4LKXA

Humanized antibody 4b12 fab complexed with a cemx segment
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
214
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGYSITSDYAWNWIRQPPGKGLEWIGSISYSGITGYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCARMGYDGLAYWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two potential therapeutic antibodies bind to a peptide segment of membrane-bound IgE in different conformations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab fragment heavy chain
total genus 45
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lkxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lkxA01
3PWVA 2JIXD 1OP9A 1QTYT 4LLUA 4Z7QE 2IQ9L 3V6FA 1N8ZA 3S3SA 4EOWH 4WI9A 4LDEB 2CKBB 1CF8H 4ZO9A 4P3CL 4WNQB 2BDNL 4HIHA 4U6HB 3FCTB 3VRIA 1HINH 4OLUL 2W59A 5L2JA 4NO0D 5DMGC 3MRMB 1NFKA 4M02A 2R69H 5T1DL 4DGVH 3GMNA 1AIFA 4LDLB 2X4PA 1EEYA 3EGSA 2AJUL 4FQIL 1MVUA 5C08D 1WWCA 3KLAB 5J0BA 2EO1A 1MCSA 3IF1A 4B5EA 2EE6A 4J3UA 1OAZL 4RNRA 4LARL 3V4UL 1FL6B 1MHPL 1A4JB 4N0YH 4BH8A 2NPLX 1CE6A 1L9NA 3RWIB 5C92A 1MI5D 2VDNH 3DVNB 2VXUL 3C5SA 2FX9H 3L3HA 2DJUA 4JE4B 4JHBA 4LCUA 4WHDA 4H25A 5DFTA 4J3OC 3SOBH 1BX2A 1R3HB 3B9DA 4ODHL 3EYQD 5K9OB 2WINA 3OKDB 3W0WB 2RFXB 5EC2B 3NFSH 1RIVH 3MA9H 1TQCC 2X1XR 4TVPD 4B7LA 3OJVC 3G5VA 3F7VB 3TIDA 1N5AA 1UWGL 2KPNA 5EA0L 4P2QA 4DK6A 2R0ZL 1HYRC 2VO5A 4QTHB 3KPPB 3L3IB 4PJAB 4PJ5A 4PLKC 4Z0BH 3RI5K 3MBXL 1JJUA 3BGFC 3JSSA 3U0PA 4K3JH 1EXUA 1S7SB 1OY3B 1KB5H 3T0ED 2R4SH 2AKRB 5D93C 1IZJA 2XKSA 4CVXA 4LPCA 4FP8L 4LQ1A 4QHNB 3SO3C 4RAVB 3DMMA 3JVGC 3MBED 2VZSA 1D6VH 1J8HB 2VJXA 5EOTB 3G08B 1KELL 5C09A 1NSNH 2XZCH 3V6OC 5HD8C 1T21A 1X5FA 4ZOAA 4KRNA 1JUFB 1IQDB 1KIPB 1YNTA 1T66C 4KV5F 4KJQD 5FGSA 5HGAB 3O9WA 3P9LA 4Y89A 5DD6B 1D9KD 5J9PA 4LEXH 1I1YB 4CN1A 2XNAB 4UTAH 1AP2B 4C4KT 4X7SH 5CBAA 3GSRB 2DQDL 3ORJA 1NGZA 1J86A 5HGGS 2DDQL 1M7DB 4H26B 5IB4A 5KAQF 3MRPA 4NO5A 2PO6B 2Q87A 1KC5L 4PJEE 1FNHA 2LU4A 5HY9A 3BD3A 1MCFA 5TH2A 2F74B 4ZSOE 5E2VL 4XPHL 1W72B 3LB6D 4XNYL 1NC2A 4LSVH 5EU6E 1KCUH 5EU5B 1D9KA 1IGML 3MROA 4X5LA 2HRPL 2CRMA 4F3FA 4EIZC 2YKLH 4BZ2L 3TBTB 2O5ZL 1WWWX 4XX1E 1OARL 4PJAA 3WDIA 5KVMC 3F12A 3NFNA 2UZIH 1EFXD 4PY7A 3WCYA 2DWEA 3KS0H 2R29H 5E24E 4JR9L 4OQTL 4UQ2B 2NZIA 5GRXG 1K3IA 3PNWA 2Y5TA 1RJYA 4R6UA 3DRQB 1B4RA 5CZKA 4BQ9A 2GY5A 4DVBA 5IBUB 1UXSB 4G6FD 4AIOA 4ZPTA 2Y4SA 4WWKA 4F7PB 3DGCR 1XR8B 1U42A 2CLZB 5C6TL 1EGJA 4L4VE 3DXAA 4DW2L 2ICES 2H32H 2VXTL 5CGMA 4X99B 1MVUB 2OJEA 3ECBA 4P5MA 5SWZA 4LF3B 2X40A 3VG0H 2WBKA 3GSXA 1EO5A 4RMUA 3OXSA 1UB5B 3VXQB 4HH9A 3HFML 5DQDL 3ARRA 4CRPA 3VXSD 2MQ0A 2DQUH 4N8CL 2AJZA 5IESH 1YYLL 3L5XL 3WNNA 4PV9B 1DN0B 1JHTB 4U1MB 3IDJA 2NX5D 2IFGA 4AH2A 5DD3L 1YEFH 4LGRB 1NCWH 1NGQL 2XPGB 2PYEE 5K9KB 4R0LA 1EEQA 3JWOH 3DROA 4JLRA 4WO4C 4UI2A 2A83B 5TQ0H 3HUJF 3CLFH 3BDYL 3MGTB 1Q8MA 3Q5OA 3HZVA 3N1FC 3LD8B 2VUYA 5F96H 1F90L 1K2DA 2Q3ZA 1WIPA 4R2GD 1MLCB 1QSFA 4GRMB 5IM7B 3FO0H 1SJEA 2YZ1A 2FX8H 5F8QC 2BNRB 3U36B 5ELIA 4NRXA 2VXQH 4XMKL 5BMFL 4M1GL 2IAMC 5B39B 3ARBA 1TZIB 1NL0H 1F4WL 4KI5C 1KN4L 4FTVD 1HXMA 1QBAA 1ORQB 3TZVD 5D72H 1N0XH 4G9DA 3MV9A 3SDDA 1YNLL 1KJMB 3BRGC 5ADPL 4ZUSB 5KANI 1T2XA 2KZ1B 2PXYB 4NZTL 4KJYA 2A6JA 1TJGL 3RVVD 5EBMA 4G3YL 4CMHC 1PLGL 1P7KA 5ICZB 4GMTH 1FL3A 3TIDB 3IFOA 4KJWD 4IOIB 1ES0B 1H3VA 2E6PA 4PRIA 5F6HI 1WFTA 1P7KB 3P30H 2NR6D 2XG4A 3GNML 3K1KC 4YFLI 3TBSB 1RJLA 3CSGA 1NCDL 5LBSH 5EIVA 5CSZA 2R15A 1N5YH 1RFDL 3U4EB 2BVPA 1J0YA 3LQAC 4YFLF 3BEWA 4BQ6A 2PETA 4QRUA 3NCMA 1DBML 2YEZB 1BBDL 1DBJH 4GMTL 1TZGL 4LPXA 1CS6A 5C0DB 3HZKA 3QXWA 2Y25A 4M1DH 3C5JB 3MNVA 2IPTH 5CEZD 3PL6D 4YHOH 3EO1B 3QUMB 5GS2D 2B8OT 3DSNA 4NM8H 1T21B 3I6LE 5HDBE 4M6OL 4X9HA 1I7ZB 2L7UA 4HUUB 2QBWA 4QHNA 1KB5L 3MLRH 2Y9RT 3U0WL 1DQLH 2X9YA 1SVCP 2EZ0D 4PREB 2AJXL 2ADFL 1FYTD 1K8DA 5KSUA 3ZYJA 2EEAA 3BPLC 3NA9H 2EYRA 1Z3GH 4BSVA 1E27A 1ZEAL 2H41A 1ZE3C 1FE8H 1IFHL 1CF8L 4X7FC 4XP9L 4L8CA 2MQCA 3MRRB 4UUJB 1MJUL 1DN0A 1CTOA 3MLUL 3BGMA 1U95A 2R56L 5I76A 2IH1A 1TNNA 3TT1H 4XCCH 2DQDH 3D3VE 4G8IA 4JFFB 4EXPX 1GPOH 1JCKA 1KPUA 4WFGE 5BRZD 4PRHB 4M8VA 2BHYA 3X14B 3LN4A 2V5SA 1YPZB 3S88H 4DEPC 3QUYA 4Y88A 3FQNB 5KS9E 3CZFA 1XIWC 2D3VA 4Z76B 4RGNE 4PJFB 3N1MC 4HPOL 1ETZA 4JREB 4PJFA 1PSKL 3WS6A 2J88L 1WAAA 5CINL 5T1KB 3WHE1 3QXAA 1KGCE 4QF1A 4YHZL 5GRUL 2W65A 3AU1B 5K33A 3IDIA 2P48B 2HAZA 1OLZA 5LQBH 1BD2E 2R23A 3GIZH 4NSKA 1MCPH 3NACL 5IF0A 5E99L 4DGIL 2R56H 5I8OL 1RK0A 4PTUA 4W81A 5ANMA 4XTRD 5BVPH 5DJYA 5ILTH 4JRYA 5C6WH 1GOGA 3ESVF 4KMQA 5DVOA 2VRAA 1EAPA 3O3DA 4HUMB 4QGYA 4BSVB 1MFCL 5DZOA 3QXDA 2YPVL 3HNSL 1WAAF 2PTTA 2N7AA 3SCMD 2AJYH 4X5XA 2AABL 3HMXH 4V1DD 3HR6A 5GGQH 3RNKB 3QJFB 4XBGB 4DWHA 5DJXA 4YDVA 2FHBA 3LVEA 5I1DB 4PJXE 1U2HA 1GOFA 5D1XA 2NMSA 1CZ8L 5HI4C 2MOVA 4P3CH 3MRDB 3O45A 2DM2A 2X5PA 5BVJA 3DTXA 4DKFL 2B2XH 4TRPL 4N1CA 4U1MA 3QPXH 4LCWB 1S7VB 3QXVA 1V7ML 2EH7L 2XN9E 1B6UA 4JAMA 2H2PD 5E7FA 4NNXA 2XT1B 1INQB 1HHGB 4FNLH 4E41D 4JKMA 1IBGH 1N26A 3QCVH 1NBZA 4Q6IA 4GKOA 5JIHA 5J13C 1CBVL 3PP4L 2BNQA 3IS1X 1U93A 