4LKXA

Humanized antibody 4b12 fab complexed with a cemx segment
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
214
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGYSITSDYAWNWIRQPPGKGLEWIGSISYSGITGYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCARMGYDGLAYWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two potential therapeutic antibodies bind to a peptide segment of membrane-bound IgE in different conformations.
pubmed doi rcsb
molecule keywords Fab fragment heavy chain
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lkxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lkxA01
3DX9A 5KVGH 3ULVH 3U0PB 1XF3A 4BM7A 1FG2B 4PJBA 2CK0L 4DTGL 5BW7A 1TCRA 4QRTA 1CL7L 1QQDA 1YEJH 5A2LH 4GKZA 5SV4A 4QOKD 1ZAGA 5L88L 3DMMD 2NY6D 1KJ3L 3UAJD 4LLYB 2R56L 1P4LB 2NY3C 5ICXA 4E41A 4GLRI 1JPFB 3AREB 3S35X 4CGTA 3EDKA 3GBLA 3OJVC 5I71C 1KCLA 1D6VH 2QADB 5F7UA 5IJVB 1KACB 4MA8L 2APFA 4L8SC 4RFNC 4JR9H 5DD5L 1YUHA 4B41A 3QZWA 1NLBL 1I1YB 3D5OF 4WO4A 1AGCB 3T8XB 1MJ7H 4HK3N 4PJXB 2K1MA 2NY2C 4WW2F 1A1OB 2A38A 1DUZB 2J8OA 4XCYB 1DEDA 4KPHL 2C26A 3FO0H 2KZWA 4Z7NF 3S88H 4GRMB 5CIPH 2JJTC 5DURB 1WC7A 3ES6B 4TSCH 1T66C 4G3YH 5JOFB 1IAKA 1D5ZA 2XWTB 2ICWI 4HIXH 1OOAA 1MLBA 1J1XL 2Q6WB 5MEPB 5INCA 4DEPC 4TQEH 4FFWC 1IAMA 1HKLL 2AP2A 4GG8B 1MNUL 4MD5B 5IOPB 3BESR 3BKYL 3PGDB 4HV8B 5I1IH 4OM1L 4MNHA 4P2QB 2AEWA 4KTEL 5H35A 1DSFL 4OZ4A 2G9HB 2CPCA 4F33B 5EOCH 1S7UA 5D2NA 3KAAA 3S35H 4PIRF 1KB9J 3W2DH 3E6FA 3LS5L 4L8CA 3T1FB 5ACZB 1S7QA 3RL2A 1K8DA 4NCDA 3QUXA 1ZEAL 1HXMA 4LCYA 2CO7B 2LU7A 4JFFD 1AD9A 1S9YA 5JMOC 1SJXA 4TUKH 2D4DA 3HRZA 1T03L 1ZWIA 3P11H 4JDTL 3GSNA 1OTUD 5I19L 2R0WH 2NZ9C 1FIEA 3MRKA 4NNPH 4GS7B 2DLFL 4HZLB 5GZNC 2Y36H 3D2UA 4GAJH 1T04A 3CLEL 1LD9B 3WE6B 1FFOA 5DQJB 2XT1B 4XPGL 5GGQH 1UB6A 3D0VB 2V9RA 1IARB 2DMKA 4OZFG 3LHPH 5AYUL 4X8XA 3EO9L 3BIKA 1JGDB 1QEWA 4FNLL 1AP2A 3VXMD 5CJ5A 1LMKA 2ED7A 5JW4Q 4JJHA 4QXUL 4HD9A 5FUCE 1FAIH 3D6GA 5F88B 5JOPD 2HT4D 5C09B 3W9DA 3GSWB 5C0FA 3H42L 3NCEB 4P2OB 4JFPB 5HHNB 1GHFL 2W0FA 1OGTA 2BNRB 4R7DB 1BQHG 4MSWA 3HR5B 4XPBL 5IM7B 4ELMA 4OLUH 4M3KB 4PV9B 1KPVB 3CVIL 3DX8A 1ZGLA 3OKDB 3BZFA 3GMRA 3L3DA 4ZTOL 3KPOB 4BZ2H 3LKPB 1BF2A 3IDXH 1R3LA 3QHZL 5GSVA 1OM3L 4L4TE 4FQ2L 1HHJB 5H2BB 5HHMD 4BZ1L 5IUSA 1EH9A 3KPMA 5F71A 5GQBA 2PCPA 1WEJH 2RFXB 2BERA 1HYSD 2QSCL 5F9OL 2NXZD 4IS6B 3B9KA 4R7NB 3MFGB 5DI8B 3PE9A 3PGFH 5D70H 3VDBA 1EDQA 3NPSC 4YHLL 3WIHL 4HFUL 3ZYZA 5A16B 3VFRB 4EDWL 2YD4A 4HH8A 1ITCA 4P46C 4PP1D 3GSXA 1JF6A 5EO1A 1HHKB 4PY8I 1PG7X 4NUGH 3GI9L 5DWUH 5DVOA 4RMTA 5I1LA 4TSAH 2BMKB 4Z95H 4KZEH 4XBGA 2XTJB 3ZE1F 2QSVA 2R8SH 1YMHA 1R3KB 32C2A 3QULB 4WEBL 2DTML 1KNOA 1MCHA 3VFSA 2VZSA 3W82A 5BVJA 1S7VA 4HWZA 3DECA 3QUKA 1I3GL 1YEFL 5IB1B 2DBJA 4Q0XH 2MCPL 2R2CA 3VFUB 1GGIL 4HGMA 5AG9A 3GSOA 1TTFA 4JVWA 3EJYC 5E8OB 2X2YA 2CUIA 4DAGL 4F7TA 1OAYL 5D71L 4XVJL 5ISZD 5E9DE 4HZAA 3LZFH 1NFDB 2DQIL 2BOBA 1FO0B 2PW1A 5KANI 1IAIM 3BX7C 2EDQA 3L5HA 4N8VG 2GJZA 3HNSH 4NO0B 4FS0A 3O45B 4AL8L 4BFEA 5L2JA 4JM4L 4UT6L 3EYUH 1U8MA 2FEDD 5BS0B 3ZT5A 3SGDI 2F8XC 4KUCD 4XP5H 3B8YA 1NMCB 3WYRA 5SX5K 1D6EB 4G7VH 1CDUA 2FR4B 1IC4L 4DZ8B 5JHDE 3TIDA 4OBSA 2AK4D 1H0DA 3X3GL 4WIQA 1S3KL 3O6MH 1G7JB 4OQTH 1HSAB 4PJDF 4R9HA 4M6MH 1PG7H 1L0XA 3UTTE 5FAAA 3PHOB 3MR9A 3UDWA 3RVXC 1I9RH 2IGFL 3DBXA 4PJCF 1HHGA 3I6KB 1MIML 4JFOB 5EU6A 5DEFA 3P0VL 1K4CB 4TRPH 2P48B 3F6LA 3K7UA 1AHWC 1GIGH 4JHBA 1B90A 2A6IA 1M7XA 4U33A 3MRJB 1KGCE 4AH2B 1NCTA 3O6KH 5I1EL 3FB7B 1T0NB 4JM2C 3UJTL 1KTDA 4FQXD 1NH6A 4U3CA 5DJYB 2YA1A 1LE9A 3UBXB 4P4KD 4ELKA 1O0VA 5TFSH 4UDUA 3GKZA 4Y4HB 3RWDB 2XG5A 2HLAB 1HIML 5DJDB 2G5RA 3LKQA 4N90D 1Z3GL 1MQ8A 1YPZB 2IFGA 2FJHA 3VWJC 2J8UE 5BQ7B 3QEUA 3ALWA 2ADGB 5DFTA 1KJVB 3L3IA 2RHEA 4H1LH 4YHZL 4WI2A 2C7UB 4PJ9A 4JRXD 2DYPA 4PJGE 3QIWD 4HAFA 3OGCB 4NJ9H 3W39A 2R39A 3D39E 4G8EB 3D3VD 5E1HB 4X9BA 4K9EL 3U4AA 4ONOA 1I1AA 1RUPL 4NKIH 2YK1H 2BOCB 3TNNA 1KLUA 5GS0D 43CAB 3MUZ1 3EZJB 3FO2A 2OP4H 4HXBL 4NZUH 5BV7H 3TH3T 5BZDB 2UWEE 3ZYIA 3QH3B 4KXZI 4GG6A 2XWBB 4L5FH 2EDJA 3RNKA 5L9DL 2DQHH 1JBJA 4KRPB 2WUBH 5DVLA 1CD1A 3L7EB 2V2XA 4ORGA 1FYTA 5GISH 4X6BB 3DUSB 2X1WL 3JUZA 4XBEL 5EORH 4NO2A 3FQUA 4K9EC 3BQUB 3PWJB 3AS3A 3K8KA 3T0VA 1JMZA 3GI8L 2UUDH 4ODVH 1RHHA 4KTDL 3K4DA 3AREC 1R3IH 2CKNA 5IK3A 3GMLB 1FZMB 5E6IB 2QADC 1P1ZB 1F5WA 1JPTH 1FH5H 3RVUC 2QSTA 4WI5A 2FZ3A 3ULVF 4GMSH 5IESH 2Y6SC 2P45B 4ZXBA 1CXEA 3N1GC 4JEGB 4WI4A 4UTAL 4Y89A 5JQ6L 4PB0L 3HI5L 1OPGL 1F02I 2A74A 4TPRH 5HYSB 4UMGA 1C7SA 4FXKA 4AYFA 2AGJL 1N64L 4YHKH 4HIIB 1MCQA 5D7JA 4ORZC 4NJAH 2GSGB 3BP7A 3T0AA 4E41E 4G6KH 4LCCA 4RSVA 4YGVB 2MPAH 4JGUA 1DVFB 3O0RL 5IP4A 4C4KO 3U6RB 5EC1B 4KKBC 3LCYA 4M5YH 1TJHL 3HFML 5DFWH 5H94B 5DMJB 1OY3B 5T1MA 3BPCB 3ZKXB 4ZAKD 2D7TL 2H32B 3NABH 1BLNB 3KPSD 5CLTA 5E56A 1S9KC 1NAMA 3O6FB 1BVLA 4MAYA 5KSVB 1JJUA 4X4YA 3VI4F 5B8CA 2W38A 4AY0A 2DAVA 2J2ZA 3RWEB 4S1SL 5MEQA 5D1XD 3F7YA 4YXHL 3LQAH 3QO1B 1YNLH 4KV5E 4D3CH 2CRIA 4HQQH 4OLWL 5MEOA 5TDPA 2RAMA 1MH5B 5FOBA 1NC2A 1T1WB 1YECH 4ETYA 1G7PB 