4LL4B

The structure of the trx and txnip complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-interacting protein
publication title The structural basis for the negative regulation of thioredoxin by thioredoxin-interacting protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein/protein binding
total genus 35
structure length 105
sequence length 105
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ll4B00
2DC5A 3PR8A 4MK3A 3VFIA 4ZBAA 4MF7A 2VCZA 2YJ7A 3LG6A 2YP6A 4K0NA 3GMFA 4KAEA 2JL4A 3GSTA 5JWQB 4BA7A 5D96A 3ME8A 3ZRDA 5IO2A 3TDGA 3ZITA 2IJYA 1XFLA 2PWJA 1U6TA 3HA9A 1M2BA 1ZGNA 1J0FA 2LNTA 2KP1A 3IDVA 2BTOT 1OKTA 1KTEA 1F6MC 2O7KA 2ES7A 3IXRA 1SK2A 2X8HA 2ZCTA 2YV7A 3F3RA 2RM5A 3FZ4A 2YNXA 4FYBA 4ZIJA 2JSYA 4PNFA 4BL7A 2E7PA 1G7OA 3VURA 1DUGA 3AY8A 3M9JA 1GNEA 2KHPA 5AGYA 1DBYA 2WDUA 2FUG2 4KDYA 2L4QA 1R4WA 3D4TA 2YWIA 3KEBA 1O81A 4IELA 4EE0A 2A2SA 4BVYA 2LKUA 1XBSA 1R26A 1A0FA 3G7IA 1YEXA 2REMA 2I3YA 1SKSB 2HSHA 4XIHA 3UARA 2CVKA 5IM9A 1EEMA 4XS4A 1TRVA 2HXKA 3CTFA 4V1Ap 4KDXA 2B7JA 5D9WA 1UVZA 5ECQB 1GL8A 2GVPA 2LRTA 3HVSA 1PGTA 5C04A 3CTGA 3GX0A 1NHYA 1O85A 5IMZA 1PRXA 4X0XA 4G2EA 2HLSA 4XS4B 4IN0A 3UIWA 4ECJA 2GGTA 2LRNA 3EURA 4DSQA 2H70A 2YANA 1TTZA 3HVVA 2C0DA 4YQVA 2GSQA 2LSTA 4IQAA 4OMVA 2N5AA 4K7NA 3Q6OA 2C3NA 4G19A 2VL2C 2PMTA 1OE8A 11GSA 3QD9A 3VI5A 5HFIA 1GSUA 3TJKA 4AJ8A 1GUMA 3EU3A 2CX3A 4NHWA 2VL2A 1FB0A 4LL1B 5INYA 4L8EA 2WGRA 2DIYA 1SK0A 1B8XA 2H1DA 4WXTA 3D6IA 2C0GA 4IGJA 3CSIA 3IPZA 4MCUA 2B5XA 2A2RA 1O8XA 5J3RA 4KDUA 1B9XC 4NXIA 4DSRA 2O8VB 1QK8A 4QL7A 16GSA 5HR2A 1PN9A 2XBIA 3DEXA 1GWCA 3ZREA 3KH9A 1TI3A 4IJ3A 4PQ1A 3ZVJD 3ZIJA 4GWRA 3HJOA 3WGXA 3E9JB 1G0TA 2MYGA 1HYUA 2JZTA 3VWUA 8GSSA 4F0CA 4JRRA 3J7Yk 2HE3A 6GSTA 2I1UA 6GSUA 4TXOA 3IA1A 2KUCA 4HOJA 3KGKA 5EPFA 5JCWA 1EOHA 5G31A 4MJCA 4POKA 2LV3A 4TXOB 2P5QA 2JACA 4MPGA 4Z7XA 4KA0A 3FR9A 1TK8B 4ZL8A 4V2NA 4IHUA 1YF1A 1LJRA 2TIRA 1GSDA 2FWGA 4F0BA 3H1NA 6GSSA 2LTKA 3F8UA 3ZZXA 1XOBA 2GSRA 3HZ4A 1ON4A 3KZQA 4ECCA 4EO3A 6GSYA 1T7PB 1ILOA 4D73B 2K6VA 1TI1A 3APOA 3RAZA 1Z9HA 5IMDA 5D8IA 2H0GA 2LJRA 4JR4A 5G5EA 3ZFLA 3D0ZA 4JU5A 3DVXA 1SD8A 1VF1A 1SL1B 5J9BA 3W8JA 4G9HA 3FZ5A 1EP8A 4F2IA 2HT9A 4AJ7A 1FOVA 4OFMA 4K6XA 4AJ6A 4POLA 2OKAA 1BEDA 1PSQA 5CP1A 1ST9A 4KE3A 3NZNA 1GSSA 1BJXA 3H4KA 9GSSA 5G1LA 1AAZA 4GSNA 2AB6A 3QAGA 3VPQA 5A5KA 2ON5A 4K0GA 3H79A 3G9BA 5FT3A 4GQCA 4ZL9A 2PUKC 3N5OA 2VLTA 4CDOA 2MMAA 3HHVA 4HQSA 2JSZA 4HU7A 1ZYQB 2H66A 1WJKA 2DMMA 5CAXA 3KMNA 1EP7A 2EIOA 2NPBA 1SYRA 3MNGA 4ACSA 2XC2A 2VM2A 4KSOA 4EDYA 1ACVA 5H5RA 5G5FA 3KD0A 1K0BA 2M46A 1XCCA 2FNOA 3LGCA 3LQ7A 1O6JA 3UMAA 4XS6A 1JHBA 5IPGA 4O5RA 5D73A 3EMXA 5HR1A 2MBSA 4K7OA 2QC7A 1GSQA 4V2MA 4JEDA 4I5QA 1JZWA 2R4VA 4NMUA 2JU5A 1TXXA 5B6NA 3ZTLA 3BCKA 1J08A 3TJJA 3F6FA 4EDZA 3GHAA 2B1KA 1K0NA 3UJ1A 2H19A 2BJXA 2IL3A 1KBNA 2OA7A 4WKWA 2WB9A 4WF4A 3FRCA 5E4WA 4PQHA 5B8BA 3ZVJA 4KCEA 4FO5A 3MWHA 1FB6A 3GV1A 2V32A 2VUPA 1V58A 1YKCA 2C3QA 1QQ2A 1CQHA 1YZXA 4EUYA 4IP6A 4LMWA 2H6YA 4XTSA 1Y25A 1VF4A 4ZXGA 3APQA 12GSA 4PX1A 2KOKA 2GQKA 2CZ3A 2WFCA 1N8JA 5GAPD 2DLXA 2FWEA 1C72A 4TR1A 4N10A 5CREA 3BJ5A 1TW9A 4RI6A 2P0GA 5B8AA 5AN1A 1TU8A 3IR4A 3KH7A 5EY6A 3W6GA 4TR1B 3GTUA 2KLXA 1XWBA 2GSTA 1Q4JA 3ZLPA 4KSMA 5LNKe 5CO3A 6GSWA 3A2VA 3M1GA 1ZCPA 2AHEA 3GTUB 5GSSA 1QFNA 2TRCP 5KN1A 3VWXA 5ECPB 1Z6NA 3IV4A 2FA8A 3O76A 1XWCA 4H86A 1KNGA 2GT6A 2DSAA 4MMMA 5D93A 3H93A 3TKPA 3WT2A 4EL1A 4TOPA 2HI7A 1QMVA 3NOFA 2CZ2A 1PA3A 1NW2A 2HSYA 4TKYA 1IYIA 1SL2B 1GSYA 3FZ9A 5H5QA 2VCWA 4TVEA 1XW6A 1M9BA 4WEYA 3I43A 3I69A 3IBHA 4JZQA 3JCML 2GS3A 2R5GA 4HQZA 2IMEA 1JZDA 1MDKA 1MD3A 1TU7A 4ZILA 4ID0A 2N5FA 1TK0B 4POBA 1XWAA 5ID2A 1SENA 1O7UA 4GRFA 3F4TA 2CA8A 3O3TA 2FCHA 1KEBA 1PMTA 4WETA 2GZYA 5F0GA 5AIVA 4IP1A 2I4AA 4TRXA 1K0MA 5ID2B 1FG4A 1GTAA 3P8WA 3DWVA 5F07A 1WPIA 5KN3A 1XIYA 4HI7A 3DVWA 4IW9A 5CRWA 4MJAA 1MDJA 3ERWA 1S3CA 3EWLA 1EGRA 3ISOA 3US3A 3HXSA 3D22A 3SWLA 4QQ7A 1XVQA 1XW9A 4HU9A 1O8WA 1T1VA 3TJGA 1X0RA 5D9TA 2VL3A 1JFUA 5L71A 3HY2A 3CSHA 1OKDA 1BYEA 4J2FA 5ECMB 2DJ0A 5F05A 1WOUA 4TR3A 1VRSD 3VPTA 1GH2A 1EEJA 4CHSA 1NSWA 4L5LA 1FO5A 3I6AA 1GSEA 3FK8A 4O7HA 2JADA 4RI7A 3TKSC 3KM6A 2B5EA 3QR6A 2CVBA 1A2LA 1TRSA 4WBRD 2ALBA 4DEJA 3CRTA 1GUHA 4TR0A 4MPFA 5DCHA 3U5RE 1A8YA 3BD2A 3RPPA 3TKSA 5DVBA 2C0FA 5KEJA 1GTUA 2RUFA 1ZMAA 2K9FA 3QAVA 4IJIA 2IIYA 5G1KA 3GH6A 1MEKA 4ZB9A 1WWJA 5JWOB 1BG5A 2OBKA 3UBKA 5D9XA 3VI7A 1SK1A 2IWTA 3GKXA 2I81A 1NM3A 3HJMA 5DALA 1Z6MA 1K0DA 3GYKA 2PBJA 2C1YA 5G2ZA 1PL1A 3LWAA 5DALB 3L4NA 1GP1A 