3LPWA 1GGBL 1QVOA 2C3VA 1IQDA 1J0JA 1OGAD 2D7TH 3D0VB 3QNYA 3VFVB 2DJSA 2A6KA 5IFHH 2NY0C 1X7QA 5J1AB 3GSUA 1DEEA 3BH9A 3RL2B 1J8KA 1MRFH 1W2KT 3KPRB 4FQ2L 3V5HB 4JPIB 1BREA 1KPVA 2GFBA 2VDLH 3IJHB 3JV6A 4FFYL 4OZFG 3CVHA 5GRYA 4J12A 4C59B 4RMTA 2R9HD 1F2XK 4Z7VE 4LHUD 1RZJL 2BSSB 1G1YA 4AMKL 5D70H 2XV6B 2BXYA 5EG6C 3ROLA 4IEFB 4N9OB 2O5ZH 4WUUE 5HJ3B 3WJLA 2W07A 4XMKH 2Y06H 3IJHA 3JV6B 2WWKT 3O3BA 4HWBA 3GK8H 1H3PH 4GG6E 2VWEC 4LLMA 4N1HB 3BKCL 3SGJC 4KK9D 5C0CB 4HPOH 1SY6A 4Y16C 1I3RB 1P7HL 4RISL 5I17B 3T2NH 2CKBL 2ZG2A 2E9BA 2NXYB 4UV4H 3WE6A 4XBPA 3AXLA 3OR7B 1RUPH 3UTSE 3CVIL 2ICWI 3MJ9H 2HFEB 5AYQA 3CFBA 4FQXA 4N0RA 1ORSB 3D9AH 3BP5B 4OLZH 4R97C 3TN0D 2OL3B 2UUDH 1EMTH 1KG0B 2AXHA 1GL4B 2HT4C 1KJ2L 2YOCA 2EDFA 4UV4L 2A74B 5FM8A 3ULVC 3LH2L 4CN6A 5AD0B 4ZOBA 3GO1H 4IRSD 1X5HA 1LEKA 2AABH 5FUCC 5J1TC 1S5IL 5CJXC 3WS6C 5F7NC 4GAGL 1JPGB 2EYSB 3RIFF 1H5BA 2OK0H 1QYGL 2X4RB 4HC1A 5CEZE 4F33A 1E4JA 2EDNA 2VNCA 3W11D 1N0LA 1BD2A 3T0EB 2Z0BA 4Z7NE 4ZUUA 4NBYB 5IVZB 1GHFL 2OZ4A 4XNZB 3QIBC 2HH0L 5CJOL 2Y6SD 3VCLB 3VFGL 3OXRA 3LQZB 4PRPA 3VXMD 4JY4B 4IRSB 4PJFE 4LSVL 4NQXB 5E2UH 4ODWA 5CZXC 1NBQA 2HTKC 5DJ8A 2Q8BL 3RRQA 3H3PL 4JRYB 1CICB 3P4OA 3V4PH 2GKIA 3VXUD 1NFDF 3GJFA 4Z7VF 1BOYA 3LEVL 3U9UB 1TENA 3IFLH 2IH3A 2V7NA 5EORH 1FIEA 2A73B 4YZFE 3RL1B 4PJ5B 5DI8A 1T1WB 4HWUA 1N7ML 3GB7B 4BQCA 3PHOA 3ARGB 3DVGA 1DE4A 3Q6FB 4Z78A 1R24A 4P9MH 2EE2A 4MJ4A 1FVEB 2DLFL 4NM8L 4XP6L 1WIUA 2CK0L 3QQ3B 2E27L 5F9DC 2XKNB 4NBZB 3GMRB 1H15B 3VXUB 1HIMH 4LVNB 5CZVH 2GJ6A 1YPZA 5A16B 4HPYL 3IKCB 2FJFA 4TSAH 4X6EA 2CXGA 5EC1B 3HAEA 5C0ND 3VMPA 5JR1H 5F9JB 1PBYA 4HKJA 1CGVA 3ZKMD 4I18B 4DFHA 5HYJE 3VFPA 1FL6A 2FL5A 5EZOL 4K3HA 4JZNA 3O45B 5C0AD 2ENYA 3X12B 3MRKB 2MJWA 3OZ9L 3F5WA 35C8L 5EUKB 2R0KH 4ZS6D 5T1MA 3SDCC 2O61A 3LEXA 4G5ZL 1CDYA 1CD0A 1U8LA 3SGKC 4FZEL 1IEAA 5C0IB 5D2LA 3BQUA 2BY3A 2DWDB 3ZE0F 1JZ2A 1DLFH 2W0PA 1GGUA 4OAWB 4ODWB 1MHHA 1MFAH 1XZ0A 1K6QL 4H0IA 2F5AH 3QUMA 4IHOA 4U3XA 4MQXC 1E28A 3ARBC 5FB8A 1P4LA 1C5CH 1HEZA 4JFXA 1NUFA 3BFOA 4YXKL 4YAQB 2O93L 4X9FA 5IHZA 3DX8B 1IAMA 3BPCA 3RQ3A 1MFBL 2ICEA 1ZGLA 2DKMA 3QXAB 4EN3A 2D9CA 2NY6D 1IGFH 1LO3L 1WBZB 2F5AL 3DLQR 4N0YL 5AD0A 4KGJA 4NKQB 4APQD 4OIIH 4QGTA 5C0NC 4C54A 1FL5B 3OHXB 1K4CA 2VITA 1RVFH 3VWJB 4ZFOB 2GIYA 4Q58C 4PGJA 4P46A 4PTTB 3MLUH 4RFEA 5L2KA 3QUYB 5DD5H 5D96C 2E6JA 3QFJB 2OM5A 3LV3B 3NZHH 5ESQB 4MJIE 4J23A 2WINB 3LEVH 3ULVH 4IMKA 3ZHLA 1OTUD 2MSPA 3U7WL 4P46B 3LIZH 1I1CA 4XC1L 4P3WA 4Y2DA 3X3FL 2I9TB 4OZGF 4LVOB 2VDLL 2BRQA 3MQIA 5F89A 2FO1A 3IF1B 3IS0X 4HXAL 3U46B 5I66B 4MMZC 1T1XA 5F7UA 1IGTB 4YX2L 3MLXH 4WY7L 4NGHH 4MDJB 2Q86A 3LZFL 2XRAL 1E6JL 4Z7WF 4UU9A 5GGVY 5ITBL 1H8OA 3DUSB 4JFQA 4KJPD 3WXWH 4TULH 1Y0LB 2DYPA 5DRZB 1H0DB 4PG2C 4CADA 3L1OH 4Q9CA 1XGYL 3GSOB 1UA6L 2OP4L 1XIWD 1YY8B 5CIPB 2PYEA 2F54D 1PVHA 1HH9B 5HTSA 1MIML 2P42B 3MREB 4UINL 3P4MA 2Q3AA 5HGDB 1J12A 3CFJA 4LVHC 3CX5K 4PJHB 3LEXB 1A1MB 5CD3A 4IRZL 1CE1L 2A9MH 1KTDA 2RBLA 5F21B 3MV7E 5D8JH 3VFSA 3ARZA 3HC0A 3V0AC 3I2CH 1V7NL 5JZ7D 3BKCH 1CIUA 4IOIA 1XGRB 3RGVD 2LU3A 4ZAKC 4LOUC 1TIUA 2BSTA 3UDWC 5CD3B 4WY7H 2EXYD 4WUKH 3RIAK 4TN9A 4MA7L 4CL7A 3FB6A 3PV6A 5JXED 3WFDH 4ENEC 4F37F 4YZFF 3WO4B 4UIKH 3RP1A 3GSWB 1NLBL 4MDJA 3V8CA 3C6LA 2CK2A 3E3QE 2NTSP 1CICC 3M45A 1FLTX 1UCBL 1TMCB 1YEIL 1NBVH 1QG3A 1WBYA 1DLHA 4MCZB 5K59E 1H3GA 5J8OA 5DC4B 5L6YH 3DURA 4PJ7B 3CFEA 5CEYA 5J6GB 3MRHB 1I4FB 3TV3H 4XNUL 1IQWH 1WFUA 3L7FA 4I3GA 4HD9A 4N0CD 4Y5YC 4MGXA 3TYGH 4NKDA 2BY1A 4LCIH 1ORQA 3CFKB 2R2HB 4Y4HA 4UMGA 5EO9A 4WHYG 3F6LA 4LFHD 4PRHD 1F58H 1IC5L 4XI5D 1HSBA 3FO9A 3A67L 3QZWB 1A9EA 3SE3C 4R4ND 3C60D 2M1KA 1MHPH 3REWA 4O4YH 1G9NH 1FVDA 2EC8A 2ORBL 4GO6B 5CGYD 2YPVH 3HNSH 2UZXB 5KTEH 3VXQA 2WQ8A 1CGWA 5ABDE 5MI0C 4HUWB 5FCSH 4J6RH 5DD6A 1T20B 2E3VA 4YDIL 4PTTA 3BW9B 2GEEA 4RFEB 1CR9L 1EK3A 4ZPVB 5D5MF 2GJZB 2VAJA 4S0SD 2MWCA 5AAMA 4A6YB 1JPFB 2ILLA 2OMBA 3O4LA 2XQBH 2P8LB 2V17H 2F5BH 3R06A 4LGPB 4ZSOB 1J5OL 4MA3B 2XY1A 3V5DA 3VFUB 4ORZC 3F62A 4MSWB 2DWDA 4Z0BL 1I9RH 4S1RL 5ECJE 1CBVH 2J88H 4V1DB 3UO1L 2V2TA 4QLRA 5IGXH 4YHLH 4X5WB 1AXSB 3K46A 3DHJA 2X4SA 1G6RL 4FXKB 2C3GA 1OP5H 3OB8A 4UOJA 1OSZA 4RFOH 2XA8H 2XWBA 3O2DA 5DSCB 2J3SA 5EWIL 5L8KB 2F53A 1D5XA 1SYVB 4Y16D 5F97E 5D1ZC 1RIUH 4I0CC 4UNUA 1XR8A 3D85B 3SPVA 3QFDA 4MJIB 4GT7A 3C5JA 5DK0B 5IQ9A 2IWGA 2FCBA 4YXKH 1LDPH 3SGDH 2OL3A 3CU1A 1FG2B 5D71H 1DSFH 3E6FB 1KIQB 3S36X 4EUPG 2LTQB 5GXBB 3JV0A 2Y23A 3K3QA 5GGSA 2IAMA 3GIVA 3GM0A 4O2CA 1CLZL 2KKQA 3RGHA 5A1AA 4B41A 3CXHK 3IRPX 4LAQL 3WNOA 4UTAL 2GJ6B 4RDQG 5A16A 5IV2A 3FL7A 4YO0A 5CHNB 1G7HA 4WFEE 1EEZA 5I74B 5HY9B 2Z31B 4PRIB 3OKOA 2PF6A 4OM0L 3K4DA 3CPLA 3PWNB 4F2MB 1DE4B 1QPXA 1M6OA 3T2QA 3QULB 1MLBB 1YN7B 2VLKD 4KTEL 2WWMD 5E00A 3W11C 4ONHA 4OCYL 4I48B 5GHWH 5KJRL 2IH3B 3CDCA 3D3VA 4H88L 4OCSH 4QRPB 4N0CC 4JO4H 2WUCH 3U79A 3RWCA 4M9OA 3S4SG 4PJ9C 1R24B 3S35L 4NRXB 1UWEH 1D9KC 5KSAA 3BH9B 4J3TA 4RAUA 3LEYH 1S8DA 2C3HA 3UC0L 1QVOB 3D0VA 1GAFL 2MHAB 4F7TA 2AK4B 1CLZH 5BOPA 5DJXB 2E9WA 2PUQT 2J7LA 1FJ1B 1KULA 4S1QH 