4LKXA

Humanized antibody 4b12 fab complexed with a cemx segment
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
214
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGYSITSDYAWNWIRQPPGKGLEWIGSISYSGITGYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCARMGYDGLAYWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two potential therapeutic antibodies bind to a peptide segment of membrane-bound IgE in different conformations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab fragment heavy chain
total genus 45
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lkxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lkxA01
1UM6H 1DEDA 1CXHA 3LV3B 2PYEE 4NC1E 3QHFH 1FNGA 5EU6A 2FIKA 5KVMC 1CL7L 3MOBH 3WNOA 1VACA 2A6DB 1B9ZA 3K4AA 4U1GB 5D2NC 4UTBL 5L2KE 3L9RA 15C8H 2AJYH 5C07B 3ZT7A 2BDNH 3WNMA 4IRJD 3T2PA 4S2SB 2JIXD 3MMEB 3NA9H 2HTLC 3H9SA 5FCSH 3I3DA 5DHVH 1KCVH 1UQSA 1T1YA 4JVWA 4KKNA 5MEPA 5ESAB 2H26A 5KS9B 2CDFA 5ITFA 1YECL 4LLUB 2IPUK 5FCUH 5FYJU 4NZRL 1TTFA 4ONGL 1VFAB 4X7SH 1S3KH 5KSBF 3VXQA 4RWYH 2W60A 1OAXL 1MWAB 2P5WA 2VLJA 1F58H 3BP7B 5CILH 3G5YA 1GHFH 5FHBH 5T3ZL 3VCLB 1BOGB 4GXVH 1KIUA 3MO1A 5SWZB 3ZHLA 2PCPA 2UY7A 4F8TA 2J4WL 4KROB 4XAWH 4GKSA 4O9HH 1KXVC 4XPGH 3VG9C 4U6XA 5KSAA 4YHLH 1EHAA 2R4SH 4LFHG 1A9BA 2ADIB 3ULUF 3LN9A 4ONHB 4NQSB 5GRJH 3SHSA 3GJFH 5D8JH 1OTSC 1IGMH 1U8HA 1VB9A 2OLDA 3ZKXC 1AFVL 5E1HB 1I4FB 3V0VB 4JFED 5BCAA 4MMXC 4HUVB 3AMLA 4HDIA 1A7NL 5GGRB 5AD0A 2YUVA 2KPNA 3ZHDA 1H3PH 2DDQH 2XWBA 3ZDZE 3S3JA 4I2XE 5GGTL 4G9FA 5IV2B 3QDGE 4XI5D 4M8QA 2VLME 4LFHD 1D9KD 3IF1B 4OZHB 1D3CA 1FCCA 3B9KB 4DN3H 3X13A 4PJIE 3IS0X 3G6AB 3HE6C 3NVQA 2VR9A 3WIHH 4XBPA 3QT2A 2XN9A 3SPVB 1K4CB 3RVXD 3MJ9H 4O58H 3G04B 5E0QA 3DRQB 4TNVK 1F90L 1IGJA 2P7TB 3WCYA 4MA7L 3EGSB 4ETQA 5IB3A 2BVOB 3FB6B 5TQ0L 4MJ5A 4PJDF 1E4XI 2FIKB 2VXSL 2F5BH 5DEFB 3VFTA 1L7IH 1RHFA 5KVGL 5C0BB 4F7EA 3QB7C 2VDPH 3T0XA 1W8NA 4FFVD 1KELL 1AGEA 4YDLC 3T2OA 1MEXH 5HBBA 5IESL 5JIPA 3TO2A 4GKZA 3T1FA 3MLYH 4JFFA 4DEPC 2F5BL 4AEHL 4PG2A 5B8CC 5TDOA 1CU4L 4S1RH 2GHWB 5EC2B 4BQ8A 4D9QE 2W65A 3HNSH 1PDKA 1CGUA 1YUHB 5D9SA 4ZXBD 3V6FA 4MA7H 3IU3A 4E0RA 4JANB 5FV2A 4LVOC 4YGVA 4X6EA 2HVKA 4PRHA 1U8NA 5EOCL 5TFSL 1AGCB 4D3CH 2WP3O 3UBXA 2FEDD 2HFEB 3QCTH 1VACB 3HC4L 5BRZD 4M8VA 1UEYA 3CX5K 5MP6L 1S7RA 1T2QL 4BKLA 1QRNE 3O2VL 4JFDB 3U0TA 5I8OL 2QQKH 3TVMB 4MD5A 3C08L 4MDIA 5I16A 4ZS7L 2NW2A 4HKZA 4WENB 7FABH 4ZMAT 3FN0H 2FX7H 4R4ND 2HA1A 4G43A 2HFGH 3HZKB 4OZGE 3ZE0F 3IDXL 1LE5B 5E00B 1C5DB 2A6IB 2PXYC 5FYKD 5BZDB 1TLKA 4KZDH 4TVPD 2WUCL 4YXHL 4G9FB 2OJEA 35C8H 4K55A 2K3TA 5E4EB 4PRIA 4L9DA 1CD1B 4M7ZB 1H0DA 3PHSA 3WLWC 4DQOH 1A7PL 4HQQL 4TNWK 1XGPA 4EVNB 4GUPB 1NAML 5FHBL 5T3ZH 4KTEL 4P3DB 5L9DH 4X98B 4NKDB 4AIOA 2ESVE 5J56B 1MF2L 5BZWB 4LLDB 4PLJC 2D7NA 4HUXB 2NY7H 3RL1A 3SQOH 4HV8A 2D31B 4MCZB 5BO1H 2Y25A 3G04A 3PL6C 4FTVE 5JW4Q 1PEWA 2XRAL 4YEEA 4Y2DB 2WBJA 5D7KD 3IFOB 4GW4A 3ELAT 3CU7A 4WW2B 3LD8B 2MTPA 1RZGA 2IGFH 2AVGA 3C5SB 5CJBA 3F6LA 4KDTC 1CGSL 3BWAA 5C08A 2XYCA 1ZSDB 5I73C 1MLCA 3L3GB 3U7YL 3V5DB 2X4NB 2JELL 2XACC 3ULVH 2YEZB 4WWID 2ARJB 5DMGC 5EOTB 5IB2B 1QRKA 5ISZB 4LVOB 2Y23A 3O6FC 5BO1L 4YDIH 1FFQA 2YRPA 2MHAA 1YNTA 2FEDC 1NJ9B 2F74B 4OGAD 1PZUB 3SO3B 4XBGB 1P7HL 5FEBA 1F45A 3DV4B 3VH8A 2FECL 1XH3B 1UB5B 1AKJB 4RISH 1CFSA 1CDGA 1OGAD 3SKOB 3KJ6L 2EIZA 3QPXH 4KRLB 3TA3D 4ZXBC 4N90D 1BVLB 1VDGA 1QLFB 4F7PB 4Z18A 1KB5L 2VDRL 2NR6D 2YPKB 2FCBA 3D2UD 4JFDA 1MAML 4NGHH 4OCYH 5GGVY 2DTML 2AW2A 4Y88A 2RIKA 4MDIB 1V3LA 5I16B 1NBZB 2HLFC 3P11L 4ELMA 4ZS7H 1IGJB 2P7TA 3BE1L 3GHEL 3C6LA 1ZLUK 3SDAC 2F15A 3U48A 5E6IC 5DUBA 3PUCA 1WK0A 1RUPL 5HYJA 3EZJB 2P8LB 4PJIB 5ESQA 3LEXA 1MIMH 1PYWB 1FL3A 1K6QL 3SDYL 4ZYKA 2YUWA 4KV5F 3KXFB 4HJ0C 4YGVB 2X2YA 2VL5B 1YNKH 4KWUA 1FNLA 1KJ2H 3T77B 1FO0B 4IMKA 3ULVF 1IJ9A 3EJYD 3VXRA 2FWOA 2F53E 4CVWA 5D7SL 4BK5A 4BYHA 1H15A 3K1KC 5F3BA 3FQWB 1S78C 2GW5A 5DHYA 2LV4A 1CZ8L 2QKIA 5DI8B 4QY8B 1JVKA 5EC2A 3DSFL 1QFUL 3BD5A 4I77H 4ODUA 3QWOB 1IFHH 2GTWB 3I50L 4IBLT 1CU4H 1G7HA 3QUZA 1Q0XH 4JHWH 4X6CA 2RGSA 3H3PH 4FQ1L 4R4BA 1LK2A 4WHYG 1JI2A 4NO3B 4ZDHA 4K7PH 5IMOA 3U82B 2P5ED 3HZKA 2XG5A 3DI2B 3I02B 5CJ8A 3FN0L 1ZT7B 3G6JB 3MYJB 4RRPA 1JNNL 1KENL 5D7LA 4P4KA 3CC5A 1XF5A 4ZS6C 3QJFA 2Q20A 3GBMH 4JFZL 4F2MB 1T7YA 4QYOB 3HZVA 2HP4A 3RWDB 2Z8SA 2HJFA 3B83A 1D6EA 3FMGH 4XP5L 3RA7H 1J8HD 1KEMH 2X5PA 3MZGB 4UBDD 5D6DA 3GSRB 5KSAC 1NFIB 2D7PA 1T1WB 2EDDA 5HYSA 2Z9TA 3D25B 3IJYA 1LE9B 3BYYA 5GRVL 2FATH 2XTLA 3QIBA 3GM0A 3F58H 3EO1A 5E8NB 4LNRB 3BSZL 4HSQA 3GSNH 4LCUB 5E24E 3LHPL 3DX7A 3RGVB 1NANH 1F4AA 1I9JH 1YC7A 4FNLL 3LIZL 1OT2A 4PJEF 4M5YH 3BGMB 2ZNXA 2LU4A 3VE0A 1AP2B 4TTGA 4NKDA 1RQ5A 2C3WA 3FN9A 4LRIA 2CUMA 4MQXC 4Z7OE 4UIKH 5AZEH 4KTDH 1A1OA 2ZUVA 4NWTL 3BPNB 2ENYA 5FYJL 1NBZA 1FYTA 2A1WH 3BRDA 2FX9H 2VQUA 3VXTB 1EEZA 3IXAB 2XKUA 3VXNA 2GCYB 1W0WA 4LDEB 4WNQA 5E6ZA 4IS6A 2I60L 1YN6B 1CLZH 4XHJD 3KWWA 5E99H 1ACYL 4OZIE 4JKMA 4NC1C 3ULSB 4K23H 5EDXA 1IAMA 4YBQC 2VH5L 2N7AA 2AI0L 4ZSOE 8FABB 1YDPB 3DRTB 3P77A 5ITFB 