4LKXA

Humanized antibody 4b12 fab complexed with a cemx segment
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
214
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGYSITSDYAWNWIRQPPGKGLEWIGSISYSGITGYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCARMGYDGLAYWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment heavy chain
publication title Two potential therapeutic antibodies bind to a peptide segment of membrane-bound IgE in different conformations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lkxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lkxA01
5CBEA 4NQCE 1J0ZA 2AJ3A 4D0BB 1TNMA 4ONFL 2V2WA 3SKNA 4Z5RA 1H5BC 3S37L 4RMWA 3S96B 1FO0L 4LVOB 1YNTA 5F21B 3EOBA 3BP6A 1KCRH 1KYOK 4JFDB 5HYJA 4JAMA 4BSVA 3OF6D 1N2RB 2OI9C 3UZVB 3RZCD 4G7VL 1BD2B 2OQJB 2X40A 4MJ4A 3BD4A 1NCDL 3AREA 5HYQB 1S7UB 5LCVH 1MAMH 4R3SA 1KJ3L 4U1LA 3AS3A 5I1KH 3S36H 2GW5A 3TN0C 5CUSL 4D0BA 4UOW0 5DMKA 4P2RD 4XB8A 4NRYA 4JZNB 1ZHKB 4L29A 2ZSVA 3S96A 1U8LA 3CCHB 4I48B 4CN1A 3VWJC 3VA2C 2BOCB 2IGFH 3OX8B 3IDYB 2VN4A 1N2RA 4P2RE 4S0SD 3SDCC 5FHBH 3I9GH 4KJWC 1V7NL 4WEUD 3RTQA 4P59L 1I8MA 2PR4H 1BD2A 2OQJA 3LD8C 5DZNA 1S7UA 1EPFA 4MCYB 3O2DH 4JHAL 1EVUA 1A14L 4X8XA 3CVHL 2VLKA 1DVFA 3BDYH 4OZIE 3RWEB 4L8BA 4BFEA 5BZDB 1ORQA 5E8NB 3O2DA 3VD9A 3CCHA 4TRPL 2BOCA 3S36X 2R29L 5K59F 3O0RL 1KBGH 2CRMA 5MEOA 4GW4B 2ESVD 1BFTA 3L9RA 4X7FC 4ZOAA 2ATKA 1QYGL 3GHBH 4MCYA 1BFSA 4YHYC 4M1CC 2P43B 5DJYA 5CEZL 5DHYB 5FA4B 3SCMA 2CSPA 2AK1H 2W0FB 3TFKD 1SBSH 1YDPA 4M3KB 1MRCH 2ESVE 3RWEA 5BZDA 4P23D 5E8NA 4U2ZA 5DO2D 4KKBC 3C08L 4BKLB 2CKBB 3NN8A 4JPWL 1DQJB 3RBGA 3FQXA 1IT9L 4NPYB 5SX5K 2YRLA 3U1SH 3BQUB 4DN4L 2ENYA 2VXSH 4HGKC 1BVLB 5F9WB 5DHYA 4TVPH 1KB9J 2C1OB 3QA3A 4ZAKC 1OSPL 2BDNL 3DV4A 4X9IA 3VGEA 5HDQL 4BH8B 4P0DA 3F12A 4JLRB 4X5LA 3RPIA 1X5FA 4XP9L 4A6YB 1JZ2A 5I8KL 5DEFB 1DQJA 4G6KL 3STZB 3KYAA 5HY9B 1EFQA 4WO4B 4NPYA 3MUGB 3HMXH 3DETD 2Z4QB 2IPKB 4HS6B 3KLHD 4A6YH 3FN0H 2C1OA 2IFFH 1L0QA 1FIEA 4ODVH 3ILQD 4N1CA 3O6KL 4BH8A 3HMXA 3VI3F 1KJMB 4JLRA 2WIMA 1AQDB 2A9NL 5F3HA 3VXUA 4A6YA 5EOQH 3KLSA 4JO3L 3STZA 5HY9A 3L5WB 3LRSA 4WUUB 1AXTL 1R3LA 2NY3B 4DFIA 1LP9B 2V9RA 4WFFD 1BIHA 2JB6B 3DYOA 2Z4QA 4S10A 1YJDL 2YPVH 1A6PA 1JVKA 3H42H 1YUHA 3L5IA 3U4BH 2IAMC 2P5EE 3TM6A 1J0JA 1XZ0B 3HR5B 5IJKC 1U3YA 2YUXA 1QPPA 3VG0L 1KJMA 1T6VN 4F58L 1T89A 4ZUWB 1MCSA 3NTCH 3NOIA 1HYSD 4GW5B 2OP4L 3HNVL 4CN4A 1R3IL 3V0VB 1OT2A 3L5WA 3WDHA 1NUFA 2AEQH 1AGBB 8CGTA 4WUUA 3PGFH 3D0LB 4N8PA 4NQVB 3VXQB 1ZANH 4EZMA 5C0NC 5C2BL 5IWLC 3HC3H 3T08A 1C5CL 2A6KB 1XZ0A 4Z7OE 4LMQI 2CRZA 3LHPH 4PP1C 1IAKA 5EOCH 4OCSL 3NCBB 4ZUWA 2NTFA 2PTTB 4NRXB 1S5HA 2Y9RT 2NY5H 2YD4A 3I3BA 4PBXA 3VW3L 1OAKH 4K23H 3L7FB 4XX1E 5E6IA 3JWNC 4Z7WF 1UGNA 3V0VA 3G04A 4JPKH 3UX9B 2Z35B 1Q1JH 4JPVH 4N9GB 4X7CC 1QFWM 4XPBL 4NQVA 2F74A 5DUBA 2Y36H 3GSXB 5C9JA 5L9DL 2EXWD 4YAQB 4C83B 2QQLH 4WWID 1IKNC 4P5TD 1JNHB 5C09B 2A6KA 5F6HI 4YUEH 4KZEL 2O61B 3HTLX 1SJHA 3T0EB 2VQTA 4NRXA 2PXYA 1RIUL 1CD8A 4OZGE 5FM8A 3L7FA 1V7ML 3RX7A 1Y18A 1JRHL 1RJCA 1A4KB 4N9GA 2ICWI 1H5BA 3UO1L 3MRGA 3RI5F 2R8SL 2WK2A 3RY6A 5CGYC 2A6DA 4NNXB 1CI5A 1MRFL 2M1KA 5DVNA 1DBML 4HWZB 2K9UA 1JNHA 5CEZD 5F1NB 4PRAB 2HKFL 1P4BH 1TJIL 2DQCL 3B5TA 3P4NB 2DJUA 5A16B 5JXAH 1Q94A 1NMAL 1N59B 1QFHA 2AJVL 5H35B 3TN0A 2PCPB 3KPTA 3L3OB 1A4KA 2YD6A 3QISA 1KPRB 5CEZE 4GG6F 2BK8A 5B21A 3BP4B 3NCEB 2MJWA 4NNXA 1UQSB 4N1HB 5CMAA 3VWJA 2ZUUA 4YHPB 3NIDF 3SDCA 3T77B 4PRAA 1UEYA 5F7HA 1FYTD 5JQ6H 4HKZB 1P7KA 5ALCL 5HDBF 4HSQA 4WI2A 2QBWA 5H35A 5GGSY 3U4EB 2ARJB 5DHVB 4DKEL 2PCPA 5LXGL 3ZKMD 4D2NA 1HIMH 2B4CL 3C9NB 4FXGB 4OFVA 1CXKA 4X9GA 4EVNB 3FONB 5F7UA 2GK2A 1IGML 1FYTE 2AV7B 1J05A 1XT5A 5DURD 3MJGX 4HH9A 3LIZH 3QWRD 3QRGL 5DHVH 3KWWA 2FL5B 3ULVL 2DM4A 2HKHL 3ESUF 3MSPA 3VD5A 3VXNA 5I15H 4KHTH 4K7PX 3QIWC 1F11A 1MCEA 4UTBH 3L3DA 3AXLB 3U4EA 2ARJA 5DHVA 4UV4H 1NBZA 1AO7D 4FABH 2ZG1A 5EBMB 2HFGH 4FXGA 2G2RA 1YQVH 4C54A 4JHWL 3AS2A 1BBJB 3FONA 4IRSD 5C3LD 1JMXA 3JV4B 1A5FH 4PRHD 3F7RA 3HI5L 2V2XB 3CMOH 3ARPA 1AO7E 1CDUA 4YR6B 4LQFL 2DIBA 3D1MC 5C7XH 2J88H 4WW1B 6CGTA 3QUXC 1AKJD 1CFNB 4NBXB 1V3LA 4C4KO 5KJRL 4PJ9C 5J06A 4ONHB 4EUPB 4OJFH 4UAOB 1U93A 3AXLA 1LEGB 4PRHE 1ADQH 4ZAKA 2DOCA 3G9VA 5EBMA 1LE9B 3L1OL 3QG7L 1YEKH 4TPRH 1BBJA 3BIKB 1A6VL 3L3JB 4LPXA 4G9DA 3FB5A 3JV4A 2RGSA 3EIFA 2RB8A 1REIA 5GS0D 1ADQA 4EUPH 3VXOB 4CU6A 4OZ4A 4NQED 3QQ9C 4X6CE 4YR6A 1IMHC 3T8XA 4B5EA 4WNQB 1NMBH 4WW1A 1ZEAH 2R56L 4U0QB 4XWGL 1CFNA 5E6ZA 2JCCF 5KSAC 4MA7L 2VWEE 3CU7A 4E41B 4EUPA 2YK1H 2X9WA 1LEGA 4FXKA 5FOBB 5D7IB 1QSZA 4NQEE 5KW9L 2R9HD 4LU5L 4Z7VE 3WUZA 1ED3A 3JWOC 3MLVH 1CN4A 1F13A 4LGPB 5HHXL 4OTXH 3QEHB 3MODH 1MOEA 1QRND 2X4NB 4WNQA 4MJIA 5C6PB 4QRPD 3NCCB 4MNQD 4E41A 1ZTXH 3IKCB 1YEGH 4HMCA 1QA9B 3OKYA 4AEHH 3BZEA 2O5YH 4JFOA 3T04D 2NTSP 1R24B 1NLBH 1QRNE 1DBKL 4CJ1A 2FGZA 3S8WA 4QRPE 2UV3A 1YPZB 3OB0K 4G5ZL 4MNQE 4Y89A 5KN5B 4TTGA 1I1RA 3QEHA 4Y16D 3N1GC 5D9SB 4Z7UE 2EDRA 5EPMB 2EDNA 5C0CD 4Q2ZB 3VDCA 3ZTNL 4KKNA 4TSAL 4PGDA 5A3IC 4HLZG 3PQYD 