5TE6H 3EOBB 5K9QI 1G0YR 1Q72L 3WD5L 1KEGH 3P4LA 1XGYH 1DDHA 4L9LB 1V3KA 4LEOB 2J8UF 3TN0B 5C8JA 2GSIB 5FUOH 3RY4A 4JZNB 3S4SA 2DLFH 5D7KD 2Q6WB 3IDMB 4XPGH 2XFXB 1QZ1A 5E94B 4UOW1 2DMCA 4U49A 1KXVC 1A7BA 4L3ED 2P5EA 5E8DH 4CDGC 4MQSB 3UTZA 1YEDB 1BX2B 4JDTL 4YQXH 5HYQB 1P4IH 4GKZB 3JTTA 3LKNB 2W60A 5B21A 1X4YA 2VDQL 3TO2A 3T65A 3KLHD 3ZDZE 5FDWB 5I1AA 2PKDA 1D5MB 1LK2A 1IKNC 1NDGA 2X1OA 4X6BB 1FVCA 3I84A 1L7TH 1U8OB 4OSUH 5TDPA 2AVGA 3LMJH 1BZQK 3VJ6B 4G9FB 2Y5TB 1IGYB 3NZHL 3WUZA 3EO0B 4Y5VB 2CUMA 1UM6L 4FTVB 4X6CB 2WV3A 2EDDA 5EUOA 1I3UA 2IH1B 1RUKH 4HX1B 5IW1A 5DHVA 3MCKB 1T0MA 3DRTA 3MRHA 1XF4B 5LGJB 1TVDA 4M7KH 1BZ9B 1QLEH 4TUJB 5FA4B 1YYML 5DJ6B 5F9WB 2G9HA 3WHXA 3GSNL 4QT5B 1FDLH 4XBEH 1QBML 4NO2A 3ROOB 5KSUB 3CK0H 1G7PA 5F1SA 5F7DA 3TVMA 5JDJA 1QFWL 3QEQB 1UT9A 4JFFA 3G6JF 4NQED 2UWEA 1Q0YH 1P5UA 5FK9A 3UTSD 1ED3A 5IK3B 3QEUB 3AB0B 5DDHA 4LHQB 4YHYC 4WO4D 4XB8A 1JGDA 4Q74A 4QY8B 2BY0A 2PR4H 4HUKB 3O6LH 5FGRA 5C0BE 1OP3K 1ZS8B 4QKXB 4U1SA 3NAAH 4G42A 4Y5VC 4JDVB 1TQCB 4K71B 3BW9A 3QDAA 2APFA 3AC0A 3KYKL 4W4OA 5A2FA 2ZOKB 4KY1L 1NBZB 4Z7WB 1FNLA 4HT1L 4JVPA 2DQIH 3G6JA 4PGDB 3UTQA 3KPMB 4WO4B 1IEHA 4Z7OF 4P4RA 2JCCF 4XVTH 1RK1A 5KSBA 5FUZL 3MGOA 4YHKH 2YKLL 1GYAA 4IDLA 1DVFC 3B6SB 1RD6A 1X5YA 4U0RC 1Q9OA 1WQVT 2XTJD 1MELA 3L5XH 1EEZB 1OARH 1JIBA 1YYLH 1U8IA 4NNYA 2XWTA 2COQA 1CFQA 2A1WH 3AS2A 2AK1L 5C08E 5H2BA 1WJ3A 2J1KA 4ODTL 3PGCA 2CMRL 4ZFGL 4NYLB 1VERA 2IAMB 3GIVB 2XRAH 5GGSY 2D4DA 3CVHB 1MF2L 3KPPA 4XMLH 3BP4B 2HJLB 1IAOA 3T0XA 3WIFA 1ZOXA 4HWNA 4APQB 4U05A 4XCFH 2D2OA 3HLAB 3N1PC 1LO5B 5KVDL 1YJDC 4YO0B 2AV7B 4OF5A 4BUHA 3PP4H 5EU6A 3S6CA 3LY6A 3MGAA 4PJDB 4XP4H 3ZE0E 1KLGB 2A1WL 3D18B 3MCLL 1DFBL 2HFTA 3BP6A 2EDLA 3MXWL 2PW2A 5HHMD 4GRWH 4YE4H 3KWWB 2A9ML 1ITCA 3P0VL 1PY4A 1VADA 3MLVL 1ETZB 1X6LA 3DVFA 3R8BB 4UT9L 2JELH 1VFBB 1MUJB 1JRHH 5E5MA 1JN6B 1KENH 2C1PB 3H2WA 5BVJB 1WISA 1ADQH 3HZYA 3MLSL 5GS1C 3BPCB 4L4TD 1RURH 4PRIE 2HVJB 4QRSB 3FFCE 4YHZH 1QYGH 4GG8A 1FPTL 1OSZB 3CSBA 5DSCA 5IFJB 1MLCA 4AEIL 4MCYB 4JRXA 2VE6A 5IW6B 2VDPH 1P4BL 4NHCL 3GIZL 2P5WE 4WTZA 3RBSA 3LSOB 4CDHA 1KEML 1HH9A 1P84J 1NMAL 5CJQL 4RSVA 2O26U 1UZ8B 5DK2A 1RZKC 2DBJA 1DBMH 1RPQA 1U8NA 4ZXBC 4OB5L 1FH5H 4X8JB 4OZFB 4HXBL 3DXAE 1ACYH 4PJIF 4OZHA 5I1IH 3HN3A 1EHAA 4L3CB 4HCRA 5IEKA 3VXRB 1MHCA 4HLZG 3AREC 4BFIA 4QXWA 5C9JB 4MA8L 4CVZB 1MJ8L 3FB8A 4O02L 3SJVB 1V3LA 5IMOB 3TESA 2W0FB 2H26A 4ODXB 4G43A 2MCPH 4MJ5B 5ADPH 4XH2B 1MQKL 1KEMH 2FSEA 1IC7H 3PDOB 2CLZA 4D9RD 15C8L 1X5XA 2B7DT 3L7EA 2XWJA 4PJXF 4NHUB 5C2BL 5C1MB 1L0XA 5IFAL 4N8VB 2DTMH 5BV7C 3T65B 3FRUA 2R4SL 5EU7C 4Z8FH 5TE4H 1SEQH 5F9JA 5E08L 2NW2B 3OKNB 4WI7A 1FNSH 3G04A 4N0UE 4AIZA 4QCIA 1QEWA 3QDGA 1S7RA 2FGWL 2XWJB 3HC3H 3BZEB 2WANA 2MPAL 1VFUA 4L8BA 5ETUB 5FO7A 5IVOA 1ZTXL 3BP7B 4YHOL 5GZNC 4JHWL 1BOGA 4NRZB 1FFPB 1A9BA 4CVUA 2F15A 2H2SC 5EIIA 3QUZC 2NXYD 1FNGB 2AJ3A 3P77B 3UTOA 4YXLH 3VXRA 5HHNB 5D7LE 3MLRL 3U0WH 2ADJA 1MRCH 3STBA 1FSKB 5INDA 4HZLB 3MXVH 3UPCA 4X8JA 1JHLL 4H0HB 3MRFB 3TA3C 2OR8A 3S35H 2IBZX 5FYKD 2NXZD 5ADOL 4LK4A 4YK4C 2CDEA 4K3DH 1C5CL 3MGOB 1P1ZB 5HGHA 3TYFA 4PJIE 2VDNL 4O58H 5DJ2A 4LLDB 2ITCB 1RURL 5HSFA 1K2DB 4K7PL 1FCCA 3ULUC 4PRHE 2YEZA 2AAVA 1NDMB 3HMXL 3DETC 2I07B 4PJHA 3K1DA 3PWPA 5DQJA 2WIIB 1A6ZB 3O4OC 5KVGL 1FNFA 5DTFB 4KI5D 5CJQH 4R96B 2APXA 5CWSB 1KIPA 2A74A 4XZUA 3MJ8A 1AD0B 3OB0H 4KUZH 4UZGA 4OCXH 2GTZA 3VXMB 3NBNA 4OLWH 4QRTA 3KWWA 5T1LA 1JE6A 1YQVL 4A2MA 3G04B 4Q2ZA 3Q6GL 1FG9C 2NQCA 1A6UL 4OCYH 4MWFA 1AO7E 2P7TB 1NKRA 4R7DA 3N9GH 3IKCA 1KCVH 4I3SL 2YUWA 5FHBH 2PYED 2N7BA 3PUCA 1I7UB 2IPUG 4OQ1A 1IARB 4KK6C 4QOKE 1MQKH 4ZPTB 4F7PA 1IAOB 3ZZ1A 2NY3C 3SDDC 3UYRH 3D69A 4XT1C 2VLJB 3UX9B 3DMMD 4NQDD 4HKXA 1XGUA 4ZS7L 3QCUL 1HOCA 2VDML 3N85L 4HWBH 3QQ4B 1CDIA 5DURD 5DJAA 1FZKA 3PQYA 3TJEH 3OKDA 3BKJL 4POZC 4XP5L 5C0BD 3MROB 4LHUA 4S1RH 3G5YB 1RUQH 2JJWA 2P8PA 4AENB 3Q1SH 4M7LT 5HVGB 4PGCA 1Q9KB 3LD8C 3JV4B 4NNPH 4X6BA 5DUMH 4K7FA 3RWGA 3PDGA 5EWIH 2BNUA 2IANB 1WFNA 3JWOC 4YHPA 1FRGH 5C7XL 4HMCA 4I8DA 1F42A 3MBEA 1VPOL 1KNOB 4QRRB 3VWKD 3VFOA 5MEQB 3MOAL 4TQEL 2J4WH 5EZLB 4QHLB 1MCEA 3KVQA 4A6YH 3RA7L 1NFIB 3SGEI 3QJHA 3QWOB 3IJSB 2MQ3A 2P45B 2VZ3A 2AV1B 1V8HA 3PE9A 3HZYB 4JDZA 3QUXA 3T0VA 3B2UD 4HWEH 2J8UA 4OJFL 3W39A 3REWB 5B38B 1LK3L 3SKMA 5KZCB 5F7MC 3VE0A 4N90E 4PYHA 4OLVH 5E9DD 5L8JB 4XAKD 3QIUC 1GGCH 2DQHL 1J10A 3PWJA 4Y5XC 1LVEA 1AQKL 1T83C 2P47B 4FQXB 3O2DH 3RWFA 2FIRT 3HI5H 3SGDI 3LKSB 1HYSC 1B90A 1T89A 4ZUVA 3KGRA 1LEGB 4XVUC 1ZHLA 2R4RH 1BOGB 5KW9H 4AMKH 2G60L 1AHWC 5HI5D 1CK0L 4X4XA 5JHDD 1A3LL 4QYOB 1OTTD 4PJ7A 4QTHA 5E9DA 4OF7A 1FZJA 4NP4H 3UBXI 3QUML 3HKFA 3BIAX 3KJ4C 5B8CA 5H37H 2EKSB 5IROA 5KAQG 4JG1L 5KANG 3GRWA 1EXUB 4P2OA 4MX7A 4Y5VA 1HI6A 3UP1A 2NW2A 3FB5B 4MMXC 5F7EL 3G9VA 3ZT5A 5BXFB 4IJ3C 3C5SB 5FHBL 2XY2A 4RGNC 4PJAE 2VLJE 1YMHA 25C8L 3QDJE 2QQQA 4TTDD 1XGRA 4JM4H 1IJ9A 3ULVE 2BVQA 2ZUQB 1A7RL 4G6ML 3W2DL 5A2JH 4WDIB 2B4CC 2A2QT 3B8SA 4I2XB 5F1IB 1JYNA 1N64H 1U8PB 1AC6A 3S96A 3STZB 4WTXA 4Q6IB 4M6NH 2GJ6E 3G9AB 5CLWA 5IB5B 1U8QB 