3L9SA 4AF2A 4KH7A 1XPVA 3TKRA 4KUNA 3F4RA 3GL5A 3ZYWA 1M9AA 1A24A 4ML6A 4Q5QA 4EXJA 4BWSA 1X9MB 1R5AA 3A3TA 1FHEA 3F3QA 3K8NA 1MD4A 2R2JA 1HNAA 1V40A 3TUEA 2F51A 20GSA 4MA9A 2CX4A 5IOWA 2H72A 1W4VA 1EV9A 1WIKA 1U88A 2E2MA 18GSA 3J7Yb 2WS2A 2YWOA 3KCMA 4NHZA 3DGQA 5JCUA 2F9SA 3KTLA 3RBTA 4OFNA 1DE1A 1XWKA 4PGTA 2RIIA 4K1FA 4BWQA 2VLUA 3P7XA 3QMXA 3CMIA 2VLVA 2CAIA 2AYTA 3GN3A 3FZAA 5ENUA 3A5WA 1OE7A 1A8LA 1GTIA 2H1BA 3UEMA 4MZWA 3IK9A 3DXBA 2VCXA 5ECRB 4EF0A 2GTUA 2E2GA 3WD6A 2V41A 1WP0A 4ZB6A 2NBSA 2H75A 2KP2A 1FVJA 4MDCA 2VOCA 1M7TA 2L6CA 2A4VA 4D73A 3IAS2 3LXZA 2H71A 2P5RA 2AJQB 3UVTA 4OCEA 2FLSA 3QOUA 2FHEA 3IK7A 3FY7A 3GRXA 2DIZA 3SBCA 4J56E 3VLNA 4KCAA 2WZ9A 4OO5A 3M0FA 4I8BA 5ABRA 3TKSE 1JLVA 1G6WA 5IMVA 5COHA 1K0AA 2PGTA 2V1MA 3LFLA 2DJJA 1ML6A 3QPMA 1B48A 3Q18A 4I6XA 3EINA 4N0ZA 4KX4A 4ECBA 3ZL5A 2I9HA 3C1SA 1PQNA 1E6BA 2EIRA 4WBJA 1XWGA 4QL9A 2HFDA 3WGEA 3S9FA 5ECIB 2FWFA 3CRUA 2MMNA 1SU9A 2V6OA 1OC9A 2CVDA 3KXOA 17GSA 3GIXA 3C7MA 3M3MA 1EV4A 3F4SA 3LXTA 4G10A 4TN8A 3V1WA 1OC9B 1XW5A 3D4MA 3HCZA 5JCGA 2K8SA 3RHBA 1AUCA 3ERFA 2Z9SA 3D5JA 4HZ2A 4PQIA 3F9UA 1ZOFA 3G7YA 5B7CA 2B7KA 2OBIA 3LEFA 2AUVA 5DCGA 3D21A 3GL3A 5CRHA 2B6MA 4HS1A 1XZOA 1YF0A 22GSA 5HQPA 3WGDA 1BQ7A 2H76A 3GUSA 1ZYEA 2WJUA 1Z7RA 1ERUA 5H5SA 1SJIA 3BCIA 1K0OA 1SD9A 3TKQA 1V9WA 4Q5RA 1M2DA 1URMA 2VL9A 3BBYA 4EVMA 3IE3A 2LS5A 1GSFA 3R2QA 5ECLB 4LA1A 4GQFA 3ZIVA 1W89A 5EL8A 2HRFA 3DRNA 4GF0A 5GAND 4XHMA 3F6DA 1V98A 2VD1A 5DDLA 1HQOA 1QXHA 3TRXA 2L59A 5ECKB 2H74A 2DJ3A 2H0IA 1E2YA 1SJZA 2H6XA 3QCPA 2K8VA 3CYNA 2DBCA 3CBUA 4IKHA 2H1GA 4N30A 2ON7A 1XXUA 3M9KA 4I97A 3QFBC 2VAFA 5IIZA 3DD3A 2O89A 4F9ZA 2O87A 1JLWA 1YJ6A 2IPAA 2H1AA 2L4CA 3M8NA 5IMCA 3QFAC 1X5CA 1H4OA 3WYWA 1I5GA 3KIJA 2NVLA 4TW5A 3F63A 3GURA 3FKFA 1LU4A 3GKMA 2H0HA 1GTBA 4OO4A 2V2GA 4ILFA 3E0UA 4E8EA 5DQSA 3G7JA 2H6ZA 2EC4A 1AC1A 4OCFA 5J41A 2N5BA 5CYYA 2CV4A 3TGZA 4IS0A 1S3DA 2DMLA 3F0IA 3P90A 3EYTA 3UVHA 3ZMLA 2IFQA 2TRXA 1GLQA 4WR4A 3LYPA 2C4JA 1YEPA 2HYXA 4NV2A 2X99A 1AQWA 1AXDA 3GFKA 2GSSA 2OACA 2LNSA 2IFQB 2XHFA 1ERTA 5C00A 4O32A 2EIQA 4K2DA 5LCZA 3Q74A 3RDWA 3DMLA 2WCIA 2CQ9A 4K7IA 2OE3A 2L6DA 5IOXA 3L78A 1TKDB 4J57E 2F8AA 1WRYA 5CRDA 5DAKA 1GNWA 1GRXA 1YQ1A 2AV4A 4HUAA 4WR5A 1F3AA 2XPDA 1GUKA 3ERGA 4MF6A 4JBBA 3ZFBA 4PUFC 3DKSA 5DBQA 1T4YA 5DAKB 1K3YA 4NAXA 5HR3A 3FYGA 3L9VA 1FVKA 2LUSA 3TB2A 3DIEA 2GLRA 3MSZA 1VF2A 2PU9C 3RPNA 5KN2A 1HNBA 2HZFA 4ECIA 1DE2A 1B9YC 1YKAA 2LJAA 3W8SA 3CSJA 1OYJA 2DJ2A 4XS1A 1PL2A 2J9HA 2G2QA 4JE1A 3HKRA 3HDCA 4Q5NA 4F82A 3GSSA 4YQMA 2MBTA 3FR3A 2WRTA 3BOAA 2L57A 3FHKA 3FR6A 3VWVA 1BX9A 1EGOA 1U87A 5DJMA 5G30A 4EKZA 4KW6A 1M99A 10GSA 1EWXA 3A2WA 4F03A 4DVCA 1OVNA 2YWMA 4V2LA 3TRPA 5GSTA 2ZNMA 3IRAA 3I9V2 1BAYA 1TRWA 2FY6A 3HYPA 5JWRB 3C71A 1B4QA 4OWYA 3ME7A 5CNWA 1VGLA 3LORA 3Q19A 2YV9A 3UOMA 3HZ8A 1TRUA 2LJKA 4L0WA 1PKZA 1V2AA 3P2AA 2PERA 4L0UA 4YAPA 5J9CA 1XOAA 4BPYA 2D2ZA 2FWHA 2HZEA 2OE1A 3EU4A 1Z7PA 5FWGA 2VCVA 2E0QA 3EMPA 4MP4A 1X9WB 4RUVA 4K8MA 2P31A 1F37A 2HZEB 3H8QA 5DJLA 3MAKA 4DSSA 2BMXA 2GDRA 2YZUA 2H8LA 4MJBA 4LL4B 1XVWA 4O92A 2G0FA 4IQ1A 4DSSB 2RLIA 2X8GA 1ERVA 3GNJA 5ECSA 5J4UA 4XRDA 2H01A 1R7HA 2O85A 3HJPA 2FD3A 2YN1A 1RQMA 5A4UA 4XCSA 2OADA 14GSA 2CAQA 1IYHA 3EE2A 3IAM2 4MLYA 4YQUA 4PNGA 1R5PA 1QGVA 7GSSA 3HD5A 1OAZA 4MH3A 2IMFA 2JZRA 4KNDA 5AIXA 3FW2A 2F3MA 2MMZA 3C73A 3LYKA 3TJFA 3VK9A 2C80A 3PGTA 3QAWA 2MZCA 4TXVA 2AAWA 1WMJA 4XRAA 2FA4A 3GH9A 4PXOA 3TOUA 3GKKA 2NDOA 1ZZYA 2GT5A 5D9VA 1F3BA 2DJ1A 1O73A 4N11A 5IQYA 2ZUPA 4CW9A 1SL0B 1K0CA 3TOTA 1TOFA 3N9JA 4ULXA 1K3OA 1AQVA 3KMOA 1GULA 4GXZA 5ELAA 3U6VA 1UC7A 3OR5A 4FYCA 2RM6A 1A0RP 1RW1A 1M0UA 1TJDA 1TK5B 1FAAA 4I2UA 5ELGA 1F2EA 2FGXA 1F9MA 4OD7A 2YPMA 4WF5A 4EC0A 4HZ4A 3TRQA 1OC3A 4FIWA 3GKNA 3PH9A 2YWNA 4X1UA 1J9BA 5AISA 3O6TA 5J5NA 5EVOA 2X8CA 4P3YB 2C0EA 3KP8A 4E8HA 3LSZA 5IO0A 1DSBA 3IOSA 19GSA 1AIUA 1B4PA 1CQGA 2VCTA 2XPEA 4IBPA 3UBLA 1GLPA 4HDEA 1T8EB 2V6KA 4N0VA 2GQLA 4HEA2 5IMFA 4I2TA 3ED3A 2XBQA 2J23A 2LQQA 3APSA 1T00A 4RQXA 2YZHA 1G6YA 6GSXA 1Y6EA 1LBKA 2LQOA 3KJYA 2R37A 1HNCA 1T4ZA 3PINA 4Q5FA 3FEUA 1S3AA 1Z3EA 1M2AA 1AQXA 1X5EA 1JZOA 1SJ6A 1YY7A 2HRNA 1PKWA 4MZCA 1MDIA 2OE0A 1PD21 2VM1A 1TP9A 2VD0A 3HVXA 4FH8A 2B3SA 2LRCA 2OJLA 2RUEA 2M80A 6GSVA 4LLRA 4RQRA 4MZBA 1YDKA 2VIMA 4GSSA 3CXGA 2LEGA 1MTCA 1UN2A 3TJBA 1I9DA 1RK4A 3GX8A 3QDNA 1ABAA 2QKEA 5ECNB 2IN3A 1X5DA 2H73A 3EVIA 1FW1A 5CRGA 1SKWB 1U3AA 4NV5A 3E3EA 4HJ2A 4ZBBA 1HD2A 4LMVA 1A2JA 3EC3A 3LJRA 1G7EA 3MDKA 2R3XA 1Q98A 2WULA 1X9SB 3IC4A 1Z5YE 