SEP A;  1ZZC A;  1BXH A;  1NZC A;  3GBG A;  1PO2 1;  4XPV A;  3I54 A;  1V6O A;  1OUX A;  1VBD 1;  2VZ3 A;  2RS1 2;  3FUQ A;  5EYY A;  3THP A;  3EO6 A;  1Z7S 1;  2OUJ A;  2W1W A;  4LO4 B;  3IWZ A;  2WAA A;  2ZGM A;  4CSW A;  2J22 A;  2LS6 A;  2D43 A;  3ZFF C;  4MO3 M;  4CDX A;  3RSJ A;  1OLR A;  3WW2 A;  2ZEW A;  5JOY A;  4MV2 A;  1AXK A;  2GC1 A;  2Z69 A;  4UFL A;  4CU6 A;  5AC9 2;  4LKS A;  1WMF A;  3MPP G;  1W04 A;  4LIV A;  1LGB A;  2IVI B;  3SH3 A;  2HWD 1;  2RHP A;  1H0B A;  3ALQ A;  2CNA A;  1WLW A;  2RR1 1;  3H9A A;  3R4D B;  4M0H A;  1FAY A;  3HR9 A;  3JXS A;  1REF A;  4WM8 C;  5IVE A;  2BFU S;  1DQ5 A;  1E5I A;  1KJR A;  1W8Z A;  5FY8 A;  1S0F A;  4A7Y A;  3DEC A;  4A3Z A;  3O1P A;  3JQX A;  4IV3 C;  2RDS A;  4CXY A;  5T50 A;  2TUN A;  3QOP A;  2VNV A;  4NMI A;  5FY7 A;  3RZJ A;  2QDN A;  4G3Y C;  4XFB A;  4C1X A;  4LBN A;  2BGC A;  4GAL A;  3LQC A;  3KS7 A;  4B1L A;  3N7M A;  4DUX A;  3ST7 A;  2ZHK A;  5L7O C;  4NUB A;  3M1H A;  1ST8 A;  4WVV A;  4XEZ A;  2K46 A;  2RM2 2;  3AKQ A;  4BJ0 A;  5FP3 A;  1W0N A;  4Z8B A;  1QKQ A;  3CBN A;  1K5M A;  4FQZ A;  4YVS A;  4LEJ A;  1YYN A;  2WL1 A;  4GKX A;  4F3J A;  1NOV A;  3LPF A;  3MW3 A;  4IE6 A;  5EZW A;  2DDU A;  1BLZ A;  4NRM A;  1SZB A;  1BK1 A;  3CQO A;  2Z79 A;  4D69 A;  3K2O A;  2W68 A;  4LK7 A;  4FPL A;  2WBK A;  1DG6 A;  3VBR A;  1LHO A;  5EHD A;  2VAU A;  2NP0 A;  2VXJ A;  1GWM A;  5C9A B;  1UZ0 A;  4GA9 A;  3MLJ A;  4R4Z A;  5HCB A;  2ZGU A;  3ZFE C;  2XLF A;  3TAY A;  2WN3 A;  2YG0 A;  1AR7 1;  1BBT 2;  3EJK A;  3M3Q A;  2R04 3;  3E6D A;  1VBC 1;  3P3P A;  4QX0 A;  5CB7 A;  4BQ5 A;  5KC5 A;  4YGD A;  2WN2 A;  4JKL A;  2XJT A;  5CKQ A;  4UF0 A;  5CA6 A;  1WCU A;  1U5X A;  3W58 A;  5ABJ B;  4JGZ A;  5IVV A;  2DVD A;  1OF3 A;  2H0V A;  1ASJ 3;  2A75 A;  3OPW A;  1O3R A;  2G9F A;  2EIC A;  2YB7 A;  1NUK A;  1OUR A;  1O6U A;  5G04 L;  5FBZ A;  2D6N A;  4KGQ A;  2XKP A;  4RQP B;  3GZA A;  2BGO A;  1JW6 A;  4JTN A;  1S0E A;  3RVH A;  4A44 A;  4X6Q B;  3T3Y A;  2R32 A;  4UW4 A;  4EV0 A;  1CON A;  4Q2F A;  1YUD A;  1ENQ A;  1MS9 A;  3RYP A;  3POE A;  2Y34 