4HXAL 3KG5A 3QEQD 3RDTD 5FUCE 5DJAB 5C0CE 5JUEL 1FHGA 3F65A 4QYOA 4OD2B 5KN5A 1ZK9A 1Y6NR 5MP6H 1ZLUK 5D9SA 4RIRB 3PQYE 1F4WH 1KCVL 3QEQE 5FCSH 1MJ8L 5T1LB 4DVRL 4Q2ZA 4L4VB 1NCCH 4XNQB 3ARZA 4X98A 3OTTA 1MUJB 1A47A 5EUOF 1IKNA 4LAJH 1XF2B 4JVPA 5KOMC 4DW2L 1MEXH 2CIKB 5KVEL 3A0OA 5JQHC 3F5WB 1IAIH 5T1DL 4E0RB 4Z76A 5DJAA 2DQTL 2XN9D 2FH6A 3O45B 1KJVA 4G9FB 4PJCB 5L0QC 5C0GA 1UH2A 4O58L 3UTZB 3DSFL 4PJEE 4S2SB 3HUJE 4WVRA 4RIRA 3DUUA 4I5BA 1LEKB 2DBLH 4M8QB 4NZRL 1FG9C 1SY6L 3GB7B 4L4VA 3S88H 4KTEL 4WW2F 1KUMA 4MDJB 4L1HA 1XF2A 4TSCH 4AIOA 4NQDB 2BNRB 4QCIB 3W0WE 5FO8B 4LFHD 4DUXA 2EH7H 5E94A 1JGLH 1HWHB 3BKJL 4GXUM 4E0RA 1CD9B 2NYYD 4HF5L 3ULVE 3O45A 5T1KD 4M7KH 1WZMA 1F6FB 4PJCA 3E0GA 3HC0B 1OTTC 1BQHB 5DJ6B 4O2CA 5D93B 1KB5L 2VXVL 4P3DB 4YDKH 1WWBX 4J3XA 1LEKA 3NPSC 2CGRH 3AY4A 3GB7A 5FHAH 1B2WL 3U82B 4Y88A 1X5ZA 4MDJA 5KTEL 4ODSL 4YE4H 2YEZB 1MAJA 4NQDA 5FO8A 2VLRD 2R0WH 5AZ2H 3IDXH 4HV8B 4YDJB 1LO5A 4TTDD 2F58L 1FVDB 1ZA3A 3GJFB 4JREB 3H9SA 4P3DA 4DOHE 5B22A 3QFJD 1JGVL 1Q38A 2VLRE 2QSVA 4HAGA 5J8OA 3HE6C 4F7CA 2MTPA 5CZVL 4AQOA 1WK0A 4Z9KB 1PG7H 1J0YA 1EEQA 2YEZA 3GJFH 4X6BB 2OJZL 2NW3B 4K3GA 4GRLB 1VGEH 4BQ6A 4LCYB 3QIWA 1FVDA 4UBDC 1KNOB 3GJFA 5E5MB 4AY0A 2ZOKB 3M8OH 3JV6A 2WBJC 3IGAB 3ARFC 3K81A 1CS6A 3O3DB 5TFSH 5AG8A 4MA8L 4NJ9H 2A0LD 2E6QA 4CADA 1OAZH 4X6BA 2VL5A 2XZCL 1RIHH 4U3HA 3CSYB 1IGIL 3Q6FB 4GRLA 4YHOL 1XGYL 1ODAA 4LCYA 4PJ9A 4L3AA 4LLDB 1BX2B 1U8MB 3WEXA 1L0YA 3PL6C 4QXTB 1R3HA 1NBVH 3DVFA 1DBBL 4NO2B 1SM3L 3HCVB 4WFGE 2VYRE 5TDPB 4AIZB 1SYVB 3EOAB 1E4XL 2HT3C 1GVIA 5DVMA 1ZHBB 2JK5B 2ZOKA 2F53D 4FP8L 3FB7B 3W2DL 3O3EA 3IGAA 4S11A 4TNWK 5FM5O 2ZNWA 1F3DH 4WI5A 4PJGF 3O3DA 3UYOD 3N1FC 4RGNE 1H3VA 1SHMA 3CPLB 3RL2B 1P6AB 1BOGB 1AGEA 4PIRF 3C6LB 1WTLA 3CSYA 4RBPK 2F53E 3DX9B 2PYFB 5KSAA 4LLDA 5T3XD 3JWOH 4QXTA 4NO2A 3HCVA 3RVTC 5GISL 5E2VL 4LLQA 1SYVA 4AIZA 4F3FB 2NY1D 3EOAA 1ZHBA 2APWA 5IKCB 1I1AB 3VGDA 1MPAL 4LLYB 3FB7A 2LTQC 2OL3L 4HS8H 1HOCB 5AWNH 5I73C 4NSKB 5F7MC 5CUSH 4K71B 3CPLA 3VGGA 3Q2CA 1BOGA 2C5DC 3BPOB 3GMRA 2CDGB 2IQAB 4I0PC 3B5GA 1FNHA 1EZVY 5IB4B 5FYLH 5CLWA 3WIHL 3GJEA 4MWFA 5HGBA 3OKLB 4PTUB 5IKCA 4APQD 4P59H 1I1AA 3DRTB 1Z9LA 2COQA 2I9TB 2CDEB 1HOCA 3ZMRA 3AGVA 4YX2L 5KBNC 2VH5L 5EBGA 1F3JB 2EO1A 2CKNA 1YA5A 2IQAA 1JGUL 2XICA 3AS1A 1I9JL 3M1BB 1OLZA 3B9KD 5IK3B 2R29H 4H5SB 2HTKD 3DHMA 1IGJB 5D7LB 3JSSA 4FG6D 4NFBA 1T20A 3DRTA 1A7PL 5ANMA 2C3GA 4N8VB 3G5XB 1U2CA 4YHMH 3TZVD 2WANA 2H3NA 5IV2B 4JZOA 2P24B 4WUKH 2FJHB 4PS4H 5ECJE 3MRJA 5CJQL 4AG4L 1JFQL 3RUGA 5A2IH 5D6CB 5IK3A 4H5SA 1N4XL 4MLIA 2F8OA 1IGJA 5JPNA 4PFEA 1WFNA 2J7LA 3U7YL 1R3JB 5IVXE 3F7PC 5KVGL 3G5XA 3MLYL 4U0RC 4JFPB 1RV6X 2XNAB 3MRNB 4P2YA 3ALXA 5K9KB 3CFKB 5D6CA 3QEGH 5F7EL 4FQXD 4POYA 1OWWA 4Y1AD 1UWXK 5IVNA 4NDMB 4EQ2A 2PNDA 3FQTB 1BFOB 2ZNXA 4PJ7F 1R3JA 3ULUF 5DLMH 3KNBB 3IJSB 2WP3O 3WIIL 3MRNA 4I3RH 1KTLB 3NPZB 2C1PB 4Y1AE 5DWUH 1MNUL 4YQXL 3MBED 5K9KA 2V17L 4OCRL 1BQLL 1G9NL 1K3ZA 1T2XA 1ZVSB 3CFKA 4XP5H 4IRZL 5E99L 5FYKL 4HWEH 4U7MA 2C4FT 1D5BB 1NQBA 1LO3L 2NY0C 3MV8B 4NDMA 1NANI 3FQTA 1J1XL 3DJ9A 5D2NE 2EO9A 3MX0A 3IJSA 4L4TB 4QGYA 1KTLA 2FBJL 4E5XA 1EEUA 5BRZB 5IESH 4N0CC 3QHFL 4K8RL 4LHUG 3HE6A 3KHQA 1ZVSA 3GIVB 2JELL 4FMFA 2FD6L 3H0TB 1HSAB 1TDQA 4X80H 1D5BA 3RIAF 1H8SA 2AABH 3MV8A 1FFRA 1Z5LB 1U6AL 3QULB 4P2CG 4XNUH 2X7LB 4L4TA 5KVFL 1G7JA 4E42B 5I9QC 1MF2H 1N8ZB 5BRZA 2RR3A 3VFVB 5KSUB 4MXVE 1OLLA 3C5SB 1IEBB 2WBJA 4OCSH 5EIQA 4O4YH 2VRAA 1ES0A 3ARFA 4OLXL 4Y5XB 1KIQB 3H0TA 3MPCA 4XTRC 4Q0XH 4N90E 3HAEB 2FO1A 2DQIL 4B50A 4L8DB 5HHNA 1Z5LA 2C26A 5F6IB 5DD6B 3QULA 2J8UF 1PZ5B 1O0VA 4KROB 2H26B 3NFPB 3PL6A 4YHLH 2VZ3A 4OGZA 2DN7A 3BHBB 1HYRC 4MQXC 4M7ZB 1N8ZA 2HJKB 2FEEI 2EDTA 3WFBH 5KSUA 1WWCA 2FGWH 2N4IA 2QADC 3HAEH 2HWZH 4GKSB 3NAAH 1UKSA 3C5SA 5GZND 2V9QA 2GY7B 3BAEL 3BZFA 4PD4J 3FL7A 1KIQA 4EI5B 3FZUD 3HAEA 4ZO6A 4RMQA 4C57C 3UO1H 1P1ZB 5DD6A 2NPLX 1PZ5A 3MACH 4HFUL 3U9PL 2H26A 4R4ND 1BWMA 1GGUA 1RAMA 5LQBL 1DBMH 3BHBA 4LSUL 4OCWH 2VDOH 4HFWB 1SEQL 2RFXB 1MCWW 4R97B 1WEJL 4GKSA 5C70A 3WLBB 3IU3A 3HE7C 5T1MA 5J89A 4OFYA 4EI5A 3UPAA 3S35L 5ISZB 4Q9QH 1JJUA 2NCMA 3Q3GB 4UT9H 4LVEA 1OTSD 5JW4N 1TXKA 1P1ZA 5ILTH 5C86A 5I71B 4AZ8A 1WICA 3MJ6A 2GSIA 4RGOH 2JJUA 1MIML 2NY6C 4HFWA 2RFXA 3O81A 4MQ7B 4EN3C 3KLAB 2E7HA 4HUWA 5EU7C 3LKPB 1ND0A 1YEEL 1BAFH 5CKGA 2DLGA 1MREL 3P11L 5CKAA 5ISZA 3Q3GA 5JOFA 4NN5B 5FGCB 4WFHE 3DUSB 4S0TD 4KHXL 3VRIA 5GZOC 4BZ2H 1F90H 2GFBB 4MA1C 1B9ZA 2LU7A 2AI0L 3F6IA 1AC0A 2EDBA 4MQTB 4J6RH 4LEXH 3MNVB 1A3RL 5JHLH 4U6HB 5BS0D 1MFEH 2BJML 3G6DH 4MQ7A 4JQVA 2VDNL 3VGAB 2KL6A 5D96C 4M6OL 3LKPA 5TDNB 4BZ1L 1UKQA 4YHIB 3DURB 1MVUA 3BH9B 3ROLB 2FECI 2UUDH 1XF4A 5BS0E 3SHSA 3F7VA 5B8CC 2WWKT 2GFBA 4YDIL 2Y7QB 1IAII 4XHJD 4NNPH 4HJJL 5I1GL 1KELH 3I3DA 1K4DB 1MCFA 4KJPD 2UY7A 4R7NB 5D72L 2EKSB 35C8H 4QTHB 5T5FL 4KJQD 1X9QA 5FYKE 5TDNA 2EDFA 1IAOB 3Q6GH 4YHIA 3DURA 4B41A 3V6OA 2J8HA 2Z8VC 3ROLA 1YNKH 5CEXB 3NACL 4QT5B 4NT6B 3CZFB 4DJMA 4G6JL 4X7SH 2JIXB 3DMMD 5JO5B 3ARTA 3QG7H 4NWTL 4ERSH 1IC1A 3W81A 3MJ7B 