4YAVA 3WT1A 2M72A 2QSIA 3DYRA 5DQYA 4AGSA 4MF5A 4GTUA 4NWYA 1A2MA 5LD0A 4BVXA 1PX6A 4ZBDA 4ZL7A 2PVQA 5A4VA 1THXA 2IMKA 4V1Ag 2IMDA 1OC8A 2VO4A 4KGIA 1PX7A 5ECOB 2PN8A 2QGVA 1NHOA 1WE0A 2PPTA 3GA4A 2L5LA 4PUAA 5FHIA 2GQMA 5B6MA 1ZL9A 2PVOC 2YJHA 2IMIA 3KTBA 1U3IA 2B5YA 1SYXA 1UA5A 3RHCA 1JZRA 1A23A 3IHQA 1ERWA 1AW9A 4YH2A 5IPHA 1EZKA 1SKRB 5HFGA 3VWWA 2C3TA 4IVFA 4MJEA 2L5OA 1N2AA 4HJMA 1THOA 4ML1A 4GCIA 2JZSA 3UL3A 2DJKA 4POMA 5F06A 3C8EA 5ECHB 5HFKA 2HNLA 2X64A 5E59A 2C8UA 1QUWA 2NTOA 2MMOA 2VCQA 4JR6A 1V57A 4GSTA 5GZZB 5A4WA 3NIVA 1USBA 2R6KA 13GSA 2CT6A 1H75A 4MH2A 4X43A 5F8BA 3L0HA 2B1LA 4GLTA 5HR0A 4ZB8A 4L5OA 5IMAA 1T3BA 4MABA 2K18A 3C1RA 1VF3A 4KB3A 3ZMKA 2YOIA 3A2XA 2GZZA 2H30A 1K3LA 2F8FA 4TR4A 4ISDA 4PURA 2YCDA 4K9ZA 4NPBA 2GZPA 3TCOA 5KN0A 1EOGA 3KP9A 3L9UA 4OFTA 4FYUA 1TDIA 3UAPA
chains in the Genus database with same CATH superfamily
2DC5A 3PR8A 4MK3A 3VFIA 4ZBAA 4MF7A 2VCZA 2YJ7A 3LG6A 2YP6A 4K0NA 3GMFA 4KAEA 2JL4A 3GSTA 5JWQB 4BA7A 5D96A 3ME8A 3ZRDA 4Z2TA 5IO2A 3TDGA 3ZITA 2IJYA 1XFLA 2PWJA 1U6TA 3HA9A 1M2BA 1ZGNA 1J0FA 2LNTA 2KP1A 3IDVA 2BTOT 1OKTA 1KTEA 1F6MC 2O7KA 2ES7A 3IXRA 1SK2A 2X8HA 2ZCTA 2YV7A 3F3RA 2HRKA 2RM5A 3FZ4A 2YNXA 4FYBA 4ZIJA 2JSYA 4PNFA 4BL7A 2E7PA 1G7OA 3VURA 1DUGA 3AY8A 5BRTA 3M9JA 1GNEA 2KHPA 5AGYA 4BL7B 1DBYA 2WDUA 2FUG2 4KDYA 2L4QA 1R4WA 3D4TA 2YWIA 3KEBA 1O81A 4IELA 4EE0A 2A2SA 4BVYA 2LKUA 1XBSA 4CY6A 1R26A 1A0FA 3G7IA 1YEXA 2REMA 4G0KA 2I3YA 1SKSB 2HSHA 4XIHA 3UARA 2CVKA 5IM9A 1EEMA 4XS4A 1TRVA 2HXKA 3CTFA 4V1Ap 4KDXA 2B7JA 5D9WA 1UVZA 5ECQB 1GL8A 2GVPA 2LRTA 3HVSA 1PGTA 5C04A 3CTGA 3GX0A 1NHYA 1O85A 5IMZA 1PRXA 4X0XA 4G2EA 2HLSA 4XS4B 4IN0A 3UIWA 4ECJA 2GGTA 2LRNA 3EURA 4DSQA 2H70A 2YANA 1TTZA 3HVVA 2C0DA 4YQVA 2GSQA 2LSTA 4IQAA 4OMVA 2N5AA 4K7NA 3Q6OA 2C3NA 4G19A 2VL2C 2PMTA 1OE8A 11GSA 3QD9A 3VI5A 5HFIA 1GSUA 3TJKA 4AJ8A 4K5SA 1GUMA 3EU3A 2CX3A 4NHWA 2VL2A 1FB0A 4LL1B 5INYA 4L8EA 2WGRA 2DIYA 1SK0A 1B8XA 2H1DA 4WXTA 3D6IA 2C0GA 4IGJA 3CSIA 3IPZA 4MCUA 2B5XA 2A2RA 1O8XA 5J3RA 2DKHA 4KDUA 1B9XC 4NXIA 4DSRA 2O8VB 1QK8A 4QL7A 16GSA 5HR2A 1PN9A 4O5UA 2XBIA 4G0IA 3DEXA 1GWCA 3ZREA 3KH9A 2R0GA 1TI3A 4IJ3A 4PQ1A 3ZVJD 1M3IA 3ZIJA 4GWRA 3HJOA 3WGXA 3E9JB 1G0TA 2MYGA 1HYUA 2JZTA 3VWUA 8GSSA 4F0CA 4JRRA 3J7Yk 2HE3A 6GSTA 2I1UA 6GSUA 4TXOA 3IA1A 2KUCA 4HOJA 3KGKA 5EPFA 5JCWA 1EOHA 5G31A 4MJCA 4POKA 2LV3A 4TXOB 2P5QA 2JACA 4MPGA 4Z7XA 4KA0A 3FR9A 1TK8B 4ZL8A 4V2NA 4IHUA 1YF1A 1LJRA 2TIRA 1GSDA 2FWGA 4F0BA 3H1NA 6GSSA 2LTKA 3F8UA 3ZZXA 1XOBA 2GSRA 3HZ4A 1ON4A 3KZQA 4ECCA 4EO3A 6GSYA 1T7PB 1ILOA 4D73B 2K6VA 1TI1A 3APOA 3RAZA 1Z9HA 5IMDA 5D8IA 2H0GA 2LJRA 4JR4A 5G5EA 3ZFLA 3D0ZA 4JU5A 3DVXA 1SD8A 1VF1A 1SL1B 5J9BA 3W8JA 4G9HA 3FZ5A 1EP8A 4F2IA 2HT9A 4AJ7A 1FOVA 4OFMA 4K6XA 4AJ6A 4POLA 2OKAA 1BEDA 4Z2UA 1PSQA 5CP1A 1ST9A 4PTSA 4KE3A 3NZNA 1GSSA 1BJXA 3H4KA 9GSSA 5G1LA 1AAZA 4GSNA 2AB6A 3QAGA 3VPQA 1PFOA 5A5KA 2ON5A 4K0GA 3H79A 3G9BA 5FT3A 4GQCA 4ZL9A 2PUKC 3N5OA 2VLTA 4CDOA 2MMAA 3HHVA 4HQSA 2JSZA 4HU7A 1ZYQB 2H66A 1WJKA 2DMMA 5CAXA 3KMNA 1EP7A 2EIOA 2NPBA 1SYRA 3MNGA 4ACSA 2XC2A 2VM2A 4KSOA 4EDYA 1ACVA 5H5RA 5G5FA 3KD0A 1K0BA 2M46A 1XCCA 2FNOA 3LGCA 3LQ7A 1O6JA 3UMAA 4XS6A 1JHBA 5IPGA 4O5RA 5D73A 3EMXA 5HR1A 2MBSA 4K7OA 2QC7A 1GSQA 4V2MA 4JEDA 4I5QA 1ZYNA 3A5IA 1JZWA 2R4VA 4NMUA 2JU5A 1TXXA 5B6NA 4ICYA 3ZTLA 3BCKA 1J08A 3TJJA 3F6FA 4EDZA 3GHAA 2B1KA 1K0NA 3UJ1A 2H19A 2BJXA 2IL3A 1KBNA 2OA7A 4WKWA 2WB9A 4WF4A 3FRCA 3IHGA 5E4WA 4PQHA 4Z2RA 5B8BA 3ZVJA 4KCEA 3IC8A 4FO5A 3MWHA 1FB6A 3GV1A 2V32A 2VUPA 1V58A 1YKCA 2C3QA 1QQ2A 1CQHA 1YZXA 4EUYA 4IP6A 4LMWA 2H6YA 4XTSA 4USSA 1Y25A 1VF4A 4ZXGA 3APQA 12GSA 4PX1A 2KOKA 2GQKA 2CZ3A 2WFCA 1N8JA 5GAPD 2DLXA 2FWEA 1C72A 4TR1A 4N10A 5CREA 3BJ5A 1TW9A 4RI6A 2P0GA 5B8AA 5AN1A 1TU8A 3IR4A 3KH7A 5EY6A 4EIPA 3W6GA 4TR1B 3GTUA 2KLXA 1XWBA 2GSTA 1Q4JA 3ZLPA 4KSMA 5LNKe 5CO3A 6GSWA 3A2VA 3M1GA 1ZCPA 2AHEA 3GTUB 4CY8A 5GSSA 1QFNA 2TRCP 5KN1A 3VWXA 5ECPB 1Z6NA 3IV4A 3PPUA 2FA8A 3O76A 1XWCA 4H86A 1FOHA 1KNGA 2GT6A 2DSAA 4MMMA 5D93A 3H93A 3TKPA 3WT2A 4EL1A 4TOPA 2HI7A 1QMVA 3NOFA 2CZ2A 1PA3A 1NW2A 2HSYA 4TKYA 1IYIA 1SL2B 1GSYA 3FZ9A 5H5QA 2VCWA 4TVEA 1XW6A 1M9BA 4WEYA 3I43A 1PN0A 3I69A 3IBHA 4JZQA 3JCML 2GS3A 2R5GA 4HQZA 2IMEA 1JZDA 1MDKA 1MD3A 1TU7A 4ZILA 4ID0A 2N5FA 1TK0B 4POBA 1XWAA 5ID2A 1SENA 1O7UA 4GRFA 3F4TA 2CA8A 3O3TA 2FCHA 1KEBA 2QA2A 1PMTA 4WETA 2GZYA 5F0GA 5AIVA 4IP1A 2I4AA 4TRXA 1K0MA 5ID2B 1FG4A 1GTAA 3P8WA 3MIXA 3DWVA 5F07A 1WPIA 5KN3A 1XIYA 4HI7A 3DVWA 4IW9A 5CRWA 4MJAA 1MDJA 3ERWA 1S3CA 