2A1WH 4OZHB 4GS7C 2G75A 1I9IH 4NQCA 2Z4QB 2ID5A 4FQCL 3VWKA 4D9QD 5D2NE 1KIPA 1UZ8A 3VH8A 1CGUA 3P4MA 3GO1L 1I4FB 3CSYA 3T2NH 2K7QA 3MGAA 3GSQA 1U8JA 5FV1L 1C7TA 1EJOL 2APTA 2WINB 4PGEB 5HSFA 1A7QH 2XN9D 1CLYL 3F5WA 3WFDL 1J1PH 4LARL 1XGUA 2ZKHL 4FHBD 2HJKA 5AAMA 4MVBD 1OL0A 3OTTA 4GH7B 4OKDA 1KCUL 1QSEB 3DRQB 3QNZB 3QNYB 1U2HA 2QTEA 3O11A 3CFJA 4LRNL 4EDXB 1KIQB 5HGDB 2A83B 3GBNL 5KG9A 5FCUL 4IDJL 1QHOA 5GRJH 5MERB 3BZ4A 3ROOB 3HTLX 1RJZA 4EIZC 3V52L 4P2OC 3GRWL 3FO1A 3RIAK 3TA3B 3RDTD 4AEEA 1G7HB 1K5NB 1Q9WA 3H9HA 4Y16B 5IGXL 1N4XL 3ARBA 3AS0A 1QSVA 1IKNA 4G6JH 4UTBH 2BCKA 3H6JA 4NQEA 5CEYA 5T3ZL 3D9AL 3QCVL 4FXLA 3MREA 4F37K 4ZS6C 3ABZA 2OI9B 5HDOA 3WFHA 3IS0X 1BJMA 2BVYA 2R2HB 4KJWD 4YHYB 3EHBD 3MBXH 1OWRM 4QRPB 4RGOH 2ICCA 3VXRE 3ZKMD 1U3HD 2H1PH 2PXYD 4JO1H 4PRHE 4YDVB 1GXEA 3RU8H 1JWUB 3NOIA 4UNVA 4Q9RH 4F7CB 2CD0A 1KT2B 2IADA 2AJUL 2VRAA 4G9FE 3Q5TA 2I5YL 1CXIA 4WUUA 3F62A 1OAQH 4AZ8A 2JTDA 5D1ZD 4X4XB 4LF3A 5D1QD 3QAZB 4OT1H 3Q3GA 3SDAA 3TLRA 1LE5B 4L9LA 1FC1A 1FO0L 4QTHA 4KROB 3FHQA 3UO1L 2MQ0A 2XTJC 4ODXB 1FC2D 2VDRH 3OR6A 1EK3A 2RB8A 5DVKA 3ORJA 3FT2B 5HGHB 4GMTH 1U95A 3K4AA 3KPLB 4I0KA 1T5XA 2HKFH 3SJVB 5K9JL 1YNTA 1JUFA 2IAND 5FB8B 3JWDH 4G6FD 3QWQB 3HE7A 4JDZB 3VD5A 4KMTH 4LGSB 4I0PA 4JKMA 5FYJE 1BGXL 4K94H 4QNPF 3V4VH 1ZLWK 4L8BA 5DMYA 1FDLL 3BZEB 3MODH 4XVSL 1PYWB 5DYOB 1NMCC 4HCRA 1ZT7A 3VXSA 2J4WH 1MCJA 2UZXB 3U9UB 3RIFF 3CFCL 5EC2A 4OCNC 5IEHA 3BXNA 4ZO8A 4NZDA 2PO6A 5INDA 1GCFA 1W8NA 3G5XA 1EEZB 4PUBH 3HZVA 3DIFB 3DWTA 1HCVA 1YEEL 1VGEH 5DD0H 3WXVL 1A0QH 1MAML 4OAWB 2YD5A 2NTFA 5D7SL 3LV3A 5AG8A 4CUCA 4L8SA 4N5UA 3CMOL 1IBGL 3GMOB 4GKSB 5FYJH 1GGCL 5FA4B 2J5LB 1JP5A 2W60A 4OD2B 4JANA 1DEEA 1DANT 3E3QC 3MNWA 4M6OH 1AIFA 4KHXL 3FAXA 3DGGB 3ETBF 1EEYA 1JGVL 4A2LA 3OPZL 5CZXC 1RK0A 1XF4A 3H0TA 3SN6N 3WN5B 3CDYA 4ZFGH 4LHUG 1OQXA 1NKRA 2FD6H 5DJ8B 4F7MA 4BFIA 4G8FB 4Y4HC 2APXA 3VFGH 3TT3L 1U8PA 4ZFZA 1CU4H 4XC1H 4JAMA 1J0KA 3L5WB 5EU6E 5K9OA 2AQ1A 3QJHA 4NZTH 1UEYA 4OCYL 5A2IH 3HC0B 4X5XB 5IMKB 4YPGB 4RMSA 1G0XA 1RUMH 4JN2B 3W5MA 4WI9A 4R96B 4DKDC 4D0BA 5IB4A 1GYAA 5MHSD 3PWPD 4CADB 2A6DA 2QQLL 3QT2A 1KTRL 4U1SA 4JFXA 3KLHC 3TFKD 1RZGB 2GSIB 4MGXA 3RX8A 1IM3B 3FFDA 9CGTA 5IB3A 4ZD3H 3GNML 1B3JA 5GS2H 1MI5B 4KK6D 2P5EE 1SYVB 4I13B 4OBRA 4H1LG 1B4JH 4MS8C 2XPGA 3GEWB 4WY7L 3U9PH 35C8H 3RKDC 5D6CB 4KQ3H 3O9WB 1BZ9B 4NC1E 3SDYL 4NQDD 4F9LC 2FB4L 5JPMB 5DMKB 4UT9L 2FEEI 5DJAA 1N5YH 2DQUL 4FFVC 4JKPH 1XCTA 3FQWB 4KRPC 5E8EA 2VDOH 4LFHD 1TNMA 1PAMA 4FABL 5FK9B 2BHYA 4EXKA 1LNUB 4X5LA 1EO5A 1MFAL 4P2YA 4N0YH 3QA3B 5FYLE 1BD2B 3V5HA 3D18B 3L3JB 3L5IA 4G6AC 5EU7E 3GIZL 2KH2B 3BQUC 2FHFA 1B4RA 2BNQE 2DQDL 2VQ1B 4NHUB 4UB0H 1FYHB 3HG1D 2R0LL 2K3TA 2GTWB 3U7WH 4LKXB 4Y4FA 5SWSD 5KTEL 5H37H 1OAZH 1YEDA 5J13B 2ZCLL 1KN4H 5E6IC 5F1NA 4GG6E 4JPKH 5FGCE 2R29H 3EIFA 4NQXB 3C6LB 3Q6GL 5BZWB 3A6CL 3JV4B 2EE3A 2J8UF 1FYTE 5FO7A 4CN4A 1FV1B 4OFIA 1KIRA 4LPVA 3AXLB 4KQ4H 3RPIA 5KJRL 1FGNH 4LASL 2VB5A 4XP9H 2DQJH 5HYEA 2XZQH 5FF6B 1AFVH 5FYLH 2F74B 4PGZA 1N3NB 3D25A 3IETB 3OZ9L 1JYNA 4PJGF 1YN6A 1BFSA 2ZPKL 5HTSA 2QLVB 4YXLH 3TBYB 3H9SD 4QRRA 4OFYD 4MCZA 4I77H 1Z5LB 2H26A 3WFBH 1DVFC 1H5BB 2B7DT 3PWUA 3P0YL 3WBDA 2NR6C 1RULH 2AV1B 5EN2A 1X5JA 2FLRT 1INQA 3GJFA 3PXHA 4YHOL 3SGJA 3WKML 4JHAH 3F7RA 4PRDA 3ZKXC 3IFOA 2IH1A 3BKCL 1LO0H 1KPRB 2VDLL 1MHEA 3O6FC 4K3DL 2XA3A 1A21A 2W9DH 3CFKA 3K2UH 1AXSA 3BDYH 4PJEF 1KENL 1PLGL 4KUZH 4DZBB 5I1CH 3W81A 2V6HA 4HWNA 1F4WH 1P69B 5BJTB 4JPWL 1KTLB 4QRQB 4U6XB 4PY7B 2AV7B 3QUYD 3UTSD 1XGTA 2YBRA 4HX1B 1KYOJ 2H9GB 4U4BA 5CUSL 2VABB 4R3SA 3L7FB 2PN5A 5CKAA 4Y19A 1A2YB 3F7QA 3FL7A 2ZOKB 1JGLH 1L7TH 1E6OL 2ZSVB 2ZUTA 3NTCH 2VR9A 3HAEA 3RJDA 3C60D 4NQSA 2PYED 5EIIB 5JIKA 4D9LL 1PEZA 5E99H 3WIHA 4JQXC 3LKSA 4JHWH 2WW8A 3LEXA 3SKMA 4HLZH 3WDHA 3U7YH 3SDXB 2WUCL 4ZTPH 3U36A 4AJ0A 5KS9A 3QPQD 1QA9B 5JHLL 1QYGH 3B43A 2VH5H 3QZWG 2H3NB 1NEZB 1CF8L 4QRUA 1JHKH 4L3EB 1WITA 1UJ3B 3CU7A 1LEKA 2NY0B 3MV8D 4UIKL 2VZ1A 5I1DB 1XT5A 1IFHH 4EQ3A 2DLIA 1DLHB 3BH8B 1RU9H 1I1FB 1ADQL 4OUUB 5K9KB 3DX7B 1IVLA 2I9LA 2AVGA 4XZUA 4YHIB 4E42A 4NQCE 1C12A 5BO1L 5IHUL 5ETUA 2VC2H 1EJ6A 3TA3C 4YXKL 4RMUA 4MQTB 5HDBF 3M8OL 4Y16C 4CVZA 5GGTH 1JPGB 3NMEA 3RWFB 5A1AA 2G60H 5D7LB 2AXGB 4Z78A 1SJHB 3O41B 4NC2B 1T1YB 5DUPL 2OI9C 4HUVA 2YEZA 4UV7L 4KK8C 4YHYC 1U8LA 3G6AA 2XZCL 4GBXD 4U1NB 4X80L 5IJKC 3BP6A 5E5MA 1YEHH 1CLCA 2X4QB 4Y1AD 3VXUB 2X4TB 2YPVL 3M07A 2ED9A 3D85B 3UMTA 1CXHA 2I07A 2BC4A 5IT2H 1CQKA 1UKSA 2GCYA 3FFCD 4GXVL 4IHOA 3QUMB 5C0CA 5D9SA 4M6NH 5C9JA 5LWYH 2W92A 1I3UA 1UADC 1IL1B 4M7JL 4N9GA 2EDKA 1FL5B 4NQEE 3G5ZB 4LEOA 4XNUH 3QAZC 2P8MB 1XF2B 1URLA 3QO0B 4I48B 5EBLB 2V7NB 2X4PB 1F6FB 1JHTB 1KXQE 2BRRL 3QWOB 4KROC 3RWJA 4A6YL 4O58L 5DK0A 4P5TA 6FABH 5J9PA 1FL3B 2LQRA 4Q2ZA 2Q3ZA 1QFWH 3W0WB 1NJ9A 2ARWA 3CCHA 2LV4A 3C5ZA 4WWID 3PWNB 3RP1A 2VWEE 3VRJA 4NO5A 5ESQA 1INEH 2P44B 3TZVD 5C08B 5DZLA 5CHNA 3VGBA 4XVTL 3ULUD 1NKOA 3IFPA 4BQ8A 5GRYA 4R2GB 4BQCA 4E5XA 3Q1SH 4Y2OA 4OB5L 3KPRD 2FJFA 1T4KB 3BD3A 1EXUB 3S4SA 4MB3A 1IGTA 4U3HA 3BIBX 