4M43H 3DYPA 5I17B 3TIDB 4YXHH 3LRGA 2QQKH 1N64H 3HMWH 1K4DA 3MXWL 2IMMA 4R7NA 5DRXB 3V6ZA 2EKSA 4O5LH 1AI1L 4QTHA 2IH1B 5T33H 2QSCL 1EFXD 4HT1H 2VQ1B 5HTSA 3FO2B 3NABL 5IR1B 3GSOB 1I8KB 3BW9B 4NT6A 3CZFA 3VWKC 1LO0L 5D1ZB 1DN2A 5DC0A 2JIXA 1QFWL 1MQ8A 5JO5A 2DQGH 1DUYA 3QXDA 5I17A 5MENB 4UMGA 4RWHA 1IGCH 1NC2D 3MV11 5DRXA 3HC4H 2QEJA 5E5RB 3RVXD 1HN1A 2CPCA 2DD8L 4G6MH 3CDGB 1AJ7L 3D3VB 1OM3H 2B8OT 1K85A 4ZNEA 3FO2A 4PJAE 5IR1A 3GSOA 1I8KA 3QUML 4ODHH 5DEZA 5TE4L 4OLWL 5D1ZA 2IANE 1UADC 3EJZC 4OI8A 5EO1B 5MENA 5IFJB 2OR8A 4M5YH 3SDAD 3KPQB 3V8CA 4ODTL 1GC1L 3UJTL 2IPTH 1W72L 3BGFB 4BQCA 4JB9L 3C5ZC 3ECBA 4U1SB 1NCWH 3EYFB 3IRZA 1HQRB 4GBXD 4QXUL 3S34L 2VDLH 3P9LB 5CFHA 3CUPA 4DK3A 4KUCD 3BGMA 3O8XB 3IFNH 4I3SH 2AK4B 2NY7H 1JTOA 2FHCA 5BOPA 5IFJA 4Q6IB 3VGBA 3Q48A 3WYRA 3KPQA 1HQ4A 2YKLL 5EBWB 1BM3L 2CMRH 1QO3A 4XC3L 2WQ8A 3RQ3A 3UBXB 1KCVH 4U1SA 3EYFA 3NZHL 3PP4L 4PR5B 1HQRA 4TULL 1OTUD 3ZHDA 3P9LA 3WDJA 1MJUL 5CJXC 2Z93B 2XTJC 3BISA 3O8XA 4LCCB 5FKAA 3QDMA 2AK4A 3INUH 4U1HB 1KEMH 3OR7A 1RUML 1F4AA 3U6RA 1YYLH 1RJYB 1NGYA 3VFPA 2E5EA 3GIZL 5T1DH 5EORL 2WZPD 4Z7NF 5KS9A 3FHQA 2K7PA 2NX5A 1C5DB 1XCQB 4WU5B 5EBWA 4JQXC 1OGAA 2XFXA 1QSEB 4RQQB 2E6JA 4R4FH 4WGVB 3VXRA 5AZEL 4NZRH 4WTZG 2R0LL 1ACZA 1KCSH 1CGUA 1MCQA 2FIKB 2Z93A 4JFEB 3RI5K 2ZP0T 3IAPA 4HWUA 4IOFC 3VG9B 4XAWH 3SE4C 2OK0L 1DDHA 3TBYB 1A21A 1U3HC 4X4XA 4XBPB 3ZSSA 4EN3B 3LN4B 4OIAA 3U2SA 4J3OC 1QFOA 3C60C 3BSZL 3RAJH 3O6LL 2NZIA 3HE7A 3MQIA 2CDFA 3T0VA 3GNML 2DL2A 4WU5A 1IFHL 3B9EA 4K7FB 1OF2A 1TNNA 1QSEA 4RQQA 2F9BT 1NSNL 4DGVH 4O51A 1CF8L 2ICEA 1AXIB 4HXBH 4XCCL 3VU2A 3O2WH 3X11B 1IGTB 3D25A 1UC6A 25C8L 4XBPA 4EN3A 5DJZB 1HHGA 1G9NC 1H3XA 3FQUB 1FAKT 2ERJB 3G08B 2NW2B 1R5VB 3WFEH 4OI7A 3IJHA 1T80A 2NY2D 3PNWB 1E28B 4N68A 3UDWC 1LO2H 4YDLB 1SYSB 2XWBB 5B8CB 1KV3A 1YY9D 4ZD3L 2A77H 1DP0A 1INEL 4H0GA 3AUVA 5D1QB 2XQYG 1FL5B 3VXTB 5K59E 1V05A 1Z3GH 3TYGL 4K8RC 5DUMH 4Y5VB 4KK9D 2OJZH 2P5WB 5DJZA 2HT4D 3AS0A 4LPVA 3FQUA 4P2OC 5L8LB 1K8IB 3CFIC 4IS6B 2NW2A 2ZCKL 3VFRB 5BMFL 2FX8H 4ZFFB 2F54D 4JN2B 1AFVH 1JNNH 1MCRA 3C2SA 4XCYB 1E28A 3LH2H 1KXTB 1T4KB 1T1ZA 4KQ4H 3H9YA 1TETH 4BFIB 1SYSA 2XWBA 4IJ3B 5IB5B 3ES6B 5B8CA 5HYFA 4RCAA 3TA3C 1UWEH 4JRXD 2XQYK 1P7QD 5DEGB 5D2LF 4S1DD 2F54E 3VXTA 5IT2H 4BM7A 4RMTA 4PJDB 1OCWL 2E27L 4NKQB 4Y5VA 1I3GH 2P5WA 4DCQA 4NHCH 2GT9A 2AKRA 1IGIH 1K8IA 1XGYH 1IQWH 4IS6A 3DVIA 4JRXE 1AR1C 1YZZA 1SM3H 1DQQA 4XCYA 3VWKB 1T4KA 1E4XH 1VFBB 4U7SA 4JCMA 5TF1L 4BFIA 2DWEB 1MFCL 3LEXB 3ES6A 3EO0B 1T2QH 5IVZA 1Q9KA 2X9YA 1C7TA 4M62H 2WUCH 3RY5A 2CH8A 5B38B 4H26B 2ZCHL 3BEWB 4Q58C 1KSRA 1AP2A 1RPQA 4PRBA 3MRKB 1T5WB 4LRNH 2J8OA 4F80A 4MCZB 1CFTA 4KKAD 1EHLH 5IBUG 4L1DA 2DM3A 3CX2A 5GISH 2WUBH 3VWKA 5JA8B 1Q9OB 3EO0A 1BVZA 1NGZB 3VI3E 2I24N 4IM8A 2DQUL 1J1PL 4TQEL 4H26A 3B2UD 4Q74A 3V52H 4R2GB 3NCJH 1OP5H 1UYWL 4Y4FC 3P4LA 5DD0L 3BQUD 4ELMF 3JBG7 1I9IL 1EIBA 1SJEA 4MAUH 4MCZA 4FQHB 2BOBB 5ACZA 1CVSC 5ICXB 3RU8L 4Y5YB 2BVQA 3SQOH 1QSVA 1A1OB 3BE1L 4I2XB 2V5RA 4YX2H 5D7SL 3B8YA 5D7JB 1CLCA 3LB6C 5IMOB 3C5ZA 2CLZB 5E8DH 5B39G 5LVEA 3BPNC 3CFCH 5DK2A 1YYMH 2P46B 2BZDA 5J13B 5EWIL 4ZXBC 1MCBA 4FQHA 3OKMA 1I9JH 1S7VB 3RNQB 1I3VA 3VXSD 2CJUH 3P0VH 4IOIA 1WZ1L 4Y5YA 2F5AH 1JHLL 1MHCB 5I1HL 1A1OA 2APBA 2GTWB 5FYJD 3EFDL 1K8DA 4I2XA 4HUXA 3FOLB 4OAWA 3QXWA 4LNVA 3VXSE 4M6MH 3EYSH 3FQRB 4GRWF 4R26L 1MHHA 5IMOA 3SKUD 4Z7WE 3ZDYF 1INQB 1UKTA 1FN4A 3I84A 1MCNA 4G8GA 4I13B 1HHHA 1YC7A 1YEIH 1CXLA 3V2AR 2R4RL 4Y4KC 1S7VA 4OCYL 3RNQA 5IM7A 2ICCA 5E00B 1NMCB 3WJJC 4AM0A 1HHIB 5GGRB 2LE9A 4N0FA 3KR3H 3GBMH 4JQIL 1WFUA 4I4WA 4F7TB 2DICA 1KIRB 4ISVB 2D0FA 1F5WA 3FOLA 2D0GA 3E1F1 3MJ9L 1OY3B 3FQRA 1N0LA 3VD7A 4M1DL 3QG6A 1INQA 2SEBB 3TCXA 5C08A 5DMIH 5TH2B 1ONQA 4PRPE 2NLJB 1A7NH 1J0IA 3SE4A 4F8TA 1F6AB 5C6TH 2APFA 3QQNA 5MEPA 1HHIA 1XAUA 5GGRA 5E4EC 3G6JF 2EEDA 4HK3N 1TVBB 4H88H 3ZYOA 1S5IH 5C92A 3QAZB 4L8SB 4MHHG 3P77B 4XVJL 1AGFA 4NHUB 1PY9A 3SKMA 4PY7B 2SEBA 4GG6E 3TO4C 1BQLH 2V7HB 1G9NH 4UDTB 4JY6A 4OUUB 5LGHH 5F1KC 3WUWA 2NLJA 4MA3B 5E8PB 3D18B 1CLYH 2B0SH 1FNSH 1RFDL 4TUJA 1CFSA 5ERWB 1ZSDB 2M26A 3MV7B 1EGJL 1WUNT 2KBGA 5HSFA 1TVBA 1I8IB 5CSBA 1YN7A 5ESQB 2JLLA 3DXAD 5HDBE 3SDDB 3IDJB 1CU4L 3GSQA 3P77A 5ADPL 3UDWA 4HIEB 5DS8B 3C2AL 5E7FA 3MBXL 4DK6A 2V7HA 3LQMA 4LDLB 4R90H 3LN5A 4UDTA 5JLZB 2AJSL 4OUUA 2YA1A 3DXAE 4LKCB 4MA3A 5E8PA 3VJ6A 1JGDA 3WKNA 3GKWL 4GKZB 1X44A 1KPUB 3DIFB 1MCOH 3WXWL 1ZSDA 5IFAH 3MV7A 4MJ6B 1U6AH 4O2FB 4P2OA 4JCLA 3SGKC 1YNLL 3ZKQD 3ZE1F 1GC1C 4NQCB 1P7HL 3QNYA 3SDDA 1HINL 3IS0X 5IGXH 3K2MC 1IC5L 1N5YH 2W0KA 4C59B 3S4SB 3BMWA 4WDIB 4HIEA 1G9EA 3HRZB 2R69L 3QWOB 2DLHA 4MB4A 3PWNB 3K1KC 5JLZA 2IBZX 3ZKXB 3MC0A 4LKCA 4CW1B 3GHEH 2D7TH 2VMFA 1FZMB 4XCFL 4GKZA 1HI6A 1KPUA 1OQXA 3VXPB 2OM5A 3TBWA 4O2FA 2D9QB 3T0DA 1KENL 4X83A 1QKZH 4M1GH 3A6CH 43C9A 4TN9A 4U1NB 3RIFK 1CFBA 4OLVH 3S4SA 5IB3B 3RZCB 1VKXB 1X5HA 3BRGC 3LSOA 4K3HA 3QWOA 4GAFB 1MCIA 4WJ5A 1WF5A 3N1PC 1KTDB 4D0DB 5D71L 3MJ8B 2YC1B 2VZTA 3MUHL 4JFFD 1D5XB 3ESVF 5I74C 4CW1A 1KLFA 4P2RB 5E08H 