3KPTA 1P7QA 5I15H 5HGDA 4PGZA 4C56A 1E6OH 2H1PH 2HKHL 4PBWD 4JFDB 4RBPK 1IZKA 4QRQA 4OZHB 3NAAL 1P4IL 1OL0A 2P43B 4CU8A 4NQSA 5D7JD 1E4KA 1DDHB 4L9LA 1ZXQA 4GXUN 4TSBH 2QQLL 4RAVA 2QHLA 3SE9L 3IDXL 2ZCLL 1NANH 4U1GC 1GGYA 1TQBC 4ODUB 2A6IB 5HVFB 4E5XA 2Q7YB 2IALA 4ELME 5IQ7H 3BT2H 1XGUB 1ZLWK 1GPOL 2DLGA 2C4FU 5HYSB 1CFBA 4ZUWB 2CIIA 2WM0A 1T2JA 4L8BB 2FATH 4OZFH 3HG1B 3IB4A 5D4QA 4DK3A 4ZD3H 4FMFA 4HBCH 3MLZL 3P40A 1QQDB 5DC9B 4HIXH 4O2EB 5C07D 1ZVHA 2R1YA 5D7LB 3BKML 3EKCA 5HHVL 4LLVB 2R23B 2IC2A 3CFBB 2B1HL 4GLRH 3LS4L 2VLMD 3WEXB 2NY7H 2C5DC 3H7BA 3ZDYF 5AZEL 43C9B 4F7CA 3PHSA 1PG7W 5I8OH 5GJTL 5T3ZD 1AR1C 3CPLB 1UACH 4P2QD 1OAQL 4FABL 4M7JL 3VFMB 2HP4A 4PJEF 1A0QL 5C07B 5IFAH 2AERT 1Z5LB 5JOPD 3UZQA 4J3VA 1VEPA 4NFBA 1ZANL 5DHXB 5TE7H 2GK2A 3WLWC 2YD5A 4XNMA 4N9GA 4JGJA 3CDFA 5ITBH 1FYTB 4NQVA 4MS8C 1OAKL 1IKNA 4LLDA 4YC2B 2Y36H 4R2GC 5CBEA 1ZVSA 3KPSD 1KV3A 2DDQH 2FEEI 3CXDL 1D6EB 3DTXB 4BZ1L 2UV3A 4WCYL 3ZKND 4F15B 1N6UA 5J3HD 1CDUA 4ODSL 4TOYL 3D0LB 3MZTA 1DQDH 5A43C 1OQXA 5HYJA 1S7XB 4FTVE 4X6CE 1YMMA 4R8WH 4PY8J 1CXHA 5JZ7C 1J7VR 1XF5B 3D48R 1C1EL 4UDUA 1R3LB 5FGCB 2D9QB 5B8CC 4PBXA 1FNGA 5E7BA 3EOAB 3EOTL 4ZFGH 1SMAA 1A64A 3SDAC 3B8YA 1ZK9A 5HHMB 3ULUE 3KDMA 1S7TA 1A7PH 1JYWA 1HZHL 5L0QB 1D6VL 3ME0A 4JEGB 4U1SB 1RUAH 5D7IB 2G2RB 2OQJA 3W5NA 3VFSB 3PP3H 1IAKB 1DQQA 5E4EC 1LO4H 5EU7E 3RZCB 4JCMA 5BZWB 3Q5TA 2EC9U 2FBJH 1HH6B 3MJ6A 4JPWL 3KYOA 3S36L 1ED3B 4MD0A 3T4YB 4MQ7B 1DZBA 3ARED 1U9KA 3BI9X 3GSNA 4FN0A 5ISZD 2GTWA 3HCVA 3TPUA 5D1ZA 3X13A 1ZA6A 1MCDA 4Y4HC 2LE9A 2CJUH 3MTRA 4PJBE 3JV4A 3WFBH 3H9HB 3LN4B 1DEDA 2FJHA 2EEDA 4KMLB 1I9JL 3TV3L 3C8KA 4ODHH 3HPJB 3HUJE 5GSRB 4NQVB 2PN5A 3VWKA 4HF5H 3DBXA 2FX9L 2XTLA 1J1XL 3N9GL 3KYNA 3BXNB 1JGUH 1LNUB 2NY1C 4PJCF 1F58L 1IC5H 1YC7A 4NQCA 3K2UH 4MJIA 3WDHA 3DUHA 4X6DE 4DKDC 1UQSA 2BP3A 3O3EA 3DV4A 1Q1JL 3P4NA 5E2TH 1OWWA 2VB5A 2YZ8A 4P59H 1NCTA 4JZJB 1J8HE 1FSKC 3RJQB 4ELKA 2VLKB 4P2RE 2P7TA 2CSPA 3O2DL 4PRBB 4ZDHB 3UPRA 4B0MM 4WW2C 2NXYC 3KYOB 5C0FA 1LEIB 3O6LL 1NC2D 2MFNA 1EGJH 3ZTNH 3ILQC 1BMGA 3Q1SL 3O2WL 1BBJA 5JQ6H 3S3PA 1B9ZA 1OGAB 1JGUL 2X2YA 2HVKA 4O58L 4L8CB 5DMIH 4CMMB 5IB3A 4I9WD 5C8JB 1OAXH 2XXCB 1TTGA 3MC0A 3SHSA 3HAEH 4AEFA 3GRWL 5IBLD 4D0CB 1MCHA 3LKRB 1YMME 4U1IB 4HH9B 3U83A 4GAGH 2VAAA 1NFDA 4YUEL 1E4XH 3RA7H 4ZO6A 3MJ7A 4MNQA 1YEJL 4XCEA 5FAAA 2UUDK 3WFEH 5DUPH 1YY8A 3UTTB 3GI9H 1DQJA 3L3DB 1RIHL 4LSSL 5FHAL 1F02I 4Z6AT 2G9HB 2UYLB 3FFDB 5CJXA 1QP1A 1A6UH 1S9YB 3CJJA 1GGCL 2JCCB 5I74C 1BQUA 3OGOE 2AKRA 2HFGL 2FYYA 5EZJA 3SCMC 4NQEA 3LHPL 3ZDYE 3UTTE 3HPLB 3IGAA 1FP5A 2OSLB 5CJ5A 3TBWA 1P6AB 5ICYB 4WU7B 4DQOL 1ZAGA 3MRKA 3H3KA 3GKWL 2ATKA 2R0WH 4U6VL 4PJIB 3I9GH 5ALBH 3GMOB 1R5VA 2DIAA 4NNPL 5DUML 5KSVA 1M7IB 4ELMB 1EPFA 3C9NA 3TZVC 3VWKC 4U1KA 3F65A 4RZCA 3D5OF 4AT6A 3K2MC 1WZMA 1CGSH 2GTWB 4P4KB 3JTTB 1D7FA 4PGDA 5T33L 2OL3L 1S7WA 5SV4A 3CSYB 5DR5L 4L1HA 4ZAKB 4PG2A 1UENA 5GZOC 5EN2A 2ESVB 5KS9F 1G7QB 1I3GH 3HB3C 3JV5A 3ZHDA 1BPVA 1URLA 1P6FA 3ES6A 4PV9A 1WIOA 5IR1A 1G6RA 4RISH 1PX4A 3QG7L 4TNVK 2Y7QB 3NGBB 3UC0H 1U58A 4Z0XA 5I0ZA 2V7NB 5ANME 4YAQA 1QUNA 4PRAA 5DD1H 4DUVA 5EULV 2H32B 4M03A 3ZKXB 1OW0C 1XF5A 3PWUB 4UDUB 1EHLH 5DMJB 1IGFL 1LO3H 5HGAA 1BJ1H 4OLYH 1VDGA 1NMBL 3O11B 3SDAA 1W0VB 1NMCB 4X0KB 4R0LB 3QQ9C 4JANB 5C0EA 2J8OA 3CC5A 3EFFB 3GNMH 5F93C 4HXBH 2PYFB 5F3HB 1F97A 3E1F1 4GRWF 4PJ9B 4C58B 4C56E 1KB9J 1QSVA 1PLGH 4D3CL 1MCOH 3MUGB 3MYZA 1HSAA 4H0GA 4OTXL 5D2LB 1B3JA 4RAHA 2CD0A 3PWLB 3HUJA 4ZMAT 5JOFB 4JGMA 3DYOA 3AS1A 5E1AB 5BRZA 3V6BR 4XVJH 4HS6A 4MZ3A 2AI0H 5IJKC 2QADB 1EA9C 4EN3C 3NA9L 5E6IB 2VABA 4KVNL 3DXAB 4RFNC 2YMXL 1MCLA 3FQRA 5I1AB 3UCRA 8CGTA 4X8XA 4F3FB 3BP6B 1H3XA 2W9DH 3OGCB 5J7CC 1FC1A 4MWFB 3BGAA 5I8CB 2QADD 1I7RB 4F9PC 4FQPA 2N4IA 2RCSH 4HV8A 3BUTA 4KRPD 3L7FB 2HT2C 4Y2DC 4UV7L 1FN4A 2ZWLT 4H5SA 3MX0A 3BH8A 1MJ7H 2E8ZA 2P49B 2VXQL 3VA2C 4MXVE 2VXSL 4M4PA 3X17A 3IU3A 4LHUG 1T5WA 1TZHB 1DL7L 3SDYH 4P23B 4YBQC 5CZXD 5E2UL 3DX7B 3B9KB 5IHZB 4MAYB 4AL8L 1FAIL 4L8SA 4NZRL 4OGXH 1J18A 4R4FH 4NN7C 2VISA 2MHAA 3FJTA 4KRPB 2YD7A 4WI2A 4NZTH 1B0GA 1A02N 1DR9A 1X5KA 1I7ZA 1S9WB 3B43A 3DOSA 4G7YL 5F1NB 5BS0D 4ERSL 3MUY1 5KG9B 3C2AL 5IBUG 4NQSB 2X9XA 3HI1A 1DQJB 2NZ9D 5IBTH 1UXWB 2J8UB 4YWGL 3L3KB 3RVVC 4LAJH 3OKYA 5C9KA 3T08A 5F6IB 1P7QD 1BM3L 3QUMH 3HE6B 4MA8H 4N0UA 1QFOA 3TLRA 1G84A 1A5FH 3WFDL 2HLFC 1FCGA 5E8PA 1I75A 4LVNC 3OR6A 1X5LA 3CDYA 1KJ3H 1G6RB 4PD4J 4Y7MA 5C0CE 4XPTH 3STLB 4IIQB 1FN4B 2KUTA 1EV2E 2A9NH 4NOFA 3T4AB 2EXWC 4PGCB 4DTGH 5EO1A 3EW3B 4ZAKA 1FE8L 1IFHH 1AI1H 5E6IC 3BVNA 4JPKL 5FK9B 1HHHA 1QSFD 4HCRL 4UU9B 3VI4E 4JY5H 3EJYD 3FT2B 4I0PC 4NQCE 5MP6L 2X09A 4WFFE 1T2QH 1CE6B 4YBQD 3WHXB 4KXZI 3IDYC 3QQ3A 4KU1A 4M3KB 5DXWA 5FYJE 3T2PA 4JHZA 2IMMA 4FQHA 4ZNEE 4BSWA 5IHBA 1A0QH 4UIMB 3EFDH 3GMOA 4H20L 2X1WL 4PJFF 1SJXA 3HE6C 2BMKA 5CIPH 4U1JA 3BPLB 5J13B 1IVLA 2X4QB 4MJ6A 5MP6H 3TGXA 1XH3B 1GC1H 1EVUA 4M6AA 3PWPD 5LKNA 2ARJQ 4UAOB 3WLWD 3SDXB 2ARWA 3P4OB 3DSFL 4JPKH 5E8NB 3MRGA 3RZWA 4YE4L 3MUGA 1RZKH 4PJ8C 2BJML 5JHDE 4OUUA 