2CJUH 5F7DB 3QA3A 4FXGA 1TENA 4ZOBA 4XVSL 1B2WL 1MQKL 3NCJH 3FZUC 1T0MA 2VUOA 4I0PB 4YHZL 1C12A 1HSAA 4M48H 5IHUL 3PV6B 2F5AH 2A73A 2P24B 3JVGC 3BW9A 5I8KL 1VA9A 3MV8B 4X6DB 1T89C 1NFDE 5IVNA 4OFDA 3RNKB 4OF5A 1NCBL 4X7CC 5J12B 1TVDA 3K1DA 1ZT7A 1AO7E 3G6JA 1LEIB 5GSVB 2OP4H 3SDAD 3MJ7A 4XXCA 3S34L 2EDYA 4YX2H 1RZJC 4ZFZA 4X6FB 4JZNA 3MRPB 4RFEB 4WY7H 2OI9B 3IETA 5AZ2L 4DN4L 3IDGB 5TE7L 5C1MB 1UH2A 2BXZA 4JY5H 5HHNB 1KN4L 1TTUA 3TH3T 3IAGC 1T5XA 5HI3D 1WT5C 2GITB 3TVMC 3FAXA 4ZFGL 3WNKA 2NLJB 1HH6B 2VLRA 3TLRA 3WDIA 4HWBH 3SOBL 1UADC 4Y4KA 2NY1C 2V17L 3HE7A 2EC9T 3SPVA 5HI5C 4K3HA 1YY9C 5K9JL 2C3XA 1RAMA 4JM2D 1I1FB 3NFPA 3GSQA 3NZHH 3OX8B 2DOCA 2G2RB 4MLIA 3L7FB 1OY3B 1RJCA 5E5RB 3UZVB 3B5GA 1AXIB 1AQKH 4XNMB 3ROLB 3G5XB 1G0DA 3W9EB 1F4YH 5IR1B 4X6BB 3ULUE 1J11A 4HS8H 4HIJB 4KKBD 3GIZL 5LGHL 1SMOA 2MCG1 1AD9B 4D0DA 3BZ4B 1FAKT 2F9BT 3HNTL 5D7IA 5DR5H 3WFHA 1HCVA 3VMOA 1HHIB 3P30H 3GIZH 3O0RL 1NBQA 3AXLA 5TDOB 3E6HB 4RMTA 5AUMB 1L0QA 4MQ7A 2OK0L 4NRZB 4NKMA 1JZ8A 4O58L 2XY2A 5AWNH 4PLJD 4OD2A 3MRNA 4RNRA 4M1GL 4OLYH 3VWKD 4K8RD 4E0RB 4JE4B 2H32B 3O4OC 3OL2A 4PP2A 1MFBL 3WS3B 3QDHA 2SEBB 2J2ZA 4QHMA 4MNHA 5DJ8B 1UJ3A 4JN2A 4P5MA 2VQ1A 5L7XL 2YD6A 1Q0YH 2B1HH 4H25B 2LTQB 5DUMH 1ZGLM 1K2DA 2Z93B 4J6RL 4HUKB 3ARGA 3AGVA 3PDOB 4FHBD 3U7AA 4GAJH 4YHKL 2QHLA 3UC0L 4HIHA 3U0TB 3MLUH 5GSVA 1CGWA 1RY7B 4G8FA 4ZPTB 5HDOA 1OD9A 2NY2C 4S1SL 5H37H 1MVUB 1QQDB 3UC0H 2HLAB 2CRYA 1IGTA 1SY6A 4KKBC 1OW0C 4PTUA 2Q1EA 3PWNA 3Q3GB 1TXKA 4CMHC 4BFIB 3GMQA 1ZGLB 1CFVH 1IC5H 3JTTB 3EDKA 5I1AA 4C83B 3TBTA 1MHCA 5IB5A 5DUML 4I0PA 3EAKA 3OJ2C 5H8DA 1YY9D 5GRZA 1H3TA 1OD7A 2YMXL 3F5WB 4FQQA 4WGWB 5I1HH 4R4FL 3V6ZA 2FECI 2NLJA 2PN5A 4H8WH 4KK5C 1QBBA 2FLBT 5KVDH 1JE6A 1KGCD 4FFZL 3KLAA 4PPTA 4LSSL 3TA3A 5HGHB 4JO4L 5IEHB 3O8XB 3LEVL 1MWAL 2XFXA 3AB0B 1HIMH 5KVEL 3BKYH 5FGBC 1QSZA 2CPCA 3VRLE 4U6YA 1Z0NA 3JUZA 2D31A 1YYMH 2NY3C 3C5JA 4QRRA 1FPTL 3MNWA 3NIDF 4M4RA 4HS6A 1RUMH 2MFNA 5CCKH 2FBJL 4MNQD 2D0FA 3MRPA 1N8ZA 3EO0A 4UBDC 4YX2L 1SJHB 2IQAA 3BXNB 3BRGC 4F9LA 2CLVB 3WE6B 4HWZA 1V3JA 2D03L 2OMBA 1D6VL 3TF7C 5CZKA 1UA6L 3MQIA 4PJEA 1OARH 1J18A 3OAUH 3AU1B 5D7IB 5D7LE 4YNYA 3VGDA 4PD4K 4M4PA 1MAMH 4OCYL 1R24A 2YPLA 1PZ5B 5HYSG 2X4NA 5SV3A 4KQ4L 4IRJB 4X8JB 3BUTA 2EDTA 1SEQH 4WGVB 1CDUA 5J8OA 1MRDL 1QYGL 5HDBF 5I30H 4ZUTB 2AK1H 4PJAF 5IVXF 1R6VA 1WITA 4RMWA 2GSIB 1E4WH 2QQQA 3RWIA 4JR9L 4Z5RA 3VU2A 3BP4B 4OFKA 3OX8A 1X5HA 4JHAL 2ZZUT 3L3IA 5AAMA 1X6LA 1AKJA 3NIFE 4L8BB 5KSVA 3DROA 3BO8B 3A0OA 1JFQH 2GTZB 1TPXC 4RMVA 5CP7B 1NL0L 4HZLA 4O2FA 4I3SL 1K2DB 4XNZB 1CF8H 3G6JF 5GGUA 3OPZH 4G6FB 4ODXA 5EPMB 3AM8A 1DLHB 4HFUL 1I1AA 1ZWIB 4CW1A 4F9LC 4QHLB 3P73B 1IAIL 7CGTA 2IADB 3I9GH 4QXWA 4XBEH 3OG4B 4G8IA 3PWVB 4PRIE 1UWEL 3DVNB 2ZUTA 3UPCA 3LDBB 2PTTA 3DIFA 3K46A 4WW2F 5HHMD 1PY9A 1FL3B 3LPGA 3B6SA 4KJPC 4KPHL 1H9VA 1N64H 4I0PD 5H35A 3X11A 1MI5E 4RGOL 5F1SA 3GO1H 1RU9H 1FIGL 2W9LA 4IOSD 1BX2B 4KK9C 3U1SH 5FYKL 4JJ5A 1BIIB 1X4XA 2QEJA 1DN2A 1QNZH 4Y16D 1NGQH 4XVTH 3MJ6A 3HG1E 5GSRB 4G7VL 3S37X 4WFED 4J7RA 4XNUL 4JFXA 4K3EL 1QYGH 1BFOB 3FQUA 3KPPB 2CGRL 3TP4A 1DP0A 3CH8A 1G9EA 3QUMA 3NACH 3PE9A 3TNNB 2R0LH 1S7QB 5DURB 3CZFB 4LSDA 4I48A 3TWCL 1OW0A 4PGEA 3CAFA 3ARBC 4LGRB 1QA9A 1VGKA 3ALPA 1J0ZA 1FE8H 3I75B 3MACH 4U7SA 3S6CA 1A21A 4RGMB 4LF3A 3DO7A 3MX0A 2H3NA 2DWEB 4L29A 1U8JA 4ELMB 4KAQL 3VRJA 5HDBE 2O5ZL 3MRHA 3PDOA 4IMLA 1MEXL 2MQCA 1JHLL 3O8XC 3RPIA 2NXZC 2X40A 4MCYA 4PJDB 4Y5XC 2J8OA 4UIMB 1CK0H 1FL6A 3CFCH 4XBEL 1LNUA 4LKXB 5JR1L 4HXBL 4ZPVA 5MERB 2ZG3A 1U42A 4J6RH 4Z8FH 4CMHB 3K4DA 1MHPH 2HH0H 2Q8BH 3O6KH 5ACZA 2OBGA 1ZHNA 1MUJB 3C6LD 1KB5H 3B5HA 4G42B 3D25A 4URTB 1DJSA 2P47B 3KS0J 2EDJA 4KJWD 3H7LA 1B3JA 2L0DA 5DA4A 3OR6B 2CDEA 2E7LC 4WW2C 4L4JA 3BH9B 4U1SB 5FYLD 3HG1B 3MO1B 5SWZA 2WW8A 5D1ZC 4P5KA 4PJHA 3G6AA 4K71C 4Y2DC 3CVIL 4UILH 5KS9E 3SO3C 3X12B 3OKOB 3SBWC 1ORSB 4HQQH 3RL2B 1MI5B 1AD0B 2AJVH 3UEZA 3R8QA 1FRGL 4E5XA 4L4VD 3O4OB 3BEWA 5TE4H 4HS6B 1EVTC 1JK8B 4M7KL 4ZUTA 3MLTB 1ZLUH 4EDXA 3ULVE 4ERSL 1XGQA 1R3HB 1IGML 1XCQA 4ORZC 2VLJD 3V7AG 4NN6C 2IGFL 4P2RA 4GFTB 3WN5A 1ULVA 3ULVC 5IJKC 3G08B 2VB5A 3WO4C 1SBSL 3RIAF 1F6LL 4AIZA 1Q72L 1MRCL 3ZKQD 3P9LA 5J3HC 3A6CH 5GQBA 2OTWA 5F1NB 2X9WA 3BIBX 1CT8A 3UPRA 1QSVA 3UAJD 1MREL 1UC6A 3SGJA 4MD4A 3S5LB 1BFVL 3PP4L 1FNAA 1FZOA 1BBJA 3O2DA 1S5IH 3VE0B 4K94L 4DW2L 4RGNE 1INEH 4PJBE 3ZTNH 2MKWA 4NQDE 1DVFA 3S88L 1EJOL 1A1MB 2W59A 2ADFH 2X4OB 3QO1A 3MBXH 4GG6A 1UACL 3SKMB 3HZMB 3B2UD 1X5FA 5DMKA 2XKNA 4YXLH 5FO9B 2J1KA 1HOCB 4K3DH 3VRJB 1AGDA 5J9PB 4LQFL 3T65B 4KZEH 1O7VA 3ILPA 5D5MF 3WNLA 4HAGA 1Q9KB 5FO7A 4OLUL 3ARBB 4LGSB 4EOWL 4BZYA 1XGPB 3EFDH 4Y8AA 2IAMB 2YSSA 3KPPA 3W82A 3TYGH 3BT2H 4UAOC 4M48L 3K7UA 3VFOA 1ZHNB 4XWOD 5GHWL 4WUUD 3ZKSD 5D1ZD 4K9EH 3RHWF 3N06B 1RJLA 2P8MA 1J0YA 1REIA 5T5NG 1UXSA 2D2OA 2DJSA 4NQEA 5ADOL 5DK3A 2EKSA 4WO4C 4R2GC 4HC1L 1FZMA 5I6XC 1BQHG 2I5YL 3PWLA 4ZUSB 4EIZC 1ACYH 1G6VK 1E0OB 3U9UA 5JHDB 3I6GA 1RVFL 1PFCA 4M5ZL 5GGQH 1AD0A 5C09E 5BRZB 4PJDA 2PXYA 4Z95H 3VXPA 3GJEA 5I1LA 1NSNH 3QUKB 