1FHGA 1FG2A 1RIVH 3KYMA 2PETA 2FHBA 3C8KB 5HY9B 4JKLA 4XNXL 1ZLVH 2EE6A 4FTVD 1A9BA 4Q74A 3SKJH 1R24B 8FABB 3MYZA 3PL6D 1S7WA 3MCLL 4PREB 1A7NH 1PKQA 1S7SA 3G5VB 2XQYG 3S37L 1P4LA 4J6RL 43C9B 1PKOA 1JPFA 1NFKA 4J4PD 1JV5A 3AREA 5DK3A 5CP7A 3MC0A 1B0RA 5IFAH 1FZOB 2FL5B 1DLFL 2Y7QB 3BD4A 1JNLL 3K81A 5IJVA 5GRZA 1FBIL 2MHAA 3MNVB 5GHWH 2J5LC 1AGCA 3MRNA 3MOBL 1UWXK 4LDOB 1CG9A 3VXSE 5DD1H 1A1OA 2VERN 2OX5A 3SDDD 4KZDH 1DBAH 1P2CB 5JIIA 1X7QA 4FXGB 3CK0L 1RJLA 1RIUL 2IJ0C 3WN5C 2AJYH 4NKOA 2ZUWA 1K85A 4YHNB 5LGHL 2WBWB 4OCLC 5JNYB 4WFED 2XWTA 3QG7L 5F7EH 4E0RA 4FRWA 5JXAL 1KULA 3MJ8B 5MEPA 1AO7D 4IRJA 4ZS7H 5KSAD 3QB7C 4DN3H 3HLAA 3RY6A 5IOPA 2VLKD 5EFIB 1TZHB 4XXCC 5EWIH 3LH2H 1XFPA 5LJYH 2NCMA 3PWVB 4AM0A 4X6DF 4P2QA 4ONGL 1OP5K 4AIOA 3UTPD 1CGXA 2G9HA 4K3JL 4F33A 3GSRA 4BUHA 4YDKH 1T7YA 4D0DA 3PGCA 3MLXL 2M1KA 3SDCB 3TPKA 1P84K 1W72H 5ACZA 2NYYC 5LAXB 1Q0XL 1HSBB 1QSFB 2P1YA 5K93A 1CXFA 1FG9C 3IDNA 4QHKJ 2AQ3A 2CK0H 3O9WC 4DTGH 1X6LA 1CL7H 4EN3A 4ONFL 1BJ1J 1SM3L 4LCWB 1YC7A 1U8IB 1AKJB 3E6HB 1N5AA 4HZLA 1RJCA 3EZ8A 5SV3A 1MUJB 5L88H 2GITA 4MCYB 3V6ZB 1KJ3H 5F7DB 1TZGL 3QNXB 3WDIA 2R56H 5IF0B 5TQ2L 4AG4L 3IF1B 3MLWL 4UUJB 5ICZB 1UXWA 1RK1B 5TJWK 4GRLD 5IHBA 5C0GA 3U30B 3MRLB 3QQ9D 4U31A 1JGDA 1S5IL 1S8DA 1BQUA 5J13C 1UQSA 3KJ4B 3IRPX 5DD5H 4Y8DC 3RWGB 4Z7OF 5EU3A 3MLRL 5K33A 4DKEL 3C6LC 1EO8L 4CU7A 1G1YA 5GIRB 4M8VA 2VMFA 4LLUB 5SWZA 4KPHH 4DGVL 5H37G 2GT9B 4OI8A 1XMWA 3DO3A 3UXFA 5GSRB 3O6LL 4EVNA 3T77B 3RTQA 3FQRA 5LQBL 2AXJA 4U1IA 4X7TB 1T1ZB 1ORSA 5M94B 5I1GL 3EDJA 1IE5A 5C07D 3IAPA 3HN3A 5GJSL 2CDGB 1ZT1B 3OKDA 2NZ9D 4PRPD 5BOPA 2EXWD 1TPXB 5B3NA 1J1XH 4ZPTB 1K2DB 2PTUA 3WMSA 5GZND 1H5BC 1HKLH 2FGZA 1MNUH 3VG9B 2Z8WC 5JQHC 3BKYH 3LVEA 2MTPA 2RFXA 4OM1H 4TVPL 3GRWA 2L4OA 5E8NB 1WZMA 4KTEH 3MRDA 1DSFH 5T5FH 4LHQB 3M1BA 2EIDA 5M95B 3LS5H 1JZ3A 4Z7UB 4IMKC 3AGVA 3VFRA 1FN4B 3ZSSA 2OMNA 3M17B 2VLME 1ZEAH 4OV6F 4QRRE 4DVRL 1FVCB 3NA9L 1T03H 1YJDL 4JDTH 5I19H 3VMNA 4HXAL 2DLFH 3ZKND 1YMMD 1NBQA 5IW1A 4GG6F 3CLEH 3BDXA 4XPGH 4YIQB 2X5PA 1BBJB 1OLLA 4OGZA 5IB1A 2M8XA 3VFUA 1TTGA 3EOTL 1UT9A 3KDMB 5AYUH 4EBQL 3BGMB 3BVNA 1WAAE 5D2LA 5FECA 3QUZD 4IMLB 4OD3L 3FN9A 2O93L 1YJDC 4FNLH 3ZE0F 4BH7A 3GBML 4DCQB 3TJEL 1UJ3C 4HLZG 3RI5F 4QXUH 4L29B 5F9AC 3QEQB 2NY0C 2XV6B 5BS0A 4Y19E 1E4XL 5ID1A 2MCG1 4HT1L 4BSVA 3QFJB 1OW0C 3H42H 2FR4A 1NSNL 3LD8B 1GHFH 4O2CB 3MRHB 4QRSB 5HYJA 2H6PB 4P46D 2N56A 4Y4KA 1HI6B 1CFSA 4XPBH 3R1GL 4MJID 3WCYA 5FO9B 4HDIA 3CVIH 3MUGB 5KS9E 2HN7A 4GXUM 3DO7B 1PZUB 4ZTOH 1HH9B 1U91B 3QHZH 1OM3H 4FQ2H 3QUML 2IALB 1I7TA 3I6KA 4JFOA 4BZ1H 4C4KT 3MO1B 1T0MB 4BH8B 4FG6C 3O4LB 3F58L 1B2WL 4K23L 4LLMB 2QSCH 1BHGA 5F9OH 1NDMB 4AH2A 2VLJD 1WJ3A 5HBBA 4YHLH 3WIHH 3UBXA 3B2UC 4HFUH 1YDPA 3BT2L 4EDWH 3TF7C 2VDQL 4K7PX 3PABB 5F72S 5JW4N 4OGAD 1FFQA 1WVZA 3IDJA 5D7KE 3MLZL 5HHVH 3PUCA 3GI9H 5D5MB 1KEGL 1YPZA 1A4KB 4NYLA 3RJQB 4MD4B 4I4WA 4X9IA 3U46B 1J18A 2AJZB 3JWOL 4WEBH 2OZ4A 2DTMH 1KJVA 3VH8G 3VI3E 1I3GH 1KEML 4CNIB 1YEFH 3B8SA 5F7LB 3GUTB 1KPUB 1WV7T 2MCPH 4V1DD 1GGIH 2XTLA 1JNNL 4G8EA 5TGBA 4RNRB 4DAGH 1OAYH 4XVJH 4YBHA 3CXHK 1CGVA 4OIIL 1UGNA 1S7XB 3OSKA 4F2MA 2DQIH 4XCEB 5DJXB 2BOCA 5C0CE 1OAXL 3G6JA 3JTTB 3P77A 4GAYA 4KFZC 5TQ0L 4OSUL 4R2GC 4AL8H 5IVOA 4JM4H 2EDHA 4BQ9A 4CW1B 3SE3A 1C08A 3C9NA 3JWOC 1LEGA 4JM2D 3GMMA 4YX2L 5CMAB 4QWWC 3IVKB 4JY4B 4C55A 4HK0A 1AGDB 2YPLD 1FORL 2NNAA 1IC4H 4X6FA 3DUSA 4X83A 1QFWM 5J1TC 2D4FA 5JTWA 3X3GH 1A22B 2R23B 1S3KH 1EX0A 3PWJA 1H3PL 4KVNL 2I60L 3BHBA 3VWJD 1NDGB 3BWAA 3RGVD 4JO4L 4B7IA 5C0EB 5E00B 3S97C 2FH8A 5H8DA 1A6ZA 4OZIE 3MXWL 5EG6C 4PYGA 2EEDA 2IGFH 2C3HA 1MIMH 2DL9A 3P0VH 4XBPB 2CLZB 3IKCA 3QXDB 1OCWL 1KGCD 1XEDA 5I15L 5DMIL 5SWQA 5CBEB 5I2IB 4JFFB 3EDDA 5I1EH 4F7PB 1OD7A 3UJTH 2X42A 1FQ9C 1L7IL 2MKLC 5CKGA 2E5EA 5HYSA 3QFDB 5F6HJ 1PKQE 4MJ4A 2WIIB 5DC9B 2I24N 2DKSA 5ITFB 2GSGA 5CJOL 1Z3GH 4DUWA 2Y5EA 3FZUD 5HHOD 5DD6A 3QWRD 1DVFA 2IF7A 2BNUA 4MNGA 2CK2A 5IVXB 4LKCB 5FDWB 5EC1A 1J12A 3CZJA 4MXQC 4HUWB 4YHZH 1CFQB 4WGWB 3VXMB 3GMPB 2H32A 4OF6A 2GJ6A 3TN0B 5IG7A 5CJBA 2NY5L 3O6FA 4UILL 4ZQKA 4CN6A 4P5KB 4K9EH 5ERWA 1DQQA 2V17H 1RUPH 4XMPL 3PXJA 5F9JB 3T0EA 2VIRA 3RVUD 2GUOA 3HE6A 3GJEB 4HXBH 3QO1A 3SDCC 4Q6YA 1AR1C 4YBQD 5L9DH 3WO4B 1IAIL 1IZKA 4ZDHB 4EI5D 1MH5A 4PLJC 2NY5C 2XNAB 4XBEH 3LIZL 1G7PA 2VAAB 3V8OA 1KFAL 4X6CB 2VE6B 4JQXA 2VDNL 5F7YC 1M05A 1VFAB 4P2QE 5FDYA 3GI8H 3WIFB 2PW2B 5EUOA 1JRHL 2F5BL 4KTDH 5CILL 2NXZB 1I4FA 4KKBD 1V7ML 3DARA 4PGEA 2X9WA 1LP9B 3U30C 3U4EB 1WBYB 1EMTL 4JJ5B 4Z7VB 3OKLA 3MRPB 2X4OB 2K7PA 3KJ4C 4AIZB 5JDSA 4WJ5B 3QNZA 3QNYA 1FVDB 2ZNWA 3I85A 5JXEA 5HGDA 2A83A 4UTAH 5JQ6H 4PB0H 3HI5H 4HF5L 1OPGH 3DURA 3BAEL 1I3RB 2AGJH 3ROOA 2ORBL 1N64H 1BAFL 1MFCL 3DSFL 5EBGA 5HGAB 4E41D 2BY1A 3RVVC 1EIBA 2J88L 3CX2A 4PJHF 5DJ0B 5FKPB 1G9ML 1OARL 1QLRB 1XR8A 3MJ7B 4H26A 3O0RH 4DOHB 1HH6A 2QBWA 2EDTA 1TPXC 2J12B 5ISZB 1TJHH 3HFMH 4PJ7F 3L95A 4WO4D 4ZOEA 3VG9C 3WJJC 2D7TH 2VJXA 2D0GA 5HHQB 1ZLSL 4QRPA 5D7IF 4S10A 5SWZE 2CH8A 1IJ9A 4YDVA 4Y2DA 3RUGF 3T4YB 4S1SH 2R2BB 