1FZMA 3TWCH 4X9FA 2XIDA 3VXPA 4KK5D 2IADB 5C0DB 5DRWB 4FTVD 1MIEL 4EI6A 2JCCE 4A2LA 3TBTB 4JFFE 5AUMB 4U1NA 2MQ0A 3FFDB 4M5ZH 2WIIB 3IFOA 1CBVL 1EEZB 4L3CA 5FA3A 5IB3A 5ID0A 4OZIB 5I30L 1VKXA 3GBLA 2NR6D 4HH8A 5DJ0A 4H0IA 3TVMD 4FTVE 4NNYB 5CINL 4NKDA 4D0DA 3MJ8A 2YC1A 1D5XA 4IOSD 4P2RA 3S35H 2YPLD 3HNSL 4RISH 2IADA 5C0DA 2DQDH 2EE6A 3OKKB 3KPOB 3BPLC 3TBTA 3T2NL 2DS4A 2O5XL 3BN9D 4DEPB 2WIIA 1EEZA 4IIQB 1JPSL 2B2XL 4OZIA 2AGJL 2YPLE 4OLYL 2ESVB 1XCTB 4Q6YA 5D1XC 5DSCB 4P5KB 1CE1L 5F7FA 5DD3L 3VE0B 5D5MA 1KT2A 3DO3A 5C07D 2YUZA 4YO0A 4I0KA 1IKFL 5IHZB 1INDH 2MOVA 1WJ3A 2AJYL 3BIAX 3REWA 5I8OH 4MDIA 5CEYA 5GSVB 4HC1H 4P23B 4RAUA 3U36B 2AJZA 2WV3A 4ZXBA 2CUHA 1I7ZA 1MQKL 3KPOA 5C07E 4MNGE 4PY8J 1B88A 1AE6L 4OZFH 1OWRM 1M7IB 2ESVA 4HC1A 3GBNH 5HGDA 4ZSOE 1MH5B 1GOGA 4GMTL 1HH9B 4P5KA 5E8OB 4XPHH 4CRPA 2EZ0C 3T0WA 3MCLL 3EGSB 2I9LB 3CGTA 2V6HA 3P30L 4OBRA 4POZD 4U1IB 5JHDD 5EIIA 2AXFB 5IHZA 3F6LA 4OZFA 4XNXH 2PO6D 5JW4R 1F6LL 4Y0GA 2Q8AH 1HH6B 1F00I 5EC2A 5GSVA 5FDWB 1UM6L 4P23A 5DQJA 4K3JH 1H0DB 4Y4KA 1ZXQA 2CIIB 2OJEA 5GRUL 5JHDE 4J3SA 1KCLA 2OR9L 5EU3B 1OPGL 4WEMB 5EUOE 3F7QA 1MH5A 2B1AH 1A9EB 4UB0L 3GO1L 5E8OA 1VDGA 5DGRA 4GMSL 2I9LA 4FFZH 4U1IA 2AXFA 2EIZA 3I6KA 4NM8L 2ZUQC 5MERB 1HH6A 1NBYB 5H37G 5KAQF 3UYRH 3QDAA 5FDWA 1QLFA 3QO1B 3KJ6H 5IB2B 3ARGC 4PV8A 4X5WB 1H0DA 2J5LC 3OV6A 4GOSA 5I76B 3N50A 3ARDD 4FQJH 3DRQA 2P5EB 2Q86B 4HGMA 1FLTX 4WV1C 1GZQB 2MPAH 2AS5M 3WNPA 1AQKH 2VSCA 2CR6A 4XMLL 5L88L 4YBHA 5T1LD 3U0WL 1IEHA 3EDEA 4MX7B 1DQML 2FSEB 5MERA 1NBYA 2A73B 2R9HC 4LLWA 4FQPA 3TO4A 3QO1A 5C0FB 4HWBH 5IB2A 2JB5H 4X5WA 1PJ9A 5I76A 2ZKHL 2Q86A 1R3KA 3WO3B 4JY5L 2AAVA 1X6LA 1JWUB 1G7QB 4HWBA 5SWSE 3HI1B 3ZT7A 5I6XB 4L5FL 1E6JL 2DL9A 4FQIL 3OZ9H 2HLFD 4GQPH 1KLUB 3L5XH 5J6GB 2YD3A 3V6BR 3KYOA 4MX7A 1RK0B 2UYLB 2A9ML 4X6EB 1HKFA 5C0FA 1LDPH 2GK0A 3PABB 3RFZC 2Z0BA 4OGXL 4LASH 3RJDA 2DQHL 3QUKB 4GH7B 2HG5A 2WBKA 2XQBL 4C56D 4EBQH 2H9GB 4EDXB 3W5MA 4O00A 3IFLL 4F33B 5ICYA 1JWUA 3QIBD 1G7QA 4OCXH 3F8UB 1A6WH 3HI1A 4O02L 1WCBB 3GMNB 4ZOBA 3RIAK 3S34H 3SGKA 3EHBC 5I75B 2AJXH 1V3MA 1GGIL 4OZGB 5J6GA 1IAIM 4P5TB 5TQ0H 2IG2L 3GM0A 4C56E 3MR9B 4LCWD 2UYLA 4XPFL 4X6EA 4MXWL 1CQKA 3VFSB 4ZTPH 4UIKH 1NEUA 3S37X 2VABA 3QUKA 4DZ8A 2XI9A 2DQEL 2H9GA 4PRDB 4EDXA 4M7LL 4F33A 3SKJH 5IHUL 4LCWE 5ELIA 2BC4B 3JV5A 1E4XI 4BUGA 4MZ3A 1WCBA 3U7AA 5FGSA 1CG9B 1FFOB 3CK0H 4OZGA 2R4SL 4HK0A 4DQOL 4X8JA 1FCCA 3P4OA 4N9OB 1RUPL 4H1LG 4P5TA 4XVTL 4JM2C 3QQ3B 5TDOB 3DHJA 4NZUH 2FCBA 3MR9A 4ODXA 5E4IA 3WFDH 4X7TB 1IVLA 2OMBA 5A2JH 4ZFOL 4NKMB 3DECA 1T7WA 4QRTB 2FB4L 2G5BB 1KC5L 2JJSC 1Q0XH 4UOJA 4PJGE 3TYFA 1E0OB 3UTOA 3ARBC 4HCRH 4HUKB 2FJGB 3GM8A 5I1IL 3QI9C 2XY2A 3PGCB 1CG9A 4FNLH 4OLZH 1FFOA 3HZKB 1R5WB 2D03L 2BY0A 1OQOA 2VR4A 2YOCA 5TDOA 1DQLL 4HCRA 2V5TA 3QQ3A 1VADB 4UIMA 4X7TA 3V0WH 1YMMD 2GYSA 5CCKH 1FYTB 4QRTA 2NXZC 2NYYC 1TZHB 2EE3A 3BFOA 1R0AH 2G5BA 5C8JB 3T1FB 3NVQA 5DVLA 2HFEA 4PREA 5JZ7D 5L2KD 5JW3H 4QLRA 1IE5A 3H2WA 4YWGH 3QZWA 1YMME 3KS0J 2Z92A 3BP7B 3UZQA 4XH2B 3FMGH 1DLFH 5F71A 5AYQA 1GZPB 1FLRH 2VL4A 3WXVH 4UV7H 1Z9OA 4DKFL 4F9LC 3HZKA 5K9QI 1R5WA 4L9LC 5E8EB 1VADA 4CVZB 5D1XA 3K7UA 5L2KE 1ZLWH 1FYTA 3RUGF 1TZHA 1EMTL 4X6DF 3VFUB 1GGTA 5AYUL 5C8JA 5I1LB 5GGQL 3C6LD 1AO7B 1EERB 5JDSA 3NCYS 4ZMAT 5CSZA 5TE7L 1P4IL 1I1FB 3AROA 4XP1H 1Q0YH 3BT2H 4HBCL 4IRSB 5E1AB 2DQJH 2R1WB 1SVCP 1GZPA 1S9XB 4QWWC 4PRHB 3B9VA 3QWRA 5E8EA 1HWGB 4CVZA 1FIGL 4XPGL 1VFAB 3NFSL 1FNGA 3CLFH 1AKJB 4RWYH 3VFUA 3FFCD 4UQ2A 5ENWB 1FJ1B 3S3SA 4N0UE 2BVOB 5F9OL 1MCJA 2NNAA 3MLXL 5F44A 5TF0A 1H9VA 4P4KD 3SGJC 1AO7A 4X6CB 1NLDL 3ZTJG 3QDJA 4D9LL 4KKCD 2AXGA 2DI8A 4JPIA 3T4AB 4QRRD 4IRSA 4XPAH 3VFNB 4GSDH 4WY7L 2R1WA 1CK0H 3FFCE 3MLSH 2J12B 1T5XB 1S9XA 4YHNA 1S9VA 4PRHA 5KG9B 5DMGC 1HEZA 1J0HA 4NQEB 4Y4HC 1VFAA 1BEYL 2XG4A 2JJWA 2E27H 5J6HA 4Z7VB 2GITB 4QRRE 2A6JB 1UCBL 5ENWA 3U7WL 1P6FA 2BVOA 2D7MA 2VXQL 4FFVC 2R23B 5DMJB 5GS0H 4X6CA 4WWKD 4JM4L 5DTFB 3W9DA 3F58H 3T4AA 5KVDL 3IF1B 2XKNB 3OXRB 4FQ2H 3CXDL 2YBRA 2YA0A 4BSJA 1T5XA 3ULUD 4PJHF 4GAGL 1F4XL 5KG9A 3AB0B 3C5JB 5CJOH 4NQEA 2YWYA 1QRNB 2ED9A 2X4RA 2QL1A 2GITA 1QLEH 1XGUA 2F5BH 1KJ2L 2A6JA 4QRPB 3LOWA 4MNQB 3ULUE 5T5NG 2R23A 2JJTC 3CFDB 4IDJL 4Z7UB 1CDBA 1WQVT 4Y2DC 1DSFH 1G7MB 2R0ZH 5DTFA 3ELAT 2BSTA 1AY1L 1OP3H 3IF1A 3OXRA 4HHAB 1T1XB 2DQUH 4G8FB 5HHMD 1U95B 3MLPA 5J56B 5GRWA 1P4LB 3C5JA 3RGVC 4ZS7L 2FYYB 2VZVA 4Y16B 3QQ4B 1ETZB 1QRNA 3ZKND 5C0CB 2IQ9L 3B2VL 1Q9LB 1BPVA 3RHWF 1WC7B 15C8H 4MNQA 1G6RB 5HHME 3UTTA 2VIRB 1JHKH 3CFDA 4Z7UA 3PQYB 2NY4D 5CD3B 3QEQB 3QXVA 3C8HA 3RDTB 5CILH 4APQC 1JN6B 3L95B 4HHAA 1WGOA 5FF6A 5F7LB 4LMQE 1WFTA 1IQDA 3UTSD 1G6RH 1HK6A 2FYYA 5HYEA 4LVHC 3QQ4A 2H2SD 1I7UA 3MRFA 2G75B 2HMID 3ZL4L 1EJOL 3CD4A 2FRGP 4R8WL 1ZHLA 3QJHA 3B9KC 1NEZB 1G6RA 2NXYC 2ITDB 2VIRA 4PJEB 3UTSE 4P99A 3HUJB 3PQYA 5EFIB 2BRQA 5CD3A 3RDTA 4C58B 2RCSH 1AD9B 1XR9A 1JN6A 5HGGS 3NMEA 2P48B 1KEGH 1RSFA 3GZKA 3L5JA 1JCKA 1XR8B 2APXA 5ACMA 4YZFF 3W0WB 5TE6H 3QUYD 1PLGL 2OZ4H 5CHNB 5JIHA 2J8UE 1NEZA 2BVTA 4J4PD 2ITDA 4C55A 