4JDVA 2VLKB 2AJZB 3VXOB 2WBJB 3LQMA 2X4TB 1F4WH 3EOAA 4G3YL 2X42A 3O3AA 1UFUA 2IH1B 4CU7A 1UKTA 1IBGL 2BY3A 1R3HA 1NANI 2BNQA 2P44B 2NY4C 3AXLB 1BJ1J 3SQOL 3FO2A 5DQ9B 5J06A 4M5YL 5T33L 4NYLA 4JKPH 1QBLL 3NAAH 4LAQL 2K7QA 4P5TB 4XHQA 1FAIH 3TGXA 3D3VE 4M62H 1J86A 3NGBC 4PBXA 3UYPA 1KEGH 1RVFH 1KLUB 3KJ4B 1UGNA 1N0XL 4GQ9L 4MZ2A 1TMCB 4XP9L 1LGVA 3NIGE 4UU9B 3AAZA 1U2CA 5LXGL 3OKOA 2IBZY 1F4XL 4OIIL 5EA0H 1RK0B 1MI5A 2QJDA 5IHLB 2QSQA 5CILL 2CSPA 2Y06H 1UENA 3NFPB 1ZOXA 3OKDA 3O3DB 1DQDL 5CUSL 2BNRB 3L9RB 1UB5A 1IZJA 1MJ7H 4ZD3H 3DJ9A 1ZT1B 1J5OH 2MKLC 4F7MA 4UTAH 2A74B 4GSDL 5T1LB 4KRNA 2X89D 5E9DB 4FFVC 3VXUB 1WC7A 3WN5B 1MFCH 3QWRD 4N0FB 3LQZA 1Z2KA 1RZ8A 4PTUB 3CU1A 3QHTC 5DC0A 1MIEH 3MUHL 4JM4L 4D0CA 3VWJA 3OKMB 4U1GC 1QSFA 5C0RL 3PL6B 2R29H 1S8DB 3RWFA 3DSFH 5D1XB 5DLMH 1J12A 5FKPA 1QFUH 3IDIA 4PP1D 4D9RD 4XAWL 3T0BA 4HX1A 3MJ9L 2V2WB 3BVNA 3UCRA 5IG7B 1HEZA 3DYOA 4PJAE 5IVXE 1TJIL 1S5IL 5EUKB 4Z0XA 3WIHL 1IGYB 3IKCA 3PDDA 1WWCA 2AXGA 5DHXB 1N0XH 3TNMA 5D7KE 1KCUL 4DAGL 1QR1A 5BVPL 4WDIB 1HOCA 1KPUB 5EULV 4TUKH 3EHBC 4Y4FB 1UYWH 3I84A 5E6IA 4F2MA 1J1PH 1HI6A 5TDNA 4L4TB 2UYLB 4XP6L 5GRYA 1DFBH 4JDVB 2Y72A 5GS1A 4XMLL 1LO5B 1YQ2A 4M6NL 4LEXH 3WE6A 1G7IA 1XGTB 2E6JA 5IMOB 3ARRA 2B0SL 1NGWA 1GYAA 4FMFA 1OOAA 2VN4A 2GUOA 5D2LB 1T66D 4OI9A 2ZSWB 2WSKA 3U7WH 4KVCL 1N4XL 5T5FL 3MLVH 2CIIA 4MJIA 2G9HA 5CZXD 5IBTH 5T3ZD 1XF1A 2C1OA 1NMBH 5T3XD 2W0KA 4ODTL 5F9JB 5F72S 2Y6SD 2HFFA 3VMPA 4G8GD 3CSGA 4GRLA 1FNEA 1MQKH 1DR9A 4ZAKC 4PJ8B 4XRCB 2Q87A 1HHJA 3PXHA 3RUGA 4BQ6A 4XH2B 2FL5A 5MENB 3TJEH 5I18H 2ZCHL 1TNNA 2WQ8A 1RUQL 1CD9B 1LO4L 4Z0BH 4YHPA 3BT2L 2Y9RT 3KR3H 1QLEH 4GG6F 4Q2ZA 4KUCD 2VDLL 3EO0B 1RD6A 1URLA 4PJ7A 1N4XH 5D7LB 4LCCB 4LVNC 3ARFB 3ULSA 1ND0A 3TESA 4QOKA 1I7RB 2HTKD 4OGYL 3V79C 1VHPA 1CXEA 3AUVA 3WSQL 1ITBB 4L4VB 2ICWA 4QRRD 4WTWA 1U3HA 2WM0A 3IDXH 2W65B 5I1GH 2BJML 2BOBB 3IXTB 1E6JH 3VGAB 3B6SB 1P4BL 1I4FA 4P9ML 4KUZL 4NKOA 4HUWA 1HCFX 3AS0A 1HKFA 5EORL 1XGRA 5J6HA 5L9DL 3QDMD 2NTFA 3LZFL 2NYYD 2O5XL 3JSSA 5IM7B 1EEYA 4R96A 5EUOF 1CDCA 2JIXB 4JFPB 4Y1AA 2G60H 2VISA 1TZGH 4WO4A 3QRGH 2UWEB 3QCVH 5IJVA 1J0JA 1GL4B 4LMQI 1YEEH 3BO8A 3KPRB 2AXGB 1NC4B 3GSWA 1QRNB 2WUBL 3K8MA 3NCMA 4OZGF 3VXSE 5MHSE 1O0VA 3LRSB 1D9KC 5JPNA 4UAOB 2XA3A 2BNRE 5FHAH 3T8XB 5I1IH 2RFXB 4ZFZB 4OI7A 4N1HB 1P5UA 5J6GB 3DVFA 2ICWI 2R2HB 4U2ZA 3DX6A 4LGPB 5ILTL 1KPVB 3RNKA 4ELME 4RDQF 5D70L 3N1PC 1N0LA 5IF0A 1UM4H 4AM0B 2HTKC 2IMMA 3O9WA 3VXUD 2P49B 2DQDH 4LSRH 4BA8A 5DEFA 3VFTB 3ES6B 3DMMB 4J8RA 3STBA 2FB4H 2AJUH 2ZUSA 1FPTH 3VI4F 3VGFA 5HYQB 5E5MB 3UTTD 1IGYA 3IKCB 1I8LC 5IK3A 4QHKJ 5F1KC 5CJQH 4X4ZA 1RUKH 1FFOA 5JXED 4ODTH 3IDGA 4DWHA 2VL4A 1GZPA 2DD8H 4F7CB 3MR9A 5GISL 3IDYC 4FQXB 2ZUQB 4GXVL 5KSBB 1K8DA 1WZ1L 5C0AE 5CJQL 1DVFD 3SY0B 4ODSH 2X6MA 1G7IB 5FGBA 1YJDH 5H2BA 5ITBL 5M7QA 1P5VA 4JZJB 4XPTL 2EICA 3TZVD 3VFPA 4NRXB 3U1SL 5JR1H 1EBAA 4MA3B 5C08E 3QH3B 2HTLD 4NSKB 1MHHA 1KCVL 4XC1H 2CDGA 2C3GA 1CLCA 5EOTA 2ESVB 3JWDH 3DXAE 5L0QB 5C08B 2CK2A 5I66A 3CDCA 3CSBA 3QDJB 1A3LH 1U93A 1A7OH 4PRPD 2ARJA 3GJFB 4HKXA 3VI3F 1NCNA 2MOVA 3BZ4A 5EBLB 4X98A 5GJTH 1A5FH 1Q9WB 4UT7H 1FN4B 4BM7A 4ISVB 4P4RA 3OPZL 1DANU 4QGYA 1F3JB 2CMRH 5DO2D 4OGZA 2EDKA 4HFUH 4QRTB 1EA9C 1UM6L 4NZTL 4APQA 4C54A 4TTDD 2VQ1B 3O6LL 1WIUA 4PLKC 2QR0A 1U8PA 1JPST 4Y2DA 3PJSB 1AHWC 2NNAB 3ARGB 3VWKC 4G6KH 2DQGL 4WW2A 3FONB 3UTQB 4NQDD 1CICA 3BPOC 3C9NB 3S5LA 2OL3L 4P9HH 5B39A 3GSQB 1CYGA 3HMXH 2N1KA 2EDLA 3W9DB 4KVCH 3J7HA 4HKBA 3MOQA 5T5FH 2BVPB 1K6QH 4QXTA 1A7NH 4QHKI 4UQ2B 5CEYA 4P23B 4JQXA 5DZNA 3MBED 2V5RA 4JREB 2Y36H 3R1GH 3TC9A 1ZHKA 4HLZG 1QFWH 3Q3GA 4HMEA 4KZEL 1MELA 4FQHA 5ISZA 1UVQA 1MJUH 1FCGA 2VN7A 1GC1H 4OCRL 4WFFE 4CVXB 1DUYB 2P8LA 4M5ZH 5ESQB 1KYOK 5IKCB 1DBML 2LAGB 4KRPB 1BFTA 3ARBA 1FZKA 4GRMB 2XQYG 3K2UL 3WUZA 4PGCB 1FVCA 2ADGB 3GK8H 4BH8A 2KZ1B 4L4VA 2A83B 4NKIL 1IM3B 4QY8A 3O6FA 4IRSB 5EBMB 3OMZA 1BFVH 3ZKND 2ZUQC 4W4OC 5J13C 4YHKH 5F21B 3LKQB 5I76B 4IRSD 1UZ6E 5D7IE 3IJSA 3VXSD 1U8IB 4QRPA 1RJLB 5EOCH 3OAYH 2W0FB 1V7NL 1YMMD 1HZHL 2QTEA 5C0BE 3NAAL 4RGOH 2W07A 1U8KB 4P2RD 1QFHA 5HI3C 1J10A 4FXKB 3DMMC 1E28B 1GPOL 3S35X 3ZDYF 4X83A 1S9XB 2E6PA 3KYNB 3B9VA 4WVRA 1HK6A 2XA8L 1Z9LA 4G9FE 4JCLA 5BRZA 2GI7A 4NQSA 1VEPA 1FBIL 1U8HB 1FC1A 1F2XK 4KK8D 1NEZB 1IC7L 4LP5A 5DTFB 5KSUA 2DBJA 4NQXA 4LPUA 3I6KB 3U6RA 3TBVB 2YPKA 3ZE2F 1GRWA 2F58H 4WWKD 5IMKA 1QKZL 4X5WB 4X9FA 4X80L 4E42A 4HS3B 5BVJA 5FECB 4YR6B 4IDJH 5DHYB 1PX4A 3NGBB 1VKXB 3CVIH 3MR9B 4MX7B 3GNML 1IVLA 1FYHB 3C6SA 1KB9K 4JM2F 3ARDA 4KRMB 3N50A 1MCNA 5DT1H 2WINA 4OZHA 12E8L 4R0LB 2GY7B 4TSAL 4YDJB 1AP2A 5HHVH 1NCCL 2BHZA 2X1WL 1I1RA 4CW1B 4P2OA 4D8PA 4OZ4A 4PJ8D 1QBML 3C8HA 1T0PB 2XZQL 5DVOA 1KACB 1MCPL 4OLZL 3DRQA 4MNQB 3MBEA 3FT4B 2F19L 1BGXL 3QNYB 1W2KT 4W70A 1D5MA 2VR5A 3GSUB 4MD0B 2DIBA 4OUUB 4KQ4H 4MA1B 3FO1B 3IDNB 3VRIB 1WZKA 5ISZD 4JREC 5DA0B 4PJ9D 1C7SA 2IQAB 3BXNA 2A77L 4PGBA 4U6HA 3MV7E 5H35B 3R0NA 2XOTA 4Y16B 2Z92B 3OKKB 1NFIA 8FABA 3HR5B 4N0FA 3BPOB 5F6HJ 2X1XR 4GKZB 3G9VA 3V5HA 4OTXL 1NMAL 1YN6A 4U3HA 