A;  3EBR A;  2J1U A;  1AXZ A;  1PNF A;  4HLT A;  4QPI B;  2FQP A;  2VUL A;  1ZRF A;  4CUG A;  4EWD A;  5A6Y A;  3OB8 A;  5C3O A;  4AFM A;  4AHX A;  5C8C B;  1QJX 1;  2PHT A;  4WBB A;  2BOI A;  1D7P M;  2BW8 A;  4XMA A;  3E6B A;  1ULD A;  3POW A;  4H55 A;  1BEV 1;  3R0R A;  3JBG 3;  2X5I C;  2EXH A;  3EQE A;  4LIU A;  4PLM A;  2ADD A;  5L9B A;  4AZZ A;  4RGK A;  5LA2 A;  4NII A;  2BNM A;  5FLH A;  1UY3 A;  3V56 A;  4NIA A;  2EXI A;  4DXT A;  3U0Z A;  4P08 A;  2QBX A;  1CQ9 A;  1ZZB A;  5E1R A;  5I0T A;  3WQ7 A;  4LE4 A;  4E2S A;  3RFR A;  2J1T A;  3AP4 A;  2OPW A;  4OZO A;  4MH0 E;  1ZZ6 A;  3GXU A;  4YNI A;  5DDJ 1;  5FZ3 A;  2V72 A;  1FPN 1;  3J26 N;  4AYU A;  4MGT A;  2LM3 A;  2XPJ A;  1PVC 1;  1FV2 A;  4OHZ A;  2W5F A;  3G6J B;  2ZGS A;  3AZY A;  1RUF 3;  1E5S A;  1W6M B;  3N35 A;  4Y5Z 0;  1OC1 A;  2E63 A;  2OUH A;  3PJQ A;  5C4W A;  5FMO L;  2C6S A;  2JX9 A;  5BNP A;  1D4M 1;  4QGM A;  2XR4 A;  2JE8 A;  4Q0U A;  4QQO A;  4BWO A;  2AUY A;  2C24 A;  1Y43 B;  2GP3 A;  2YFU A;  5FCC A;  1LU2 A;  2FDG A;  3T0D A;  2E51 A;  1EAH 2; 
#chains in the Genus database with same CATH homology
 3P1I A;  1J83 A;  1JU3 A;  3T2P A;  1JZ4 A;  1OF4 A;  4CUA A;  4CVU A;  1OD3 A;  4Z2A A;  5LCW L;  3MBW A;  3WF1 A;  3HN3 A;  1K45 A;  1JYN A;  2Y6G A;  1DLC A;  1L7R A;  1CX1 A;  5G05 L;  1GQP A;  2V5D A;  4L0P A;  4BXS V;  1W9S A;  2LW8 A;  2VC9 A;  1JZ7 A;  4P5Y A;  3THC A;  3T09 A;  2JD9 A;  2X10 A;  3LPG A;  3MV1 1;  4QB2 A;  2QQI A;  3LEG A;  1T2X A;  2VJX A;  3CKH A;  3IDA A;  1JYV A;  4DEQ A;  1PX4 A;  3HOB A;  1IQD C;  3F2Z A;  4W8J A;  4E8C A;  4ARY A;  2VZV A;  3CMG A;  3ACG A;  3K4A A;  2EID A;  2VZU A;  2QQJ A;  3A21 A;  1NX9 A;  2YFZ A;  5IYY A;  2W91 A;  4AAX A;  3I2F A;  3I2K A;  3A7Q A;  1W9T A;  3NJX A;  2PQS A;  3J7H A;  3NQH A;  3C7G A;  2ZEX A;  1J84 A;  3GGL A;  2J1S A;  4P02 B;  3I3E A;  4DXR A;  5C7G A;  1JZ5 A;  1TG7 A;  1F4A A;  3WNK A;  4QDQ A;  1UMI A;  1WCQ A;  3OBA A;  4QDR A;  4A6O A;  4RN5 A;  2E33 A;  2V4V A;  2Y6J A;  1H6Y A;  5JXI A;  3GM8 A;  5IJR A;  1NAE A;  1JZ6 A;  1JZ8 A;  4FI9 A;  3EB7 