3N9GL 1G9MC 4YXHH 1VACB 3IGAB 4X99B 4PGDA 1SEQL 2R4SL 3MRBB 4U7MA 1A3LL 4OLWH 1YY8B 2PTTB 5C09D 4KI5D 4MJ5B 2FSEB 3HI6L 3QDGB 4P2OD 1FCCA 2DQTL 2BNRD 1HHHB 1ETZA 2P8LA 1JE6A 3LRSA 4RAVA 4K3EL 4FQCH 1NCBL 3MLTB 1WBXB 4ODWB 5HGHA 1AH1A 1BVKB 1F11B 3KPLA 3DVGB 2EYTB 3GO1H 4YH6A 2FX8L 3TH4T 3CGTA 1EJOH 1QVOB 5FB8A 5DRXB 3RBGA 1CLYH 3WFDH 1CICD 4LARH 4RQQB 2ZKHH 5EO9B 1MCSA 1S5HA 1RURL 4JZJA 3OAUH 1KCUH 4A6YA 3CH1B 4EUPB 4IIQB 4KVCL 3MRCA 4LRNH 4K55A 1J0IA 2HFFB 3GBNH 4HPYL 3HMXL 2XTJE 5DYOA 5FCUH 1IEHA 4IDJH 1JPST 5HHPB 4M4PA 2EDLA 3V52H 3UPCA 3LD8C 2B39A 3GRWH 4ZOCA 1A47A 4TYUA 4XGZB 5IGXH 4JRXB 3ROLB 5FGBC 1N4XH 3BPOB 4M61B 3QIWB 2WBJA 2X1QA 1EEZA 1MCLA 4OKVB 4BJLA 5D2LE 3KPNA 3D3VB 1TVBB 4PJAF 1NFDE 4OAWA 5T3ZH 3D9AH 3QCVH 2AABL 2B0SL 4YGAB 4CVXB 1WZ1L 2B5IB 4U6HA 1AE6L 1VGKB 5E8DL 2J8HA 2WWMC 3I2CL 5BS0E 4HG4K 2BVTA 1FSKB 2OL3B 4MDJB 1EAPB 4OD2A 1OF2B 5T1LA 3T4AB 3GSVB 3ZTNL 1GZPB 4UQ3B 1WWCA 4O02L 4PD4J 2FBOJ 5HYJE 3DGGA 1QFHA 1QBLL 2AJUH 4NKDB 4F9PA 4Z8FL 1I8MB 4LQFL 2P24B 2I5YH 1R3JA 4NO0D 2CIKB 4ONHB 3HAEG 3VRIB 5EZIL 2XZAL 2FH6A 4NQVB 3UC0L 4PGCB 1FO0H 1WAAF 3IXTB 3MRMB 1NFIA 3CDGB 2XI9A 2Z9TA 3MQIA 3I6LD 4AEIH 4YPGA 3UO1H 2YC1B 3SCMA 1VKXB 5JUEL 4XXCA 3BEVB 1I7RA 3E3QE 4UQ2A 5GS3A 1ZVSA 4CJ0A 4CU8A 5LGHH 5I18L 1BBDL 4WU7B 4Z5RA 3OAZK 3RAJL 1FZKB 5K9JH 1ND0B 1GOFA 1RZGA 3RIFK 1IM3A 2EDWA 5A2KH 2C3VB 3IU3A 1MI5A 3DV4B 4I8DA 4FMKA 4YNYB 5EOTB 3D69A 1BGXH 1YPZE 4MJ6B 5DJCB 4JRWA 5KS9F 2YWYA 5MI0B 5JPMA 2DMBA 3GHBL 1FDLH 1LHZA 2NY4D 4XVSH 2AK1L 3FQWA 2P4AB 3RVWD 2J3SA 4ODBD 5F3BA 2XACC 3WFCL 4YO0A 3VGGA 4ZSOB 4NNPL 4HHAB 3N1FC 3CFCH 1VFBA 5KSBB 3PHSA 2WQ8A 1BM3L 4ZAKB 4G6ML 4KRLB 5E2TL 4TVSa 4H20L 2F54D 3KPSB 2X7LA 5IKCA 1OD9A 4UI2A 2VQ1A 4NHUA 5MENA 3G9AB 4LQ1A 1YEEH 4LP5A 4UIMB 4ZFFA 4MQXD 4ZODA 3WXVH 1MAMH 1Y18A 4JB9L 1QBAA 3BP4A 5D7SH 3Q6FB 2BVOB 5IQ9A 4DW2L 3G6JE 5D1XB 3IDGB 3CMOH 4B53A 1IBGH 1GGCH 5E8PA 3BN9D 3C6LA 2ICEA 5BZWA 5GGUB 4KHXH 1BOYA 1M4KA 2DL2A 4ZUTB 3I3DA 4YPJA 2KKQA 3AXLA 1JGVH 3O3AA 1A6PA 3OPZH 1LEIA 2H8PA 5FF6A 2BHZA 3AS2A 5GRUL 4ZUUA 4POYA 3IETA 4JM2F 4J3UA 5T1KA 1J1OL 3TT3H 3H9YA 4P23A 5JDJA 2GIYA 1K3ZA 4KRPD 4IDLA 2IPKA 2HVJA 4RFEB 4IOFD 5JLZB 1H5BA 4G80A 4OCYH 4PGBA 4KHTL 1KCSL 4Z7QE 2M2DA 2OM5A 3T65A 4PLKC 2XYCA 3X14B 4HKZA 3DETD 2LU3A 2A77L 2XN9B 4G6AD 4AIXA 3BQUD 4YFLF 3TCLB 1NBZB 2G5BA 5E2WL 2QQLH 3TN0C 4HUKB 4CMMB 4U05A 1T5WB 1SYSA 1KPRA 3SGEH 5E94B 2CKBB 3QXTA 5DO2D 3WEXA 4KTYA 3GNMH 2HT4C 1DTUA 2VLRA 5E6ID 5EZLB 4U0RB 4G8GA 4DZBA 2YA2A 4YC2B 4ODTL 4WY7H 4QHMA 4YLQT 3WKNA 1EFXD 5BJTA 3F7VA 4U6XA 3RDTB 3BUTA 2DD8L 3SDYH 3WSQL 5IHZA 2FB4H 4HX1A 3MUHL 5I66B 4U1KA 4UT9H 4MNGE 1S9VA 1QLEL 2H9GA 1EA9C 2DQUH 3WO4C 4WW1A 2DWDB 3B3IA 4OZIF 3L7FA 4NC0B 4MXVE 5I8EB 4FABH 1F3JA 3VRLE 2BSTA 2DYPD 2ZSVA 3ARQA 2BVQA 1MFAH 3L3GB 2GJ6E 4L4VB 5ABDE 5EIIA 3KR3L 3GIZH 2ERJB 2R0LH 1U3HB 4BA8A 1HYSC 2NXZC 3T2QA 1HXYB 1QA9A 5KTEH 4QHUA 1NEZA 2Q1EA 2ZCLH 3CX5J 3E0GA 1H3XA 4L3EA 1IM9A 4PJ5A 2P5WD 3EO0B 1MVFA 3Q6GH 5IW3A 4JG1L 3A6CH 1ULVA 1NGZA 5D1ZB 3BH8A 1I1FA 4OUUA 5K9KA 5KJRH 1T7ZA 4LASH 4YDJA 3REWA 3OL2A 3STLB 5BRZA 2H32H 3OB8A 4YHIA 3OZ9H 2DI7A 2Z91A 1NUFA 5AYQA 4PJXF 1YN7B 1U42A 5EUOE 4Y5XB 1HCFX 4JY6B 2ZPKH 1B6UA 3K80A 4M1DL 4PJFB 4WFGD 1XCQB 4WI3A 1RJYA 3EOAA 5L7XL 1EVUA 1Q9OA 5C0BA 3P0YH 1JGEB 3ELAT 2IANB 4G7YH 3ZL4L 1SJHA 4NRYA 2D7MA 5DDHB 1B6DA 5EOCJ 3ULSB 1WCQA 4YHOH 4P57B 4ZXBD 4G6FB 1QSEE 1CE1L 4WW2A 3WKMH 1HK6A 2CUMA 3WS6C 4NKMB 2HFEA 4ISVB 5JW4R 3BKCH 4X4ZA 2JIXA 3MROA 3RWCB 2VDLH 4K3DH 3D1MC 2OTPA 1U92A 4U1JB 2X4QA 1Q0YL 1FFPA 1MFBL 5D7JD 2HG5A 1KENH 1PLGH 4PJIB 5TDNA 4ZO7A 1KLGB 2LAAA 1G0YR 5I8CB 4JREB 4JPWH 3QUMA 3VD9A 1X5XA 5J6GB 1FL5A 2IAMB 5CUSH 3VXNA 2IBZY 5ECJE 4FQHB 2FBJL 2VQUA 4JCMA 2P8MA 5FYKD 3CFDB 3KXFA 2ZUUA 2X4PA 1JHTA 1JNHA 4IRZL 4FMFA 4D9LH 4MAYD 4QRPE 2Y07L 3TA3D 1HDMB 1Z9OA 4BKLB 2CDEB 4X6EB 1XIWD 3W0WA 5IQ7L 2WUCH 2VAJA 5JHLH 3OAYH 1NUGA 4J1UA 1CF8H 5C08A 3V6BR 4GW4B 4HH9B 3VU2A 4KK8D 3KHQA 2KQNA 4UIKH 1OTTD 4GRWE 4YFEA 4IIQC 2XXCB 1ADQH 1OB1B 1Q9LB 2WUBL 4NRXA 1Z9SA 1N8ZA 1WIUA 2CDFB 2E7BA 5GS0L 4EI6B 2YD8A 3ZT6A 3VGFA 1G7MA 4DUVA 2OL3L 5EUKA 5IHUH 3BYTA 5BO1H 1RD6A 4PREA 5A2JH 1UVQA 4IM8A 3ZKSD 3G5VA 4YXKH 3M8OH 3O2VL 3PWPB 5FXCH 43C9A 1P7QB 4QY8B 4QHKI 3BPOC 4P5MA 3QIWC 4KGJA 1KB5A 3X13B 4OF3A 4U1GB 4KROD 1I1RA 2VTFA 3JWNC 5DUPH 4TTDD 5KVMC 2Y7QA 4OZFA 3THML 1AD0B 3ZTJH 2QL1A 4UV7H 3ZHLA 4KMQA 2B5IC 4WNQB 3EJZD 5GS0C 2XZCH 4X80H 2KPNA 1WFTA 4G5ZL 1FSKC 3PQYD 2O5XL 1A1MB 3SJVD 5JO5B 2YPVH 1DL7L 2W9EL 1MAKA 1BZ7A 2UV3A 5C0ND 3MNZA 5IVZB 1YYML 1P2CA 4LSSL 4F7EA 3VE0B 4RBPH 2AEQL 4MA1B 3FTGA 8CGTA 4GXVH 4U7SA 1S9WA 3BKJH 3UJIL 5LXGL 3AM8C 4M7JH 4YHNA 5EO0A 2WLYA 2GEEA 1VADB 3QQNA 1OP3H 5JNYA 1F42A 2IPUK 1M1SA 4WHTB 1II4E 1JZ2A 4NNYB 1NCCL 4LNRB 5DRZA 2BRRH 5BVPL 1JGUH 5SWSB 3PNWB 4C83A 2EO9A 3S98A 3DROB 5F7KC 5EFIA 1TZHA 3TNMB 3IJYA 4ZUSA 2EDDA 3PWVA 3QR2A 2C4FT 4Z9KB 3QHFL 1AQDA 4WUUD 3RGHA 3QIBA 2Z93A 4XVTH 4X7CC 4QF1B 3PWLB 5LAXA 1I3VA 4OB5H 3LQAL 3TO2B 3VMOA 4PRAB 1FLRL 2YUVA 3T0DA 