3TYFA 3RX7A 4L4TD 4E41B 3RKDC 4M6OL 3PJSA 2BK8A 3HLAA 4CGTA 1NC4D 4KJYB 4XPTH 2VLLA 4P3CH 3D5OF 1BQLL 2DLFH 3L6FB 3NACL 4DGVH 4XZUA 4PG2C 4ZFOA 5B8CA 2DJ4A 1UWXK 4KH2A 1IAIM 3QPQC 4O02H 5I19L 3U4EB 1AXTH 3C60C 4UDTB 5D2NE 4QXTB 5CEYB 1BF8A 3J8F7 4LF3B 3BEVA 1NBYB 5FYJD 1OAUL 1NGYA 4WI3A 5KSVB 5ICXA 1MCWM 2PYEB 3EO1B 3QDGD 4U7KA 5KVFH 4TSAH 5J3HD 1YZZA 1A6UL 1ZA6A 4HW6A 1NMAH 4K7PX 5H37G 5IOPB 3RGVA 2V7HB 2NY4D 1PG7X 3FO0L 3QUMB 4H88H 4LHUG 4I0PC 4OCXL 5SX4H 3OQ3B 4P23C 1RU9L 4BQBA 3RWJA 5IMMB 3QUYA 5KVGH 3OXRA 2JCCB 3TN0D 3KHQA 4UQ3B 5HHMB 1EGJL 3FFCB 2LABA 2GK0B 3EYOA 1RZ8B 4GKNA 4LHQB 5EZLB 1CD8A 1T0NB 4OF0A 3MACL 1MVFA 1LO3H 1NAKL 2EIBA 2EZ0C 1EHNA 2I07A 3ARDD 1CLOL 3L5HA 4XPBH 4XWGL 3MRKA 2VLRB 4N0CC 5JIKA 3BKCH 2PO6D 5JDSB 4LAJH 4XMKH 1DUYA 5IKCA 4HIXH 3RU8H 4PJ8C 4N1CA 4KVNL 4NQUA 1H0DB 2H1PL 4UT6L 4NQCE 4WO4D 2AAVA 5F93C 3C5ZA 4EVNA 2Q8AL 1B4RA 3OXSA 4GBXA 4Y5XB 4EI5C 2B20A 4PJ7E 4LPYA 1IC1A 2VXUH 2XN9D 3I6LD 4X6FA 2B2XL 5C0CA 1CLOH 3L3KA 2H32H 4MZ3A 1B0WA 2AABL 1Y6NR 2C4FT 3N85H 4X6BA 3KYAA 5I74B 3BX7C 2I9TA 2IBBA 2HWZL 4HGMA 4R4NC 2FJFA 3JTSB 1ZSDA 2E27L 1RK1A 3ECBA 3KLDA 3QEQA 1I9RL 3CIQA 2P5WE 5JPMB 4PG9A 2Z4QA 3RDTA 1YYLH 3LVEA 2DLEA 3HR6A 4JPIB 4LARL 5DGRA 2IMNA 4FFYL 1BAFL 1ZVSB 4WU7A 2HKFH 2XZAL 2FHCA 5GRWA 1KCSL 4YHZH 3MRJB 1R5VB 2JJTC 4FQCL 1Q94A 1ZTXH 4XPFL 3WXWL 4GT7A 1DZBA 5C0DA 5DSCA 4J23A 3LHPH 2EIZB 5MEOA 3BP6A 2BHUA 4X99B 4C59B 1UB6A 2E27H 1QSEA 4K3JH 1SJEA 4Z7WB 3KLHC 2IANA 4PJ7B 3S34H 2IAMD 1NDMA 4XP5H 4JRYA 3WL9B 4X7TA 3STLB 2ZPKL 1UCTA 3BISA 1JCKA 3D39E 4OJFH 5I1AB 1YEHL 3L1OH 3BH8B 2DQDL 4LSRL 4Y4FC 5EU7E 5E9DE 4PJIA 5IFAH 2P46B 4K8RL 2R9HD 3PXJA 3UO1H 2QQLL 1A6WL 3RVWD 2BOBA 3IXTA 5I1EH 25C8L 1ZLVH 2XKNB 1N6QH 4J8RB 4APQD 2DI7A 1NGXA 4NRYB 1ADQA 3CDGB 4H20L 3BP7A 1BZ9A 4JRWA 3H9ZA 3CUPA 1LO0L 4NQDA 2OTUB 1ZA6B 2UVEA 4W4NA 2NYYC 5CGYC 4LL9A 5MEPB 2IH3A 4TUOB 4U1HB 4HIHB 1KV3A 4LSVH 5KSBA 4IJ3B 4GLRH 4OCWH 5HJ3A 2WLZA 1IKNA 2EH8L 2D4DA 1RHHA 6FABL 2BRRH 4GRWB 1DQJB 1PVHA 4AEIL 3V0VA 1LD9A 4GMSL 1MAKA 3CXHJ 4YHYC 5JDJA 4PTTB 4OQTL 5DEZA 3DNKA 1TPXB 1IQDB 3VFNA 1CR9H 3GI8L 1BM3L 5C07D 2YD2A 1VESA 5EC1B 2V7NB 4PRPE 4LCWA 3U9UB 3KNBA 5JHDA 3H9SD 5C3TA 1MJJB 2NZIA 3MRGA 1WLHA 2VABB 4WEBH 1V05A 1NKOA 2Z35B 4KK8C 1EAPA 1UJTA 3LKPA 3H3BC 2NX5D 5JXAL 2R2BA 5HPMB 4Q9CA 4E41E 3KYMA 2R1XA 3HZYB 1T1WA 5HYSB 5J11C 3KXFE 2Q8AH 4QO1A 4ODSL 3VA2C 2UZIH 5DGQA 3BDYL 4OB5H 4J3TA 1YEDA 3BOVA 5C0FA 4JB9L 4L3ED 2APFA 2V9RA 3FO2B 5DQ9A 4NM4H 1TJIH 3S96A 3DLQR 3S35H 1DN0B 3VXUE 2FHFA 1E27B 5I71C 4OZHE 3LSOA 3MNVA 4B0MM 1U58A 4ETYA 1HHGB 2OZ4H 4RGND 5TF1H 3N1QC 4S1DC 1O5DT 3BGMA 4WRLA 2D7TL 3PG2A 3SKUD 2VTFA 4MNQE 1N5AB 4JRYD 4AG4L 1EFXB 4GRLC 5DMGD 4DTGH 5JOPD 4HMCA 1JHKL 1CGTA 3TO4D 2D0GA 3VXOA 3V0WL 2IANE 4KKAD 3S4SA 4KGLA 3FT3A 4YJZL 3ZE1F 5FKAB 1WISA 3VXNB 2XWTB 4EI5A 1PSKL 1ERNA 3NPZB 2XWBB 4Q0XH 1YMMB 3MJ8A 4IS6B 4CAGA 4TOYL 2WQRA 2FX9L 4I8DA 4R2GB 3GB7A 3V8CA 3C5ZC 1I8KA 5ADPL 2ITDB 2X89A 3IGAA 4PJEB 4LIQH 3MPCA 5HY9A 1DUZB 3JWNC 5CLTA 4WV1C 1AGBB 5C0GA 3RHWK 4QRSA 5INCB 1N59B 5I15H 1C8PA 3TPUB 5AWNL 4ZTOH 1ZV5A 5DJXB 4WI9A 1K4CA 1TZIB 3H7BB 3MZTA 4RWYL 1S7WB 2XZCH 1KTRL 1IGFH 2J8UE 3ZKMD 1S7QA 5CKGA 2X4QB 1B2WH 1M7IA 4MVBC 1KBGL 1F42A 4CVZA 1S7VA 5CSZA 2XICA 5E8DH 1FP5A 5TDPA 3NFNA 2BSED 4UV7L 1IC7H 1JN6A 4U1NA 5ANMB 5K9OA 3MJ7B 4QRUB 3KYKL 5C3LD 5D2LA 4JHZA 3C8KA 4JFOB 5J57B 5LG1A 3P9WB 3ISWA 1N5YL 1J1OH 1S7RB 4PY7A 3DUUB 4PV8A 2NX5A 2NY1B 1NCWH 2H45A 4X4XB 4UT9H 5BVJB 4GMTH 3T09A 2FH6A 1ZLSL 4D0CB 1NLDL 3KJ6H 3VG0L 5DMYA 5E8EB 4ZXBA 1TVHA 4MXVE 2PTTB 4OT1L 3WEXB 3HMXL 1X7QB 1YJDL 3OR6A 1T5XB 4YC2B 3SE8H 1JIBA 4JPVL 3V6FB 2CDEB 2EDQA 2VDML 2R15A 1CE1H 1MFNA 2O5XH 2MQ0A 5LVEA 1F58L 4XVSH 2BY2A 3BRFA 4R4FH 1A6TB 3CSYA 4JY5L 3MNZA 4M7LT 1U8KA 5I30L 3PGFL 5EZIL 5HVWA 4KI5C 3IYLW 5HXMA 5I1DB 2V7NA 4X6CF 5TJWK 3BEWB 1I7RA 3VGEA 1RFDH 5J12C 1I85C 4PJBB 1KLGB 1P69B 2B5IB 2XXMB 1ZLSH 3OG6B 4EEEA 3IDNA 4MD5B 2BNUA 3QNZA 4YUEH 1KSRA 4FQIL 5ALCH 1T22B 4MWFB 4ZG1A 1U91B 4U6HB 3ABZA 5D93C 3FAWA 3D85A 3U46A 3DO7B 1TVBA 2VDPL 4LDLB 4HS8L 3CMOH 1L9NA 5IESH 4A6YA 5BQ7A 2X70A 2EEBA 1BVKB 1EUUA 1IAKA 3GMMA 5JQ6H 3ZE2E 1HHIA 1CD0A 2ZCHH 4WEUD 2EDOA 1KNOB 3WJJA 1KJVB 4Y8DC 1CD1A 1HIML 1OPGH 3ZKMC 5C2BL 2AK4B 1BLNA 1GGYA 2FO4A 4QOKD 1RZIA 5F9JA 5GGVH 1QACA 2PNDA 5B3JE 4JO2H 3O41B 1ITCA 4ELMF 4TULL 6CGTA 2ZSVB 3P4OA 2Z8WC 3EJZC 4CJ1A 1T4KA 1MUJA 2APBA 4LSUH 2SEBA 3RWGA 4N8VA 4RA0C 4GKOA 5GJTL 2JLLA 4S0TD 3PWJA 5C0CD 1S5HA 3WDJA 4U6VH 4X7SL 4J1UA 1C16B 4Q2ZB 4QRQA 4WO4B 5IJVB 2WUCH 3FRPG 4XVJL 1FG2A 3H2WA 4M9OA 4R8WL 4CNIB 1OAZL 3EYVA 3HE6B 4U0RB 4UOW1 2R4RL 2EYTA 2DWDA 2Y7QA 5FDYA 5C0AB 3P0GB 3DMMA 2ITDA 5ESVB 3E1F1 1KG0A 3UJJL 2LU7A 1WZLA 5FF6B 3ILQD 4MQXD 5DD3H 1AQKL 1T0NA 1F90H 3SGDI 1KIRA 4XCNB 3SCMD 3VFRB 4NWUH 1GZQA 1VFAA 1MCOH 3R06A 4JO1H 4PJ9A 3QDMB 4UOJA 2F8OA 3UTSE 1S9YA 1Z6JT 1JI1A 3H6JA 4WFGE 2W1NA 5I17A 1YMME 1INDH 5EU4B 2R39A 1KIPA 1A7RH 4ZQKA 3BMWA 4LSPL 2EIEA 1YQVL 1BQHA 3LEYH 4JZJA 12E8H 2FWOB 2C3VA 4C57C 3DOSA 5I73B 5HD8C 