3QIUD 5EPMB 1YJDL 3VFWA 4FQ1H 5T5NG 2HH0H 1UKSA 2ZCHH 1D5MA 4NJAL 4Z76A 2H3NA 2Z8VC 4X7CC 4D0DA 1NGXA 5TQ2L 4XCFL 2ZP0T 5IIEB 5JLZA 4FXLA 1MFNA 3Q48A 5EU4A 3QJHB 3BPNC 4JY5L 7CGTA 4WVRA 3VGDA 4NZDA 4QOKA 3MRMA 4FQLL 1S7VA 4Z95H 1GIGL 5C2UB 4ONFH 2FGZA 2KQNA 1SJVA 1WZKA 3EZ8A 3ILPA 1BIIB 3LEYL 1ZA3A 4NC1C 2PYFA 1FQ9C 1TPXC 3S5LG 4K9EC 5KN5A 4X4MA 5AG8A 4NN6C 3QNXB 2JTDA 2YK1L 2LABA 4S2SA 5HVHC 1RZIA 5EIQA 4WU5A 4K8RH 4P4KA 5TF0A 3H0TB 3NFPA 4MB5A 4ONGL 2HFFA 1CU4L 3WE6B 2W38A 5JPNB 5H94A 3IDNA 2GYSA 1DP0A 1I4FA 3QXDB 1KT2B 4HKXB 5C0CA 2QQKL 1JN6A 4F8TA 2CUIA 1R5IA 4OIBA 4IOSD 5INCA 4YFEA 5CMAA 1JWSB 3RVUC 2X1QA 4R9HA 2HG5A 2Y5EA 2VXVL 1RULL 3O0RL 4OLUH 4KROC 1XR9A 4DN4H 2HLAB 5GIRA 2W65B 3K2UL 5DWUH 4D9LL 1G9EA 3GI8H 5T1DH 4QHUB 4TUKH 1I1AC 3MMEB 1W0WA 1S9YA 4LPUA 4NN6B 1U8IB 4W4NA 4WV1A 1FFOB 3WSQL 2L7JA 1RZ8B 2EIBA 1FFOA 1EDQA 3KNBB 1IRAY 3C5ZA 3KDMB 4QHUA 1IC4L 1RUKL 4ZO7A 3SBWC 3SJVA 2G75B 2R1WA 1GVIA 3HTLX 3DO3A 3NIDF 3UJJH 5IVXB 1YC8A 3UJTL 4UV7H 1KJVB 3VXSB 4JN1H 2HJFA 1YNTB 2BHZA 4RRPG 1NEZB 3A67H 4HJJH 2BVOA 5GS2H 1P1ZA 1JZ6A 3WO4C 5ID1A 5FYJD 2YMXH 2W0KA 43CAA 3MRDA 2E8YA 4NOBA 5KS9B 4I0KA 3FB7B 1F45A 4MJID 3UDWA 5T3ZE 1I9IH 2IAND 3GDBA 1Y0LA 4OGYL 2HMIC 5BJTB 1NC4D 4F7EB 1CT8A 5E70A 2Y6SC 1A6TB 2EIZB 2VLME 2KL6A 4HUXB 5DD1L 4D9QE 3MBXH 1ZLSL 1J05B 1UKQA 3O6FB 5EU4B 4GSDL 1TZGH 1KJ2A 4TNWF 4G8FA 2FATL 3ZE2F 3O4LB 2JJSA 5D5ME 3EO1A 5CP3H 2WLYA 3NCFB 1I8KB 1KG0A 4G5ZH 5CBEB 5J12C 2VQ1B 4IRJC 12E8H 4IMLB 1NUGA 4IOFD 3TBVB 1MCWW 1Y18B 2YPLA 3QO1A 3HNTL 2CQVA 1MCCA 2ICCA 3S9DB 3V6OA 1EUUA 3CAFA 3RPKA 2OL3H 2UY6A 4JO2L 4Z8FL 1BLNA 3GSQA 1YY9D 3DV6A 4RIRA 5KTEL 4FQJL 4PJGE 3O4LD 2O5XL 4POUB 3MR9B 5IWLC 3BWAA 3S5LB 1F2QA 4POZD 1N3NA 1WICA 3AB0C 4NJ9L 3BWAB 5FA4A 4OV5A 1NAML 5LWYL 1WFOA 4ZUWA 2E7MA 3I9GL 2CMRH 3DUUB 4DVBB 2YD2A 2Q8BH 1K6QH 3DV6B 1AY1L 4KHXH 4ZO8A 5IJVB 4MJ2A 4GW5B 3CVHL 3MRLA 2EDOA 3GMLA 4DW2H 2ZOLA 3L3GA 4ODUA 4YJZL 3DBXB 1IT9L 2AK4D 3TWCH 4ZXBB 3S7GA 3GJFB 3GJEB 2KZWA 2FEDD 2YA0A 2DI8A 1ONQA 4MQXD 3W0WE 5HYJD 4JQVC 2F54A 2NYYC 5CMAB 5I8KL 4RMVA 5DR5H 3T77A 1U91A 5ALCH 2AS5M 3O8XC 4OM0H 1U8NB 5MERB 35C8H 2A6DB 3BDYH 3BIKB 4PJ8B 3VFVA 5H94B 3JWDC 3FAWA 1OPGH 5EFIB 4BQBA 2WMPA 5E8PB 3KPOB 1ZSDA 1R3LA 4ZXBD 1ZLVK 5HYQA 2H32A 2Z31C 1HDMA 5HYJB 1W72A 2DF3A 3GSVA 1WZ1L 3MOBL 5IJKA 4QRSA 2Z4QA 2Z93A 4ZUTA 1AD9A 2EH7H 2G2RA 2OQJB 4S1SH 3H8NA 5IHUH 2VXUH 3C6LC 3GHBH 4NZJA 4OCNC 3RU8H 1DBAL 4HEPG 1IQWL 1XCQB 5FIEA 2QADC 1ULVA 4D0BA 2V2XB 4P2RA 4PS4H 1RFDH 3RNQB 4GAYB 4QHLA 3K8MA 3QEQA 3ZYZA 3S96B 1CG9B 3MOAH 4ODTH 5FGBC 2Q8AL 2D7MA 3LZFH 2HKHH 3PXHA 2HMID 5DEGB 4X5XB 4P9HL 4XGZA 4GW1A 1D3CA 1NGPH 3T0DA 3IFOB 1UCTA 4S11A 3KXFA 1JMXA 1TJGH 1K5NA 2EDRA 4OJFH 4XMLL 3L9RB 4X4XB 3G5ZA 5BCAA 2P5WB 4FOMA 5ACZA 3MCKA 2LVCA 4MAUH 2GHWB 5FYJL 5DVMA 4UBDD 1T5XA 3TA3B 1T22B 1RV6X 2NTFA 1T5XB 3PWPE 1A8JH 4CJ0A 1HZHH 5IVNA 4QXTA 3LAFA 1FV1B 4FQQA 4OFPA 5E1HB 4YLQT 2Q8AH 1M6OB 3OV6A 4JFOA 5F1KC 2BCKA 3BH8B 2YD3A 1Z0NA 4QYOA 4R97B 1IM9D 1YN6A 2APVA 4K3EH 3MACL 5CCKL 1D5XB 1SYVA 5FYJH 4PUBL 1A7OL 4Z77B 2ZG1A 1UG9A 4P2OC 4K9EH 4NP4L 1U93B 4RIRB 3NCCB 3H7BB 2FWOB 5K9OA 3UTQB 2M8XA 4LCIL 2C3WA 2DQIL 5DJ0B 3O6KL 4WU5B 2H9GB 3LKQB 4LVEA 4LOUD 4IMLA 1LEKB 1OOAA 4V2CB 1MY5A 3RVTC 3CUPA 5H35A 1DCLA 1MQ8A 5IB3B 1BGXH 1CXIA 1ACYL 5KVFH 4FQCL 4D8PA 4P57A 1MFDL 1NBVL 4QOKD 5C86A 1ERNA 3SKUD 1BBJB 5C0EB 4YX2H 3BJ91 3FRPA 2NW3B 1INEL 4P23D 1KTRL 1U2CA 2AGJL 3HE6A 1R5WA 3FN3A 1BVKA 1A6TA 3X11A 4JFXB 3QQ9D 3U2SB 3HUJB 3UJIL 3LDBB 3BE1L 5HHXH 1GSMA 4O5LL 3W5MA 4PJ7E 4WI6A 2EXYC 1NLDL 1K8IB 5JXAL 5EB9A 3MFFA 2JJTC 4HIEA 3NABH 5I1JL 3OMZA 3MLYL 2DBLL 3I85A 3M1BB 5BS0B 2QL1A 4BZ1H 1OCWL 4P49A 1Z2KA 3MRIA 4LRNH 3N0PB 5C0DA 4KTEH 3H3BC 1D5BB 3MLZH 3QDGD 4YNYB 1KCKA 2VXSH 2R2HA 3PWUA 1U8MB 1P7QB 3ARDD 3M8OH 4YPGA 1C1EH 3VXTA 2W91A 1HHJB 3UJJL 4KUCD 1U58B 3PGFH 2H6PA 2E7BA 2J8UE 4I13B 2JCCE 1B4JL 4O5LH 4OQTA 5I8EA 1DEEB 4RZCB 3M17A 3BZDA 3BX7C 3MYJA 4U1LA 2IQAB 3RWEA 1P69B 4M48L 1B0RB 1QPPA 2C3VB 3QNYB 4KDVA 4TUOA 4Y16A 1YEEL 4JFZL 1Q0XL 3SDCA 2V2WB 1QSEB 3DX6A 1Q9WA 3QCTH 5AZ2L 3SDCB 3MUZ1 1DBKL 5TDOB 4YIQB 3JVGA 4JFHE 1JV5A 1QD0A 3BGMB 3RWEB 2WUBH 4ODVL 3ZDZF 5B8CB 2Q6WA 3EBAA 5ICXA 4EQ2A 1VACA 4QXUH 2P46B 5HDQL 4IS6A 3SDAD 12E8L 3QUKB 2NY4D 1INDH 2LV4A 3VMOA 5I1CH 1BVZA 4K3DL 4M93C 2X42A 3PP3K 3HPLA 1MJ8H 2VR5A 3R4DA 2OZ4H 3QO0A 5DJ8B 1MREH 5ALBL 5AWNL 8FABA 9CGTA 4FQIH 4CNIA 4DZ8A 5E99H 4DGIH 4KFZC 4NRZA 4QXUL 5LGHL 2F19H 3BZFB 5F3HA 4LAQH 5CSBA 4M1GH 4PRDB 1KELH 3UYPA 1YDPB 4XP1L 4WW2A 4ZQKB 2AEQL 4DEPB 5ID1B 1BWMA 1JHTA 1UB6A 3P11H 2ZPKL 2FHCA 3R8QA 4EDWH 4FFVC 3BZEA 1I9IL 4JDZB 1BD2B 2HFGH 2HJFB 4CGTA 5I18L 1NCCH 4ZTPH 1ZHNB 3OXSB 1FORH 3MRLB 2F8VA 2ZZUT 4JKPH 3PXJA 3LRSB 1T7XA 2A0LC 2VLKA 1AJ7L 1FFPA 2X4TB 5E00B 2P44B 3E8UH 2K3TA 1YA5A 3RGVA 3OB0K 1FVDB 1B0RA 2DI7A 1NGQH 3RTQA 3WFHA 4K94L 3QXUA 2CH8A 3OPZH 1JZ4A 4MHHG 3OKOB 5L0QC 2EE9A 2DB8A 4G43B 4MD5A 5DYOB 4M5YH 4AIZB 2D31A 3CSYA 2UVFA 3EJYC 1Y6NR 5D1QD 5I8CA 1EO8L 4G8IB 3BXNA 5JMRA 4ZYKB 1CXEA 3AM8A 3I6LD 