A;  1NKG A;  2ORZ A;  2W87 A;  2VQT A;  3ACI A;  4QX3 A;  3I3B A;  3LE0 A;  3AC0 A;  4GWJ A;  3WNL A;  1P8J A;  3A23 A;  2B4K A;  1O8S A;  4OYU A;  3C8X A;  1F4H A;  2CDO A;  2QQK A;  1W8O A;  2VZO A;  1UWW A;  3U37 A;  4GWI A;  1UX7 A;  5DQ0 A;  1R64 A;  1GOH A;  2VZQ A;  1KEX A;  5DPN A;  1US3 A;  2J1R A;  3ACH A;  4ZXE A;  3I2J A;  1XPW A;  3VDB A;  1W99 A;  3HNY M;  3WF3 A;  2R7E B;  1JHJ A;  4JKK A;  1XNT A;  2QQN A;  3VDC A;  3WF2 A;  2WZE A;  5CZK A;  2VCB A;  5B4N A;  1GNY A;  4OMC A;  2ZEZ A;  3ECQ A;  1BHG A;  1JZ3 A;  1CZT A;  1DYO A;  3C7E A;  4A41 A;  4XUR A;  3UET A;  2VM9 A;  1W9W A;  2EIE A;  1SDD B;  3NNG A;  3T0B A;  1JI6 A;  3FHA A;  2W9X A;  1PMH X;  4KI5 M;  5LA0 A;  3MO4 A;  4XZU G;  4E8D A;  4YPJ A;  2XHN A;  2ORX A;  4ZZ8 A;  1UYX A;  3W5N A;  4KMQ A;  1US2 A;  1XNA A;  4W50 A;  3IAQ A;  5IFP A;  3WNN A;  3ZM8 A;  1DP0 A;  4JX0 A;  2OKX A;  1GU3 A;  2W1U A;  2Y8K A;  1KGY A;  1CZS A;  1SG3 A;  2WYS A;  4KWU A;  3I97 A;  3WNM A;  3SEE A;  1PX3 A;  3EYP A;  5C70 A;  3UES A;  3WNO A;  2VZP A;  2VL4 A;  4DUV A;  5JXG A;  5CYY A;  4LQR A;  2XOM A;  4QX1 A;  2YC2 A;  3HEI A;  2W94 A;  4XUN A;  4A4A A;  2X09 A;  4DUW A;  3WEZ A;  4QAW A;  2VME A;  4QPW A;  3BGA A;  1UY2 A;  4QX2 A;  3THD A;  2W47 A;  1TVG A;  1PMJ X;  5LA1 A;  1LNS A;  4PF1 A;  2VMC A;  5EIY B;  2J1E A;  3VD9 A;  2B9V A;  2VMD A;  3WSO A;  2W1Q A;  5J1X A;  3A22 A;  2HLE A;  2W46 A;  1GMM A;  5IFT A;  4BDV B;  2WO3 A;  1O8P A;  3VD3 A;  1WKY A;  2YC4 A;  5DMY A;  5I0D A;  3GDB A;  3PUI A;  3VDA A;  3C7O A;  3LEI A;  3MV0 1;  4A45 A;  1HN1 A;  3ABZ A;  1XC6 A;  1H6X A;  2VZS A;  2WQ8 A;  4GZ9 A;  3K75 B;  3OEA A;  2E31 A;  3MUZ 1;  1EUT A;  4MGQ A;  5JR2 A;  4QB6 A;  2WO2 A;  2X05 A;  3HPN A;  4M4R A;  2WAB A;  1GOF A;  3ETP A;  5A1A A;  1GUI A;  2XON A;  1L7Q A;  1K12 A;  2WAO A;  3SKJ E;  1MPX A;  1JZ2 A;  2XQX A;  1O59 A;  2RJ2 A;  1OT5 A;  4D8M A;  3OGV A;  4MGS A;  3BN6 A;  1UYZ A;  2E32 A;  3T2O A;  1YQ2 A;  5C71 A;  3FHQ A;  2VZT A;  2VO5 A;  5HPO A;  5JXJ A;  2BZD A;  1UY1 A;  3CDZ B;  1JYX A;  4JHZ A;  4ZZ5 A;  1EUU A;  