4M9PA 3RA7L 4C4KT 3TCLA 5KSAD 5ETUA 3V5KA 1WEJL 1M6OB 1PW3A 2E6QA 1XF5B 1JGEB 4ACPA 4WCYL 2P45B 4MD4B 4LCYB 4AL8H 1N64L 4I18A 1FSKB 2VRAA 1G7HB 1X6NA 3QUZB 5GS1C 4Y89A 4FQIH 1OCWL 4WUUA 1EO8L 1V7MH 2NY2D 3IVKA 1J87A 2M2DA 3WN5C 1P9MA 4KAQH 1E4KC 3UTZA 2Y4SA 4NO2B 1CGSH 2AJYL 4AEFA 2YZ1A 3MGTA 3MRBB 5TQ0H 3JV0A 1FORL 3D3VB 3H42H 5SX5H 3AAZB 2V5YA 4XBPB 4D94A 2HRLA 4TSCH 3TN0A 1FDLH 2EH7H 5E2WH 3JWDC 1FFOB 3AREC 4WU7B 3CX5J 5GGVL 2CKBA 4WFHD 4KJQD 5FK9A 5CZVL 4RMRA 2J6EA 5C07E 4P2CG 4PGJA 4XP4H 2WBKA 2K9UA 4O2EB 4GRWF 4HJJL 5IB3B 1KC5L 1F6AB 1A6ZA 2VZ1A 4LU5H 5SX5K 2DRUA 2AI0H 4XP1L 3R8BB 4GS7C 1IAII 1U91A 3A6CL 3NCBB 4HH8A 4WU5A 3AS3A 2X4TA 4RWHA 3H42L 4YHNA 3C5ZD 3O3AB 3BKCL 1VGEL 3MYJA 4Z7WA 3P73A 4U7MA 3G6DL 4MA3A 2PUQT 2C1PA 2KQNA 4Y4FD 2FJGB 4GAGL 2J8UB 1FGNH 2DTMH 4WV1A 5C0AA 1S7TA 43C9A 5C0RH 3CCHA 3S3PA 3NABL 4LPWA 4M6NH 2VOTA 3BN9D 3MLYL 1G7LA 1TZHB 1IM3A 1MCWW 3UDWC 1QPXA 3QIWC 4NQTA 4PRNA 5JW4R 1WGOA 1NFDB 3LRHA 3MRFA 3U9PH 2GIYA 1HH9B 2JJUA 5E5UB 3T0ED 2GSGB 1EEZB 5D2LE 3Q0HA 4DAGH 3ZYOA 2NY3D 3MXWL 1Q0XL 2OJZL 1YY8B 4TUKL 1SM3L 4J3WA 4OD3H 5JOPE 1MREH 1DQQB 2YUXA 1HE7A 5HI5D 4WDIA 3I2CL 4HT1H 1CZ8H 2EO1A 4Z78B 2BVQA 3T3ME 1FDLL 4WHYH 2ZOKB 4BFGA 4PFEA 1JRHL 4MS8C 4FQ2H 4Z6AT 2B1AL 3O6FD 4HPOL 4FXGB 4OB5L 1AXSA 3LRGA 4PGEB 5LWYL 1T66C 3ALXA 4G7VH 3RI5K 2ZUUA 5DVMA 1JPSH 3O6KL 3H9SE 5FYKU 1B6UA 5F88B 3UJJH 1II4E 3SJVA 3CFDA 5C0IB 1G6RL 3FFCE 3C08H 3IDUA 2WAHA 3PL6A 4WHTA 3C87A 3QFJB 3K4ZA 1ORQA 1HWGB 3RPIB 3KPNB 5EU6E 3VFMB 1EAPB 2XQBH 2BFVH 2NY5L 1PKOA 2JJWA 4U1KA 3SDXE 1JF6A 2ED7A 3TIDB 4XVJH 5L6YL 2DI9A 3M8OH 3PQYA 2LAAA 5IGXL 1YNLH 4Y4HD 1BFSA 4PYGA 1UM5L 3AREB 3QCVL 2BRRL 4LPVA 5C0FB 1Q9LA 1YEDB 4WI7A 1JNLH 1RIUL 3ARSA 4DEPB 1BD2B 4ODWA 3RVTD 3RWHB 1WFNA 3WLWD 4LRNL 2LE9A 1E6OL 3NBNA 1B0RB 3IRPX 3EBAA 3EJYC 2ORBH 1BQHB 1UWGL 5EOCJ 5F3HA 1ND0B 2J8UF 4X9GA 1CFVL 1AJ7L 4S1QH 3HKFA 4E5XB 4MAYC 5GJSL 2HFEA 3P0VL 1CXFA 4KV5E 4OTXH 5TH2A 5EZOL 5DQJA 1S7TB 3S97C 43C9B 2G2RA 2VZUA 1IL1A 3QZWA 4YHMH 1JHLH 1U36A 1HI6B 1IBGH 5TDNB 4OUUA 1I7TB 4FOMA 1MJ7L 5E7BA 4P57A 5CEXB 1RUAL 1CI5A 3CMGA 4L1DA 4OZFA 4ESKA 3B2UC 1CTOA 1J05B 4GRLB 1KJ2A 2EH8H 3T3MF 3TH2T 1A02N 3VFSB 1OSPH 2WUBH 5CS7A 2EYRA 4K3JL 3W0WD 1BGXH 1ZA3B 1N6VA 4G9DA 4MS8D 1IT9H 4AIZB 1OAUH 1LEKA 2FBJH 4FP8L 2VSCA 3TT3L 4NO0D 3T3PE 3LMJL 4MHHG 4OD3L 4PR5B 3FN3A 2RCSL 4PREB 1QLFA 3BJ91 1ZHBA 3RBGA 3TBWA 1X5LA 1EBPA 4WUKH 4AT6A 2VDMH 5ENWB 4RBPK 2X4SB 3F7VA 2BY1A 3ZDXE 5I1EL 3CCHB 4EI6B 2OL3A 4PJFB 3U4EA 4ZFFB 8CGTA 1GGUA 5IJKA 4UOW0 4R7NB 3ARPA 3U7YH 3BEVB 5TE7H 4OCNC 4DGYL 3QAZC 1QEWB 1KFAH 2W0PA 1TQBC 2VL5A 5DD0L 1GOHA 4MAYD 2PW1B 4AQOA 1PBYA 2W9EL 4GAYA 4ERSH 5HYQA 3DX8A 4DFHA 1PYWA 3TT1H 5DC9B 4OCWL 1G7PB 3OXRB 2ZCKL 5I6XB 4HWNA 5K9KA 1I8IA 2WP3T 1OP5K 1VPOL 1M7DB 3F62A 3KDMB 2Y07L 3BZFB 3EDDA 1GGIH 3KYOA 3W39B 5I8KH 4O51A 3X3GH 1QHOA 4DN3L 1OP3H 32C2B 3FZUD 2YUZA 1BEYL 3T8XA 4U3XA 1I75A 4I4WA 4LPXA 1XF3A 3ARGC 2DQGH 2YRZA 3L3KB 4R97C 1YEJH 5ICXB 4JFDE 3OJMB 3BFOA 3DHMA 3TT3H 5IM7A 3W0WB 5BXFB 3JWOL 2M26A 2Z93A 3QEHA 4Y4HC 5I19H 3JV4B 4Y5XA 5ISZE 3LB6D 1D5ZB 4Z78A 3L3DB 2UWEA 4U6XB 1HXYA 4QHUA 2FJFB 1A4KB 2AXJA 3GGWA 5ELIA 4FS0A 4KROC 2BNUB 3QNZB 2IG2L 4YXLL 3E6FA 4YLQT 4A6YH 4F58L 5J4MA 4UINL 3SGDH 2P42B 5CJXA 4JZJC 2BSSB 3UO1L 1INEL 4JFZH 3ZTNL 4X4XA 1T2QH 4P23D 5JHLH 3G6JE 4ZUWB 1GZPB 2XWJB 3MRDA 4OZGA 5DUBB 4FQXA 1U0QA 2DBLH 2OXGA 3EDJA 2HRPL 4PJAA 5IVXA 3KLHD 2H9GB 5M95B 1E4XH 2EYRB 3O6ML 3VFMA 4AG4H 1RIVL 4QRTA 3NIGF 1NCTA 3OB8A 3B9KA 4XX1E 5ACLA 3O4LD 3NTCL 5F7KC 3UXFA 4AMKH 3W5MA 4PG9B 1AR1C 1DBAH 3FB7A 4JKWA 1U92A 1TETL 4GQ9H 3EFDL 4DK6A 2ZUWA 4GQPH 4NJAH 2AGJH 4DZBB 4NZUH 5DQJB 4TOYH 3VXMA 1U6AL 3NFSL 3GM8A 5KZCB 1FYTB 3D6GA 4HXBH 4XVTL 1CLYL 1DBMH 2R8SL 1SJHA 2V9QA 2Q8BL 3BI9X 5IFAL 4JGMA 2YS4A 4U2YA 4NO3A 2EYTB 2Y7QB 5H2BB 3X11B 2CXGA 1N6QL 3IAQA 3QIWB 3JWOC 2VAAB 3QUXD 3TO2B 2DICA 2D7TH 1KF9B 1OAKL 4NNXB 4R6UA 3NPSC 3INUL 4V1DB 4ZUUB 4KUCF 5GGQL 2CRMA 1U8PB 4UINH 4GRMA 4QHNA 1TTGA 4P9HC 5IIEB 1ZHBB 1NBVL 4YO0B 2BOCB 1XIWB 2QBWA 5DD5L 1MFBH 4FNLH 1WWAX 1UKSA 4Z7QF 2DQJL 3V7AE 4LSTH 3NCYP 4NM4L 4F9PC 5LXGH 4GRWH 5DMJB 4YE4H 2XZQH 1IEBB 3P40A 4HCRL 5DWUH 5EUKA 4Z0XB 5CGYD 2ITCB 4JQVA 3CFKA 1P4IH 1A4JB 5CWSB 2XY1A 5E2TH 3WLBA 4KI5F 4OSUL 3RQ3A 4YQXH 5F7EL 3VXRD 1I1AD 4JFXB 1OAKH 2NNAA 5GS2D 5JW4M 5EBWB 3BKMH 2IALA 1I85A 1CICB 4K07A 3GEWB 4HGWA 2IEPA 5DFWH 1G6RB 2A77H 4PJDE 2VH5H 1SYVA 1XIWC 3DTXA 2PXYD 5BW7C 3CPLA 1FVCB 4QGTA 2RAMA 1NGWB 4I3RH 4DOHB 4FQXD 1MJ8H 3MGTB 1DBJH 3IU4L 3FKUS 1P4IL 4YR6A 5BRZE 1QEWA 4OIBA 4DKDC 3KNBB 3S96B 5D7LD 1I1YB 4AH2A 4GAYB 2EKJA 1QLEL 3TA3C 3PDGA 2DYPD 2Y5TB 2DM4A 2VXVL 2C1OB 4JQIH 4IDLA 1MPAH 5D7JD 4DGVL 1MWAH 3BUYB 4HLJA 3MA7A 3JV4A 3QFJE 5CAYB 5SV4A 5ACZB 3L3DA 3C60B 2FGWL 3UPAA 4P9HL 1NKRA 3GSNB 5HJ3B 4RX4A 2AXFB 5GGSY 4HCRH 5DWUL 2F8XC 3EZ8A 5FGRA 4PLNC 4WY7L 2YD3A 2HJKB 5EG6C 4XPAL 4G9FD 2DQHH 4DKAA 3W9EA 2C1PB 4JFHD 1BJ1H 1PSKH 4KMLB 2IPUG 3UYRH 3BW9B 4LCCA 4P3CL 1CFQA 3C5SA 2VDNH 3CXDH 1RJYA 1LO3L 1NAKH 2UUDK 1XEDA 3CX2A 