3EWLA 1EGRA 3ISOA 3US3A 3HXSA 3D22A 3SWLA 4QQ7A 1XVQA 1XW9A 4HU9A 1O8WA 1T1VA 3TJGA 1X0RA 5D9TA 2VL3A 1JFUA 5L71A 3HY2A 3CSHA 1OKDA 1BYEA 4J2FA 5ECMB 2DJ0A 5F05A 1WOUA 4TR3A 1VRSD 3VPTA 1GH2A 1EEJA 4CHSA 1NSWA 4L5LA 1FO5A 3I6AA 1GSEA 3FK8A 4O7HA 2JADA 4RI7A 3TKSC 3KM6A 2B5EA 3QR6A 2CVBA 1A2LA 1TRSA 4WBRD 2ALBA 4DEJA 3CRTA 1GUHA 4TR0A 4MPFA 5DCHA 3U5RE 1A8YA 3BD2A 3RPPA 3TKSA 5DVBA 2C0FA 5KEJA 1GTUA 2RUFA 1ZMAA 2K9FA 3QAVA 4IJIA 2IIYA 5G1KA 3GH6A 1MEKA 4ZB9A 1WWJA 5JWOB 1BG5A 2OBKA 3UBKA 5D9XA 3VI7A 1SK1A 2IWTA 3GKXA 2I81A 1NM3A 3HJMA 5DALA 1Z6MA 1K0DA 3GYKA 2PBJA 2C1YA 2A2PA 5G2ZA 1PL1A 3LWAA 5DALB 3L4NA 1GP1A 3L9SA 4AF2A 4KH7A 1XPVA 3TKRA 4KUNA 3F4RA 3GL5A 3ZYWA 1M9AA 1A24A 4ML6A 2R0PA 4Q5QA 4EXJA 4BWSA 1X9MB 1R5AA 3A3TA 1FHEA 3F3QA 3K8NA 1MD4A 2R2JA 1HNAA 1V40A 3TUEA 2F51A 20GSA 4MA9A 2CX4A 5IOWA 2H72A 1W4VA 1EV9A 1WIKA 1U88A 2E2MA 18GSA 3J7Yb 4A5PA 2WS2A 2YWOA 3KCMA 4NHZA 3DGQA 5JCUA 1M3JA 2F9SA 3KTLA 3RBTA 4OFNA 1DE1A 1XWKA 4PGTA 2RIIA 4K1FA 4BWQA 3MYDA 2VLUA 3P7XA 3QMXA 3CMIA 2VLVA 2CAIA 2AYTA 3GN3A 3FZAA 5ENUA 3A5WA 1OE7A 1A8LA 1GTIA 2H1BA 3UEMA 4MZWA 3IK9A 3DXBA 2VCXA 5ECRB 4EF0A 2GTUA 2E2GA 3WD6A 2V41A 1WP0A 4ZB6A 2NBSA 2H75A 2KP2A 1FVJA 4MDCA 2VOCA 1M7TA 2L6CA 2A4VA 4D73A 3IAS2 3LXZA 2H71A 2P5RA 2AJQB 3UVTA 4OCEA 2FLSA 3QOUA 2FHEA 3IK7A 3FY7A 3GRXA 2DIZA 3SBCA 4J56E 3VLNA 4KCAA 2WZ9A 4OO5A 3M0FA 4I8BA 5ABRA 3TKSE 1JLVA 1G6WA 5IMVA 5COHA 1K0AA 2PGTA 2V1MA 3LFLA 2DJJA 1ML6A 3QPMA 1B48A 3Q18A 4I6XA 3EINA 4N0ZA 4KX4A 4ECBA 3ZL5A 2I9HA 3C1SA 3CQFA 1PQNA 1E6BA 2EIRA 4WBJA 1XWGA 4QL9A 2HFDA 3WGEA 3S9FA 5ECIB 2FWFA 3CRUA 2MMNA 1SU9A 2V6OA 1OC9A 2CVDA 3KXOA 17GSA 3GIXA 3C7MA 3M3MA 1EV4A 3F4SA 3LXTA 4G10A 4TN8A 3V1WA 1OC9B 1XW5A 3D4MA 3HCZA 5JCGA 2K8SA 3RHBA 1AUCA 4O5QA 3ERFA 2Z9SA 3D5JA 4HZ2A 4PQIA 3F9UA 1ZOFA 3G7YA 5B7CA 2B7KA 2OBIA 3LEFA 2AUVA 5DCGA 3D21A 3GL3A 5CRHA 2B6MA 4HS1A 1XZOA 1YF0A 22GSA 5HQPA 3WGDA 1BQ7A 2H76A 3GUSA 1ZYEA 2WJUA 1Z7RA 1ERUA 5H5SA 1SJIA 4K2XA 3BCIA 2QA1A 1K0OA 1SD9A 3TKQA 1V9WA 4Q5RA 1M2DA 1URMA 2VL9A 3BBYA 4EVMA 3IE3A 2LS5A 1GSFA 3R2QA 5ECLB 4LA1A 4GQFA 3ZIVA 1W89A 5EL8A 1ZYPA 2HRFA 3DRNA 4GF0A 5GAND 4XHMA 3F6DA 1V98A 2VD1A 1HQOA 5DDLA 1QXHA 3TRXA 2L59A 5ECKB 2H74A 2DJ3A 2H0IA 1E2YA 1SJZA 4YKGA 2H6XA 3QCPA 2K8VA 3CYNA 2DBCA 3CBUA 4IKHA 2H1GA 4N30A 2ON7A 1XXUA 3M9KA 4I97A 3QFBC 2VAFA 4G0LA 5IIZA 3DD3A 2O89A 4F9ZA 2O87A 1JLWA 1YJ6A 2IPAA 2H1AA 2L4CA 3M8NA 5IMCA 3QFAC 1X5CA 1H4OA 3WYWA 1I5GA 3KIJA 2NVLA 4TW5A 3F63A 3GURA 3FKFA 1LU4A 3GKMA 2H0HA 1GTBA 4OO4A 2V2GA 4ILFA 3E0UA 4E8EA 4FQUA 5DQSA 3G7JA 2H6ZA 2EC4A 1AC1A 4OCFA 2X49A 5J41A 2N5BA 5CYYA 2CV4A 3TGZA 4IS0A 1S3DA 2DMLA 3F0IA 3P90A 3EYTA 3UVHA 3ZMLA 2IFQA 2TRXA 1GLQA 4WR4A 3LYPA 2C4JA 1YEPA 2HYXA 4NV2A 2X99A 1AQWA 1AXDA 3GFKA 2GSSA 2OACA 2LNSA 2IFQB 2XHFA 1ERTA 5C00A 4O32A 2EIQA 4K2DA 5LCZA 4K5RA 3Q74A 3RDWA 3DMLA 2WCIA 2CQ9A 4K7IA 2OE3A 2L6DA 2UZ8A 5IOXA 3L78A 1TKDB 4J57E 2F8AA 1WRYA 5CRDA 5DAKA 1GNWA 1GRXA 1YQ1A 2AV4A 4HUAA 4WR5A 1F3AA 2XPDA 1GUKA 3ERGA 4MF6A 4JBBA 3ZFBA 4PUFC 3DKSA 5DBQA 1T4YA 5DAKB 1K3YA 4NAXA 4BIKA 5HR3A 3FYGA 3L9VA 1FVKA 2LUSA 3TB2A 3DIEA 2GLRA 3MSZA 5BMUA 1VF2A 2PU9C 3RPNA 5KN2A 1HNBA 2HZFA 4ECIA 1DE2A 1B9YC 1YKAA 2LJAA 3W8SA 3CSJA 1OYJA 2DJ2A 4XS1A 3HVNA 1PL2A 2J9HA 2G2QA 4JE1A 3HKRA 3HDCA 4Q5NA 4F82A 3GSSA 4YQMA 2MBTA 3FR3A 2WRTA 3BOAA 2L57A 3FHKA 3FR6A 3VWVA 1BX9A 1EGOA 1U87A 5DJMA 5G30A 4EKZA 4KW6A 1M99A 10GSA 1EWXA 3A2WA 4F03A 4DVCA 1OVNA 2YWMA 4V2LA 3TRPA 5GSTA 2ZNMA 3IRAA 3I9V2 1BAYA 1TRWA 2FY6A 3HYPA 5JWRB 3C71A 1B4QA 4OWYA 3ME7A 5CNWA 1VGLA 3LORA 3Q19A 2YV9A 3UOMA 4KF9A 3HZ8A 1TRUA 2LJKA 4L0WA 1PKZA 1V2AA 3P2AA 2PERA 4L0UA 4YAPA 5J9CA 1XOAA 4BPYA 3EU4A 2D2ZA 2FWHA 2HZEA 2OE1A 1Z7PA 5FWGA 2VCVA 2E0QA 3EMPA 4MP4A 1X9WB 4RUVA 4K8MA 2P31A 1F37A 2HZEB 3H8QA 4BVYB 5DJLA 3MAKA 4DSSA 2BMXA 2GDRA 2YZUA 2H8LA 4MJBA 4LL4B 1XVWA 4O92A 2G0FA 4IQ1A 4DSSB 2RLIA 2X8GA 1ERVA 3GNJA 5ECSA 5J4UA 4XRDA 2H01A 1R7HA 2O85A 4MNNA 3HJPA 2FD3A 2YN1A 1RQMA 5A4UA 4XCSA 2OADA 14GSA 2CAQA 1IYHA 3EE2A 3IAM2 4MLYA 4YQUA 5KOXA 4PNGA 1R5PA 1QGVA 7GSSA 3HD5A 2DKIA 1OAZA 4MH3A 2IMFA 2JZRA 4KNDA 5AIXA 3FW2A 2F3MA 2MMZA 3LW9A 3C73A 3R3EA 3LYKA 3TJFA 3VK9A 2C80A 3PGTA 3QAWA 2MZCA 4TXVA 2AAWA 1WMJA 4XRAA 2FA4A 3GH9A 4PXOA 3TOUA 3GKKA 2NDOA 4HSCX 1ZZYA 2GT5A 5D9VA 1F3BA 2DJ1A 1O73A 4N11A 5IQYA 2ZUPA 4CW9A 1SL0B 1K0CA 3TOTA 1TOFA 3N9JA 4ULXA 1K3OA 1AQVA 3KMOA 1GULA 4GXZA 5ELAA 3U6VA 1UC7A 3OR5A 4FYCA 2RM6A 1A0RP 1RW1A 1M0UA 1TJDA 1TK5B 1FAAA 4I2UA 5ELGA 1F2EA 2X4AA 2FGXA 1F9MA 4OD7A 