4H25B 5D2LF 3NCYS 5MI0C 1NFDF 3B6SA 4XNXH 1JF5A 5T5NF 3U48A 4PLOB 1IT9L 4LCWA 4X7SL 3FCTB 4RIRA 1AKJA 4D9RD 1L6ZA 5ALBL 2QHLA 1MUJA 1TXKA 4LLQA 4Y5YB 1ZA6B 2DIJA 3MCLH 5KVEL 1A9EB 3PP4L 3QNXA 4LVOB 2P7TB 2ADJB 3S37H 1AGFB 1F4YL 4J6RH 4ZAKC 4LPUA 4E9LA 1VCAA 3BGFB 1CYGA 2Q7YB 2Z31D 3HPJA 1O7VA 1MI5E 1VPOL 1ZSDB 4I0PD 1DLFH 3T2NL 3V6FA 4WEUD 3SKOA 1UKTA 5ESAB 2BSRA 1U93B 5D1XC 4RX4A 1FBIH 3GHEL 1I7UB 4PRBB 3U0TA 2X10A 3DRTB 4GW5B 1BQHB 2ZUSA 3UBXG 3RWHB 2DJSA 3IDMA 3QUYB 3O8XA 3OKEA 3UTSB 3MOBH 1GAFL 2JCCB 2GJJA 3WL9B 2QSQA 5CJXC 1L9NA 1IEBB 4LLUA 2GT9A 1WIOA 4PJDA 3CK0H 5GSRA 1RIUH 2BVUA 1IRAY 2BXZA 4ZYKB 1IGCL 2Y5TB 4YWGL 5MENE 5BMFL 3OXSA 2BX5A 4PJCA 3ARGD 5C0AB 1OSPL 2CKBL 3O3DA 1CD8A 1F8TL 5J1AB 2CDGA 3QG7H 5C86A 2YMXL 4RWHA 5JXAH 1K2DA 3DUHA 2EKSA 2OTUA 1RPQA 1EHLL 1OQOA 3I3EA 4KK9D 3WJJA 2VXTL 1BD2D 1RZKL 1YPZF 3FQTB 3CDFA 2JK5A 3B5GA 4W6XB 3FONB 5CBAB 5CD3B 3KVQA 4NBYB 4ONGH 4HPOL 4I2XB 4K3JH 1AGBA 3DPBA 5DHVA 1MHHA 1HEZB 3EYVB 3PIQA 3MLXH 1WZLA 2G2RA 2LU4A 4U0RC 4YC2C 1Q0XH 3MBEA 4M93B 1TVDA 3ESVF 3RDTC 1N59A 1RZKC 2MSPA 3KYAA 3QDJA 4ONFH 1DQJA 1SM3H 1XGPB 2VDKL 3HNTL 1JF1A 3OB0H 2YSSB 1BIIA 5GS1B 2NX5B 4FFZL 3ZE2E 3MV01 1ZE3C 1TZGH 1JN6A 5IMOA 4O2FB 4FQQB 4U1LB 4KJWC 2P49B 4N8VB 2BY2A 5TQ2H 4AG4H 5F7HA 3P73B 3MLWH 4XWOD 3QEHB 2ERJC 4GBXB 3LKRB 5E7FA 3FRUB 2ZNXA 3ZKMC 2VLRE 1U3HC 2QEJA 3N0PB 4GKNA 4G8GE 4POZC 4HC1L 3I6GB 4J3TA 4MQSB 1DBJH 3L6FA 5TE7L 2AQ2A 2R1WA 1S5IH 1G1CA 4NSKA 5KN5B 1AI1L 1U8NB 3RWIA 3FFCB 5HYSG 3BEWA 3MLRH 4DKEH 1A7RL 3QYCA 4OV5B 3CFBB 1EO8H 2M26A 3V4VL 1FAKT 4OLXL 3RA7L 4GAGL 5D1ZC 4DGVH 4Z7QF 4JLRA 2XXMB 2HLFD 4LVHB 3H2WA 4O2CA 3MRHA 1NGWB 2VZOA 4PP2B 1YYLL 5LQBH 4HIJA 4L3AA 4QT5A 5FA3A 1KJ2A 4Y5XC 5FGBA 3VXQB 5F8QC 1UCBL 1A6WL 3MUGA 5GJSH 1G0DA 2DN7A 2FATL 3PP3K 2HTKC 4K3HA 4PG9B 4WFFE 1H3GA 4TVPD 2FO4B 3R4DA 4N0UA 4L3EE 4PJ5E 3HMXA 3TZVB 3MO1A 3LN9A 3O4LA 1P7KA 2VSDA 2GTZA 3KPRB 4XH2A 4MWFB 4RZCB 4TVPH 5IV2B 3ARRA 4X8JA 5L2KD 4X7DC 5I9QB 4MXVF 5BRZE 2VOTA 4PJ8B 4YR6A 3VRLF 4GW1B 4J3OC 5I1JL 4W4NA 2O5YL 4U49A 4QOKA 1MLCB 1MFDL 3PABA 3PL6B 1CDIA 3X12B 3L3HB 1NC4A 3DMMA 3MCKA 4DVRH 2NY0D 4IRSD 1ZT4B 4J8RA 3OX8A 3MOAL 1QG3A 3NA9H 5D5MA 5C0BE 5D7LE 3AC0A 1YJDH 1TVHA 1A4KA 2IAMC 3ISWA 2BJML 1E28B 4PRNB 4HXAH 4OLZL 4DQOL 4MD4A 3HPLB 5F7WC 3FQNB 3U46A 2FCBA 3MGTB 2IPTL 2LTQB 2AJZA 2P8PB 1OGAB 1ZHLA 1BZQK 1Z9LA 5F6HI 3G04B 2WBKA 3QG6B 1JI2A 4LPTA 1A1NA 4U6VL 1H3WM 2E8YA 5DUML 2X4SB 4HIEA 4OZHF 4RNRA 5CIPA 1WWWX 3NH7L 5JORB 2UYLB 3EOTH 5KBNC 4EBQH 3INUL 1LO5B 1MFEL 4OD3H 3RL1A 3C2SA 5DJXA 4ZUWB 4JDVA 5I8OL 2OR9L 3GBMH 2E9WA 3TJEH 5IBTL 5I1AA 1K4DA 4JFDB 3X3FL 3FT3B 1DN0B 1E4XH 3RX7A 4K71B 4URTB 1Q94A 4HT1H 2DQFA 3B2UD 1G7LB 5AD0B 3C5SB 4HJ0D 1NSNH 4WDIB 5KSAB 3KS0H 2NY7L 3S5LB 3R1GH 3W0WE 2HT3C 2O61B 1S7TB 3VFNA 4LAJH 3NN8A 4XXDB 4Z76A 3NAAL 4RMWA 1NDGA 3T2PA 5C08E 5E00A 5DHXB 1SBSL 4KRMB 1CDHA 3ZMRA 4U1GC 3MV9D 3QUMH 3LSOB 3TBSB 3KYKL 1X5KA 3MA7B 3F58H 4KK6C 2XKNA 1B2WH 1A6UL 2O5ZL 2V9TA 3EAKA 5DZOA 5B22A 1J0HA 3QXDA 4K23H 2R29L 2YRPA 3G08B 1CS6A 3UPRB 1NMBH 3FO9B 4KJYB 4F7PA 3AAZA 3G5YB 5E2JA 3QP3A 2A9ML 1FFNB 3Q5OA 3QFDA 3ZTJG 3BT2H 2VDQH 5EH1A 4MA1C 3V0WL 1S9XB 1H8OA 1K3IA 3MLZH 2ICWB 2E6QA 3K2MC 5CFHA 1KEGH 4LPCA 3VFOA 3QHTC 4NO3B 4ZPVA 3QBTB 2FIKB 3QXAB 5IVXA 3BIAX 4GRLB 4MJ2A 4LKCA 3JWOH 4JFYB 5C8JA 1F4HA 1CFQA 3VXMA 1YC8A 1KEMH 4GRWF 3S96B 3W11D 3NIDF 1HINL 4HEME 5ID0B 5IR1B 5CSZA 1JNNH 3GMQB 4HW6A 3FOLB 5DZNA 2X4NB 1UB5B 4OIIH 2EIZA 3PDOB 2QKIB 3GZKA 1X5ZA 1ZVYA 5F9JA 1IQDA 3LY6A 5EU4B 1OAXH 3LKOA 1XAUA 4CN1A 4HS3B 5TQ0H 4OSUH 3ZHKA 4B7LA 5F70A 4TUJB 2RCSL 4XMLL 3WNNA 1LDSA 1ORQA 3CUPA 3S36L 3NFPA 4YX2H 1T89C 5KVFH 5C07B 3EFFA 3HZMA 4ZDHA 4PRPB 2GAZB 4UDTB 4QCIA 1FORH 1MEXL 3LN4A 1U41A 1C5BL 3IJHA 1ZKAA 1UENA 5F7MC 3FOMB 2YHGA 1XZ0B 2MOVA 4I3RL 1KB9K 4Y5YC 1H3PH 4OCSL 2GQHA 4LVOC 4KVNH 3TO4A 2I60H 3WIFA 4MMZC 2PW2A 4HWBL 4JO4H 4HLJA 3BGFC 2AJ3B 3FQXB 5TDOB 4PG2A 3QCTL 1J0JA 3MXWH 5JZ7D 1WT5C 3FN3A 1CTNA 4PS4L 4NBXB 1R5IB 4I9WD 3U4EA 1WBYA 4HWEL 3VFWB 1OCWH 3JTSB 4L4TA 5I15H 4RAUB 3MRPA 5DMIH 2J6EL 1EHXA 3MRFB 1G6RB 5E03A 5E1AA 4OIBA 2WSKA 3QUYC 4LCWE 1J11A 1L7IH 4ZUVB 4C59B 5C2BL 4PLNC 5L6YL 4MMXC 3DHMA 2E27L 1J05B 5I16A 3GB7A 4LOUC 1T22B 5CJOH 5FKPA 1AY1L 2QR0B 3A67H 1HZHH 1CGYA 4PLJD 2BVPB 3MRGB 2FJGB 2HP4A 3DVNB 4RMVA 4QHNB 4H88L 3QUZB 2V2WB 1EFQA 3WS6A 4AQOA 4XPFL 5J1SC 4Z77B 1VSCA 4ETQA 2HJFB 1UFUA 1VENA 2NY5H 2CLRB 1RQ5A 4UILH 3NZHL 2I27N 3H7BA 1M7DB 4PJDE 5F6IB 5FM4A 4OQTA 4XMPH 4YHPB 1OWWA 2V7HA 1R5VA 2EEAA 3P40A 1VACA 2ZZUT 3WNOA 4PJCE 3MRBA 3G6DL 2AK4A 2AERT 3TBWA 3WUWB 3KJ6L 4M93C 1IAIH 5C9KA 3K3QA 2D7OA 2Q20A 5SX5H 4MJ5A 2FSEA 3LIZH 1X4ZA 4FP8L 1ACZA 3OMZA 2DM4A 5GS1C 1KFAH 1T2QL 1HHHA 2VDNH 5KW9L 2DBLL 2DTSA 1V3LA 1KXVC 3C8DA 5JHDA 1NQBA 1J0ZA 4NN6B 1YEGL 1L9MA 1JRHH 3MLTA 3R06B 2F5BH 1IAOA 1TJGL 5CILH 4ODWA 4GBXC 3DVGA 4G42A 2NW2B 1CFTB 2VLJB 1V7MH 1TTUA 1U6AL 4FQXA 2BVEA 2F58L 2ZSWB 3BH9A 4P4KA 3MRRB 2VZ3A 1EMTH 3IXAA 3ARWA 2IG2L 4DFHA 1QOKA 1Q9KB 5C0JB 3QDJE 4EUPA 5C1MB 1E4KA 3MV7D 