4CU7 A;  2VOT A;  2W92 A;  1UY0 A;  4IUG A;  2WUH A;  2J1A A;  2J1V A;  3T0A A;  4D0Q A;  2WO1 A;  3DYO A;  2ZXQ A;  3FL7 A;  2QQO A;  3K77 A;  1ULP A;  5EJZ B;  5EJ1 B;  3I2I A;  3NRU A;  3OG2 A;  2HYX A;  4LPL A;  2CDP A;  1CZV A;  4RYD A;  5FUI A;  3P6B A;  4TXW A;  3W5M A;  2VCA A;  2BBA A;  2Z4F A;  4HG6 B;  3CZU A;  3VD7 A;  3IAP A;  5DN2 A;  3SEP A;  4CUC A;  1UXZ A;  3I3D A;  2Y6K A;  4UOJ A;  2VZ3 A;  5JMO A;  3ACF A;  3VD5 A;  2JDA A;  3WQB A;  2W1W A;  2WAA A;  2J22 A;  2LS6 A;  4MO3 M;  4DXS A;  2C4X A;  4M4P A;  2ZEW A;  4JKM A;  4XUT A;  4CU6 A;  5JUV A;  1UYY A;  4LKS A;  4CUB A;  1ULO A;  3C7H A;  3CZJ A;  3HNB M;  5IHR A;  3JXS A;  4XUP A;  2DCJ A;  3DEC A;  4A3Z A;  4PT6 A;  3T0D A;  4XUO A;  2EIB A;  1JU4 A;  5HXM A;  3VD4 A;  3DYM A;  5B4X A;  3OGS A;  4DUX A;  3LQC A;  3DYP A;  4BJ0 A;  1W0N A;  3D3A A;  2QQL A;  2RV9 A;  2W1S A;  3LPF A;  2DDU A;  3CQO A;  2Y6L A;  2W3J A;  3LEK A;  4AG4 A;  1K3I A;  2WBK A;  3HNM A;  3SKV A;  4QB1 A;  2C9K A;  1UZ0 A;  2WN3 A;  2YG0 A;  2WDB A;  4CU9 A;  4QX0 A;  2WN2 A;  4MOA A;  4JKL A;  1UY4 A;  3K46 A;  3OGR A;  3HJR A;  3I2G A;  1K42 A;  2JKX A;  1OF3 A;  3NJV A;  2RVA A;  3FN9 A;  4ET7 A;  2EIC A;  2Y64 A;  2YB7 A;  1NUK A;  5G04 L;  2VR4 A;  3III A;  3K4Z A;  1RYY A;  2BGO A;  4QDS A;  4XUQ A;  4DEV A;  4A44 A;  4BK5 A;  2DCK A;  2J7M A;  4CU8 A;  3CIH A;  2J1U A;  2ZEY A;  2VMF A;  3T2Q A;  1SHW B;  1W8N A;  3I2H A;  3OB8 A;  4BK4 A;  2ID4 A;  2VTF A;  5JXH A;  4W4Z A;  1D7P M;  3WF0 A;  4A42 A;  3OEB A;  5LA2 A;  4TTG A;  4OUE A;  1UY3 A;  1GOG A;  2VCC A;  4UI9 L;  4LHS A;  4DXT A;  4P08 A;  2QBX A;  2KD7 A;  2VQU A;  3K4D A;  4UAP A;  3IB3 A;  1I5P A;  4MAD A;  2J1T A;  4OZO A;  5F7U A;  3GXU A;  2QQM A;  2E26 A;  4P00 B;  2VZR A;  2V72 A;  4XVH A;  3PUH A;  2W5F A;  1JYW A;  3WNP A;  3UNP A;  4ARX A;  1UXX X;  2BER A;  3C7F A;  1OH4 A;  2Y6H A;  3WF4 A;  4ZY9 A;  3E1F 1;  2VZ1 A;  4PQQ A;  3MUY 1;  2JE8 A;  2BGP A;  2L9L A;  2W95 A;  2YFU A;  2WZ8 A;  4OMD A;  3T08 A;  2C26 A;  1CIY A;  1UMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...