2YPMA 4WF5A 4EC0A 4HZ4A 3TRQA 1OC3A 4FIWA 3GKNA 3PH9A 2YWNA 2A4HA 4X1UA 1J9BA 5AISA 3O6TA 5J5NA 5EVOA 2X8CA 4P3YB 2C0EA 3KP8A 4E8HA 3LSZA 5IO0A 1DSBA 3IOSA 19GSA 1AIUA 1B4PA 1CQGA 2VCTA 2XPEA 4IBPA 3UBLA 1GLPA 1S3RA 4HDEA 1T8EB 2V6KA 4N0VA 2GQLA 4HEA2 5IMFA 4I2TA 3ED3A 2XBQA 2J23A 2LQQA 3APSA 1T00A 4RQXA 2YZHA 1G6YA 6GSXA 1Y6EA 1LBKA 2LQOA 3KJYA 2R37A 1HNCA 1T4ZA 3PINA 4Q5FA 3FEUA 1S3AA 1Z3EA 1M2AA 1AQXA 1X5EA 1JZOA 1SJ6A 1YY7A 2HRNA 1PKWA 4MZCA 1MDIA 2OE0A 1PD21 2VM1A 1TP9A 2VD0A 3HVXA 4FH8A 2B3SA 2LRCA 2OJLA 2RUEA 2M80A 6GSVA 4LLRA 4X4JA 4RQRA 4MZBA 1YDKA 2VIMA 4GSSA 3CXGA 2LEGA 1MTCA 1UN2A 3TJBA 1I9DA 1RK4A 3GX8A 3QDNA 1ABAA 2HRAA 2QKEA 5ECNB 2IN3A 1X5DA 2H73A 3EVIA 1FW1A 5CRGA 1SKWB 1U3AA 4NV5A 3E3EA 4HJ2A 4ZBBA 1XG8A 1HD2A 4LMVA 1A2JA 3EC3A 3LJRA 1G7EA 3MDKA 2R0CA 2R3XA 1Q98A 2WULA 1X9SB 3EPTA 3IC4A 1Z5YE 4YAVA 3WT1A 2M72A 2QSIA 3DYRA 5DQYA 4AGSA 4MF5A 4GTUA 4NWYA 1A2MA 5LD0A 4BVXA 1PX6A 4ZBDA 4ZL7A 2PVQA 5A4VA 1THXA 2IMKA 4V1Ag 2IMDA 1OC8A 2VO4A 4KGIA 1PX7A 5ECOB 2PN8A 4BVXB 2QGVA 1NHOA 1WE0A 2PPTA 3GA4A 2L5LA 4PUAA 5FHIA 2GQMA 5B6MA 1ZL9A 2PVOC 5KOWA 2YJHA 2IMIA 3KTBA 1U3IA 2B5YA 1SYXA 1UA5A 1TDIA 3RHCA 1JZRA 1A23A 3IHQA 1ERWA 1AW9A 4YH2A 5IPHA 1EZKA 1SKRB 5HFGA 3VWWA 2C3TA 4IVFA 4MJEA 2L5OA 1N2AA 4HJMA 1THOA 4ML1A 4GCIA 2JZSA 3UL3A 2DJKA 4POMA 5F06A 3C8EA 5ECHB 5HFKA 2HNLA 2X64A 5E59A 2C8UA 1QUWA 2NTOA 2MMOA 2VCQA 4JR6A 1V57A 4GSTA 5GZZB 5A4WA 3NIVA 1USBA 2R6KA 2HSMA 13GSA 2CT6A 4YKFA 1H75A 4MH2A 4X43A 5F8BA 3L0HA 2B1LA 4GLTA 5HR0A 4ZB8A 4L5OA 5IMAA 1T3BA 4MABA 2K18A 3C1RA 1VF3A 4KB3A 3ZMKA 2YOIA 3A2XA 2GZZA 2H30A 1K3LA 2F8FA 4TR4A 4ISDA 4PURA 2YCDA 4K9ZA 4NPBA 2GZPA 3TCOA 5KN0A 1EOGA 4EIQA 3KP9A 3L9UA 4OFTA 4FYUA 3FMWA 3UAPA
chains in the Genus database with same CATH topology
2DC5A 3PR8A 4MK3A 3VFIA 4ZBAA 4MF7A 2VCZA 2YJ7A 3LG6A 2YP6A 4K0NA 3GMFA 4KAEA 2JL4A 3GSTA 5JWQB 4BA7A 5D96A 3ME8A 3ZRDA 4Z2TA 5IO2A 3TDGA 3ZITA 2IJYA 1XFLA 2PWJA 1U6TA 3HA9A 1M2BA 1ZGNA 1J0FA 2LNTA 2KP1A 3IDVA 2BTOT 1OKTA 1KTEA 1F6MC 2O7KA 2ES7A 3IXRA 1SK2A 2X8HA 2ZCTA 2YV7A 3F3RA 2HRKA 2RM5A 3FZ4A 2YNXA 4FYBA 4ZIJA 2JSYA 4PNFA 4BL7A 2E7PA 1G7OA 3VURA 1DUGA 3AY8A 5BRTA 3M9JA 1GNEA 2KHPA 5AGYA 4BL7B 1DBYA 2WDUA 2FUG2 4KDYA 2L4QA 1R4WA 3D4TA 2YWIA 3KEBA 1O81A 4IELA 4EE0A 2A2SA 4BVYA 2LKUA 1XBSA 4CY6A 1R26A 1A0FA 3G7IA 1YEXA 2REMA 4G0KA 2I3YA 1SKSB 2HSHA 4XIHA 3UARA 2CVKA 5IM9A 1EEMA 4XS4A 1TRVA 2HXKA 3CTFA 4V1Ap 4KDXA 2B7JA 5D9WA 1UVZA 5ECQB 1GL8A 2GVPA 2LRTA 3HVSA 1PGTA 5C04A 3CTGA 3GX0A 1NHYA 1O85A 5IMZA 1PRXA 4X0XA 4G2EA 2HLSA 4XS4B 4IN0A 3UIWA 4ECJA 2GGTA 2LRNA 3EURA 4DSQA 2H70A 2YANA 1TTZA 3HVVA 2C0DA 4YQVA 2GSQA 2LSTA 4IQAA 4OMVA 2N5AA 4K7NA 3Q6OA 2C3NA 4G19A 2VL2C 2PMTA 1OE8A 11GSA 3QD9A 3VI5A 5HFIA 1GSUA 3TJKA 4AJ8A 4K5SA 1GUMA 3EU3A 2CX3A 4NHWA 2VL2A 1FB0A 4LL1B 5INYA 4L8EA 2WGRA 2DIYA 1SK0A 1B8XA 2H1DA 4WXTA 3D6IA 2C0GA 4IGJA 3CSIA 3IPZA 4MCUA 2B5XA 2A2RA 1O8XA 5J3RA 2DKHA 4KDUA 1B9XC 4NXIA 4DSRA 2O8VB 1QK8A 4QL7A 16GSA 5HR2A 1PN9A 4O5UA 2XBIA 4G0IA 3DEXA 1GWCA 3ZREA 3KH9A 2R0GA 1TI3A 4IJ3A 4PQ1A 3ZVJD 3ZIJA 4GWRA 3HJOA 3WGXA 3E9JB 1G0TA 2MYGA 1HYUA 2JZTA 3VWUA 8GSSA 4F0CA 4JRRA 3J7Yk 2HE3A 6GSTA 2I1UA 6GSUA 4TXOA 3IA1A 2KUCA 4HOJA 3KGKA 5EPFA 5JCWA 1EOHA 5G31A 4MJCA 4POKA 2LV3A 4TXOB 2P5QA 2JACA 4MPGA 4Z7XA 4KA0A 3FR9A 1TK8B 4ZL8A 4V2NA 4IHUA 1YF1A 1LJRA 2TIRA 1GSDA 2FWGA 4F0BA 3H1NA 6GSSA 2LTKA 3F8UA 3ZZXA 1XOBA 2GSRA 3HZ4A 1ON4A 3KZQA 4ECCA 4EO3A 6GSYA 1T7PB 1ILOA 4D73B 2K6VA 1TI1A 3APOA 3RAZA 1Z9HA 5IMDA 5D8IA 2H0GA 2LJRA 4JR4A 5G5EA 3ZFLA 3D0ZA 4JU5A 3DVXA 1SD8A 1VF1A 1SL1B 5J9BA 3W8JA 4G9HA 3FZ5A 1EP8A 4F2IA 2HT9A 4AJ7A 1FOVA 4OFMA 4K6XA 4AJ6A 4POLA 2OKAA 1BEDA 4Z2UA 1PSQA 5CP1A 1ST9A 4PTSA 4KE3A 3NZNA 1GSSA 1BJXA 3H4KA 9GSSA 5G1LA 1AAZA 4GSNA 2AB6A 3QAGA 3VPQA 5A5KA 2ON5A 4K0GA 3H79A 3G9BA 5FT3A 4GQCA 4ZL9A 2PUKC 3N5OA 2VLTA 4CDOA 2MMAA 3HHVA 4HQSA 2JSZA 4HU7A 1ZYQB 2H66A 1WJKA 2DMMA 5CAXA 3KMNA 1EP7A 2EIOA 2NPBA 1SYRA 3MNGA 4ACSA 2XC2A 2VM2A 4KSOA 4EDYA 1ACVA 5H5RA 5G5FA 3KD0A 1K0BA 2M46A 1XCCA 2FNOA 3LGCA 3LQ7A 1O6JA 3UMAA 4XS6A 1JHBA 5IPGA 4O5RA 5D73A 3EMXA 5HR1A 2MBSA 4K7OA 2QC7A 1GSQA 4V2MA 4JEDA 4I5QA 1ZYNA 3A5IA 1JZWA 2R4VA 4NMUA 2JU5A 1TXXA 5B6NA 4ICYA 3ZTLA 3BCKA 1J08A 3TJJA 3F6FA 4EDZA 3GHAA 2B1KA 1K0NA 3UJ1A 2H19A 2BJXA 2IL3A 1KBNA 2OA7A 4WKWA 2WB9A 4WF4A 3FRCA 3IHGA 5E4WA 4PQHA 4Z2RA 5B8BA 3ZVJA 4KCEA 3IC8A 4FO5A 3MWHA 1FB6A 3GV1A 2V32A 2VUPA 1V58A 1YKCA 2C3QA 1QQ2A 1CQHA 1YZXA 4EUYA 4IP6A 4LMWA 2H6YA 4XTSA 4USSA 1Y25A 1VF4A 4ZXGA 3APQA 12GSA 