1NAKH 1NEUA 4UDTB 4OCRL 1OHQA 5ESVB 2X4QA 1MREL 5AWNH 5JORB 4LU5H 4DZBA 3TO4C 1DUYB 1IGTA 2H45A 4OI9A 3ZDXF 1I1AD 3ZTJH 5CEYB 2FX7L 5K59F 2V9QA 1B4JH 1JZ8A 5EZOH 4FMKA 2GT9B 5CJOH 4EDXA 3HMWL 5M94B 3WFCL 1C16A 2B1AH 1KN4H 4R96A 2YXFA 2HN7A 5IFHL 3ILQD 2B0SH 4QXTB 1G7LB 2GW5A 5DK2B 1IGJA 1RHHB 3ZSTA 1KUMA 4JKKA 1FH5L 2OSLA 3VDBA 2FNBA 3I75B 3H9YA 1IKFL 1X3DA 1PX3A 1AE6L 3BKYH 1LO2H 4LVOC 4Q2ZB 3TYFB 4G80B 1UB6B 4ONGH 5LGKA 1EFXB 3RUGE 2ESVD 3RPIA 5JNYA 5CILH 1MHHB 1CFTA 4RRPA 4UINH 3MPCA 5FECB 5DTFA 4PJCB 5EORL 5B22A 1YY9C 3U4BH 4Z7VA 3WKMH 3WD5H 2C1OA 3NPSC 1RUPL 2AXGA 1KIRA 5JOEA 1JGVH 5AYUL 1JZ7A 4ZFZB 4OD2B 5IR1B 2V5MA 3VH8G 4KZDL 3WN5A 1BVLB 3UXFA 3FT4B 4KK5C 3QUYD 2ZSVB 5I9QC 3G6DH 4O51B 4LSQH 4YC2C 4M4RA 1L0QA 1BQHB 3TO4B 3OKNA 3PQYE 3DRQA 2ADGA 3LHPH 5EC1A 1UC6A 3GGWA 4XP5H 5IT2H 4Y5XB 1IT9H 3TWCL 5C0BB 4K3JL 4P2CG 5FA3A 1H15A 5IBLC 4JM2D 3ZDXE 5GGUA 4GBXB 4BZ2H 1TVBB 3MRQA 3L3OB 4E42B 3D87B 4L1DA 5LGJA 5D2NB 3NFNB 5D1XD 3BN9C 1P2CA 5DS8A 3GUTA 5GSVA 3QPQD 5GZOD 3MLXL 4HX1A 5IW1B 4Q9RH 1LP9F 1A1NA 3W9EB 5BQ7A 1ITBB 2V7HA 2ZOLB 3EAKA 4UIKL 2GCYA 4R4FL 4YK4B 3X3GL 1ZT4B 4LPYA 2YN5A 5MEPA 4N8VA 4TULL 32C2B 4P99A 1F3DJ 4X80L 3T0EC 1DBBL 4G8GB 1QBMH 3D6GA 5EZIH 4AM0A 4GOSA 1A7OH 1XGTB 4XX1G 1PG7X 1DN2A 3S35X 4PJHE 1KPUB 2O5YL 4OF3A 4NZUH 3ZO0A 2RB8A 3IDGA 2GSGA 3M07A 1UM6H 4PS4L 4DOHE 3WNMA 1RZGB 3CFIC 4JO1L 4GKNB 2UVEA 1KLUA 1EFQA 1P4LB 3W9DA 5C3LD 4M93B 1OSPH 4PD4K 1MRFL 1VFBA 4FQ2H 4J1UB 4KKNA 3S98A 4OCLC 3LKOB 1A6WH 2LVEA 2CIIB 1QFUH 2FZ3B 1RHFA 1XGPB 4HIIB 5GISH 4J4PD 3NPSB 4FFYH 3U9PL 4G8FB 4PJCE 1BQSA 3SO3B 4DOHB 5GS0H 4R0LC 4PJ8D 4OZIE 1DL7H 3T0AA 3SQBA 1AO7A 8FABB 1FFRA 1LEIA 2UZYB 2V6HA 1F4WH 1K8DB 1N6VA 5KSAC 2J4WL 4KMTL 1CI5A 4HKZA 1CCZA 3TPKA 4EQ3A 5DUBB 1U8LB 2AJXH 1LO5A 1KLFA 2QEJA 1F11B 1ZGLP 2VDQH 1HKLL 1U8PA 1G7LA 2FECI 1UH4A 3DHMA 3FQXB 4HIJA 2AQ3A 1YEGL 3OKMA 3QPXL 2BMKB 4H8WC 2ADIB 1UH2A 5EH1A 1XMWA 2VERN 4R26H 4L8SC 2NY2B 5EZIL 4EZMA 3JUYA 5BO1H 4QRQB 4ISVA 3S5LA 1FYTA 1VHPA 1INDL 1H8SA 2ZUWA 5J6HA 4BYHA 4MQTB 3TBTA 5ERWA 4X4YA 2R8SH 4LSDA 5IB5A 2OI9C 1C5BH 2YHGA 3P0YH 5I1EH 4I48A 4YXLL 3HAEB 5FCUH 5EU5A 5FOBB 3OGCA 1A5FL 3G5ZB 4OZGE 3ISWA 5DO2C 3WN5C 1GZPA 4JFDD 2XFXA 1H8NA 4XVJL 1YEKH 3C60B 1JNJA 5CEZL 2NY2D 2FHFA 2PO6A 4XP1H 1IC7L 5CP7A 2R9HC 5I19L 3V2AR 4XZUB 4M00A 4CAGA 4JRWA 4MD4B 4PJBA 3AREA 2ICEB 2R1XB 3BEVB 3T1FA 7FABL 1UYWL 4WU7A 1XGQA 5BO1L 4NRYB 4JKLA 1K9TA 2AEIT 3W0WD 1QSFE 1QSEE 4PLNC 5IQ7L 1MI5A 5DK0A 2IQ9H 5IQ9B 3QNZB 1RUAL 5GZND 2VLRB 4K55A 2VWEE 1R5IB 4IRSA 3HNVL 5JIIA 1U3YA 4GXVL 1W8OA 2Z4QB 1TDQA 3GMPB 3LQAL 4LBEB 1ZHLB 2HA1A 1V7NH 3ULVF 4PJBF 1KFAH 3RDTB 5DEGA 5KVDH 4EI5C 1YUHB 4LLUB 2DMKA 1ZLSH 15C8H 4IIQC 1Q94B 1JGLH 3P9MB 3RWJB 1IEAB 5I1EL 5MENA 1CGTA 4QHMB 2DS4A 3VGAB 4APQC 3TEUA 4AEIH 3OSKA 5I73B 2JJUA 3MRBA 5DLML 3D0LA 2QSCL 3MBEB 4IS6B 2EDXA 3D85D 5IUSA 1IE5A 1OAQH 3NCBB 1VACB 1OW0A 4P2QB 1JI2A 4ORGB 3SGKA 3D2UA 4G3YH 2CDGA 3QQNA 5EOQL 3V6ZA 2Y72A 4HAFA 1XF3A 2OTUA 1F3DH 4GRLB 1MHEB 2HTLC 4GXVH 1PG7H 3BP5A 1FAKT 1GRWA 4PUBH 2X4UB 3MMEA 1XCTA 4JJ5A 4LNRB 5DJ0A 2Z92B 4BKLB 1AE6H 5JLZB 3CXHJ 4YEFA 3BRDA 1KNOA 4QRRA 2GJ6D 3KYAA 4R7NA 3CD4A 3LN5B 1S9XA 4NPYA 4O4YL 4KRLB 4P59L 2F8XC 3KPSB 2D03H 2XQYG 2Z31A 1NCNA 1U92B 2EDJA 3HC4L 1AXTH 5JPMB 3UYOD 5FF6A 4N5ED 3GMMA 5FKPB 4BZYA 1T0MB 4KAQH 1KCSH 4HS3B 3RAJH 1A6PA 4RDQF 4KTYA 2DTML 5ERWB 4X4YB 1NAKL 1AR1D 2R0WL 5FO9A 2CR3A 1TETL 4I77L 4DVRH 4HCRH 2I25N 3QEGH 1QNZH 5GGVL 3RUGA 5GRJL 5JPMA 4OZFA 1EEUA 5HYIA 2DIJA 1V5JA 4DN3H 3PG2A 2QQKH 3VFGH 4X7TA 4FQHB 2IMNA 3WFCH 5I1JH 1I85C 3DGGB 3EYFB 4M6MH 1UM4L 2I5YL 3MJ8B 3Q3GA 3O6ML 4HJ0D 4HFWB 3S37H 5KOVC 3TVMD 5DQJB 3NIGE 5BJTA 2WIMA 3WNLA 3I3DA 3EIFA 4JKPL 2X4UA 4JJ5B 1NDMA 3KYMA 4X4ME 2NW3A 5E2WL 5DRWB 5I2IB 4MSWA 1RUML 5BV7L 3RZCA 1FFQA 3V6ZB 1TETH 4I77H 4DVRL 3GBML 3ES6B 4HS8H 2IG2L 4UBDC 1KB9K 3QUXB 4QWWD 4OD2A 4ETYA 2PXYC 2Z93B 2EKJA 2P8MB 1ODAA 5C7XH 4GUPA 5HI4D 2WIIA 3K0WA 5CEXA 1V7MH 2NR6C 1Q9LA 2ZKHL 3IAPA 4WEBL 3U4EA 1CDHA 5E8NA 4HFUL 1ACZA 1XF2A 4MDIA 1JF1A 2Y1VA 1OSPL 5HYEA 3S37L 5F1IA 1Q94A 4GAFB 4G6KL 2IJ0C 4ZOCA 4TTGA 4LSPH 3SY0B 3QDJB 4F58L 2AXFB 5C6TH 3GMPA 5FV1L 2NX5B 2BVTA 4JQVA 1N6QH 4PYGA 25C8H 4OFYA 5JW5B 3P4NB 4YDKL 4BUGA 5JUEH 3QDMB 2IADB 2BHUA 2ICWB 2BVOB 1EO8H 5IV2B 2Z35B 2HYMA 2ADJB 2BSED 4Z7OE 1MIEL 2D0GA 1PKQA 4Z5RA 1U41A 4NO3B 5HBBA 2FJGB 4R4BB 4Z7UF 3FB6B 3PV6B 2YC1B 1XT5A 2ZUQC 3I02A 5L2KD 1KBGH 3CLEH 4OBSA 3V5HA 1TVHB 2D03L 5EUOE 3ZT6A 4UB0L 4HWEL 4LLAA 3UBXG 2XN9D 4M43L 3IAGC 5FYLL 2VZUA 4P46C 2E9JA 1GZPB 4TVSa 4NJAH 3VFNB 2W0FA 4GH7B 3VH8A 3BAEL 3TZVB 5DFVC 5ISZA 4KPHL 3QEQD 5TE6L 4EDWL 1IGMH 1KXQE 4ALAH 1X9QA 4Y4FB 4PPTA 1MHCB 3DVNA 1WSST 3QEGL 4FP8H 5FYLD 1FG2A 3OG4B 1F3JB 5I1HH 3IVKB 2XZQL 3OF6D 2QLVB 1MCRA 1JK8B 2XZCL 5D7IA 3Q2CA 4PBVC 3HA0A 4LSTL 4WUUB 4CW1A 1VFAB 2R29L 1WCQA 4F7MB 3DARA 5B4MD 1U3HC 3TM6A 2R0KL 4ZFOL 1UZ8A 1T1ZB 1C5DB 2YR3A 4XAKE 3EJZC 4MNGA 2UWEB 1IAIH 4BFIB 2B1HH 5C9JA 4U6XA 1YMMD 4RGMB 1G9MH 1QKZL 1K4DA 1H9VA 5EBLB 1HN1A 3NA4A 1J1XH 4JGUA 