3PWUA 1OGTB 5ID1B 2V5MA 2CK0L 3E0GA 1Q9OA 5CJXC 4OKVB 3MLUL 2BZDA 3O4LE 1DE4A 1FFPA 3EFFB 1DFBL 4Y4HA 1U92B 1ONQB 5FB8B 1QO3B 3TN0B 1NGPH 2MHAB 4LU5L 3MRNB 1YY8A 2ZJSL 5DUPL 1S9VA 1HINL 3BIKB 3MCLL 5D1XD 4WI4A 2AQ2A 3UTPD 5T1KD 1T2XA 1EEQA 2NXYB 5D1XC 1P2CB 3T2NH 3T0VA 4OFYA 2UZIL 3KPRA 5CD5C 3KPQB 4LCWD 4ELKB 1CICC 5CKAA 2PYEA 4LIQL 1JNHA 4OM0L 1ZEAH 1JGUL 3NA9L 1T1XA 3L5IA 4YDKH 3UBXG 3H0TA 5LKNA 3LS5L 2HWZH 5E6ID 5EU7C 4MA8L 3ZL4H 1Q9KA 3VXMB 4J3OC 5HVGB 3GSXB 3WSQH 4WFGD 1XZ0B 4NZDA 1YEFH 4IMKC 2VLKD 3WFEL 3DARA 5E56A 3L3JA 5LGHH 1RUML 4GKNB 2WBJD 4HAFA 3IDYB 4LCIH 3KPNA 3FCTA 2R0WH 1HWHB 5D96B 4AM0A 3PWNB 1U8LB 4L4TE 2NY3B 4FZ8H 2DYPA 1P6AB 4XC3H 4RAUB 4PBWD 3SDAA 3U2SA 1JWMA 3SGEI 1P9MC 3UJTL 3RKPA 1P84J 1WFOA 3BSZH 2OS7A 3DPBA 1NCCH 1X5AA 2AEQH 3RRQA 4QXUL 5HYFA 1JGDB 1T1YB 5IB4B 5I1HL 1OLLA 4M1GH 3DO3A 3C60A 1DANT 2E7BA 1WVZA 2DQTL 5J1AB 1IT9L 4ZO8A 1AXSB 4NOFA 3QI9D 1S9KC 5EO1B 1D5BA 4CJ0A 3TBSA 3LZFH 3WNPA 1U3YA 2KDGA 5H94B 3I02A 4JLRB 5DJ6A 3P4NB 4JM4H 3RGHA 3F12B 2EE6A 3AM8C 1FGVH 5DRWB 3ZTJG 2H6PB 3RNQB 4HEME 4HWZB 2ERJC 2IFFH 3OGCA 2MMXA 4BH7A 4TNVF 3MV01 4DZ8A 3WHXB 4M93C 5EWIH 5JNYA 5ID1A 1MCBA 4HF5H 4OZIF 3SE9H 3TCXA 1PGRB 3S5LG 3LN5B 5B22A 3UTSB 1A7QH 2FJHA 5A2FA 3K0WA 1XF2A 1IGTB 1RK0A 2LVCA 3MLWL 3KAAA 5A2LH 3QO0B 3EOBA 1KPRA 3O3BB 1VGEH 1H3XA 1E6OH 2DIAA 3QIBB 1ZVSA 2P8MB 3PL6D 1AXTL 5I8CB 2AS5M 5HHVL 3EYUL 4LNRA 5HYJD 4P2OC 2Y1VA 5C9KA 5FUOL 2R1WB 3KPLB 2QQNH 2DLHA 1UZ6F 2DLFL 2ATKB 3RY5A 3VDCA 3RWEB 2AXHA 4Q6IB 1LDSA 3NCJL 4G6JL 4LHUB 5C2BH 4X7TB 1A6WH 3DYMA 4HFWA 3VXSB 4AEHH 4X80H 3GJEB 3Q5OA 2VLKA 3MLVL 1KGCE 1MIML 3M07A 2CUIA 3OKDB 5FYLE 1C16A 5F7WC 3OWEA 5D4QA 3B9AA 4RMUA 1R5IB 2NY5C 3JXAA 1JPTL 4LRNH 1PQZB 3G6DH 5C0BA 4F7EB 2AV7A 3QEUB 5LWYH 4W81A 4JM2C 4A2LA 4DVBB 4K94H 4DW2H 4S1QL 3T2NL 4W4OA 5MP6H 4X8JA 4I48B 3BWUC 1AHWB 1H3UA 1EMTL 2Z4QB 2A6KA 4D0BB 1G9MH 4L4VE 4WWKB 5GRUH 4WW1A 3I3BA 4XGZA 4XP4L 1ONQA 5FB8A 1KXTB 2JJSA 3B9EA 5SWSA 3QQ4A 5EN2B 1JPFB 4J3VA 5EBGA 2XKSA 3SE3C 3IB4A 4BSWA 4HIXL 3RU8L 2BRQA 1QFOA 3RTQD 4M43L 2EYSA 2CMRL 3W0WA 2MQ3A 5BXFA 3RJQB 1HEZB 2W91A 2GJ6A 4ZAKA 2VDKH 4OV5B 5DJ2B 5CINH 4BK4A 4RSVA 4H5SB 2CR6A 1ZE3C 3BN9C 1MJUL 4Q0XL 3IS1X 4N0UB 4OD1L 5KW9L 1R3LB 1FG9C 5DVLA 2G9HB 3I6KA 1LDPL 3DSNA 4Z0BL 1N26A 4G8IB 5GRJL 3LH2L 4Q9QL 1G7PA 4ZUWA 4C58B 3IVKB 2QSTA 2ZCLH 3LKNB 4P3DA 3BH8A 4AL8L 3PGCA 3O2VH 5I8OH 4NFDA 1AJ7H 2WINB 5DRXB 1CDHA 4HIEB 3EO9H 1IGFL 2BCKB 5DZLA 1B0GB 3HPLB 1OP3K 4WU5B 1D5BB 3U36A 3F7PC 1U8QA 4O5LH 5LJYH 1UH3A 4X0KA 1P4BH 4P9MH 5DD5H 1OP5H 5ETUB 4OZ4B 4HEPG 4U3CA 4JO3H 1JYNA 3V9FA 2NY6D 5J89A 3T08A 4M6OH 4TUOA 1INQB 3X14B 3BWAB 1RV6X 1EFXA 4XNMA 3ROLA 1SQ2N 1OSPL 5LGJA 1JGLH 3U79A 4FQJL 3VG9B 1WWBX 5F9OL 3V7MA 3G9AB 1A6VL 1F3DH 3I75A 4F8QA 1SYSA 4GW5B 5TE6H 1WSST 4YHNB 1F3RB 1QSFE 3TBYA 4Y19E 4I18C 1F97A 1MFCL 2YBRB 4Z76B 2HFTA 3OKYA 5C09A 4EDWL 4MSWA 2VXQL 3GKZA 5KW9H 3FO9A 5GJSH 1A6UH 5DYOA 4BH7B 1P7KB 4DCQB 1Q8MA 3HB3C 2YK1L 5DJ0B 5JNYB 3UPRB 2BVEA 3OGOE 4OBSA 2I27N 3L6FA 2B4CL 2CQVA 2BOCA 4OF6A 2PKDA 1N59A 3MRRB 4OD2B 1DQDH 3P9LB 1EJ6A 3TPUA 1LVEA 4XPGL 2FZ3A 3QXAA 4HMDA 1RULH 4IRSC 1S7XA 4GW1B 5DURD 2Y6SC 1HSBB 5BW7A 2Z31A 3CVHL 1A1MA 5CSBA 2VZTA 4P5MB 4ZAKD 1UJ3B 4JN2B 2EDRA 3DECA 2A38A 4H25A 3CFDB 4B53A 1W0VB 2WWKT 3QFDA 4O2CA 4GW4B 2L7UA 4KRPD 4NT6B 3M1BA 4Q7DA 4DKEL 4NQVA 4XNXL 3VD7A 3O3EB 4HUUA 1YNKL 5EZOH 3B9DA 4H5SA 4Q97A 4HGWB 5EUOA 1OGAB 3MUZ1 3ESVF 3WFBH 4DUVA 3ULVL 2IAMA 5HVHC 1FO0A 1JF1B 1OB1B 5EZLA 1G9MC 2CDFB 4F9PA 5JORA 4GG6E 2GJZA 5F9OH 1GC1C 1NCBH 2XG4A 3QQNA 3C6LB 4LCWE 4LLYA 5JZ7C 4HPOH 3K8LA 1ORQB 4EDXB 2OSLA 2CO7B 4PY8J 5GRVK 5B4MC 2IWGA 3LCYA 5C9JA 3EYFA 5A2IH 3CH1B 3KR3L 3VGGA 1JTOA 2PCPB 5JTWA 3SDCA 3QQ3B 1HQ4B 5I1DA 4HC1H 4HK0A 4FMKA 2OJZH 3KLAB 5TDPB 3E3QC 3OJVC 2HT3C 3TJHC 4OIAA 3VFUB 1BPVA 3WLBB 5ADOH 5FYKH 5MEND 3Q1SL 4DVRH 2ESVA 1FZJA 4ODWB 4HJ0D 4NQEE 3MOAH 5EH1A 4YWGH 4QYOA 3RTQB 3LKSA 3RWHA 3BDXA 1MCQA 1NAMB 4TPRH 4F37F 1M05B 3RIFK 5EFIB 4AQ1B 1QFWI 1QOKA 2AJZA 3RVUD 3P0YH 3O3UN 1Z9OA 1XFPA 5E8EA 4ZXBB 1TVHB 1NSNL 1YEGH 2J5LC 1JPSL 3S37H 1JTTA 4LVEA 3SDDC 4IJ3C 3PNWB 2IAMC 2LFGA 4JHWL 2AK4E 2YD5A 5TH2B 4HZAA 5LAXB 5HSFA 1CBVL 1J1PL 1A14H 1IGCH 1F13A 4PY7B 3QIBC 3ILPB 1JTPA 2XN9B 3QSKB 4JPIA 3WIIH 3SQBA 4LLMB 3RWGB 3IF1A 5HDLA 4WUKL 1A64A 3RWIB 3A6BH 2GSIA 3BIKA 2IBGA 3QG7L 4YDVB 3NMEA 4ENED 1VADB 2VDOH 3QXDA 3QP3A 1A7PH 4PJBA 4AK1A 2OZ4L 3VFOB 1XCTA 2Z31C 4QNPF 5IEKB 5ICYB 1BD2D 4KXZI 4LLQA 4JZOB 1M71A 3D85D 4LARH 5CZXC 3UBXB 4Z7WE 4LASL 3ULVD 1SEBB 2BJMH 3D85B 1T1XB 1NMBL 4I13B 1AE6H 2A74A 1DEEB 5FF6A 2W9EH 3DGCR 4G6FD 1MHHB 5EUOB 3QJFB 2DQUH 3ZYJA 5F9AC 3W9DA 1QBLH 4LAQH 4KU1A 4EI6A 5KSAB 1KJMB 4CU6A 1P7KA 1G9NH 1P6FA 4P48A 2YA1A 1UZ8A 3RVUC 4TPRL 3CFCL 5KANI 1KCRL 4FABH 5TGBA 5BS0D 5BZDA 2W0FA 3CLEH 1L7TL 3P4OB 9CGTA 5DK2B 4JJHA 1XF3B 4Z7UF 5E9DD 4Y2DD 5GZND 5IV2A 4RQQB 2P5EA 3HPJB 2YD4A 3IFNH 4PJ7F 1QR1B 4C55A 1CS6A 4DCQA 5T1LD 2PTUA 3V2AR 4YBHA 1RZIB 4UV4H 3BKJH 4K8RC 4HK3J 5DJAA 3CZFA 3VDAA 3TNNA 4B50A 3QA3B 4K71B 4BQ9A 