4PX1A 2KOKA 2GQKA 2CZ3A 2WFCA 1N8JA 5GAPD 2DLXA 2FWEA 1C72A 4TR1A 4N10A 5CREA 3BJ5A 1TW9A 4RI6A 2P0GA 5B8AA 5AN1A 1TU8A 3IR4A 3KH7A 5EY6A 4EIPA 3W6GA 4TR1B 3GTUA 2KLXA 1XWBA 2GSTA 1Q4JA 3ZLPA 4KSMA 5LNKe 5CO3A 6GSWA 3A2VA 3M1GA 1ZCPA 2AHEA 3GTUB 4CY8A 5GSSA 1QFNA 2TRCP 5KN1A 3VWXA 5ECPB 1Z6NA 3IV4A 3PPUA 2FA8A 3O76A 1XWCA 4H86A 1FOHA 1KNGA 2GT6A 2DSAA 4MMMA 5D93A 3H93A 3TKPA 3WT2A 4EL1A 4TOPA 2HI7A 1QMVA 3NOFA 2CZ2A 1PA3A 1NW2A 2HSYA 4TKYA 1IYIA 1SL2B 1GSYA 3FZ9A 5H5QA 2VCWA 4TVEA 1XW6A 1M9BA 4WEYA 3I43A 1PN0A 3I69A 3IBHA 4JZQA 3JCML 2GS3A 2R5GA 4HQZA 2IMEA 1JZDA 1MDKA 1MD3A 1TU7A 4ZILA 4ID0A 2N5FA 1TK0B 4POBA 1XWAA 5ID2A 1SENA 1O7UA 4GRFA 3F4TA 2CA8A 3O3TA 2FCHA 1KEBA 2QA2A 1PMTA 4WETA 2GZYA 5F0GA 5AIVA 4IP1A 2I4AA 4TRXA 1K0MA 5ID2B 1FG4A 1GTAA 3P8WA 3MIXA 3DWVA 5F07A 1WPIA 5KN3A 1XIYA 4HI7A 3DVWA 4IW9A 5CRWA 4MJAA 1MDJA 3ERWA 1S3CA 3EWLA 1EGRA 3ISOA 3US3A 3HXSA 3D22A 3SWLA 4QQ7A 1XVQA 1XW9A 4HU9A 1O8WA 1T1VA 3TJGA 1X0RA 5D9TA 2VL3A 1JFUA 5L71A 3HY2A 3CSHA 1OKDA 1BYEA 4J2FA 5ECMB 2DJ0A 5F05A 1WOUA 4TR3A 1VRSD 3VPTA 1GH2A 1EEJA 4CHSA 1NSWA 4L5LA 1FO5A 3I6AA 1GSEA 3FK8A 4O7HA 2JADA 4RI7A 3TKSC 3KM6A 2B5EA 3QR6A 2CVBA 1A2LA 1TRSA 4WBRD 2ALBA 4DEJA 3CRTA 1GUHA 4TR0A 4MPFA 5DCHA 3U5RE 1A8YA 3BD2A 3RPPA 3TKSA 5DVBA 2C0FA 5KEJA 1GTUA 2RUFA 1ZMAA 2K9FA 3QAVA 4IJIA 2IIYA 5G1KA 3GH6A 1MEKA 4ZB9A 1WWJA 5JWOB 1BG5A 2OBKA 3UBKA 5D9XA 3VI7A 1SK1A 2IWTA 3GKXA 2I81A 1NM3A 3HJMA 5DALA 1Z6MA 1K0DA 3GYKA 2PBJA 2C1YA 2A2PA 5G2ZA 1PL1A 3LWAA 5DALB 3L4NA 1GP1A 3L9SA 4AF2A 4KH7A 1XPVA 3TKRA 4KUNA 3F4RA 3GL5A 3ZYWA 1M9AA 1A24A 4ML6A 2R0PA 4Q5QA 4EXJA 4BWSA 1X9MB 1R5AA 3A3TA 1FHEA 3F3QA 3K8NA 1MD4A 2R2JA 1HNAA 1V40A 3TUEA 2F51A 20GSA 4MA9A 2CX4A 5IOWA 2H72A 1W4VA 1EV9A 1WIKA 1U88A 2E2MA 18GSA 3J7Yb 4A5PA 2WS2A 2YWOA 3KCMA 4NHZA 3DGQA 5JCUA 2F9SA 3KTLA 3RBTA 4OFNA 1DE1A 1XWKA 4PGTA 2RIIA 4K1FA 4BWQA 3MYDA 2VLUA 3P7XA 3QMXA 3CMIA 2VLVA 2CAIA 2AYTA 3GN3A 3FZAA 5ENUA 3A5WA 1OE7A 1A8LA 1GTIA 2H1BA 3UEMA 4MZWA 3IK9A 3DXBA 2VCXA 5ECRB 4EF0A 2GTUA 2E2GA 3WD6A 2V41A 1WP0A 4ZB6A 2NBSA 2H75A 2KP2A 1FVJA 4MDCA 2VOCA 1M7TA 2L6CA 2A4VA 4D73A 3IAS2 3LXZA 2H71A 2P5RA 2AJQB 3UVTA 4OCEA 2FLSA 3QOUA 2FHEA 3IK7A 3FY7A 3GRXA 2DIZA 3SBCA 4J56E 3VLNA 4KCAA 2WZ9A 4OO5A 3M0FA 4I8BA 5ABRA 3TKSE 1JLVA 1G6WA 5IMVA 5COHA 1K0AA 2PGTA 2V1MA 3LFLA 2DJJA 1ML6A 3QPMA 1B48A 3Q18A 4I6XA 3EINA 4N0ZA 4KX4A 4ECBA 3ZL5A 2I9HA 3C1SA 1PQNA 1E6BA 2EIRA 4WBJA 1XWGA 4QL9A 2HFDA 3WGEA 3S9FA 5ECIB 2FWFA 3CRUA 2MMNA 1SU9A 2V6OA 1OC9A 2CVDA 3KXOA 17GSA 3GIXA 3C7MA 3M3MA 1EV4A 3F4SA 3LXTA 4G10A 4TN8A 3V1WA 1OC9B 1XW5A 3D4MA 3HCZA 5JCGA 2K8SA 3RHBA 1AUCA 4O5QA 3ERFA 2Z9SA 3D5JA 4HZ2A 4PQIA 3F9UA 1ZOFA 3G7YA 5B7CA 2B7KA 2OBIA 3LEFA 2AUVA 5DCGA 3D21A 3GL3A 5CRHA 2B6MA 4HS1A 1XZOA 1YF0A 22GSA 5HQPA 3WGDA 1BQ7A 2H76A 3GUSA 1ZYEA 2WJUA 1Z7RA 1ERUA 5H5SA 1SJIA 4K2XA 3BCIA 2QA1A 1K0OA 1SD9A 3TKQA 1V9WA 4Q5RA 1M2DA 1URMA 2VL9A 3BBYA 4EVMA 3IE3A 2LS5A 1GSFA 3R2QA 5ECLB 4LA1A 4GQFA 3ZIVA 1W89A 5EL8A 1ZYPA 2HRFA 3DRNA 4GF0A 5GAND 4XHMA 3F6DA 1V98A 2VD1A 1HQOA 5DDLA 1QXHA 3TRXA 2L59A 5ECKB 2H74A 2DJ3A 2H0IA 1E2YA 1SJZA 4YKGA 2H6XA 3QCPA 2K8VA 3CYNA 2DBCA 3CBUA 4IKHA 2H1GA 4N30A 2ON7A 1XXUA 3M9KA 4I97A 3QFBC 2VAFA 4G0LA 5IIZA 3DD3A 2O89A 4F9ZA 2O87A 1JLWA 1YJ6A 2IPAA 2H1AA 2L4CA 3M8NA 5IMCA 3QFAC 1X5CA 1H4OA 3WYWA 1I5GA 3KIJA 2NVLA 4TW5A 3F63A 3GURA 3FKFA 1LU4A 3GKMA 2H0HA 1GTBA 4OO4A 2V2GA 4ILFA 3E0UA 4E8EA 4FQUA 5DQSA 3G7JA 2H6ZA 2EC4A 1AC1A 4OCFA 2X49A 5J41A 2N5BA 5CYYA 2CV4A 3TGZA 4IS0A 1S3DA 2DMLA 3F0IA 3P90A 3EYTA 3UVHA 3ZMLA 2IFQA 2TRXA 1GLQA 4WR4A 3LYPA 2C4JA 1YEPA 2HYXA 4NV2A 2X99A 1AQWA 1AXDA 3GFKA 2GSSA 2OACA 2LNSA 2IFQB 2XHFA 1ERTA 5C00A 4O32A 2EIQA 4K2DA 5LCZA 4K5RA 3Q74A 3RDWA 3DMLA 2WCIA 2CQ9A 4K7IA 2OE3A 2L6DA 2UZ8A 5IOXA 3L78A 1TKDB 4J57E 2F8AA 1WRYA 5CRDA 5DAKA 1GNWA 1GRXA 1YQ1A 2AV4A 4HUAA 4WR5A 1F3AA 2XPDA 1GUKA 3ERGA 4MF6A 4JBBA 3ZFBA 4PUFC 3DKSA 5DBQA 1T4YA 5DAKB 1K3YA 4NAXA 5HR3A 3FYGA 3L9VA 1FVKA 2LUSA 3TB2A 3DIEA 2GLRA 3MSZA 5BMUA 1VF2A 2PU9C 3RPNA 5KN2A 1HNBA 2HZFA 4ECIA 1DE2A 1B9YC 1YKAA 2LJAA 3W8SA 3CSJA 1OYJA 2DJ2A 4XS1A 1PL2A 2J9HA 2G2QA 4JE1A 3HKRA 3HDCA 4Q5NA 4F82A 3GSSA 4YQMA 2MBTA 3FR3A 2WRTA 3BOAA 2L57A 3FHKA 3FR6A 3VWVA 1BX9A 1EGOA 1U87A 5DJMA 5G30A 4EKZA 4KW6A 1M99A 10GSA 1EWXA 3A2WA 4F03A 4DVCA 1OVNA 2YWMA 4V2LA 3TRPA 5GSTA 2ZNMA 3IRAA 3I9V2 1BAYA 1TRWA 2FY6A 3HYPA 5JWRB 3C71A 1B4QA 4OWYA 3ME7A 5CNWA 1VGLA 3LORA 3Q19A 2YV9A 3UOMA 4KF9A 3HZ8A 1TRUA 2LJKA 4L0WA 1PKZA 1V2AA 3P2AA 2PERA 4L0UA 4YAPA 5J9CA 1XOAA 