3O9WD 4PJEA 3EDDA 4JM2A 4S1RL 4JDTL 5J11B 2YPKB 1U8PA 1X7QB 4QO1A 1OAQH 2OZ4A 2M8XA 2XN9A 3NGBC 5T1KB 2VSDA 3OB8A 3CC5B 3N85L 3S3PA 2JJSA 1D9KC 3LMJH 4M1DH 3ARBA 5FM5M 5IMLB 1KCKA 1TZGL 3NBNA 1I9RH 3FQWB 4UINH 4KUZL 4JO2L 3U4AA 4C4KT 1P5UA 3E3QE 5CHNA 5BZWA 1RZ7L 5J1AB 5HXMA 3CFEB 1MFBL 3QCVL 4DOHB 4U1KB 3KYKH 2AEPH 2X4UA 2VLRB 2YPKA 2O93L 2EE2A 1X7QA 3SDXF 3U0PB 3MUY1 1XF3A 1TITA 1U92A 4HIIB 1PX4A 4RSVA 2XA8L 1JF1A 4PPTA 3K4ZA 3QDGD 3V7AE 4X99A 1E27B 5D6DA 4P9MH 1KCRL 5IMLA 3FQWA 5EOTB 2DQFA 3VFMA 5JXEC 4OF8A 1I85C 4F9LA 1GOFA 5J1AA 3KS0H 3CFEA 43CAA 4U1KA 4BELD 4PJXA 3QDGE 2Z8RA 4PGZA 5LCVL 2VLRA 1MAML 1TPXB 5I1KL 3S3JA 5GRVK 3S36L 3U0PA 4OGAD 5IQ7H 4WHDA 1S7XB 4S1QH 2ITCB 4X5XA 4HIIA 2LU4A 2OS7A 1E27A 3H3PH 3QFJA 2IGFL 4NOBA 5EOTA 2ZSWB 3IDNB 4W4NA 1CICC 3BKCH 1JZ6A 2QLVB 1LNUB 2D4FA 3I9GL 5FHBL 4U49A 2PR4L 5HJ3A 3PIQB 5F7DB 5JIPA 3O2DL 4HUUA 3VCLB 2J3SA 2QSQA 2EE9A 1S7XA 4BH7B 4TOYH 4H8WH 2ADGB 3BDYL 2YRZA 4N0RA 2YR3A 1RQ5A 4RGNB 1DEEB 1F8TH 3L3HB 4UQ3B 2F53B 1KBGL 2FH8A 4MAYD 1S9YB 1RI8A 3E6FA 5GRVL 1Z6JT 5C0IA 3BYTA 3PG2A 2EDHA 2AJUH 4ZO8A 5F7DA 5IQ9A 3GHBL 1EAPA 5DFTA 1KF9B 4ONOA 2RAMA 2ORBH 3VFOA 3K2UH 3VCLA 3OKOB 2AK1L 1GGBH 1WCQA 1SBSL 2N7BA 2X44D 5DXWA 4YJZL 1DEEA 4EDWH 2NY1B 1VACB 2PW2A 4QHUB 3OSKA 1K5NA 3K3QA 3FCTA 5HHOD 3L3HA 4UQ3A 2F53A 3GSWB 4OM1H 4KI5C 3I75A 3WS3B 5E9DD 5T3XH 5IW3A 3U1SL 4P46C 1NAMH 4XNZB 2VXSL 5HHOE 4TVPL 3OKOA 2EICA 3BEVB 4R4NC 4O9HH 5E9DE 1NAMA 4HMDA 3RX5A 2JJTA 2PETA 2NQCA 4Y2DA 3O41A 4RGMC 2KDGA 2R2HB 3GSWA 1DZBA 1WLHA 5JW5B 2ZUSA 1S9WB 3RGVA 3HMXL 3RP1A 2FO4B 5GS2H 5FUOH 4JGUA 4ZUVB 5CJ8A 3IYLW 4A6YL 2DIAA 4XI5C 3FN0L 1FSKC 2IFFL 4XVSH 4ODVL 3BEVA 4KRPC 3D69A 3EUUA 3IFPA 4ETQB 3RVWC 4WI8A 4ZUTB 3UC0H 1I9EA 4G80A 4ZODA 3EJYC 4AL8H 4APQA 1KB5B 5EOQL 5HGHB 4R4BB 4Y2OA 1EHXA 4W4OC 5IBLC 5C0AD 4J1UB 2BSRA 3MRMA 5JW5A 1TZIA 1MHPH 1IGFH 3TZVB 3LZFL 3SPVA 2L7JA 4F15C 2YPVL 4RFEB 3H42L 4ZUVA 2YUWA 1M05B 4LLVB 4D8PB 5KS9F 1MI5D 5IVXB 5C0AE 2VDMH 3B9KA 4ZUTA 3MLTA 2G9HB 3NTCL 4R4BA 4F7MB 1BLNA 4J1UA 1MI5E 3ARED 2AEQL 1UA6H 3PGFL 1EX0A 2C3XA 1QHOA 4XMPH 5HYJE 3QXUA 1ZANL 2XOTA 4RFEA 1J7VR 1M05A 3C8KB 3P0GB 1L0XA 3BUYB 1T21A 3HC3L 1DFBH 3LHPL 3O2VH 4FQXB 5EOCL 4KJPC 4Y1AB 3HPLB 1EXUA 1OPGH 2G9HA 2NY5L 4HIHB 1OAKL 4KJQC 3RTQD 4K23L 4NWUH 3GMOB 3KYMB 4JPKL 2HVKB 4FFWD 3KVQA 1C16A 1Q1JL 4JPVL 3CDYA 4Z7NE 5IJVA 1EVTC 4ZG1A 2VLKD 1DVFD 2Y36L 3MBEB 5DVKA 2QQLL 4HJGB 4N5UA 1T83C 3BUYA 5D2NB 3T09A 4YUEL 4FQXA 3WO4C 5B4MD 1UVQB 3FO1B 3L7EB 4UT7H 4Y1AA 3HPLA 1C1EH 2VLKE 4KRLB 4Z18A 1DCLA 2ARWA 3GMOA 4HKXB 2EDQA 4I18C 3A6OA 2HVKA 5JORB 1AC6A 3GMPB 3UAJC 3KDMB 3OJDB 1C12B 3R06B 3SCMD 5IHLB 3TBVB 2XKUA 3MBEA 3M45A 4RNRB 3V7MA 4HJGA 2Q20A 1PQZB 1LE5A 5JXEA 5D2NA 1AD0A 4XVUC 4BQ9A 1P4BL 3FO1A 4WHCA 5JXAL 3RWFB 3TT1H 1JYXA 1UXWB 1VFUA 3FB8B 3B4NA 3K1DA 4HKXA 4WHTB 5JORA 3OGCB 3M17B 1C12A 2OL3B 3R06A 1FCGA 4M93B 4HKBB 4UZGA 3TBVA 1FP5A 2W60A 4K7PL 2ILLA 1CICA 3DYMA 4PY8I 3DO7B 1OW0C 1QHPA 3MTRA 1J8KA 1TQBB 4OD1H 2Y5EA 5JQ6L 1K4CA 5F96H 4EUPG 1NFDA 3V5DB 1UXWA 1XGRB 4MXQD 1HIML 3FB8A 1NGWA 4UILH 2YD5A 4I77H 3O3BB 3D39D 1QVOB 4LAQH 4PTTB 3M17A 2BHYA 1DQDH 4HKBA 3VRJA 4JRWA 3HG1A 3LIZL 1KB9K 3DO7A 3UMTA 3DOSA 3QR2A 3CFBA 2V2TB 1A9BA 3OXSB 3VXUD 3D39E 2I5YH 3WV0A 5D2LE 5I15L 2DQEH 3EFFA 4KHTL 5F1IB 5DI8A 1RZ8B 4O2EB 4ETYA 4NZTL 4UTBL 3V5DA 5HHQA 3MLWH 5KSVB 4OZHA 4UV4L 4FABL 3QIUD 3DGGB 5C0RH 1OD7A 2HFGL 1QVOA 3IDMA 1YQVL 3VXUE 2X89D 4PTTA 3MCKB 1QBMH 3TNNA 5IIEA 2NMSA 3LPGA 3BJLA 3FRUB 1A5FL 1TVDA 5HI4C 4U6XB 2GI7A 3CMOL 4JO1H 2DLFH 4TSBH 2FB4H 1UCTA 2R2EA 2UVFA 3OXSA 4JG1L 5C7XL 2J88L 5DQ9B 1U8JB 3W9EB 2W38A 1NL0H 4DVBB 4P46A 4O2EA 4OJFL 3AU1A 2F8VA 5I1IH 1ADQL 2WWMD 3DGGA 4KWUA 3MCKA 1YEKL 3X14B 4IRJD 1T1YA 3FRUA 5CAYB 2FEEL 2NZ9D 2Z9TA 4JR9H 3QNZB 1NMBL 2BY1A 5F9JB 1ZEAL 3W9EA 4F57H 5E6ID 4LBEB 4UTAH 1N5AB 2IJ0C 1LK3H 1NFKA 3K0WA 4ELME 4YPGB 3MV9D 5E1HB 2VDQH 2YK1L 3J7HA 2VR5A 3CFJB 4FZ8H 1HXYA 1PX3A 2DI9A 4HS3A 1QG3A 5DRNB 3G6AA 2WP3T 5FO7B 4U6YB 3ULSB 4HULB 2X41A 5BS0B 3MLVL 4WHYH 3ETBF 3T3PF 4PP2B 4NYLB 3MV9E 4NC1C 3HA0A 1NC4A 2FEDC 2BFVH 4OTXL 3MODL 1BGXH 3RA7L 2LAGB 5AYUH 3BH8A 2PXYD 3SKOA 1IM3B 4ODUA 1N5AA 5KVMC 4XNYH 4YGVA 5TGBA 4QRUA 1ZTXL 1SJVA 1YEGL 4YPGA 4LDEB 2E7BA 4AEHL 4A2MA 2O5YL 2UZYB 3H8NA 5DRNA 1NLBL 1HDMB 4LHQB 5FO7A 2GAZB 3MYZA 3ULSA 4NN6B 2X4QB 2GJ6D 3WJLA 4XPGH 4HBQA 1CFQB 1AGDA 1PW3A 5JMOC 4KPHH 5GGUB 3CH1B 3K46A 1W0WB 4LIQE 4QTIH 4ZOEA 3TN0D 5EZLA 2Q3ZA 4NQSA 4DWHA 1IM3A 2GJ6E 1FAIH 4D9LH 5HI5D 4GRWE 3DMMB 1ZT1B 3ZDYE 3IDYC 3EBAA 5CP7A 3B6SA 2JE8A 5EZOH 2X4OA 3LKOB 3VWJD 1IBGH 2GAZA 4PRNA 2UZXB 4GW1B 2X4QA 1HE7A 5JR1H 1N0XH 5IEHA 3SDCD 1CGSH 4KJWD 2G60H 1YEHH 3R0NA 1PKQA 3BWUC 5FCUH 5D7JD 4UNTA 3C87A 5MP6L 2Q8BH 1EFXB 1F4WL 5GGUA 3CH1A 1UM4H 1W0WA 1IC4H 4YBQC 1D6VH 2FECL 3BZ4B 1BMGA 1NCCL 3OAYH 3DMMA 4YK4B 1YEJH 5ACLA 1T83A 1JWMB 5DK3A 4NP4H 3RWIB 3V4VH 1MEXL 2OCFD 3WD5L 4PJAB 5DYOA 5DD5H 3X3GL 1IAIL 4GW1A 5DT1H 1NC2B 3LEVH 5IHBA 3GMLB 2BNQA 2P49B 4XRCB 2IANB 4NUJB 1F4YH 1D5IH 3G6JE 2V5YA 5BVPL 