4NOBA 1SBSH 1QVOB 4X8XA 3C8DA 3ARTA 3C2AH 4OCLC 1WCBB 3OTTA 1OB1A 2JKXA 3VWJC 1ZMYA 3DVIA 3MSPA 1NAMA 5IW1A 5CIPA 3MOBL 3MFGB 4MXQD 1MIEL 4WFEE 3MRBA 5ALBL 4NDMA 2ZWLT 1JPGB 3KPSB 2OJEB 1C5BH 2YHGA 4KFZC 4OZGB 4PJ9B 2VITA 3ZT6A 2GCYA 5J1TC 4NT6A 1S9YB 1FNHA 3D0LB 3QUML 1LQSR 4DZ8B 2A6IA 3V4UL 3KWWB 1LNUB 3VMNA 1QUNA 1FL6B 4YUEL 1U8LA 4OGXL 3MLXL 4DUWA 1I8IB 2AJ3A 4OQTH 3QQ3A 3CDYA 4PLOB 5JOEA 4NQXB 2XTJD 5F7NC 3SDXA 5CEZL 5IMKB 5HGAB 5CHNB 1NPUA 4PRDA 4YPGB 5HD8D 3T4YB 3RDTD 5KN5A 5KG9B 2IJ0C 4MNQA 2AQ3A 3VD5A 1KIQB 1NL0H 1VFOA 1JGEA 4JFHE 5EZIH 1AR1D 4LSVL 3Q48A 2P8PA 3PP4H 2YMXH 1GGCH 2W9DH 2YN5A 3AS1A 5C2UB 5C6TL 4LLQB 4MAYA 1BOYA 1HHGA 1R3JB 2V2WA 3BVNB 4XPHH 4PGBB 5D7JC 1S9XA 2HVKB 2DB8A 1AD9A 3WMSA 4D0DB 1RIVH 3PP3H 3FTGA 5EWIL 3W2DL 1C5CL 1LEIA 1HILB 4U1LA 3SE9L 1RZGB 2FJGA 3MTRA 5DVKA 4OT1H 4BQCA 3UROR 4BKLB 3GMNB 5C0JB 2XV6B 1JPTH 2OX5A 3RJDA 1U8MB 3TVMA 3VRLF 4JFEA 5FAAA 1QPPA 3BMVA 3T1WA 4XTRD 4KXZH 4RZCA 4R96B 2X44D 2BMKA 4UDTA 2NY0C 4JG0H 3V0WH 4FQ2L 3ARDB 3ZO0A 2CGRH 1Q0YL 2QSVA 1A7RL 1MFDL 2E9WA 3L5XL 4DVBA 1F8TL 4U1JA 4EBQL 1YEKH 4P2OD 3HNSL 4Z7VA 4F57H 4KJYA 3HE6D 2GJ6E 4MQ7B 1T2JA 3WFDL 5CIPH 1WAAF 3MV7B 2ATPB 1OGAE 5C6PB 1GVIA 2WIIA 1QSFD 1T04A 1FZOB 3QWOA 2EEAA 1IGCL 3SKNA 4HKJA 4L8CA 4IOFC 3ZLQC 3DV4A 5FUZL 3FFCA 2H1PH 2NY0D 1OP9A 3NFNB 3RVWC 4AENB 3SE8L 1SY6L 3K2UH 1F6FB 1G9NL 3QWQB 3HN3A 4P5TD 1NBVH 4LQ1A 1KULA 2H2PD 4YHPB 1VEOA 5E03A 4NHCL 2DN7A 3O9WD 1HYRC 3IU4H 2JK5B 3TBTB 4U1KB 2RQ8A 4PJ5B 4S2SA 2J4WH 4ZYKB 5FO7B 4LASH 3MV8E 4X6DE 3AFLA 1DVFC 4XVUD 2AABH 2NW3A 3RUGE 3P9MB 2C9AA 4PV9B 3MLZH 4NBYB 1OAXH 1YPZA 5HGDA 4M03A 4FZEL 1H5BA 1P1ZB 5B8CB 4HBQA 5CLWA 1KLFA 5IROC 2ICEA 3DV6A 2AXFA 3UAJC 4D9LL 4BZ1L 4H1LG 1B6DA 1LK2B 4ENEC 4Y19B 5L2KB 2E8YA 4MNHB 5DJ8A 2APVA 1NGYB 3G5YB 5I74C 4X0KB 4TSCL 5F3BB 2WWMD 1R3JA 3RDTC 2KUTA 4K3EH 3OXSB 1XH3A 2HN7A 2EDHA 4Z8FL 3SCMC 1HKLL 5HHOE 5LGKA 4HG4J 1T6VN 1QBAA 1OSZA 4P4KB 4GG8B 4KI5E 4NN7B 2N4IA 5JPMA 3GBLA 5HHPA 1T7VA 1M4KA 2DS4A 1N8ZB 2YZ8A 2FYYB 2Z91B 1JGVH 2R0WL 5HDQH 4N68A 2E7MA 2DMCA 1FYTD 2X7LA 4GAFB 4N8VG 5C09B 3R1GL 2O5ZH 4Z7NF 3KPMB 1DQML 3KGRA 5CCKL 4TSBL 5EZJB 4L1HA 5BV7H 1Y0LA 6FABH 4ZOCA 2FO4B 1ED3B 4FFZH 2AK4A 4P2QD 1EVUA 4GH7B 1PZ5A 3WYRA 3VH8G 5FM5M 1Z0MA 1GGCL 1M7XA 2YD8A 1EPFA 5F3HB 4PRBA 2G75B 4N0UE 4PJCA 2EE2A 4JO2L 1HSBA 2GT9B 2DD8L 2ESVD 1A6AA 3MRIA 3MLWH 4NM8L 2EE3A 1RJZB 2C26A 4LEOA 2P24A 4RMSA 1XZ0A 1JMZA 2A9NL 2XI9A 2GY5A 1J9CT 3N1FC 4F7MB 3OV6A 1A3LL 4H0GA 1H3VA 4X6DF 3VGAC 1G9NC 4CNIA 2I9TB 3ZMRA 1L0YA 3OR7A 3V4VL 1EDQA 5JHLL 3FRUA 2FSEA 5F1IB 1G0XA 4NQCB 2IANB 5JUEL 3P77B 43CAA 3LQAH 5D6CA 1YYML 4G8EB 3RGVC 3CGTA 3NZ8A 4NQDB 3ZDZF 4LCCC 4FA8A 1OTUD 3QNXB 4DJMA 3QXTA 5JW4N 3RZCD 3CLFH 4KI1A 1IAIH 5KTEL 3UTSD 3IDIB 1H5BB 1P1ZA 2BERA 1KIPB 4KVNH 1X44A 2VR4A 4ZNCD 1Q9WA 4JPWL 5C09D 3QEGH 2O26U 1F3JA 5E2UH 4PJHF 5E2VL 3TCLB 1QD0A 1QSED 2GTZA 5CP7A 4R26L 1R3KB 3TNMB 5TF0A 1E28A 5FUCE 2DTSA 3HE7D 4Y1AE 1OTUC 2JK5A 5FA3B 3NA4A 4YZFF 2VIRB 3WD5L 1N7MH 5E8PA 5IT2L 5FO8A 3B3IA 1ZS8B 3O81A 3T2QA 4BSVA 3D9AL 3MUJA 1X5XA 3LN5A 2F58L 2F8VA 5DDHA 3WD5H 4N0YH 4PGDA 5IW6B 4MX7A 3HZYA 3UTZB 5KVFL 3Q6FB 5IP4A 1BP3B 3DHJA 3NH7H 1CF8L 3LD8C 1NCAH 3MBEC 1I1AC 4PJIF 4BELD 5FUOH 4M61A 2VABA 2HYMA 4EN3A 5K59F 4NZUL 5E08L 2Q7YB 5GS0H 3CFIC 4IHOA 3EYFB 1J88A 3HUJA 1I8MB 2R23A 1HH6A 4B7LA 1LILA 2RBLA 3FT4A 5HHXL 4EN3C 1T21A 4H0HB 1WTLA 2X05A 2DMKA 4U1HA 1BVZA 2G75A 4H8WL 4MD0A 2IQ9L 2R1YA 1J7VR 2FL5B 4XPFH 3MRIB 2P5EE 3LAFA 1T3FB 3VD4A 2VC2L 2C7UB 1RHHB 2R0ZH 32C2A 4JR9H 4FFWD 5GS3A 2NXZB 1JK8A 1B90A 3KPLA 3JV5A 3P4LA 1H3WM 4POUB 1QFWM 35C8L 1YYLL 1CQYA 1MCFA 4F3FB 4U1MB 2O93L 2J8UA 4NFBA 4G80A 4W68A 3D39B 4IOIB 3BQUC 4FTVA 3O2WH 3N0PB 4XNYL 3WXVH 3QIUA 5ESAA 3PNWA 5JUEH 3MXVL 3S4SG 3UTSA 5C0NC 5L8KB 4QWWC 3D18B 1YMHB 3OKNB 5J0BA 1TZIA 2Z91A 2GSGA 2YA2A 3MOAL 5F7EH 4YQXL 2AEIT 2J7LA 3GMPA 3PP3K 4PRHD 5ECJE 4RQQA 1BOGA 1PQZA 1I8KB 3E6HA 1E4WL 1X3DA 5HY9B 4KHXL 2CLRB 1NGZB 1OWWA 2Y07H 4AZ8A 1KT2A 1OQOA 2ADJB 5JXEC 4JZOA 5GISH 3MLSL 2XTJB 4R97B 2HH0L 1AGDB 1FLRL 1TDQA 5K9QG 4L8SC 2GFBB 5BOPA 2FSEB 3QUYD 5MI0B 2ZUXA 3MRCB 2RFXA 3GRWH 3SN6N 2VJXA 4QRPD 4YFLF 3VXSA 3VWKB 2YC1B 1WCBA 1GH7A 1Q1JL 3M8OL 1NUNB 3L3OB 1G6RA 3QULA 3GMQB 5A16A 1D5MB 3GSUA 3PQYE 2G5RA 3MLRL 3WEXA 2H8PB 2MPAL 3T4AB 1VEMA 4RFNB 3GI9L 5KS9A 4OZIA 3WFZA 5CGMA 4WUUE 3W2DH 3FT2A 4NUJB 5IF0B 1A3RH 2N7BA 4D2NA 3QHZL 1N6UA 3VI3E 1LEGB 2E9JA 3MGAA 5GGTA 4WTZA 3PHOA 3M17B 4A6YL 4F58H 4J2XA 3BPLB 5SWZD 4DVRL 3PWPE 3PF2A 2Y5TA 4JPWH 3D39D 1AHWA 3I50H 1TETH 3VJ6B 4JVUA 4LLVA 2W9DL 1WFTA 1MWAA 1XR8A 3O8XA 4JG0L 3X14A 1V3KA 3ZYIA 2PXYB 5DMIH 1H8OA 1NUDA 3QRFM 4GXUM 4L8BA 2DM2A 3C09B 4UNUA 4YHIA 2OQJA 4R4BB 4X6CB 4CVZB 1YN7B 1B0GA 3HPLA 1AO7D 3T0AA 3ET9F 4OKDA 5DJ2A 4APQC 2OMNA 2DMBA 3I85A 3FQRA 4UDUB 4MHHI 3D69B 4QT5A 2PW2B 3KG5A 3MNWB 4OAWB 3V0AC 5CBEA 5C0JA 4L5FL 4F15C 1GCFA 5E6YA 5CD3B 2AV1B 4JFEB 3TZVC 2VZSA 3QUYB 4P46D 1GC1L 4OCRH 4PJXE 3EFFA 1SYSB 5L0QC 4CN6A 3WKMH 3NPSB 3TBYB 5JW3L 3GSRA 2A6JB 3C2AL 3QXVA 3IJYB 