5CGMA 2FDBP 5EBMB 4HF5H 2F9BT 1D9KA 2RBLA 3ULUL 3BAEH 5ENWB 5HHPA 1T3FB 1OSZB 2ORBH 3KG5A 3U4BL 1BAFH 1MFCH 3DSFH 4GFTB 4LVHC 4MNQD 2J88H 3OJ2C 5IMMB 1HYRC 3V4UL 4JVUA 1G9MH 4OZGB 4XGZA 5ICYB 4JRXA 2Q86B 4M61A 4V1DB 3OKMB 4LSQL 3D3VA 1KSRA 5E9DB 4OFKA 2IH3B 3AY4C 3ARSA 4MB5A 5ESVB 4NM4L 4XMKL 3MA9L 3WHXB 3TZVC 2GY7B 5B38A 3QEQE 3ULUC 1ZLSH 2YPKB 5SWZD 3CPLA 4V2CB 5E2VL 5EZOL 4MDJA 5DUBA 4ZOAA 3W5NA 2ZG3A 5J11B 3GSVA 5I9QC 1GZPA 2I9TA 3N9GH 4PJ8C 3TESA 4K8RC 4F80A 2YPLB 3ZE2F 5TH2B 1I8MA 1SEQH 2R4SH 4NPYB 4OFPA 1A3LH 1B0GB 3PL6C 4NIKB 1C16B 3QRGL 1TJIL 3VRIA 3UTTB 1A6VL 3KPPB 1UG9A 2GKIA 4N0UE 3CZFB 1LK2B 2XRAL 3A6BL 3RGVB 3QFJD 4JZNB 1CE6B 1ERNA 2XQBL 3IXTA 5F1OB 3HI6H 3S3SA 2HWZL 3CDGA 3J8F7 4J4PC 3O4LE 1T6WA 2DQTH 4GUPB 2YC1A 2LTQC 1ZA3A 2AJVL 5FV2A 5F3HA 1V7NL 4K3EH 1JTTA 4XTRD 4WWKB 2Z35B 1NCBH 4P99A 4PJEA 1XF5B 4WU7A 1NEZG 3E1F1 1I85C 2V5MA 1JCKA 4LLWA 4N1HB 1ND0A 2FX8H 4F3FA 4P4RA 4QOKE 1AC6A 3ZDXF 3TC9A 3B83A 3T3PE 2WWMD 1H15B 1RURH 1T21B 5EOTA 1DBBL 4FFYL 3PHQB 5D5ME 3RVTD 3SDXF 2CLVB 1ZHBB 4IBLT 4MJ6A 5DJCA 3OXRA 2DDQL 4KVCH 3D0LA 1RZ8B 5J4MA 3KLAB 4W4OA 5HHOB 4HPYH 2D31B 3HMXH 5FUOL 4U2ZA 4C56D 3KWWB 1RSFA 4K71C 3U1SL 4PV8B 3VI4E 1AGEB 2C1OA 1HNFA 4U1HB 1ZGLP 1SJEB 3BJ91 3WFEH 1WBZA 2XFXB 1F3DH 5KSAC 5KSBA 3EKCA 2CQVA 4XHJD 4D2NA 2CJUH 3WXWL 3GJFK 3NCJL 4ZFOB 5DA0B 3MFFA 1EERB 4UIMA 1U8OA 3C5JB 2AABH 2B0SH 3MGOB 2E6PA 5IIEB 5D1XA 2EYRB 1WZ1H 3V5DB 3CSBA 3IDGA 1NCWL 1AE6H 5E8DH 5AUMB 3I2CH 2UWEB 5AZ2L 4V2BA 4TNVK 4ERSL 3ZTNH 5HXMA 3FB8A 1JTOA 5HYJD 3U7AA 2F53D 4O02H 4EI5B 1MREL 1MCDA 1QBLH 3L3OA 5C0DA 3TBTA 4Z8FH 1D5MB 4LQFH 2F8OA 3BISA 2GY5A 3GSUB 4N0FA 1SY6L 1HHIA 4L3CB 5EZIH 2XZAH 2DQEL 3UJJL 3UC0H 4K7FB 3NCBB 1MJJB 1P4IL 1XGRB 4ODUA 3DX9B 4GRLC 3FN0L 5JUEH 1XF3B 5FO8B 3QQ9C 3HZYA 4PJBB 1TCRB 5I18H 1NBZA 1Z0NA 1WTGT 4LRIC 4QRTB 1BBDH 1F97A 1X5LA 3RAJH 2AXHA 5T1DL 4GKZB 5GGRA 5J89A 1ZMYA 5T5FL 4RWYL 2CKBA 4WTZG 1CT8A 4UOW1 1CDCA 4QHLB 1YQ2A 4JZOB 5EZLA 1WLHA 2EE9A 3IAQA 5ICXB 5JIPA 2F5AL 4E41B 4GKOA 3CXDL 3RDTA 3ILPA 2C1PB 1JTPA 2DI9A 3GHBH 4WV1B 4DKAA 4W6YB 5I66A 3A0OA 5IVXE 1MY5A 5IBUB 2AK1H 4JN1L 3NZ8B 2EZ0D 2VUOA 3WFCH 2W65A 2EXWC 3Q2CA 3VXME 2HT2C 2XIDA 1FL6A 4CRPA 1G6RL 2YKLL 3QXUA 4WO4B 1CDGA 1BM3H 4NFDA 4G6MH 2DLGA 5E2TH 4H20H 2PF6A 3DYOA 4XPTL 5DFVC 5JOPE 1GRWA 5HJ3B 2PXYA 1T0PB 6CGTA 4JB9H 4YDIL 3TVMD 2ATPA 2AKRB 4WHYG 4DW2H 4PLKD 4Y8AA 1M6OA 3AFLA 4R0LA 2RJMA 1R0AL 1G9NL 4RGNE 1IAKB 4H5SB 3TN0D 2A2QT 1D5ZB 3EO0A 3SO3B 1MLBB 1YY9D 4R4FL 1W0YT 4JPVL 2C3GA 5D1ZA 4U1MA 3B2VL 3OKOB 5D1QA 1NGQL 3VXRA 1P4BL 1EPFA 1X5IA 1CI5A 4PRHA 3STLA 3V5KA 5HHME 5GRUH 3ZKNC 1WFNA 1J1OH 5H35B 1OTSC 1QRND 1RAMA 4G9FA 1MCPL 5D2NB 2VN4A 3MJ9L 1XCQA 1G9NC 3MYJB 1A14L 3E6FB 1S78C 1GGUA 2DQCH 4L8CB 4QNPE 1S7QB 3CFIC 4RA3A 3RL2B 4KHTH 3KPQB 1KCSH 1K8DB 1A8JH 3B4NA 1F13A 5DDHA 1HXMB 2A77H 1AD9B 1S9YB 3QUZC 1CICB 1X6NA 3I02B 1ZHKA 1ZWIB 5E2WH 3GSNB 1EHAA 1LO4L 1MIEH 4NP4L 1LQSR 5I6XB 1DQTA 1BQLL 2YOCA 3D2UB 2A6KB 1T04B 4JFQA 4OLYH 1FFOB 5F6IC 1QLFB 1UB6B 4ODTH 4P49A 4NRZA 3UX9B 2CIIA 4F8TA 2DKUA 5I8CA 3LDBB 2DD8H 3WSQH 4DOHE 3HKFA 2RGSA 3P30L 1UM6L 1QLEH 5HHVL 1ZLWH 3BIKB 2YR3A 1QEWB 3S34L 5ACLA 5F1IB 5ISZE 1I8LC 2Q8BL 1AP2B 5CGTA 4OJFL 2E7MA 4X6DA 1KBGL 4OD1L 2IBZX 3KR3H 2ICWJ 4LPYA 4X0KA 2N4IA 2X1OA 3SO5A 4NN6C 4XCNB 1XR9A 5C0FB 3T0ED 3NFSL 4LLAA 3HE6D 4HIHA 2W0FB 1OGTB 3VD3A 4JFZL 4MSWB 3O81A 4GW4A 2AK4E 4ELMB 4HH9A 4GQPH 3I3BA 3DX8B 1OLZA 2P43B 1ZGLB 5E5RB 4O51A 5FM8A 3GMRB 3QIUA 1HWGB 4JG1H 4OGAC 3QXVA 4X9FA 4KK5D 4G9DB 1D3CA 4HWUA 2COQA 4GJTB 4HJJH 4KKNA 5A3ID 4BK5A 3LEYL 4S1DD 3KPMB 4KRNA 3UZVB 2PCPB 3U82B 1D5XA 3MV11 5EBWA 4PBVC 4S0TD 3B9KB 3MLVL 4M1DH 1QR1A 2BRQA 1CWVA 3PWPA 1A7OL 4X5WA 3RQ3A 5L7XH 1QFPA 3B9AA 2VO5A 1A64A 4RMQA 4I5BB 3QDGD 1WSST 1CLOL 3ZL4H 1RVFL 5IBLC 3GSXB 4DVBA 1CE1H 4QKXB 3WO3B 4N90E 4P3DB 1PJ9A 4XNQA 5I1LB 3SE9L 2FLBT 4FZ8L 4M8QA 4UV4L 4NQDA 4Y5VA 1WCBB 5JO5A 5J11C 1Q0YH 1YMHB 2NY4B 32C2B 3IS1X 1MFBH 5BXFB 5DF0A 1KNOB 3VFSB 1IGJA 4UNTA 5IVZA 2NY1D 4HWZB 5DRWA 3QUKB 2B1AL 1F00I 1MCCA 1T2XA 4JRXE 1U3YA 4KDTC 3GSOB 2P5EA 4HBQA 1CZ8L 5FYKU 1MCEA 4GAFB 3D3VE 3R0NA 2F54B 3IFLL 3NCMA 2VZUA 2BOBB 2FBJH 3HG1A 2FX9L 1CXLA 2Q76B 4KJPD 4J3WA 2FHCA 2PW1B 3RGVC 2GJZB 4NNYA 5B39A 1FVEA 4LNRA 3Q0HA 4IRZH 4KDWA 4EUPH 1U8MB 5L8JB 2Y07H 3PV6A 3ARFD 4Y2DD 2N7BA 3U2SA 3DROA 3TNMA 2B20A 1LGVA 1DQDL 4WWKC 5IQ7H 2PTVA 4CJ1A 1SQ2N 4R90L 1ED3A 2BNQA 3TIDB 1TETL 1CD0A 2V17L 5CP3A 5HI3D 5IFJA 7FABL 2ZUVA 4H25A 1Q72L 2YS4A 2JJVA 1S7RA 1HHGB 3FZUC 2ZCHH 3H9SA 4OFYA 5EU6B 3SHSA 1FGVL 2AXFB 4LBEB 4UINL 5GS0H 3FCTA 1WIPA 1P9MA 3BKML 2OL3H 2A6IB 2DLHA 2VSCA 2IEPA 4PJEE 1F2XK 1I8KA 2P7TA 2ADJA 1DE4A 1KTDB 3GDBA 3O2VH 1NGYA 1LE9B 4CU6A 4PTUA 1J87A 1JNJA 4QXGL 4ELKB 4ENEC 3BP5B 4JRYD 4NCC2 5DQ9B 4XAKD 3THMH 2WMPA 4XNYL 1BFVL 1EGJL 3ZHDA 5HVWA 3P9LA 1DUYB 2ESVA 2FJHB 4QXTA 4GW5A 4G5ZH 1EFXB 2O5XH 3QUYA 5F8RC 2JCCA 3QEUB 3WL9A 4LSRL 5LGJA 3UP1A 4YBQC 15C8L 1DL7H 3H3KA 2W9EH 2LAGB 4XCFL 3L3IB 1IEAA 4XCCL 4EI5C 3Q5YA 5GRWA 1YYMH 3V7MA 4LSSH 5KSBE 