3WL9A 2YA2A 5D1XC 3BIKA 5IOPB 4Y19A 4LVHB 4PRDA 3PABB 4ACPA 1ROWA 2H8PA 1KGCD 3AM8C 2ZSWA 3B2VL 4AY0A 2ENSA 2RQ8A 4TPRH 4XB7A 2YN3A 4DUWA 5D7KE 4Y4KB 2LAGB 1RZJC 2QQNL 3CK0L 2IAMD 4L8DB 3UMTA 2APTA 2BX5A 4MCYA 4TSCL 1R0AL 4UILH 2XQYK 3REVB 5TDPB 3ULSA 3BT2L 5DGQA 3GI9L 1OAUH 1QBLH 3C09C 2YA1A 1AQDB 4TUKL 2QHRH 3ARSA 4PY7B 1R3JA 1I1AA 1DLHB 5FGBA 1YPZE 3MACH 4XWGH 2OTPA 3RVXC 3WIFB 3MR9A 2BCKB 1UJ3C 1VESA 1D5IL 5E03A 1PD6A 4XHQA 2X4NA 3MRGB 3REVA 1J88A 4M6OH 4KQ4L 3F58L 4IRJB 1RZFH 2YPLD 3TNNB 5JO5B 4YHNB 1OAUL 1PKQE 2VIRB 4N1EA 4JZJC 1NBYB 4LPVA 2IFFH 4LCCA 4UNTA 3FO0L 5FEBA 3C08H 3NTCL 4XCNB 5HVHB 1MJUH 1J5OH 1I8KA 3L9RA 1OAYL 1EIBA 3MRPB 3BPOB 4IHOB 1U6AH 5ID0A 2GAZA 1QFUL 1QLRB 5JW4R 5J11B 4HJJL 5KSAD 4HIXL 4YDLC 3PL6C 4L4TB 3TN0C 4UQ3B 2W9EL 3SY0A 1PKQB 4Z5RB 4ZUVB 3SKJL 5ISZE 3W2DH 3C6LB 5EBLA 3V79C 2JB5L 5C0JA 3B9VA 1MRDH 4PG9B 3KHQA 2OTWA 1HKFA 2DD8H 1FYHB 5IMLB 4JVUA 1HEZB 4NZUL 1T03H 2B5IB 1AR2A 1Z9MA 4P46D 1YUHA 3L3JA 1NMAH 3VI4F 5CJBA 1NLDH 2JLLA 1T6VN 1X5JA 3DXAD 4OBRA 1Q9OB 4U6YA 3C08L 3MFFB 3NTCH 1H0DA 2WP3O 2EDBA 3BN3B 3WLBB 5I1IL 4QOKB 3PGDA 4M7JH 1HHIB 4K9EL 4OFKA 4J6RL 3SJVE 2VE6B 1UVQB 2BSRB 1UFUA 3M8OL 4OLEA 3FKUS 2EDKA 1Z6JT 3STZA 5HHPA 4ONFL 1Z5LA 3O9WB 4K94C 2R1XA 3T1FB 1VKXB 5B38G 3VFNA 4U7SA 5LVEA 3U30B 3QUYC 4NDMB 1OAYH 1JPSL 4F2MA 4PJ8A 5JW4Q 2FIKB 4U1KB 3WS3B 4HBCL 5I1CL 2EICA 1Q9KA 4XPFH 5TF1L 3MLSH 4KJYB 2XIDA 4WUKL 4E41B 1ONQB 4NO0B 1JF5A 1N2RB 1QSZA 1SEQL 5HHME 4FTVA 4L9DA 4X6CA 4JN2B 5GGSB 3L3GB 5I75C 4P2OB 2XXMB 3VMNA 5HHXL 3TCLA 4EBQL 3P2TA 1VFMA 5M7QA 2GK0B 3KS0J 3OHXA 3DSFH 2DL2A 3V6OE 2QHRL 4LLMB 3ZHKA 4HS8L 2YRZA 5HDLA 3RUGB 4M7LL 1LD9A 4MNGE 1BEYH 3F6IA 2Q7YA 1FNEA 1KYOJ 4KV5E 3ARTA 1UEMA 1NGWA 2J6EL 1ZKAA 4HMDA 2VR9A 5ESAA 4XAWL 2CPCA 3RX5A 1MWAA 1WBXB 3OJDA 1QFPA 5E8EB 4ZS6C 3SDCD 2K7PA 4NNYB 3FCTA 4NQXA 5B39G 5KBNC 2HJKA 4GXUM 1EHXA 2KQMA 4OZHE 4Z7NF 4UTBL 5DJZA 1ZWIA 4GJTB 2XZAH 3NVQA 4AG4L 2DICA 5C0IA 3DIFA 4K3EL 4U2YA 2FB4H 4TVPL 3RU8L 1U8HB 1YEDA 1X5GA 1PYWB 1F6AA 1C5DA 4D0BB 3U30C 5IEHA 2EIEA 4F7TB 2WSKA 4DQOH 1VFAA 4H1LA 3BN9D 4HGWB 1PY9A 1VEMA 4R3SA 3WIHA 1HYSD 2FL5B 3OL2A 3GBNH 2BRRL 43CAB 3MLVH 4LSQL 3ZLQC 3X3FH 2VDKL 2XA3A 1KCRL 3O3AA 3VRLE 3QG6B 4G6JH 4OUUB 1YQVH 4M5YL 3BHBB 4OF0A 2CKNA 1MFDH 1SEBB 1RJZB 4L4TE 5IROC 1TTFA 3BKYL 4Y0GA 2ATPA 5J4MA 3KYNB 1CFVL 2R4RL 5TDNA 3ARWA 3TBYA 2VZTA 5JXEA 2AXJA 3BEVA 1RIVL 1F4HA 1OTUC 3ULVD 3Q6FA 4DKFH 2VLJD 1CLYL 1KCSL 3OX8A 3L1OL 1C08B 1RSFA 2YC1A 2MPAH 2PO6D 4P4KC 5DJYB 3HNTH 2CKBH 3WSQH 4M6ML 4LRIC 1S7RB 1CICD 4LKXA 5CCKH 2UWEE 2VDOH 3HC4H 1MRCL 4NSKB 3LQAH 4AJ0A 2X7LB 3P9WB 2VL5B 3FQUA 4Q97A 2E7LC 1JNLL 4U31A 5DWUL 3TO4A 4KKBD 1R6VA 2X7LA 1JGLL 4Q9BA 2OR9H 1DANU 3PQYD 5C09E 5IKCB 2ZNWA 1G9MC 3FFCA 3RWIA 4NNXB 5E2JA 3UAJC 4LKCB 3OPZL 1ZHBA 5F3BA 3QA3A 5E0QA 3EYQC 4Q9QH 5I8EB 4ORGA 2YWZA 4LASL 1HE7A 1OB1A 3VFRA 43C9A 5F7YC 2BNQB 3MLWH 2X70A 5C71A 4HMEA 1AP2A 1SM3L 1OTSC 5F88B 5D7JC 3RNQA 3C87A 3LKRA 3V52H 2XKUA 3O6MH 1NMCC 1QQDA 1GH7A 2ATPB 4L3EE 2VQ1A 1IM3A 5KOMC 3EDJA 3QRGL 1GJIA 2IG2H 2VSDA 1JRHI 3MRRA 4UUJA 5E9DE 1UXWA 3DPBA 3P73B 1TJHL 1SVZA 4KK8C 5EDXA 4LSRH 1YEFL 4MXVF 4RGND 3VRLF 5I16A 3OAYH 2KBGA 1MFCH 3H7LA 1OD9A 5TPWH 3D3VD 2V2TB 1QACA 2JK5A 3QIBA 3IDGB 3DX7A 1PYWA 5IFJA 1M05A 3VG0L 1NMBH 4FFWD 4P9HC 2ZJSL 3FRPG 2P8LA 3PGFL 3H9SE 5T1KA 3O3DB 1MAKA 5FXCH 3W82A 1A14L 3SQOL 3N1QC 3MV7D 1AXIB 2F19L 2GK0A 3VGEA 1QR1B 3G6AA 1M71A 3D39B 3GHEL 5EPMA 1T20A 1NBYA 4Q9RL 3P11L 3D3VB 1RK0B 2NY7L 3FTGA 4UDTA 4X7DC 3IU4L 5E8DL 4S1DC 4BFEA 5C6PB 3UAJD 3GMLB 2H9GA 5JR1L 1N2RA 3VI3E 4KKCC 1E4KC 2Z8WC 2MKWA 2AV7A 2FX8L 3QUZB 1I7TA 2NY6B 4PJDE 1M7XA 5JDSA 1A3RH 1M71B 1KENL 4U1JB 3G5XB 1A7RH 4NQTA 2VLRE 1R3JB 3FQNA 1KBGL 2YPKB 3CLEL 3L6FB 1CD9B 4A6YL 3TPUB 3OZ9H 3QFJD 1FV1A 4FQQB 5SWQA 4OI7A 2X1PA 3EYOB 5EO9B 1XR9B 5TPWL 1T7YA 3IFLL 1MI5E 1JNLH 1YEGH 4K71C 4KPHH 4JQXA 1HHHB 3C6SA 4J8RA 2EYTB 4WHYH 3WLBA 3OX8B 2VUOA 4FG6C 1CXFA 1CDCA 3FMGL 3NCYP 2X05A 2EO9A 4I4WA 5D7IF 5D7JB 3RL2A 1KJ2H 1N59B 2YSSA 1OT2A 2FIKA 4LEOA 3QZWG 1N6QL 1BFVH 4G8GD 1NEZA 4OIAA 3P30L 1CFNB 3T2NL 2AXGB 4K7PY 3VXOA 4WHTA 4R2GB 5C0JB 3T4YA 1RJZA 5CFHA 2QKIB 3MJ9L 2ESVE 1WVZA 2BFVH 3CGTA 3PWJB 5CSZB 3NIDE 3R0MA 4Y5YB 5BZWA 4D9LH 1G7IB 5SWSA 2GAZB 2VLRA 3ARFC 1LE5B 2Z91A 4LCCB 4KRPC 5IKCA 1Z9OA 2RJMA 5BMFH 5D7LD 4EIGB 1MH5A 4V2BA 2X41A 5CKAA 4N0FB 1AGDB 1HCVA 4JG1H 5EU6B 2D7NA 5C07A 5GS1B 1A22B 3B9KA 3FONB 3TBSA 3T0BA 2W9LA 1CFTB 3TIEA 1NEZG 5CEZH 4Q0XH 3RIFK 2HJKB 5F6IC 3CMOL 1YYMH 1N4XL 4H5SB 3MRQB 4GBXC 3ULSB 5E8EA 5B3NA 1R3IL 1AI1L 4UAOC 5IB1B 1DQML 2A77L 5DJAB 3AGVA 5JO5A 5D7SH 3EO9H 1AQKH 2DMBA 2C4XA 3OAZH 2ERJB 3PL6B 1UZ6F 1CLYH 5D96B 2IADA 3QDMA 4OV5B 1OM3L 3PABA 3VFMA 4LLWA 2IF7A 5DFVD 5L8LB 4M7KL 2VQUA 1LMKA 3FQWB 5D1ZB 5T3XL 3X13B 5B3JE 2ARJA 2X4SB 4DKEL 3KHOA 2W9EH 1LGVA 4P5KB 5AUMA 1R5WB 3WJJA 3MGTA 1S9VA 3MXWH 4ERSH 2QTEA 5HYFA 4JY6B 5MHSD 4N5EC 4XVTL 3A6CL 3D39A 4H8WH 3L5WB 3V95A 2FDBP 4X99A 1LE5A 4NUGH 2CDGB 3STLA 2FR4B 1G7JA 2J12B 1JK8A 2B2XL 1G6VK 4TRPH 4RCAA 3DI3B 