1A7OH 1F45A 2GUOB 3TBSB 2BY2A 2DBLL 3WKML 1QBAA 2X5PA 1LEIA 3BZ4A 4DGYH 3S88L 4G6AC 1AY1H 1FL6B 2X1QA 1LWRA 5DA4A 1JWMA 3LAFA 4KKBD 4TSCL 3SDAB 4FQ1H 4PJAA 2GJZB 5D70H 2DYPD 1X5JA 2EH7L 3B2UC 1JGLL 3TPKA 2VKXA 1M6OA 1NC2A 3BQUC 2GCYB 4M7KL 3GJFK 4JGJA 5F9WC 3ROOA 1LK2B 1S78D 4GBXB 3UPCA 1JNLH 3VFWB 1HZHH 4F37F 3GI9H 4YDKL 2GUOA 3TBSA 2XT1B 2CGRL 5FHAL 4ZAKD 1FV1A 3CSGA 5JNYA 1R5IA 3B3IB 1I7TB 4XPTH 5GGVH 2C3HA 2XY1A 4WO4C 4YE4L 1TTGA 3SDAA 2GJZA 2R0WL 5AZ2L 3IDXL 4K2UH 3FQNB 3MUZ1 1S8DA 4R96B 2GCYA 1JF6A 3DX7B 2EH8H 1LK2A 2X42A 3TPUA 4GBXA 3MRBA 1DLHB 1NFIB 4HX1B 4ZFGH 3ZE1E 4KJYB 3HI6H 3B3IA 4MB5A 5HI3D 5BW7A 4Q9CA 1VFMA 3KLDA 3WFZA 4ZFZA 3HR6A 1PG7L 1IC7H 2XTLA 1CDYA 5IF0B 3TJEH 3T0BA 2NY3C 3FQNA 4PJBF 1VGEL 2BCKA 2X1PA 4R96A 4X4ME 7FABH 3BKYH 1B0RA 3MGTA 4MVBC 2VITB 4MJID 3MRPB 4NKIL 5CD5C 1RUAH 2DKSA 1DLHA 2W91A 5CP3H 4BUHA 4HX1A 3M8OL 2IAMD 1EUTA 1T1WB 2EIEA 2EKJA 3PDDA 5TFSL 4MJIE 4NJ9L 5GS1B 5CP3A 1NGPH 1OAZL 2P7TA 1IM9D 3BXNB 4OF5A 5IF0A 3IAQA 2HJFA 1RIHL 2NY5C 2WBWB 5HPMB 3EO9L 1MCDA 3WHE1 1CD0A 4MNHB 5GRJH 4NQCD 2VITA 1NBVL 2P8MA 2CQVA 3MRPA 3RY4A 5D5MF 3EYQC 1CLZH 2YRPA 1JPGA 2ZG2A 2DDQH 1U36A 1NCAH 5FK9B 5C0ND 1BVKB 5K93A 1YMHB 1N3NB 3P40A 4BA8A 4BYHA 3S6CA 4RMSA 5GS1A 5DJ2A 4QHLB 4CMHB 1ZWIA 3BXNA 3E6HB 4J3VA 1QFUH 3TIEB 2NY2B 3SOBH 2XA8H 2XZQH 3RY6C 3MOBH 5HPMA 2X4TB 3Q5OA 3JWOL 4MNHA 3ALPA 5HHVH 1ZGLM 4ZPTB 1WAAA 1S7WB 5K9JH 2HJLB 5HGAB 4KV5F 3T0EC 4XXDA 4HS8L 1YMHA 5CWSB 5AWNL 3MA9H 1S7QA 2EDJA 2UZIH 3HFMH 1EBPA 1DBJH 3RWDB 4KK6C 4DKDC 4QHLA 4BFGA 2F54B 3V4PH 1RK1B 5AG9A 1TQCB 3BD5A 1G7HB 4OIBA 2EDYA 2X4TA 5FYLL 3QPXL 4RAVB 4JFDA 1T66C 4KFZC 3DLQR 2MWCA 3JZ7A 5CGYD 3FKUS 4JRXB 1P7QB 2OTWB 1S7WA 2HJLA 5HGAA 2F19H 3CLEH 5HYQA 3QUMB 3MRIB 3O4OB 1J9CT 3RWDA 1KN2H 5E70A 2F54A 1RK1A 4JZNA 1ZHKA 3ZDXF 2KQNA 1P5VA 4UNUA 3KPNB 2VN7A 4I48A 2X6MA 3OX8A 4OF6A 2DMCA 4JRXA 4JHZA 1P7QA 3HNTH 2OTWA 2E3VA 3UJIH 1OARH 3GFUA 5ITBH 4W68A 2EYRB 4YHML 2DM2A 4R0LB 4WUKL 4PS4L 3RX8A 1RIVH 1ZKAA 3H9SD 4NBYB 3KPNA 3CIQA 1YQ2A 4M03A 1I3RB 3NCFB 4GW4A 2I07B 3EYUH 5M95B 4U6TA 3H9SE 4KK5C 2QV2A 2EYRA 4JN1H 2CKBH 4JKPH 5FA4A 4FZEH 1TCRB 2KZ1B 2VUOA 3QIWD 4X7DC 3WIFB 2W0FA 4R0LA 4LK4A 3EYOB 4BKLA 2CKBA 5SWZD 3KPMB 3QEGL 2C7UB 2MCPH 1I3RA 4QRSB 1CCZA 1UXSB 1N6VA 1L7TH 3K74B 2AW2A 3BQUA 3LQZB 5IP4A 4HQQL 5DLML 1BVLA 4UAOC 5SWZE 3QUXD 4I3RL 5DMYA 1GXEA 1PFCA 3FO0H 4PJ9D 5DWUL 3WIFA 1KG0B 3VXSB 3TP4A 1FNAA 4F7PB 3RHWK 4Z7WB 3D0VB 2HFFB 4D3CH 4DUWA 4XP5L 5DEFA 3KPMA 2C7UA 4LPCA 2P5ED 3HAEG 3FN3A 4HWEL 4WO4A 5BVJB 1UXSA 1HKLH 3UP1A 3MUGA 3IDGB 3LZFH 3AC0A 3LQZA 2IPKA 3QQ9D 4HS6A 4GS7B 4OCLC 1ZHNB 4OBSA 5KSAD 2AQ1A 5IESL 4PYGA 4KVNH 5DHXB 5FYJH 1KG0A 4F7PA 1AQDA 1BECA 3QFDB 4Z7WA 3HZMB 3IETB 2E8ZA 4X80L 4QHMB 5BVJA 4PRPB 2AABL 3D6GA 4LNRB 4N0YL 6FABH 1ITBB 1LP9A 3IDGA 4YC2B 2JB6A 3OJ2C 4XNUL 4OQ1A 2IH3B 1ZHNA 4LSQH 5DQDH 3KPPB 2PYED 1MF2L 1MCPL 1OP9A 1F2QA 3HR5A 3ZE0F 2PKDA 5ETUB 2A1WH 3VH8B 4O4YL 5EH1A 2DRUA 3EO1B 4U1MB 1EEYB 1MJJB 3OAUL 2YZ8A 4GW5A 1U8NB 3HZMA 4GG6B 2VE6B 3IETA 4OF3A 1MLCB 2PYEE 2HRPH 2Q3AA 4Q0XL 4QHMA 1FRGL 1AGBA 4ZS6C 4LNRA 4Y7MA 3D0LA 4LL9A 3VXQA 1JV5B 4CL7A 2IH3A 2FR4B 1NAKH 5LBSH 5HYSB 4YHLL 3V9FA 3DROB 4LOUD 1S3KL 3WFBL 2FGWL 2HWZL 2BXYA 2V9TA 3NAAL 3VH8A 4OFDA 3QEUB 3PJSB 3MNZB 5A3ID 2DB8A 2PTTA 3EO1A 3QXAB 4U1MA 1MJJA 1NDGB 4GG6A 1U8NA 4ACPA 1A64A 4M6AA 1F2XK 5EZIH 1C8PA 1V3KA 3DXAB 1UZ8B 1DANT 2Z35A 4LVNB 3X13B 5IB1B 3UYPA 4NCC2 2EDKA 3QXTA 3MACL 1F58H 3GSXA 1JV5A 1J18A 4JVUA 2YD9A 4YAQA 4C83A 3ARSA 5HYSA 3MROB 5ANME 4HJ0C 4OCWL 5BV7B 2VDOL 5C09A 4JRYD 1N7MH 2FATH 1JZ5A 2O61A 3PDOB 3T0EA 3QEUA 3PJSA 3MNZA 5F93C 2LVEA 1H3PH 4NFCA 4Q9QL 1CFVH 2D3VA 4UT9L 2VXUH 1B90A 3DXAA 3EAKA 3RUGE 3X13A 5BV7H 4X6DE 4JRYE 2D31B 3IU4H 1QOKA 5FECB 1W0VB 1Z0MA 2QQNL 2UUDK 5ILTL 1WITA 3AY4C 2R2CA 4K7PH 3DVGB 2FX9H 1A4JB 4RGOL 3JXAA 4EOWL 5T3ZH 3MROA 4NO0D 4HWZA 4OIIH 2YMXH 4NM4H 3Q5YA 5F1NA 1E4WL 1G0DA 4NCDA 4LLUB 3P4NA 5A16A 4Y19D 1BAFL 3MOAL 2YD1A 1N59A 1BZ9B 4R6UA 1RZIB 5CLTA 3L3OA 5D93C 1KPRA 4DZBB 4BZ2L 1F90L 3PP3H 1W0VA 3BP4A 3FT2B 4J8RB 4NO5B 4HAFA 5K9OB 1UQSA 3RWGB 4Y19E 1K9TA 2QQQA 4J6RL 4LEXL 4YHPA 5JHLL 2D7PA 4GAJH 2GY5A 1MFEL 2JCCB 4WI9A 3G6DL 2XZAH 4JFFB 3T77A 1GIGH 4HKZA 1UWGH 4HLJA 1B4JH 4NZTH 4DGIH 5IUSA 4FTVB 5F89B 4JREC 3C9NA 3WNNA 3AMLA 1RURH 2QKIB 4DZBA 1OAYH 5C0EB 4EVNA 3FT2A 4J8RA 4NO5A 5K9OA 4I3GA 1I7RB 2AV7A 4NNPL 3T2OA 3VMPA 5IBUB 1A6TB 1KELL 4WFED 3TVMB 1KIPB 2JCCA 1JI1A 35C8L 2FL5A 4OF0A 1FG2B 4WI7A 4JFFA 4JG1H 5BO1H 3TF7C 1KLGB 4JDVB 4PJHE 4GRLC 3IXTB 2YPLB 1VB9A 3Q6GL 3QPQD 5L2JB 4M61B 4XP6H 1YNKL 5F1SA 4WFEE 1KGCD 1DBAH 3ILPB 3ZKSD 4X7SL 1D5ZB 2WLYA 3SGDI 2QKIA 1F3DJ 4UBDD 5E03A 4ERSL 5DJ8B 4D0CB 5C0EA 4M43L 4HK3J 1J1OL 1I7RA 2J6EH 4YXHL 3I3EA 2QQKL 1JZ4A 1N64L 3HMWL 1BIIB 1KIPA 4PB0H 2V2XA 5C07B 1KXVC 1KGCE 4MNGB 4O5LL 3ARFD 1WVZA 5BJTB 1TCMA 3DX6B 4JDVA 2J6EA 5T33L 3A67H 1UM5H 2YPLA 4HT1L 4ONHA 4ZSOB 2VLMD 4JG0H 2VERN 5IEKB 5L2JA 2FLBT 2W9EL 1I4FB 2Y6SC 1SMOA 3ILPA 2Y07H 1D5ZA 1DN0B 3RWHB 1LE9A 2DQGL 3NIGF 