4BPYA 3EU4A 2D2ZA 2FWHA 2HZEA 2OE1A 1Z7PA 5FWGA 2VCVA 2E0QA 3EMPA 4MP4A 1X9WB 4RUVA 4K8MA 2P31A 1F37A 2HZEB 3H8QA 4BVYB 5DJLA 3MAKA 4DSSA 2BMXA 2GDRA 2YZUA 2H8LA 4MJBA 4LL4B 1XVWA 4O92A 2G0FA 4IQ1A 4DSSB 2RLIA 2X8GA 1ERVA 3GNJA 5ECSA 5J4UA 4XRDA 2H01A 1R7HA 2O85A 4MNNA 3HJPA 2FD3A 2YN1A 1RQMA 5A4UA 4XCSA 2OADA 14GSA 2CAQA 1IYHA 3EE2A 3IAM2 4MLYA 4YQUA 5KOXA 4PNGA 1R5PA 1QGVA 7GSSA 3HD5A 2DKIA 1OAZA 4MH3A 2IMFA 2JZRA 4KNDA 5AIXA 3FW2A 2F3MA 2MMZA 3LW9A 3C73A 3R3EA 3LYKA 3TJFA 3VK9A 2C80A 3PGTA 3QAWA 2MZCA 4TXVA 2AAWA 1WMJA 4XRAA 2FA4A 3GH9A 4PXOA 3TOUA 3GKKA 2NDOA 1ZZYA 2GT5A 5D9VA 1F3BA 2DJ1A 1O73A 4N11A 5IQYA 2ZUPA 4CW9A 1SL0B 1K0CA 3TOTA 1TOFA 3N9JA 4ULXA 1K3OA 1AQVA 3KMOA 1GULA 4GXZA 5ELAA 3U6VA 1UC7A 3OR5A 4FYCA 2RM6A 1A0RP 1RW1A 1M0UA 1TJDA 1TK5B 1FAAA 4I2UA 5ELGA 1F2EA 2X4AA 2FGXA 1F9MA 4OD7A 2YPMA 4WF5A 4EC0A 4HZ4A 3TRQA 1OC3A 4FIWA 3GKNA 3PH9A 2YWNA 2A4HA 4X1UA 1J9BA 5AISA 3O6TA 5J5NA 5EVOA 2X8CA 4P3YB 2C0EA 3KP8A 4E8HA 3LSZA 5IO0A 1DSBA 3IOSA 19GSA 1AIUA 1B4PA 1CQGA 2VCTA 2XPEA 4IBPA 3UBLA 1GLPA 4HDEA 1T8EB 2V6KA 4N0VA 2GQLA 4HEA2 5IMFA 4I2TA 3ED3A 2XBQA 2J23A 2LQQA 3APSA 1T00A 4RQXA 2YZHA 1G6YA 6GSXA 1Y6EA 1LBKA 2LQOA 3KJYA 2R37A 1HNCA 1T4ZA 3PINA 4Q5FA 3FEUA 1S3AA 1Z3EA 1M2AA 1AQXA 1X5EA 1JZOA 1SJ6A 1YY7A 2HRNA 1PKWA 4MZCA 1MDIA 2OE0A 1PD21 2VM1A 1TP9A 2VD0A 3HVXA 4FH8A 2B3SA 2LRCA 2OJLA 2RUEA 2M80A 6GSVA 4LLRA 4X4JA 4RQRA 4MZBA 1YDKA 2VIMA 4GSSA 3CXGA 2LEGA 1MTCA 1UN2A 3TJBA 1I9DA 1RK4A 3GX8A 3QDNA 1ABAA 2HRAA 2QKEA 5ECNB 2IN3A 1X5DA 2H73A 3EVIA 1FW1A 5CRGA 1SKWB 1U3AA 4NV5A 3E3EA 4HJ2A 4ZBBA 1HD2A 4LMVA 1A2JA 3EC3A 3LJRA 1G7EA 3MDKA 2R0CA 2R3XA 1Q98A 2WULA 1X9SB 3EPTA 3IC4A 1Z5YE 4YAVA 3WT1A 2M72A 2QSIA 3DYRA 5DQYA 4AGSA 4MF5A 4GTUA 4NWYA 1A2MA 5LD0A 4BVXA 1PX6A 4ZBDA 4ZL7A 2PVQA 5A4VA 1THXA 2IMKA 4V1Ag 2IMDA 1OC8A 2VO4A 4KGIA 1PX7A 5ECOB 2PN8A 4BVXB 2QGVA 1NHOA 1WE0A 2PPTA 3GA4A 2L5LA 4PUAA 5FHIA 2GQMA 5B6MA 1ZL9A 2PVOC 5KOWA 2YJHA 2IMIA 3KTBA 1U3IA 2B5YA 1SYXA 1UA5A 1TDIA 3RHCA 1JZRA 1A23A 3IHQA 1ERWA 1AW9A 4YH2A 5IPHA 1EZKA 1SKRB 5HFGA 3VWWA 2C3TA 4IVFA 4MJEA 2L5OA 1N2AA 4HJMA 1THOA 4ML1A 4GCIA 2JZSA 3UL3A 2DJKA 4POMA 5F06A 3C8EA 5ECHB 5HFKA 2HNLA 2X64A 5E59A 2C8UA 1QUWA 2NTOA 2MMOA 2VCQA 4JR6A 1V57A 4GSTA 5GZZB 5A4WA 3NIVA 1USBA 2R6KA 2HSMA 13GSA 2CT6A 4YKFA 1H75A 4MH2A 4X43A 5F8BA 3L0HA 2B1LA 4GLTA 5HR0A 4ZB8A 4L5OA 5IMAA 1T3BA 4MABA 2K18A 3C1RA 1VF3A 4KB3A 3ZMKA 2YOIA 3A2XA 2GZZA 2H30A 1K3LA 2F8FA 4TR4A 4ISDA 4PURA 2YCDA 4K9ZA 4NPBA 2GZPA 3TCOA 5KN0A 1EOGA 4EIQA 3KP9A 3L9UA 4OFTA 4FYUA 3FMWA 3UAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DC5 A;  3PR8 A;  4MK3 A;  3VFI A;  4ZBA A;  4MF7 A;  2VCZ A;  2YJ7 A;  3LG6 A;  2YP6 A;  4K0N A;  3GMF A;  4KAE A;  2JL4 A;  3GST A;  5JWQ B;  4BA7 A;  5D96 A;  3ME8 A;  3ZRD A;  5IO2 A;  3TDG A;  3ZIT A;  2IJY A;  1XFL A;  2PWJ A;  1U6T A;  3HA9 A;  1M2B A;  1ZGN A;  1J0F A;  2LNT A;  2KP1 A;  3IDV A;  2BTO T;  1OKT A;  1KTE A;  1F6M C;  2O7K A;  2ES7 A;  3IXR A;  1SK2 A;  2X8H A;  2ZCT A;  2YV7 A;  3F3R A;  2RM5 A;  3FZ4 A;  2YNX A;  4FYB A;  4ZIJ A;  2JSY A;  4PNF A;  4BL7 A;  2E7P A;  1G7O A;  3VUR A;  1DUG A;  3AY8 A;  3M9J A;  1GNE A;  2KHP A;  5AGY A;  1DBY A;  2WDU A;  2FUG 2;  4KDY A;  2L4Q A;  1R4W A;  3D4T A;  2YWI A;  3KEB A;  1O81 A;  4IEL A;  4EE0 A;  2A2S A;  4BVY A;  2LKU A;  1XBS A;  1R26 A;  1A0F A;  3G7I A;  1YEX A;  2REM A;  2I3Y A;  1SKS B;  2HSH A;  4XIH A;  3UAR A;  2CVK A;  5IM9 A;  1EEM A;  4XS4 A;  1TRV A;  2HXK A;  3CTF A;  4V1A p;  4KDX A;  2B7J A;  5D9W A;  1UVZ A;  5ECQ B;  1GL8 A;  2GVP A;  2LRT A;  3HVS A;  1PGT A;  5C04 A;  3CTG A;  3GX0 A;  1NHY A;  1O85 A;  5IMZ A;  1PRX A;  4X0X A;  4G2E A;  2HLS A;  4XS4 B;  4IN0 A;  3UIW A;  4ECJ A;  2GGT A;  2LRN A;  3EUR A;  4DSQ A;  2H70 A;  2YAN A;  1TTZ A;  3HVV A;  2C0D A;  4YQV A;  2GSQ A;  2LST A;  4IQA A;  4OMV A;  2N5A A;  4K7N A;  3Q6O A;  2C3N A;  4G19 A;  2VL2 C;  2PMT A;  1OE8 A;  11GS A;  3QD9 A;  3VI5 A;  5HFI A;  1GSU A;  3TJK A;  4AJ8 A;  1GUM A;  3EU3 A;  2CX3 A;  4NHW A;  2VL2 A;  1FB0 A;  4LL1 B;  5INY A;  4L8E A;  2WGR A;  2DIY A;  1SK0 A;  1B8X A;  2H1D A;  4WXT A;  3D6I A;  2C0G A;  4IGJ A;  3CSI A;  3IPZ A;  4MCU A;  2B5X A;  2A2R A;  1O8X A;  5J3R A;  4KDU A;  1B9X C;  4NXI A;  4DSR A;  2O8V B;  1QK8 A;  4QL7 A;  16GS A;  5HR2 A;  1PN9 A;  2XBI A;  3DEX A;  1GWC A;  3ZRE A;  3KH9 A;  1TI3 A;  4IJ3 A;  4PQ1 A;  3ZVJ D;  3ZIJ A;  4GWR A;  3HJO A;  3WGX A;  3E9J B;  1G0T A;  2MYG A;  1HYU A;  2JZT