5F7FA 4LVNB 2AEQH 2FWOA 2DYPB 3OKKB 5GGVH 1PD6A 3RHWK 3C60A 3W39B 1Y0LA 2WBJD 2PYEA 3MX0A 3KPSE 2JF1A 5LXGH 5GRVL 3UJIH 5I1KL 1KCKA 2MNUA 1CDJA 1I1AB 1YEKH 1HOCA 4IOSD 5TE6L 3TNNB 1T20A 1I7ZA 1KLUB 1NCCH 5IROA 1EBPA 2AJXL 5BVPH 5HPMA 3T3PF 5FGCB 5D5MF 3FQTA 4MQ7A 3FONA 2P5WB 1TLKA 2VXSL 5CBAA 3RZWA 1RIHL 3MV8A 3QHFH 1SEBA 1CD1B 2VLLA 4I0CC 2V2XB 4ORGB 1FYTB 1DQML 5HDBE 4I2XA 1YZZA 2UZIL 2Z8VC 3TYGL 4NO2B 1MVUB 3FQUB 3MCG1 4D8PB 4M9OA 3FRPA 1QBML 1IGIL 5GGTA 3LEVL 1NL0L 4M5ZL 1JK8A 2Y06L 3QPXL 4P0DA 4Q6IA 1RHHB 1VFMA 4D9QE 1FLRH 3C6SA 3VA6A 4NNXB 2VXUL 3HS0B 4LLDA 3GK8L 4WV1C 3SCMD 1IT9H 1XGPA 4LLVA 4BSJA 4X7SH 2Q87A 2YSSA 5JOEA 3K8MA 5ALBH 2FZ3B 4POUB 4F57L 4HMCA 5KVEH 3PP4H 4ZXBB 1MY7A 4WO4C 4O2FA 3FJTA 1F4YH 1JZ4A 3DTXB 3QEHA 4I3SL 1FNHA 1VEMA 3WNKA 1VPOH 1DFBL 1K8IB 3I6GA 4M7ZB 4Y1AA 1KYOK 5D7JB 3BP7B 4LSPL 4LCCB 5KSUB 3GHEH 1KV3A 2R1YA 4KWUA 3O3BA 3OAUL 3L5XL 4NN5B 1GAFH 2FO1A 3SO3C 5I8KL 1WUNT 4LK4A 3GMNA 2YUXA 1A3QA 5T1MB 5EA0L 3NIGE 4KI5C 5IW6A 3GSNL 1NAMB 5MEND 1AJ7L 1BVLB 4PP2A 4MAYB 4X4YB 1IGCH 3ARDD 2AEPH 4YWGH 5BMFH 1IQWL 4HUNB 1OSPH 1A7PL 2CKBH 1F8TH 2OTWA 1LILA 5MEQB 1NGXB 1XIWB 5D2NC 3K1KC 2YZ8A 3F7YB 3RKPA 1UM4L 2HVKA 2YMXH 5DEGB 4AENA 3MOQA 1RUQL 5LBSL 1EHLH 4LSTL 4BQBA 2CR3A 2VITA 3P9MA 5DK2A 3R8QA 3TZVA 4L4VD 2VXTH 4BSWA 1RZKH 3U83A 4OGXL 3QQ3B 5MEOB 1CICC 5TDPB 3HB3C 3TIEA 5JPNA 4G43B 4NGHL 1NC2B 3F12A 5IVXF 4HPOH 2EDXA 4POZD 2BSSB 3HZKA 5I6XC 2G75B 4D0CB 4FTVA 1KELL 4NQCB 1E27A 5JW4M 5I17A 4OM0L 3VWKB 5CWSA 1KIPB 3L3HA 1WK0A 1UZ8B 1CDBA 3P4MB 3LDBC 3CSYB 3GSQB 1U8JB 4M9PA 5TF1L 2VDKH 2IANE 1DDHB 1E28A 3HNTH 4PRNA 3F5WB 4J4PA 1XGUB 5C6WH 2HJKB 3MGTA 4YAQB 4FFZH 4Z0XB 2E9JA 4AEIL 2HFGL 5J8OA 1UC6A 2GK0A 3CFJB 3QG6A 3BW9A 4LCIL 2EH7L 1MRCL 3VDAA 2HTKD 4LCUA 5KG9B 2X4SA 3PQYB 4HS8L 3BZ4B 5DSCA 4LMQE 3V0VA 5JORA 1RJZB 4LGPB 4X6CF 4HC1H 1KJMB 4JFED 1ONQA 1Z6JT 2HYMA 3FO1B 5TE7H 3SDDA 1Q9WB 3H9HB 1AI1H 3KYNA 3ARBB 1REIA 4RFOL 1A7RH 4AT6A 2FECI 4NQEB 4ODSL 5CEYB 3MREB 1UWXH 1LP9F 4OLXH 3RA7H 1P6AB 4GAGH 3WFHB 1G7LA 1NCNA 4X6DE 4Z7VF 3V6OC 5T3XD 1AO7A 4G8IA 1YYLH 3EYQD 2NLJB 1J86A 1BECA 3B9KC 2VLKA 1UCBH 1A6WH 2IAMD 1W72A 5KZCB 2FATH 1O5DT 4HGWB 4R4BB 2IADB 1BFTA 1QACA 4WUUB 4LMQI 4NDMB 2H2PD 2VISA 3NGBB 4LSVL 3VFMB 1GZQA 4LF3B 3SDAB 3E2HB 4L9LB 3VGEA 3CSPA 1OP5H 2ITDA 3G5YA 3QDMD 4PJHA 2A73B 4HEPG 4UOW0 5I1JH 3WS3A 2NY4C 2O5YH 2W9LA 1IILE 2PYFA 3OR6B 3RVWC 1MFDH 2JJTA 3PWPE 1S9XA 1U95B 1T5XB 2ICWA 3TPUA 3MOAH 5FHAL 1YNTB 4PJ7A 4KUCF 1JUFB 1CVRA 4S1RL 2BJMH 4Z7OE 4DQOH 4I1NB 4OLZH 2Z31B 3HE7B 3S8WA 3QXAA 5D7IA 4MQXC 4GRLA 2FEEL 4I0PB 2IPTH 4JFYA 2R69L 1G7IA 4HS6B 2HT3D 2JIXD 3RUGA 3VCLB 4U6VH 2XY2A 2D9QB 5J7CC 1R3HA 4NQDE 3O3EB 5EPMB 4EQ2A 5JA8B 1P7QD 5DUMH 2X4RA 3GMQA 4WENB 3NH7H 1ZT7B 3BN9C 3QJFA 1UB5A 3BO8A 3INUH 3PDOA 1MFEH 5IEHB 3BXNB 4EUPG 2Z92B 4HK3J 4JFHD 5EU4A 5FHBL 2R4RL 1DBKL 2PO6B 3S6CA 2OR9H 5I8OH 5INDB 3G5XB 1FIGL 3EOYG 4TUJA 5IBTH 3QQ4A 3X3FH 3HG1E 4BELD 3ARGB 3UDWC 2NTFB 3KXFD 2ATKB 2JB5L 2UZYB 5SWSE 1UWGL 3U79A 5IFHL 4TN9A 4IOFC 4PGJA 1IGYA 4XT1C 2MQCA 2W60B 2EXYD 2NY7H 1XZ0A 3NFNB 4KJQC 3AU1A 3DUUA 1CGSL 3MNWB 3DETC 3STZA 3NAAH 1EEYB 5C3LD 5A40E 1RK0B 4Z7WB 5B38G 1SBSH 2W07A 5T33L 1RUAL 3KYKH 5DO2C 3SKNB 4CMHB 2E7CA 4BFIB 4F7MB 1BF8A 2BFVL 5E7BA 1U8PB 2O26U 3UTZA 4H8WL 1A6UH 2O5ZH 3IFNL 3H9SE 2X6MA 5K9OB 3QJHB 4M48L 4GQ9L 4C54A 4HUXA 3IU4L 5K59E 2A9MH 2QHRL 1A4JA 4D0BB 1TCMA 1YMMA 3TJHD 3V95A 4LVNC 2A6DB 2HKHL 4KGLA 3V0WH 4PJAA 5DHYB 1N0LA 3TWCL 4JFXB 3PDGA 4HFWA 3TT1L 3ZE0E 5IB3B 2DWEA 2VXVL 4H8WC 4P2RD 5CP3H 1JPSL 1G7QA 3OV6A 1I1AC 4LSUL 2FJGA 1HQRA 5ACMA 2XPGB 2W1NA 4QHNA 1MJ8H 3QUZA 1NANH 4G7YL 2ESVE 5E6YA 2V2WA 4WUKL 5AAWA 4WRLA 1U8HB 4ZG1A 4Z77A 1TNNA 2JCCE 1HINH 3F7PC 1XCTB 5FKAB 4PRID 3LQZA 5E8EB 1CN4A 3NVQA 5F7NC 1M7DA 5I73B 4JY5L 3MJ9A 3TM6A 3FT4A 3QDAA 3V5HB 4XHQA 2PYEE 1L0QA 1FNGA 1PDKA 3I75A 1WAAA 3PJSA 4P46A 2RCSH 4XMLH 5HI5C 4MJIA 2R0ZL 3S36H 3ZSTA 4Y4FB 3WUWA 2R0KL 1QP1A 4TTGA 1EHNA 4PPTA 1YEDB 1MEXH 1LO3L 3EYSL 1C5BH 4AMKL 1X4YA 3MJ6A 4LOUD 3BMWA 4I3RH 5I76A 2B2XL 3MV8E 3MACL 1NAKL 2EC9U 2J7LA 4OCSH 4ZXBC 5C0AD 1XGQA 4GO6B 1KIRB 4I2XE 4KKCD 4MA7L 4HWBH 1CIUA 2EKJA 5L2KB 5FYKL 4MHHI 3QCTH 2NW2A 4KY1L 3D25B 3DXAD 2VLJA 5KSBF 1NAML 4PS4H 1YN6B 5C0IA 4M7ZC 2V9QA 5D7JC 4HWEH 4M1CC 1W0VA 1NCAL 1XH3A 4LCCC 3ECBA 4MCZB 4H0GA 4XC3L 2J6EH 1Q9KA 5I30L 2H26B 3B5TA 5C0JA 4IRSB 1TITA 1U8QA 3PWUB 3OGOE 2ZG2A 4NN5C 5IEKB 2ADIB 3UPAA 1H3UA 5EN2B 5F89B 1T2JA 3GJFB 4HMDA 1ZANL 3LPGA 5C2BH 5L6YH 1T3FA 2H41A 4TUOA 2JB6A 1ES0A 3SKUD 2E27H 3EYOA 2IH1B 1MHEB 4MAYC 1QPPA 4OZGA 1AY1H 4HMEA 1AXSB 4V1DA 3MRIB 4Y1AE 1XIWC 4RX4D 3VD7A 1QBBA 2X09A 2QQQA 4M3JA 2NX5D 4H88H 1HILA 2IH3A 5FUZH 3O8XD 2YBRB 4MD0A 4XPFH 1A6TA 1AHWA 3EW3B 4HJGA 1TFHA 4MX7B 5JW5A 4A2MA 2WV3A 3NZHH 4Y19B 3LPWA 1OTTC 3E8UL 4JM2A 3HAEB 1R5WA 4NQSB 1P5VA 2OQJB 3SOBH 4PTTB 2B1HH 2LABA 3LEXB 3UTQA 4O5LL 3B9VA 3G6DH 1EUTA 5DRNB 3VWKC 4W70A 5TF0A 4NWUH 3BKJL 3KJ6H 2E7LC 4CDHA 3VWJA 4ZO6A 1ZS8B 3RGVA 4FP8H 3ULUE 3VFTA 2ZCKH 3ZYOA 1T2QH 3MV9B 5KW9H 1JGUL 