5DJ8A 4YFDB 5B39B 3L3JA 3BIKA 5J57B 2VLME 2VISB 5SX4I 1NPUA 1IGCL 3VXOA 1AHWB 4MNGA 1H8NA 5E5UB 3RA7H 3HC4L 1FORH 4F8QA 5JHDB 4PJ5D 3DX6A 3C6LC 4JM2F 4QEGA 3LN9A 2Q7NA 2PO6B 4G6ML 5EUOB 2Z91B 3LS5H 1OM3L 4ZSOA 3EZ8A 5IEKA 4ODHL 5CIPB 5FOBA 3OL2A 4CBPA 5D7IA 3ZYZA 5JW4Q 1DN0A 2HH0H 32C2B 1I1AC 4PJ5E 3RVTD 1MAKA 2BMKB 4M5YL 1UH3A 1MCLA 2IPTL 4K71C 1EO7A 4TNVF 2ZUYA 4OM0H 2X4NA 2XWTB 5E2TH 3BPOC 1NCWL 1FH5H 2HFTA 4WW2B 2PO6A 5EUOA 2VDLL 1X4XA 1JPTH 4YZFE 5TPWH 3IFNL 4PD4K 3IKCA 4I3SL 2EDEA 3FRPA 1QA9A 4I0PD 4M9OA 1I8LA 2AEIT 2NY7L 4LARH 1PKOA 2DI7A 4S1SH 1R24A 3ARDB 1ITCA 3ZSTA 2BMKA 1YPZA 2QHRH 3WLWC 2CMRL 2HT2C 3QWQB 2XWTA 5EPMA 4PJXF 4KZDH 2ADJB 3HHRB 5SWSB 5E2WH 4H25B 4JDZB 2HP4A 3INUL 1KEML 3WD5H 4LLMB 3SO3B 1JUFB 1YYLL 4HEPG 3X3GH 1U8QB 3OKDB 3OHXB 4U6VH 3JTSB 1NGQH 4CNIB 2LFGA 4FQCH 3EKCA 1FZOB 4OD2A 4FA8A 4W70A 3SDXE 4LSDA 4Z6AT 3W0WD 5BVPH 1GGYA 3TV3H 4R4FL 1HNGA 3WKMH 1RULH 5T1LA 3ULVD 4ZQKB 1KCSL 4XNQA 1Z0NA 4JDZA 4XAWL 1MUJA 2FX7H 5I1CH 1WZKA 1WTGT 2CIKA 4RX4D 1UB5B 1A6UH 2W9DH 3F5WA 3LKNB 1I1YB 1CGXA 4C56B 5EA0H 5E2JA 3OHXA 3BD3A 3RAJL 3QIBB 4PB9H 4G9FA 4AK1A 2V5SA 1FZOA 4NN7B 3UTZA 3BZDA 4OFPA 5D8JH 3QDHA 5MI0B 4S2SA 3WE6B 4JJ5B 4DGVL 5DC4B 4M8QA 4ZQKA 2WM0A 4HXBL 2CXKA 4JVWA 4LCWB 5L6YH 3O2WL 1H15B 2EXYC 3GUTB 1KCUH 1CTOA 1A3LH 3C09B 4PGJA 1UB5A 2BNRA 1JWSB 4QCIA 3LKNA 5EO0B 1I1YA 2GHWB 4NKOB 3V4UH 3WFEL 3VFGH 4OQTH 3HC0A 1BQHA 5DJ6A 2LVCA 5IG7B 1L6XA 4KI1A 1LO2L 3SDYH 2EDDA 1U58B 4PJGB 3MRLB 1YY8B 4EXPX 2A77L 2B1HH 4OQTA 4MD4B 4G42B 4LCWA 1H15A 5LAXB 1Z3GL 1JWSA 2PF6A 5DUML 4HV8A 4YDJA 5EIVA 4NKOA 4WI4A 4GQ9H 2NY0D 3E8UH 1RU9H 2FX8L 3Q1SH 1AFVL 1JNNL 3KJ4B 1T7YA 4NKIH 3LH2L 4KQ4L 1TETL 1HXMB 2EDOA 1U58A 1YY8A 1UWEL 1FFPB 2CK0H 4MD4A 4BQBA 1RMFH 3H3KA 2ADIB 12E8H 2K7QA 1YMMB 4WFGD 5LAXA 5JOEA 5IT2L 1ROWA 5K9QG 4XGZB 1I3GL 2NW3A 4ZNEE 1GGCH 4NHCL 2ARJQ 4PV9B 4LP4A 2D4DA 3RIFF 1IQWL 3EO9H 1OP5K 5L2KB 4QXGH 3CVIL 2N1KA 1YEFH 5ALBH 1KNOA 2PW1B 4RGND 4DTGL 5E5MA 5DUPH 1T2QL 2W92A 3TCLB 1VFOA 4M62L 2WUCL 4PGCB 1BQSA 1MFNA 2ADIA 4HD9A 2AVGA 1K6QH 1YMMA 4Y5XC 3OBAA 1LHZA 1VCAA 1SBBA 4XTRD 4LRNL 5F6IC 3Q6FA 4GRMB 4PLKC 1EHLL 5L2KA 1BX2A 1U8MA 4KROC 5GIRB 3OR6B 1AH1A 4KVCH 1RZFH 3R1GH 5TDPA 2VTFA 2WUBL 4M7ZC 4N0UB 2JK5A 3QDMD 5EU5B 4MQXD 1RUKH 4QRQB 2QADD 3ARWA 3V52L 4EI5C 1LD9B 3NCJL 4HW6A 3RL2A 3FFCB 1XGPB 4KKLD 1Q72H 2X4PB 1B6DA 4R9HA 2NX5D 3C6LA 4P4KB 3LKSB 3QDME 4MAUL 3DX9A 2PYFA 4JGMA 4OFKA 4W81A 1OGAD 5IOPB 3QPXH 5GIRA 4YXKH 1PY4A 4QRRB 5LGJB 2H32B 5IFHH 1LDSA 3ME0A 4F3FA 1BJ8A 4N0UA 5KS9E 4R97C 1FBIH 1FZJB 3SQOL 5AD0B 4LLYA 1FNEB 2NX5E 5EU5A 3B8SA 1G9MH 4YEEA 1OGAE 2AP2A 4NSKA 3VXRE 4ALAL 1LD9A 1II4E 3FFCA 1XGPA 2H32H 1M1SA 2X4PA 2VR9A 3HE7D 2YA2A 1CE6B 5E8DL 2CDGA 5F3BB 3SY0B 3CFCL 4GO6B 1YYML 4P4KA 2HVJB 4KRNA 4WWKB 4P5MB 3OJVC 3WUWG 5IB4A 5I71C 5ABDE 2GTZB 1JYVA 1J87A 2CJUL 1RY7B 3LDBC 2H32A 5GRYA 3P0VL 1WV7T 4BZYA 3Q0HA 2F5AL 3OKLA 4PTUA 1QPXA 1FZJA 4JQVC 1JMZA 2VAJA 3OG4B 5M7QA 1ZV5A 5HPOA 1FNEA 4YLQT 2I9TA 2CDEA 2ED7A 4LSTL 3BPCB 2YD7A 3NA9H 3GEWB 1OSZB 2BSSB 4K3DH 4M6ML 3EYSL 3HZYB 1F3JA 1NCTA 4NN5C 1FE8H 3SY0A 3ULUH 1D6EB 2HVJA 3GI8H 5MEQB 1YEIL 1F02I 3M1BA 3WS6C 5ESAB 5GZOD 5EU7E 5FOJA 1U0QA 5D7LA 3KR3L 3GBML 5HHMB 3VGAC 3EW3B 1RZKC 4OKVB 4N8VA 3V6OC 4K3EH 4RA0C 1OSZA 2BSSA 2DLTA 5GGSB 3HZYA 2A83B 4PJIF 1ZGLP 2UWEF 5I18H 5C0JB 5IV2A 2P24A 3LEYH 3P0YH 5DMIL 2E7LA 2FJHA 2NY4B 1NFDF 1A7NL 5C6TL 4M48H 2Z8SA 3L3GB 1MVFA 1RD6A 2VZSA 3TESA 3OG6B 2HRLA 3U0TB 3UTSB 4JKLA 4H88L 4ZYKB 3KPLB 4HQQH 4OKVA 1S5IL 1QBLH 4JFPA 4K07A 2XNAA 3S4SG 1WBZB 2E7CA 4NCC1 5GGSA 3S98A 2A83A 3D85D 4JANB 1RHHB 4CDGC 5C0JA 4XWOC 1GAFH 4F37K 2X10A 5E56A 5LGHL 4OZHF 1U41A 1CLYL 2B0SL 1FNSL 5I1AB 3L3GA 1OHQA 2I60H 5IBTH 2J8UB 1M71B 1T0PB 3LCYA 2ICWB 2P45B 3U0TA 3UTSA 4MD5B 1BFOA 3BOVA 4JZJB 4ZYKA 3KNBA 3QUYB 4KY1H 4KI5F 2C1PA 3HZVB 1RHHA 3WFCH 1KN4H 5D1ZC 3KPRD 3O9WB 4R90L 3WNLA 4URTB 2E7MA 5I1AA 4AEFA 1ZT4B 1M71A 1MCOL 4X9HA 3GRWH 1JTPA 4ENEC 5F7KC 3G9AB 4N0YH 5IFAL 4XC1L 3DSNA 3KPRE 1ZLVH 5I19H 1P2CB 4LSSH 1AIFB 4V2BA 5IGXL 4G6FD 4N90D 2GKIA 1N5YL 1MCPH 3GRWA 1O7VA 1NCBH 4J4PA 3O9WA 4LCIH 4PJ8B 1MWAB 5HHPB 4IDLA 3GIVA 4HZLB 3OAUH 1GSMA 3GHEL 1HSAA 2D7TL 3EJZD 1ZT4A 3BGFC 1FRGH 2EDXA 4CMMB 2BRRH 1UFUA 1B4RA 3P73B 3MLRH 3H9ZA 5J0BA 4XHQA 1Z2KA 3QDGB 3OKNB 5BQ7B 1QKZL 2X7LA 3C5ZD 1MWAH 3A6CL 4M1GL 3O8XC 1JZ8A 1J10A 1AIFA 4E42A 4PUBH 4OLVL 4K9EH 3O11B 1S3KH 3VFVA 1FZKB 1OL0A 3RJQB 3EYVB 1IEBA 1T03H 5B4MC 1T04B 2X2YA 1MWAA 4Q6IC 1E6OH 2YZ1A 2ZCLH 4K7PY 4OZFG 4Y5XA 3CJJA 1Z9MA 5E08L 5BXFB 5A43C 3TWCL 2D7NA 4YHKH 4L8DA 2VDRH 3QDGA 1P69B 3CSPA 4PJFF 5BQ7A 3NFPA 4LCCC 4XNMB 3WL9B 4OV5B 3BESR 2ZJSH 2IFGA 4M5ZL 4G8GD 5CBAB 2HJKA 5FYJU 1FZKA 1FGVH 2ZOLB 1T04A 1J12A 1NDMB 3LQAC 4BK4A 1QRKA 4HUMB 2O5ZL 3T3PE 1ZLSH 2VXTH 3O6MH 5BXFA 2DTSA 4G8GE 4PLJD 3MGAA 4RISL 4Z7QF 1PEWA 2XTJE 2DQDL 3NCYP 2QQNH 1Y6KR 3CNKA 1JNJA 1J8HD 3VG9C 4EOWH 4OV5A 4EEEA 3LDBB 2XRAH 4MAYB 1QZ1A 2JTDA 1TMCB 4WFHD 4CVUA 3MV01 3KXFD 1YC8A 1E4WH 4IOFD 2ZOLA 4UI2A 3WLBA 4CJ0A 3R8BB 1U3HD 