4RX4A 3RZCD 4W4OC 2FBJL 2J5LC 3ULUH 4F9LA 2P5WD 4HWZA 3MFGB 3QEUA 5DDHB 2NLJA 4JFFD 1KSRA 3QCVL 3TA3D 1OGAE 1RZ7H 1CFNA 4DKEH 2GJJA 4P5MB 1PFCA 3TP4A 4MJ6B 5MEOA 3WXWL 3VW3L 5T1MB 3AFLA 4LCYB 4UQ2A 4QT5A 2A9NL 4G8GA 4PJXB 3D69B 4WWKB 1L7IH 4RWYL 1S9WA 3IFNL 5ALCL 4BSWB 1IM9B 1ZANH 4PB9L 1KCRH 5CGYC 1I85A 1IAII 2WW8A 5HHNA 4ONOA 5JORA 4FZ8H 4KDTC 4HF5L 1A1NB 3W9EA 4K2UH 4PJDF 3KPNA 4U1NA 5DK3A 4WTZG 5ACZB 1QNZL 1QHPA 2PCPB 3BGFB 3HE7D 3U7WH 4E41A 1YEHH 4WWKD 1I1FB 2WP3T 1NSNL 1RQ5A 3SCMB 1W72L 2XZAL 4G8EB 3QUZA 3BD4A 2PXYA 4OGYH 4F57L 5L2KE 3MRNA 4IRJA 1CLOH 1MCPL 2R39A 3NACH 4LLQB 1BQHA 3A0OA 4YPGB 1Y6KR 3U7YH 2I9LB 5C0AA 4FZ8L 5BVPL 2XPGA 3EYVA 4OZ4A 4XAWH 4YDJA 1C12B 2J5LB 3WN5B 2ITDA 1EJOL 2ICWA 4DKAA 1JUFA 3DETD 3QCUH 5DF0A 4MVBC 5F70A 1MEXH 1JWUB 3DO7B 1UGNA 4JPVH 4FRWA 3ZKMC 1UH3A 2APBA 1JFQH 3VXTB 3TT3L 3H0TA 5INDB 2WK2A 3IFPA 4JG0L 3VXOB 1TCRA 4NGHL 5F7DB 3TVMB 5C0GB 3MJ7B 1KB5B 4KMTH 2RGSA 5GRWA 1AO7D 3VFUA 4P23A 2AW2A 3QNXA 2F58H 1FNAA 4NWUH 4HUVB 3JBG7 4TUJA 3P73A 4LGSB 5I71C 1WT5A 3TF7C 1HNFA 3I3BA 2GJZA 4KHTH 4F57H 3G5YA 4GKNA 1HNGA 3H3PH 2CXKA 3UJTH 1AKJD 3MV11 1YNLH 1J1PH 1ORSA 1S7SA 4LP4A 3PNWB 3QQ4A 2HFEA 1WGOA 4XP4L 5KVGH 2HT3D 2OJEB 3ECBB 3PHQB 1SQ2N 1SYSB 4I3RL 2H3NB 2NXZB 4G8EA 1CU4H 4K94H 4FXGB 1YN6B 4UB0H 3O2VH 2MCPL 2EH8H 5JDSB 4HV8B 1CGSL 2PO6C 4P4KD 2AQ2A 2NY4B 5HGBA 3GI8L 2DQCL 1BJ1J 3FOMA 4WV1C 1R3HA 5HGBB 4O2CB 2K9UA 1PEZA 3QFJA 3T09A 2IPTL 2JB6B 4KXZH 2AGJH 5I76B 1CK0H 1KIQA 1A7NH 2XA8L 1ZLUH 4N8CH 5DUPL 1QR1A 4ISVB 4M62H 2FD6H 5JW3H 3ARUA 3RTQB 3WFHB 1MPAL 1IC4H 4HBQA 3HZMB 2F53D 1JWMA 1ZV5A 4YUEH 5CBAB 3QG7H 4M48H 1HWGB 1C7SA 3HHRB 4TSCH 4W6WB 1BD2D 2VDKH 2RHEA 1M1SA 4ZTPL 1NCCL 4NUJA 1R3KA 4DN4L 3GMNB 4GMSH 3P9MA 1MIEH 5F96L 1RJCA 3RWJA 1SM3H 4DFIA 1PZUB 1JZ5A 1HHKB 4OUOA 4P3DA 3FB7A 3A6BL 4LLYA 4OT1H 1XF3B 2OTUB 4M61B 2IANE 5L88L 1F3RB 5GGRB 2OYPA 1CGYA 1X5ZA 1S78D 1D5IH 2OCFD 2O5YH 3V6FB 1AD0A 4CNIB 4JRYD 1JF6A 1MCOL 1G7IA 1X5IA 4C56D 2WBJB 5JIPA 2YRPA 1JF1B 2DQGL 1HDMB 4PRAB 4J3WA 2YUZA 1U8QA 5D1QB 5IMMA 2NXZC 2CUHA 1ZVYA 4NRYA 5EUOF 3GKWH 3D39E 4BQ8A 4DAGL 1T4KB 2Y7QA 3QHTC 5E6ID 5IG7B 1YMMB 1MJJB 3OKKB 3C2SA 3FT3A 3QWQB 2CK0H 2FLRT 4HG4J 3D2UD 1YNKH 2HVKB 1N5AB 1EAJA 4NKIL 1ZHBB 5F7WC 3RPIB 3C9NB 1EAPB 2IBGA 4RGNB 1HXYB 4HLJA 4QHKI 4U0QB 5DQDH 5A3IC 1N5YL 1Q9WB 5IMLA 4G9DB 4ZOEA 1PZ5B 4OZIA 1LILA 5CZVL 3AXLB 3OR7A 2AJ3B 3P77A 5T1LD 4D9RE 3MV8E 3HS0B 3DGGA 3KLSA 1JPTL 3MYJB 2PW1B 2DQTH 3QBTB 5KZCD 4G6FB 5DT1L 1UQSB 5CILL 3IKKA 3FFCD 4MJ5A 3AAZB 5L9DH 2DM3A 5D1QC 3K4ZA 3RY6C 3UTTA 1RK1B 4W68A 4G7VH 3SKJH 2HT4D 5D2LE 5GGTA 4XWOC 4CVZA 5HPMB 4OZIF 3MCG1 4JDTH 4RWHA 1V05A 3C8KB 2OS7A 3V7AE 4U1IA 5J12B 2JCCA 2A83A 1E4XI 2C9AA 3PIQA 1QLFB 4ZSOA 2XTJC 1NAMB 3QIWC 3FT4A 2DQFB 1LK3H 2G5BB 3EFDL 5I1GH 5LG1A 4NPYB 3QHZH 4G7VL 1AQDA 3W39B 4JPWH 1RU9H 3G6DL 4ZPVA 3LKNA 1AY1H 4BFGA 1BLNB 1JHKH 3HE6D 4LNRA 4HSQA 4ZNCD 3FO2A 1OF2B 1CL7I 3C6LD 5IP4A 1NJ9A 3IU4H 3DIFB 1FO0A 3H42L 5FECA 3VU2A 3DJ9A 4L3CA 3VA6A 5LJYH 4OCRH 4P57B 4X83A 4WI8A 4CMMA 3S4SB 2IANA 3ZL4H 1QLEL 4WNQA 4HUVA 4MXQC 1CD1B 4OCWH 1UWEL 1XIWB 1KCLA 1JYVA 2EEBA 1YECL 1J05A 3GHBL 3DRTB 3Q0HA 4YBHA 4P5KA 1QFWH 5AUMB 1TNMA 4MB3A 3NH7H 4AL8H 3MSPA 4MNGB 1RZGA 3MUHL 5GSRA 3ARBD 1P2CB 1QBBA 1A7QL 3EYOA 5T5FH 4WEUD 4EVNA 1I8MA 3ZE2E 1V3MA 1QRNB 4HHAB 3IXAB 4P9HH 3WIIH 1RZ8A 3B9EA 2AJYL 1MCIA 4XVUD 1QEWB 5ANMB 3V0VA 3LN5A 2VZVA 1JYXA 4NFCA 2Y07L 3KR3H 4PGEB 5MEPB 5ESVA 2ZG3A 1T0PB 2C3XA 1CXKA 1OGTB 4R4NC 2G75A 2R1WB 2DQJH 4BKLA 3E6HB 2NY3B 3MV9B 3SDDB 1HI6B 2X4NB 3CDGA 3EDKA 4K8RC 3KNBA 4MD5B 3VXUA 4P2OD 1EZVY 1NUDA 1QRND 2K1MA 1JNHA 4U1LB 4YGAB 4MA1C 5A40E 3HC0B 2BZDA 1LDSA 5I1LB 4NDMA 1P53A 5LAXB 2NY1B 1KN2H 2ATKB 3GSNH 1MJJA 5IMOA 1YECH 1CG9A 1BAFL 2FJGA 4R4BA 1A6ZA 3BUYB 1IBGL 2C1OB 1U3ZA 5GRJH 2R0LH 4HUXA 1RZ7L 2W9DL 3L5IA 5E8OB 4YNYA 4GS7B 4KKLC 1A7QH 5T5FL 4TYUA 1A3QA 1QKZH 2I26N 3HNVH 3PJSB 1EJOH 5IOPA 4R26L 1I8MB 1BFOA 3WBDA 1NCBL 2VZ1A 4ZUTB 3ILPB 3PJSA 3VGGA 4OM1H 4PP2B 4LRIA 2QR0A 4NM4L 2DLHA 5GGTH 5J11C 1MI5B 3HRPA 1FNSL 2FECL 3QO0B 2IGFH 3OTTA 3UJIH 4B53A 5KJRH 5HHVH 4JG0H 4PG9A 5GRUH 2VAAB 4WWKC 5ACLA 1CVRA 5IIEA 3P0VH 3BZ4A 1EZVX 3NOIA 3VDAA 3C5ZB 2QSTA 3ARFD 1C16B 1DBKH 2FZ3A 1MUJA 4PFEA 5ETUA 2BNUB 5FO7B 3BWUC 4UTBH 3HC3L 3HZKB 4Y2DB 4OFVA 4KHTL 5DRNB 1AGCB 3PIQB 1NCBH 1NJ9B 4MA7H 4YGVA 4AENA 3PV7A 5F1OB 4CMHB 1WV7T 3SKNA 1CLOL 4HQQH 4PY8I 1QSEA 3DX6B 4P5TC 4ELKB 4WRLA 1BF8A 4H25B 3F7RA 1RIHH 4LSSH 1JTTA 3C5ZD 3G6JE 3U0TA 3ZYIA 4XHJD 2XN9A 4WFFD 5GGRY 2AEWA 4Z78B 1KTKE 1T7WA 1QRNA 2NYYD 4LRNL 4OLXL 2AQ1A 4KKLD 5D6CA 3QI9A 5DI8B 4MLSA 5IVXE 3O6KH 1VGKA 3U48A 3S8WA 1DLFL 3FTGB 1TXKA 4L8DA 2L0DA 1U95B 1D9KB 4OCSL 5CJ8A 1CFQB 3LCYA 5D5MA 3AS3A 2F5BL 4KDTA 5I16B 5TFSL 4MXWL 4ZTOL 4HGKC 1IEBA 3DVIA 3W81A 1NL0L 4GRMA 5IM7A 2I27N 1JTOA 3MZGB 3S34H 4C83B 1HQRA 3S37X 5FO8B 3K8LA 2JJTA 1FIGL 2V5YA 1QFWM 4I2XE 4XPAL 4Z0XB 5IESL 2Y06L 3RX8A 4EUPB 1U8HA 2OR9L 3CSPA 4PLKD 3TH3T 5BV7H 1T80A 3HRZB 3IETB 4QRPD 3RZCC 3ALWA 1CXLA 5GRVK 1WAAE 5B38A 2I60L 4I5BB