4GUPA 2SEBA 2DBLH 4TTDC 5DJ2B 1YEGH 5EDXA 2Z35A 2CGRL 3EJZC 1I8IA 1TJGH 1XF5A 3KNBA 3MRQA 4Q9BA 5DJZB 5B4MD 3OB0K 3T0BA 2I9LB 4XZUB 1BWMA 5I75B 1HQ4B 4FTVE 1C12B 1U6AH 1QFWI 4MA3A 2F58H 3NIGF 1F90L 2BZDA 5F9DC 3MBED 5ETUB 2V5RA 3ARVA 5C0NC 4OZIA 1H15A 2A6JA 4KKLC 1G6VK 2IG2H 3QDJD 4CVZB 1QTYT 2C3WA 3ARBC 3HNVL 5E24E 3U0PA 1RZ8A 5HHOA 2D31A 4PJ8D 4K8RD 3QWRA 1SVZA 3ULUH 4PV8A 2YEZB 3UYRL 1U8LB 5F97E 3U4BH 4U1HA 3JV6B 5E0QA 4D94A 3BP6B 1RUKL 2GK2A 5E5MB 3V4UH 4LLYA 4K8RH 3QISA 4QGTA 3FMGL 4M7KL 5CEZD 4NHCL 4HKXB 4LSQH 1CFNB 4ESKA 2I07B 3BOVA 2VWEC 2GCYB 4IHOB 4NM4H 2UVEA 4XMKH 1OGAD 3MA9H 5D9SB 1IC7L 4RA0C 4OCRL 5SX4H 3QI9D 5AUMA 3NGBC 1X5GA 5E2VH 5EZOH 4TSBL 3SDAC 3BSZL 5CINL 4RRPA 4PR5B 1I1YA 1CCZA 3E2HC 4WFEE 4L9LC 3T8XA 4PJXA 4K2UL 3BN3B 1AO7E 2EDNA 4EI5A 4P5TB 1DUZA 4XCYA 5J9PB 3RRQA 1U8KB 4Q2ZB 2H2SD 2KZ1B 2VLKE 5D6DC 2D0FA 1V3JA 3CCHB 2LVEA 2IMNA 4GRMA 4HCRL 3C5ZB 3ULVD 3QRGH 3ES6A 1TJIH 4JFDD 4M7LL 4U0QB 3P4NB 4RAHA 3VRJB 4NO5B 1A6VH 3UTPE 5JOFA 4N68A 3C08L 4PJIF 2XRAH 3A6BH 5CHNB 1J8HD 4K7FA 4HBCL 1AQKL 1MJJA 2XQBH 5AWNL 25C8L 2HWZH 3VGAB 2Q6WA 2Z31C 3HE7C 2FJFB 4I0PC 3FKUS 4GG8A 2AJVH 3S4SB 1IGTB 4LDLB 4MD5A 5FO8A 1V7NH 3KYMB 1IC1A 1DZBA 1MCOL 2B4CL 1QPXA 1E4JA 3PGDA 2FX7L 4O9HL 4F8QA 4HV8A 4PJHE 1A9BB 3LMJL 1NC4D 2BSED 1S7WB 4QHLA 4GLRH 4JZOA 4XI5C 1PKQB 1S7SB 2X4UB 3T1FA 1DBBH 4FFYH 2PO6C 2AI0L 4PJ7E 2DDQH 1JV5B 5CP7B 1B0RB 3EO1B 3KLDA 2C1PA 4WV1A 3CVHB 5D7IE 5FUOH 3ARGC 3U1SH 3NZ8A 4BZYA 2B4CC 2YXMA 3RUGE 2MHAB 1X44A 2HMID 1GH7A 3VW3L 1CL7I 5D72L 2FNBA 3MRNB 1LD9A 4KK9C 3WE6A 3WXWH 5DQJA 1FZJB 1CG9B 3HR6A 3D0VA 3NCJH 5HJ3A 1TMCB 1X7QB 1RJLB 2AKRA 4NOBA 3ZDZF 1MOEA 3H3PL 1RV6X 4NKOB 1DBJL 1LDPL 1NCWH 4JQIL 4CMHC 1F4AA 2D03L 4N9OB 5AZ2H 4H5SA 1M71B 4ACPA 2YWZA 4ERSH 5C07E 4E0RB 2C3XA 4LFHG 4PRPE 2Q8AL 4EIGB 1GOHA 4IRJB 4BQ6A 5F88A 2E6JA 3MTRA 3OKOA 1IMHC 1OAUH 1MREH 5C09A 3IKKA 3HLAB 3GSWA 1RZFL 3UZEA 4S0SD 4YEEA 2R1XB 4P2OA 4JFPA 5HHNA 4AM0B 4ZMAT 3BFOA 2BNRA 4R7DA 5DQDL 12E8L 3HR5A 5IM7A 1EV2E 1SY6H 3GSRB 5B39G 3WLBB 4PV9A 1KPVA 2DM3A 3C2AL 2DQEH 3UJJH 4BK4A 1BX2B 3MYJA 4XP4L 4D0DB 3PGCB 4XWOC 4R97B 1P4IH 3KPOA 2HT2D 3KPQA 3LKPA 4CDGC 3FN0H 1HHJA 2CXKA 5H2BA 3IDNB 1CICA 5J56B 2EYSB 3I02A 5DFVD 3S7GA 4EN3B 3ILQD 3QDHA 5T1DH 2V5TA 1RMFL 4IS6A 4R7NA 3MV7B 1N5AB 4RWYH 5DI8A 2GITB 2DQGL 2A6KA 1YMME 5I73C 3DGCR 5ILTL 4PJAE 1FNSL 1QLFA 3LN5B 5A16A 2HH0L 4TULL 4CBPA 2F5AH 2HLFC 2HRPL 1OT1A 2BXYA 4MNQB 5JW3H 1UXWB 3CXDH 1WGOA 4LEXL 4OCWL 3K8LA 3NACL 4LVEA 1GGTA 1HHKA 2WP3T 5C0GB 5KOVC 4JN1H 1FNEB 4Y4FC 3F8UB 5CZKA 5F1IA 1S8DB 3JZ7A 2VZVA 1UQSB 2BMKA 4WFHE 1AXIB 1G6RH 2YKLH 1R3KA 3QULA 1OTSD 5EU3B 1MCRA 4XPHL 4XPTH 1G9EA 3SE8L 1S78D 5SWZB 4XCNA 4YDLB 5K59F 4YDIH 5E8OA 4EVNB 2MMXA 3RTQB 2JJWA 3FQRB 3HRPA 4U1IB 1R0AH 1ORSB 4RGND 1FCGA 1NFDA 1G9NH 4XVUC 4MJIE 1FO0A 4MHHG 1RHFA 4NO0A 3O45A 3BRDA 3WHE1 4R4FH 4JPVH 4G9DA 5C6PB 4IRSC 4UU9B 3B2VH 1NGQH 1P4BH 3V6OA 1D6EA 2IFFL 3SGJC 3TO4D 4DZ8A 2HJLB 5IB2B 2JCCF 5LKNA 3MRDB 4HUUB 1MCPH 3HCVB 1NCDL 3BE1L 3M1BB 5GZOD 3MJ9H 3RNQB 1G7JA 2VL5B 1A14H 1HSAA 2VLJE 3VJ6B 4M6AA 5MP6L 2YN3A 3UEZA 3PHOA 1E6JL 4I5BA 4L4TD 1NLDL 3SGKC 4KKAD 1JYXA 1CR9L 1K4CA 4P3DA 2ARJQ 1LO4H 4NP4H 3FRPG 3GGWB 3MRJA 3OAZH 2IQAB 1BQLH 1NMBL 4FOMA 5IW1B 2WQRA 1WCBA 2MFNA 3FB7A 1T0NA 4C56B 2DICA 5BXFA 5DJYA 5TE4L 3UZQA 4JHZA 5IB5B 4HJ0C 1E4WL 1NUNB 4OZGE 4FZEL 3BD5A 4Y4HA 3RWDA 4V1DE 2HLAA 3P30H 5DJDA 1UM6H 3BVNB 3TYFB 2F54A 2WM0A 5D2LB 5FECB 5CJQL 3S34H 5DC0A 2Q8BH 2Q76A 1F2QA 4TNWF 2X9XA 4BH7B 4OJFH 2NW3B 3SGDH 5BQ7A 3RPKA 3LS4L 2ADGA 2ITCB 5FM5M 3TV3L 1FE8L 3NBNA 1KBGH 4OD1H 4R26L 1BPVA 4PD4K 2RR3A 1UCTA 1JZ6A 1MCIA 2C7UA 5ID1B 4BSVB 3NFSH 3OGCA 2VL4A 4APQD 2YPLE 5HYJB 1U3ZA 2F53B 5I75C 5E9DD 4JFZH 5IBLD 4Y4KB 1CFSB 4K7PL 4HDIB 1T83C 4LU5L 4PFEA 4LHUD 43CAA 2HN7B 2VNCA 5BZDA 4F9LA 3QH3A 2XWBA 3RZCD 5KVFL 1I7TB 1ZVHA 3LEYH 2AXFA 4LBEA 5JHDD 3L7EA 4X6BA 3OG6B 4YE4H 1Y6MR 1BREA 2F8VA 4Q7DA 3MLVH 4K7PY 2W0PA 3BQUA 3OF6D 1A7OH 4OLVL 3UTTD 3W11C 4R4ND 1AC0A 2EH8L 1YDPB 2R2EB 3BP5A 5DQ9A 1CLOH 2X9YA 1RVFH 2KUTA 3GMLA 3IDJB 1F4XL 3ZYJA 1FZMA 5E6IA 5GGSB 1P1ZA 1DUYA 4WWKD 5I1HL 4NYLB 5HHOE 1D9KD 3SE9H 4DK3A 1EFXA 4FZ8H 4UV4H 5J3HC 4I4WB 1DR9A 2HA1A 4YFLI 3ULUF 2FGWL 2VXQL 4P5TC 2B1AH 3OKKA 5E4IA 3DSNA 3HC4L 5F1SA 1EZVY 4HIIA 5DMGD 5TGBB 1CZ8H 3C5ZC 4U7KA 3IFLH 1UKQA 4F2MB 4YGVA 1DP0A 2FX9H 3A67L 1HZHL 4KXZH 1QZ1A 3TVMB 3G6JB 4GAYB 3P77B 5EZJB 3ET9F 3U6RA 1WICA 3VGAC 5JZ7C 1C08B 3C9NB 4UT7L 5H94A 1LEGB 3GMMB 2WIMA 3CVHL 3BPCA 3RFZC 4PJXE 1BLNA 1DQDH 2P5WA 3D39D 4MZ3A 4HK0B 5M7QA 3A6OA 2NNAB 4ENED 4R90H 4X6FB 5KSVA 4DGIL 4OCXL 1W0WB 4ZNEA 3RWEA 4D8PA 1MVUA 1TETH 4RDQG 4OQ1A 3HUJB 5FFLA 2V2TB 1SHMA 1P6FA 7FABH 2ZP0T 3BHBB 3QXWA 3BWAB 3LAFA 2WANA 3KS0J 1QRNB 4HSQA 4NNXA 1G84A 1A6ZB 1Q72H 3HS0A 1BFOB 1FGVH 3S5LG 5ANMB 4UINH 5F44A 3IKCB 1QO3B 3BKMH 1T1WA 4RDQF 4PJBE 3I9GL 4OZHA 3MZGB 1TDQA 1YNKL 5SWQB 1VA9A 1VDGA 2Z4QA 5LCVL 1UWEL 3DTXA 2XICA 1B9ZA 2OXGA 1HE7A 3ALXA 1TZIB 4QXGH 3WV0A 4L9DA 3JV0A 4JPIB 3EDFA 1MHCB 3ME0A 1K8IA 1D7FA