3MOAH 4HEME 1CLOH 1J8HE 1VENA 1TENA 5C08E 2E8YA 3C60D 1INDL 1LILA 2Z31D 5J12B 3UCRA 4M7JH 5I8OL 4U1GB 3KXFE 3GMMB 4HC1L 4JFZL 3HS0B 4Z8FH 5GGTH 3QYCA 5HHOB 4RRPA 5GQBA 4MAYA 2YHGA 2DKMA 4Z0XB 5E9DB 1UT9A 3GBNL 3O6FB 3KLAA 4Q9BA 1WISA 4GKNB 4RDQF 2VAAB 4LDOB 3OAZH 4NQXB 4XPHL 5GGTA 2ERJC 4J3UA 4U31A 4XNXL 1NCNA 4IEFB 2Q8AL 3DUSA 4JFYB 4YDLC 5FYKD 1QSFD 1UACH 3GMMA 4P3CH 4K3JL 1BZQK 1RZKH 3HS0A 5D1QC 3F7YB 3WS6A 5HHOA 1YN6B 3MNVA 4U6HA 1M7DB 3TO2B 3ET9F 5E9DA 3FOMB 4Y5VC 2B1AL 4GKNA 1QSFE 2VAAA 4NQXA 4JFXB 4K8RD 3AM8C 4FFZL 3BH9A 4P2OD 4OD3H 3MYJB 5EG6C 4JFYA 4IJ3C 2AEWA 3UYRL 2J2ZA 3KJ6L 1J1OH 2Y7QA 2OSLB 3F7YA 4FQJL 1RZGB 1YN6A 4ZUSB 3TA3D 5C0AB 5I1EH 2MPAL 1CDIA 1AQKL 5CBEB 2AJ3B 2FHFA 1CDJA 4FRWA 2V2WB 4FHBD 1IAOA 1JPST 2KH2B 4JFXA 3PF2A 4Z5RB 5C0BD 2W9EH 5CEXA 1MI5B 2VDPH 4QT5A 1V3JA 1YNTB 5HVHB 3MYJA 3BP6B 1WIPA 4IMLB 1DQTA 5HYJB 1AR1D 4JAMB 5IMMB 3MJ7A 4HWBL 2JB5L 3PE9A 3GK8H 3TIDA 2OSLA 3HKFA 5C0BE 1XF5B 1F97A 1RZGA 2B5IB 1ZE3C 3AREB 4QF1B 2D0HA 4R3SB 3H7BB 2IAND 2IH1A 3A6BH 5T5NF 5DMKB 4NRYB 5HVFB 3OZ9L 2W9LA 4GXVH 2VQ1A 3L5XL 2XYCA 1MI5A 2ZSVB 3BN3B 3BW9A 4L29B 1U8LB 2EC9T 4IMLA 1CL7H 4U4BA 5IMMA 2C4FU 1LDPL 5F1OB 1C5BH 3RTQB 1I8MB 4LASL 4RFOH 1XF5A 4LSPH 4N8CH 4R2GC 2H2PC 4EBQL 5DJDB 4LHUD 1QP1A 4QF1A 3Q5TA 1FPTH 4WCYH 3H7BA 4OCXL 3QZWG 5KSBF 1A6WL 1E4KC 1JZ3A 2VLKB 1DVFB 4Y4FD 5TJWK 3CDGA 4PJBE 3D3VA 2AJXL 5HI5C 4MMZC 1IARB 4L8BB 1ORQB 3MCG1 5TQ0L 4Y5YC 1A7QH 5C3TA 4ZTOH 4Z0BH 5EO1A 4Z95L 1RJZB 3BX7C 2E9BA 5MEOB 5HBBA 4ZTPL 4UIKL 2LABA 3L9RB 5D7JC 4F9PA 5DJDA 2ATKB 1VEPA 3SKJL 1WAAF 5DJYB 3FN9A 5LG1A 3GSRB 5CSGA 3SCMB 2DLIA 3LB6D 1NH6A 1SEBB 5J13C 1YDPB 4LSVH 3CK0L 4GXUN 5DRZB 3UPRB 4NZUL 4ZXBD 5I66B 5D5ME 3NN8B 3WFDL 4XP4H 1BFVH 5F70A 5KZCD 3FQXB 1RJZA 2P1YA 2BNUB 4Q6IA 2ADFH 1Q0XL 1ZLWK 1TJGH 5KOVC 2YS4A 4KQ3H 1GH7A 4HCRL 3UBXA 3PV7A 4PR5A 3DBXB 3GSRA 1A7RH 4ELKB 3QA3B 1SEBA 3DV4B 4FNLL 3LQAH 4OLZL 5GJSH 3U30B 4LCCA 1EDQA 3F12B 3SEPA 3RKDC 5DRZA 3RPIB 3UPRA 4P9HH 4NO3B 4OT1H 4U1HA 1NMCC 1OGTB 5I66A 4Y4KD 3V0WL 2IWGA 5DGQA 1RJYA 5CCKL 3S5LB 1XGTB 1R0AL 1MFAH 4KV5E 2BNUA 4QHKI 1S78C 1C5DA 4YPJA 1XCQA 4G3YH 3MOQA 2JKXA 3D39B 5DFVD 3T2PA 1BJ1J 5JW3L 4YWGL 2CXGA 5FAAA 4B0MM 5D2LB 3DBXA 4ELKA 3AFLA 3ARXA 3FMGL 4HIXH 4YH6A 1DLFL 3GSNB 1FLRL 3WXVL 4JFEA 2FIKA 4UV7L 4IMKA 3I50H 2Z8WC 1EZVX 4NGHH 4NO3A 3TBYA 1OGTA 4DUVA 5F3HB 3VXUB 5A2FA 1N6QH 3LN4A 4YBLB 4LCUB 3S5LA 4FQLH 1IL1B 3P2TA 1XGTA 3LRSB 1A0QH 4KTDH 3GSNH 3OPZH 1R3LB 4OV6F 5E24E 3QAZC 4L8SC 2HYMA 3QIUB 3G5ZB 3D39A 4K7FA 3O4LD 4XP1L 1Q0YL 3BT2L 1YUHB 5D2LA 1G7PB 3QHTC 5I1JH 2DQJL 3K8LA 3GSNA 4M7LT 3ZDXE 1DL7H 5HI3C 1IGTA 3X11A 2CUIA 3TO4D 3MRDB 4TUKH 1TTUA 4PRID 3O4LE 2VKWA 2QHLA 3CLFL 4LCUA 3I6LD 4RWYL 1IL1A 4YHZH 4YEFA 3G08A 3BRDA 1R5VA 2D9CA 3SDDC 1PYWB 3PNWA 5ADOL 3QIUA 3G5ZA 4NQUA 2C4XA 4ORGB 4PRIE 2X89A 3DARA 1G7PA 3UZEA 4XPAL 3I6LE 3ZYIA 4GSDL 4IRJB 1CK0L 4ELMB 3MLSL 3NZ8B 5D1QA 1IAKB 1FL5A 1GPOH 3EOTL 3MRDA 2NTFB 4WFFE 3VDBA 3EOYG 1OP3K 1S5HB 1U3ZA 1RUQH 3TGXA 5E6IB 1W8NA 3G04B 3AM8A 3VFRA 4ZFFA 3CVIH 3MV9B 4JN2A 4JO4H 1PYWA 5GS0L 2F74B 2J4WH 3HPJB 5DUBB 5C9JB 3N9GH 3RVUD 4ORGA 5IB5A 2OBGA 3HB3C 3F58L 2BHUA 2H8PB 4FQ2L 3FO9B 4IRJA 4ELMA 5F72S 4MS8D 3NZ8A 3ZKXC 5DEGA 1SJHB 5CJOL 3CDCA 4PJDA 2DTMH 4K94H 2PXYB 4OLUL 3WFHB 1JL8A 1QLEL 2F5BL 1Y18B 5EU6D 1NEZG 1H5BB 3MRGB 3MV9A 1OAUH 3RVVD 1BP3B 2A6DB 3HPJA 1VFBA 1DSFL 3RZCC 2R0ZL 2DWEA 3LEXA 1LP9F 4P2QD 4HPOH 2H8PA 2GJ6B 3KAAA 3FO9A 1N6UA 2OI9B 4GRWB 5EU6E 1EO8H 5B38A 4W6YB 3H6JA 3QHZH 4YXLL 2E6PA 4OGYH 3BEWA 1Q94B 3D9AH 3TN0B 3WFHA 4LIQH 3MRKA 1T5WA 4P2QE 4JHBA 1KFAH 4OCNC 15C8L 3DPBA 5CS7A 4GRWH 2IMNA 2QJDA 5A2LH 1JHKL 3MXVH 4LFHG 5CMAB 4MGXA 3VWJB 1Q9OA 5CILL 2GJ6A 5F7YC 1NGZA 3SDCB 3MUJA 4GUPB 1TJHH 2R39A 4ALAH 1G6RL 1P7KB 3LD8B 5EN2B 1D7FA 4CVXB 2R0KH 4TNVK 4LEOB 2EC9U 1E4KA 3B43A 3DV6B 2BOBA 3G6JB 5H2BB 4DEPC 5ICXA 2FZ3B 4IIQC 1J05B 2RCSL 4HH9B 3QO0B 5MHSD 3ZE0E 3SE8H 1QQDB 3SO5A 3KWWB 1CZ8H 1KEGL 4LSTH 5D1XD 4GUPA 4KAQH 5D7JA 3VXNB 3EDFA 4J3WA 1EAJA 1F11B 5EN2A 5TE6L 3TFKC 4YHYB 3RWJB 2CLZA 3L3DB 3BKMH 4CVXA 4PGBB 5MHSE 1NBZB 4LEOA 4P23C 3W5NA 5DO2C 1NANH 3C8DA 2OZ4L 2ICES 3DV6A 1MFDH 2G2RB 1JF5A 1OAXH 1C7SA 3G6JA 4H20H 5H2BA 3GSVB 2Q87A 5IW6B 2FZ3A 5F9DC 2DYPB 1MHCA 2OX5A 1BWWA 3MRHB 1CQYA 3QO0A 1OAQL 2GTWA 1QACA 3GMQB 5JW4M 1QQDA 2P44B 2YD8A 3KGRA 4PRPD 1NGXB 4XBEH 2QR0B 2EZ0D 1L4IA 3LMJL 1HSBB 3RWJA 1U93B 3CDFA 1I9RL 4PGBA 4UINL 3BDXA 4ZAKB 3QDJD 5LKNA 3M07A 5E00A 4G9DB 3GSVA 1RZJC 5IW6A 3FB5B 3V6FB 3ZE2F 3KYKL 1ZVHA 2AEPL 2DYPA 2YUVA 4UT6H 3MRHA 3GMQA 4F7TA 4OZ4B 5KANI 3DETC 1KIRA 4KH2A 4ISVA 8FABB 3QDJE 3T8XB 1XGQB 1NGXA 4J7RA 3KLHC 5DJXB 5EBLB 1VHPA 2QR0A 2EEBA 3ORJA 3ILQC 4P9ML 1HSBA 1CDCA 2J1KA 1FDLH 1QLRB 4NRZB 1NUNB 4FXKB 1UH4A 5TH2A 4HUNB 1BJ1H 1EA9C 5E2UH 1F6AA 1ED3B 1S7RB 3V6FA 3ARGD 3NIDE 5FEBA 5GJTH 5IQ7L 4NJAH 1SQ2N 4FN0A 4S1QL 8FABA 1XGQA 5DD1H 4MJIB 5DJXA 4L8SA 5FUZH 5EBLA 5E0QA 3H3PL 4NHUA 4PY7A 1QLRA 4NRZA 2IAMB 3BZEB 3BKCL 4X4MA 2I26N 4JFOB 1HYSC 5AAMA 3D18A 1S7RA 1IM9B 5ERWA 2X05A 2XXCB