1LE9A 1EXUA 1FFNA 3MA9L 4G9DB 5IROA 5IHUH 4ZTPH 3R4DA 2QV2A 2YN3A 3S9DB 1W0VA 1S7SA 4Y4KC 3B9KD 1CDBA 2ATPA 1DBKH 5FDWB 3MV7A 5JOFA 2DAVA 1I7ZA 2F54A 5E94B 3F8UB 4NZRH 4GBXB 3K81A 3DVNA 4YC2C 2CIKB 4OLVL 2CJUL 3SGKA 1CXLA 4NBXB 4DQOL 2LVEA 3OKEA 3QUKA 1I8LA 3VG0H 3IDJA 2NY2B 5JA8B 5AYQA 4JRXE 1T22A 4MWFA 3L3OA 1XIWD 4FQHB 5DS8A 4QLRA 2MJWA 5C0CB 3ILQC 3EGSA 4ETQB 1NLBL 4K7FB 1J1OL 2ARJQ 5GIRA 4DGYH 2FBOJ 1YUHA 5D9SB 4KROD 2DQFB 3RAJH 3T1FB 3HC0A 5GPRA 3OF6D 5TPWH 5D8JL 5SWQB 1D9KA 5DD1H 3CUPB 2AK4D 4P2QA 1YEEL 2V6HA 1AR2A 3D39A 1HQ4A 1G0YR 1JGDA 5IB4A 2WWKO 1HQRB 4DFIA 3CDGA 1HN1A 4JJ5B 4XAKE 5D1QD 4U1JB 2FGWH 4U6TA 1KPUA 4MB3A 5I71B 1DQJA 3RP1A 1AY1H 4OUOA 3BPNC 4UUJB 1IAOA 1KCKA 4ZODA 2X9YA 4Y5YC 1JV5B 1AGCA 3TH4T 2PO6B 3OB0H 3PV6A 4FXKA 1UM4L 5IG7A 2YKLL 5A16B 4NNPL 4PRHB 4YDIL 1JF5A 1CE6B 1MY7A 4FP8H 3OGCB 3CFEB 3M1BB 1FG2B 3NOIA 3ARWA 4TVSa 3GUTB 3HRZA 2DWDB 3FQRB 4UDUA 3WJLA 1TQCC 5IVZB 1A0QH 1L9MA 2J6EH 2ZSWA 1IC4L 5IQ7H 2R2BB 5HPMA 2HT4C 4Y7MA 4N9GA 4XPAH 4JFFB 2X09A 2X7LB 4E42B 1WQVT 3FO0H 5IWLA 4S11A 4O00A 2H2SD 3KPMA 2VXSH 5E8DL 5KOVC 3W11C 3QDGB 4YK4C 4U33A 5BZWA 4GSDH 3QI9A 4RGMC 3SGEH 4ONOA 2GITA 4F37K 1IGIH 3OAYK 4LLAA 3QUXB 4I77L 1MH5B 4CL7A 4P5KB 4PJHB 3QAZB 1L0XA 4X5XB 1F2QA 2A0LC 1SEBA 1F5WA 4JPKL 3L5XH 4JLRA 2F54E 5F97E 3SGKC 2ATKA 3HRPA 4BFEA 4HLZH 3V5KB 4HPYH 4UT7L 2CKBB 2OK0H 1KJ2L 1HHKA 1A7OL 1TCRA 2NY5H 5JIHA 5M94B 1UCBH 1AQDA 3V4PL 4QTHB 3VRIA 3HCVA 1A5FL 2I24N 4L9LA 5DD6A 4JO1L 2X4OA 3QO1B 4JFFE 5TGBB 3MCG1 4HIJA 5FYJH 1IM9B 3UYOD 2WNGA 5INDB 1HH9A 4NO2A 5IT2H 3D48R 4LMQE 4HIIA 5FGCB 1CLYH 4XC1L 5LAXA 1EEYB 4UI2A 3S36H 3ME0A 5D1QA 1V7NH 1CWVA 5I8EB 1JWSA 1WEJH 2WLYA 1JPFA 3QUZC 2Q76B 2PR4L 1PX3A 5FHAL 4ZFOB 2A6KB 3WUWA 4P2RB 3OBAA 4CADA 1XCTB 3BIAX 1DL7L 5C6WH 1RMFL 2VLJB 5ICYA 2JB6B 4R3SA 5LBSH 1A6ZB 5HHOB 4RCAA 4POZD 2XZCL 3ZKXB 5CMAA 3HZMA 2ICWJ 5D1QC 1J8KA 1RUAH 1FC2D 1JPGA 2HJLA 3DX6B 2BY0A 4OM1L 1MHPL 2COQA 2VIRA 1ES0B 5FA3A 2Z8VC 2V7HA 1DEEA 5ACMA 3SO5A 2FB4L 4FTVD 1JZ2A 3TM6A 3RWJB 5ANMA 4PJGB 2WANA 1BBJB 3HI5H 5IVZA 1O7SA 2HKHH 3VW3L 4K94C 4FG6D 1UQSB 5C0CE 5FM5O 1X7QA 1UYWL 1I9IL 2XT1B 4GRLD 3EIFA 3CZJA 1AFVH 2IH1A 2IF7A 1GIGH 1BZ7A 2XA8H 5F8QC 5ALCL 4HIEA 2I26N 2FX8L 2KKQA 3CFBA 1C1EL 4K7PY 2DJUA 1CL7H 3HG1D 4LEXL 1WBXA 1GPOH 4P59H 2Q7YA 2WWMC 4EN3B 3MRLA 3E3QE 2P5EB 1DBBL 1ODAA 1RZ7H 3L7EB 1MF2H 3ROOA 5T1MB 2NY1D 2FH8A 1K8IB 2OTPA 1I3VA 3PGFH 3WXWH 1MCHA 3I6GB 3SKOA 1INQA 3HMWH 4JDZB 3GSNA 2HVJB 1NC4A 4EZMA 4G7YL 1RZJH 1WAAA 1T3FA 3GNMH 4U6YB 3MODL 4YFLI 4JFDD 1XF4A 2CKNA 3H7BA 4GS7B 4JGUA 5DQDH 4NQEB 3L3HB 1K8DB 4HUVA 3D87B 3IXAA 5IQ9A 4KZDL 5SWZE 4XCCL 5ERWB 4L8DB 1BHGA 1NLDH 4LPCA 3ARZA 3H9HA 1FGNL 1F11A 4OM1H 1YEHH 3L1OL 4UNTA 2BDNL 3VFSA 5HYJB 5B39G 1BWMA 1J0HA 1EO5A 4XCCH 3BGFB 1OGTA 2X70B 3NCYS 4Y1AD 3C8KB 1J8HE 3EYQD 2RHEA 5J9PA 2DIJA 3PHQB 1VENA 4GXUN 1DSFH 4LCUA 3WO4B 5FYJE 3OHXA 1JHTB 1T0MB 1EJOH 1S8DA 1H15B 1PG7W 2R0ZL 1KLUA 4ONGH 5I75B 4F33A 2XRAH 3OB0K 1YPZE 2UWEE 4EI5D 3FRPA 2CO6B 1AGFB 3FQNB 3GMRB 2R1YB 5MEQB 3MCLH 4Y5YA 5KAQG 2W38A 5DJCB 1F4HA 1RMFH 3OSKA 4DUXA 3GRWA 4XCYA 1UVQB 1U8QB 3VXUA 1SJEB 3NIDE 1W0WB 1HYSD 3NABH 4GBXD 4L4TA 4NQVB 3S37L 1W8OA 1A7QL 1G7JA 1PY4A 3GSXA 1BBDH 3FO9B 4HKBB 4P57B 4F7TA 3VXPB 5I1LB 4WCYH 4MAUL 3FFCD 1AO7B 4JRXA 3BPLC 1I7UA 3Q2CA 1ZHLB 1OTSD 4HX1B 3QXAB 3RWCA 3WIFA 4HWEH 1J0KA 5J11B 1ZA3A 4NP4H 4J4PC 1JWMB 2B4CC 1DTUA 3SGJC 1OLZA 5DEGB 5FOJA 4Z95L 3CH1A 3LEYL 5MENE 5GHWH 1INDL 1QSFB 5EOQH 1Z5LB 4KK5D 1BLNB 1YA5A 3ARFD 5JW3H 2X1PA 2FR4B 1EV2E 4PS4L 2ADJA 5KS9F 3NIFF 1WIOA 2ENSA 4JANA 4XMKL 3TVMD 4L3CB 2YA0A 4TVPH 3N1MC 1CDJA 1U41A 1WTGT 1JZ7A 1JF1A 1U8NB 2XNAA 3P4NA 4XPBL 1A1OB 3SDYH 2EC8A 2YOCA 3IT8D 4Z9KB 2P5WD 4L3AA 1FJ1A 1XGYH 4QT5B 2VZOA 4R8WH 4JKLA 2OI9C 4A2MA 4M7JH 4IRJC 3VXME 4S0SD 1Z3GH 3BAEH 3SDCD 1U3HB 2WBWB 1MLCB 4MGXA 4LKXA 3LKPB 2GUOB 1NC2D 2R4SL 4P5TC 2Y06L 2GAZA 1P7QD 5DTFA 1E4JA 5HI4D 1K8IA 4JZNB 2H32A 2JTDA 4KGJA 3UZEA 2NY6C 3LB6C 3N85L 4MJ6B 1TJHL 2F19H 2HT3D 3TJHD 1YNTB 3QZWG 2AEQL 2GJJA 3MJ9A 4O5LL 5D72H 1DCLA 3CFBB 1FZJB 1Z9MA 1DLFL 5D1ZA 3EO9L 1KEGL 2R1WA 3FO1A 5B3NA 4ZO7A 4R0LC 3RWEA 3LSOB 3MNVB 3E8UL 3ZHKA 1TITA 4HBCL 1PAMA 1N3NB 4XHJC 1UJ3C 5GGTH 4PJCB 4I2XA 1FV1B 1DQMH 4EQ2A 5JLZA 4JGJA 1LP9E 5I75C 3MCKA 3LQAL 4L9LC 2AKRB 3O8XD 4G6AD 3NZ8B 1Y18B 3PHQA 4Z7UE 1N5YH 3DUSB 4HUNB 4EOWH 4UTAL 2X4RB 5DJYB 3S98A 3OHXB 1NFDF 1LWRA 2AV1A 1R5IA 4ORGA 2UUDH 1RFDL 3MV8D 1PG7H 1YMMA 3EJJX 1XR9A 3BD3A 3SE3A 1CTNA 1F11B 3MLSH 3S88H 5SWSE 4XBGA 1D9KB 5DQDL 5GXBB 3WS3A 3B5TA 4Y1AB 3FFDB 3G08A 5E5MA 3JBG7 5CP3H 5I1CH 3BZDA 1DDHA 3UTTA 2YXFA 5IB2A 4JM2A 2BX5A 4NKMB 4F80A 3SE4A 5JXEA 4UUJA 3SDDA 3VXMD 4TRPH 3U83A 1MRCH 2E5EA 4TN9A 2HKFL 4G8FB 4ZPTA 5FK9B 1IEAA 1D5IH 1EAJA 5MI0C 5DDHB 3GMRA 3P3YA 3EYUH 1MPAL 4WIQA 2VDQH 1KPVA 2E8ZA 1UZ8B 5DC4B 1F4WL 4G3YH 3QFJA 3DXAD 5IR1A 3HRZB 5F1OB 1JNJA 3QIWD 3QIUC 2FEEI 4NQCD 4OLUH 5I1KH 3JTTA 4GLRI 1BVLA 3KXFA 3NH7L 3RWCB 3V52H 4XNYH 3WXVL 4GAGH 3T77A 5DK0B 5E8PB 4U6VL 3MBXL 3L5JA 4K3GA 2VLKE 5IFJB 1BJ8A