A;  3VWU A;  8GSS A;  4F0C A;  4JRR A;  3J7Y k;  2HE3 A;  6GST A;  2I1U A;  6GSU A;  4TXO A;  3IA1 A;  2KUC A;  4HOJ A;  3KGK A;  5EPF A;  5JCW A;  1EOH A;  5G31 A;  4MJC A;  4POK A;  2LV3 A;  4TXO B;  2P5Q A;  2JAC A;  4MPG A;  4Z7X A;  4KA0 A;  3FR9 A;  1TK8 B;  4ZL8 A;  4V2N A;  4IHU A;  1YF1 A;  1LJR A;  2TIR A;  1GSD A;  2FWG A;  4F0B A;  3H1N A;  6GSS A;  2LTK A;  3F8U A;  3ZZX A;  1XOB A;  2GSR A;  3HZ4 A;  1ON4 A;  3KZQ A;  4ECC A;  4EO3 A;  6GSY A;  1T7P B;  1ILO A;  4D73 B;  2K6V A;  1TI1 A;  3APO A;  3RAZ A;  1Z9H A;  5IMD A;  5D8I A;  2H0G A;  2LJR A;  4JR4 A;  5G5E A;  3ZFL A;  3D0Z A;  4JU5 A;  3DVX A;  1SD8 A;  1VF1 A;  1SL1 B;  5J9B A;  3W8J A;  4G9H A;  3FZ5 A;  1EP8 A;  4F2I A;  2HT9 A;  4AJ7 A;  1FOV A;  4OFM A;  4K6X A;  4AJ6 A;  4POL A;  2OKA A;  1BED A;  1PSQ A;  5CP1 A;  1ST9 A;  4KE3 A;  3NZN A;  1GSS A;  1BJX A;  3H4K A;  9GSS A;  5G1L A;  1AAZ A;  4GSN A;  2AB6 A;  3QAG A;  3VPQ A;  5A5K A;  2ON5 A;  4K0G A;  3H79 A;  3G9B A;  5FT3 A;  4GQC A;  4ZL9 A;  2PUK C;  3N5O A;  2VLT A;  4CDO A;  2MMA A;  3HHV A;  4HQS A;  2JSZ A;  4HU7 A;  1ZYQ B;  2H66 A;  1WJK A;  2DMM A;  5CAX A;  3KMN A;  1EP7 A;  2EIO A;  2NPB A;  1SYR A;  3MNG A;  4ACS A;  2XC2 A;  2VM2 A;  4KSO A;  4EDY A;  1ACV A;  5H5R A;  5G5F A;  3KD0 A;  1K0B A;  2M46 A;  1XCC A;  2FNO A;  3LGC A;  3LQ7 A;  1O6J A;  3UMA A;  4XS6 A;  1JHB A;  5IPG A;  4O5R A;  5D73 A;  3EMX A;  5HR1 A;  2MBS A;  4K7O A;  2QC7 A;  1GSQ A;  4V2M A;  4JED A;  4I5Q A;  1JZW A;  2R4V A;  4NMU A;  2JU5 A;  1TXX A;  5B6N A;  3ZTL A;  3BCK A;  1J08 A;  3TJJ A;  3F6F A;  4EDZ A;  3GHA A;  2B1K A;  1K0N A;  3UJ1 A;  2H19 A;  2BJX A;  2IL3 A;  1KBN A;  2OA7 A;  4WKW A;  2WB9 A;  4WF4 A;  3FRC A;  5E4W A;  4PQH A;  5B8B A;  3ZVJ A;  4KCE A;  4FO5 A;  3MWH A;  1FB6 A;  3GV1 A;  2V32 A;  2VUP A;  1V58 A;  1YKC A;  2C3Q A;  1QQ2 A;  1CQH A;  1YZX A;  4EUY A;  4IP6 A;  4LMW A;  2H6Y A;  4XTS A;  1Y25 A;  1VF4 A;  4ZXG A;  3APQ A;  12GS A;  4PX1 A;  2KOK A;  2GQK A;  2CZ3 A;  2WFC A;  1N8J A;  5GAP D;  2DLX A;  2FWE A;  1C72 A;  4TR1 A;  4N10 A;  5CRE A;  3BJ5 A;  1TW9 A;  4RI6 A;  2P0G A;  5B8A A;  5AN1 A;  1TU8 A;  3IR4 A;  3KH7 A;  5EY6 A;  3W6G A;  4TR1 B;  3GTU A;  2KLX A;  1XWB A;  2GST A;  1Q4J A;  3ZLP A;  4KSM A;  5LNK e;  5CO3 A;  6GSW A;  3A2V A;  3M1G A;  1ZCP A;  2AHE A;  3GTU B;  5GSS A;  1QFN A;  2TRC P;  5KN1 A;  3VWX A;  5ECP B;  1Z6N A;  3IV4 A;  2FA8 A;  3O76 A;  1XWC A;  4H86 A;  1KNG A;  2GT6 A;  2DSA A;  4MMM A;  5D93 A;  3H93 A;  3TKP A;  3WT2 A;  4EL1 A;  4TOP A;  2HI7 A;  1QMV A;  3NOF A;  2CZ2 A;  1PA3 A;  1NW2 A;  2HSY A;  4TKY A;  1IYI A;  1SL2 B;  1GSY A;  3FZ9 A;  5H5Q A;  2VCW A;  4TVE A;  1XW6 A;  1M9B A;  4WEY A;  3I43 A;  3I69 A;  3IBH A;  4JZQ A;  3JCM L;  2GS3 A;  2R5G A;  4HQZ A;  2IME A;  1JZD A;  1MDK A;  1MD3 A;  1TU7 A;  4ZIL A;  4ID0 A;  2N5F A;  1TK0 B;  4POB A;  1XWA A;  5ID2 A;  1SEN A;  1O7U A;  4GRF A;  3F4T A;  2CA8 A;  3O3T A;  2FCH A;  1KEB A;  1PMT A;  4WET A;  2GZY A;  5F0G A;  5AIV A;  4IP1 A;  2I4A A;  4TRX A;  1K0M A;  5ID2 B;  1FG4 A;  1GTA A;  3P8W A;  3DWV A;  5F07 A;  1WPI A;  5KN3 A;  1XIY A;  4HI7 A;  3DVW A;  4IW9 A;  5CRW A;  4MJA A;  1MDJ A;  3ERW A;  1S3C A;  3EWL A;  1EGR A;  3ISO A;  3US3 A;  3HXS A;  3D22 A;  3SWL A;  4QQ7 A;  1XVQ A;  1XW9 A;  4HU9 A;  1O8W A;  1T1V A;  3TJG A;  1X0R A;  5D9T A;  2VL3 A;  1JFU A;  5L71 A;  3HY2 A;  3CSH A;  1OKD A;  1BYE A;  4J2F A;  5ECM B;  2DJ0 A;  5F05 A;  1WOU A;  4TR3 A;  1VRS D;  3VPT A;  1GH2 A;  1EEJ A;  4CHS A;  1NSW A;  4L5L A;  1FO5 A;  3I6A A;  1GSE A;  3FK8 A;  4O7H A;  2JAD A;  4RI7 A;  3TKS C;  3KM6 A;  2B5E A;  3QR6 A;  2CVB A;  1A2L A;  1TRS A;  4WBR D;  2ALB A;  4DEJ A;  3CRT A;  1GUH A;  4TR0 A;  4MPF A;  5DCH A;  3U5R E;  1A8Y A;  3BD2 A;  3RPP A;  3TKS A;  5DVB A;  2C0F A;  5KEJ A;  1GTU A;  2RUF A;  1ZMA A;  2K9F A;  3QAV A;  4IJI A;  2IIY A;  5G1K A;  3GH6 A;  1MEK A;  4ZB9 A;  1WWJ A;  5JWO B;  1BG5 A;  2OBK A;  3UBK A;  5D9X A;  3VI7 A;  1SK1 A;  2IWT A;  3GKX A;  2I81 A;  1NM3 A;  3HJM A;  5DAL A;  1Z6M A;  1K0D A;  3GYK A;  2PBJ A;  2C1Y A;  5G2Z A;  1PL1 A;  3LWA A;  5DAL B;  3L4N A;  1GP1 A;  3L9S A;  4AF2 A;  4KH7 A;  1XPV A;  3TKR A;  4KUN A;  3F4R A;  3GL5 A;  3ZYW A;  1M9A A;  1A24 A;  4ML6 A;  4Q5Q A;  4EXJ A;  4BWS A;  1X9M B;  1R5A A;  3A3T A;  1FHE A;  3F3Q A;  3K8N A;  1MD4 A;  2R2J A;  1HNA A;  1V40 A;  3TUE A;  2F51 A;  20GS A;  4MA9 A;  2CX4 A;  5IOW A;  2H72 A;  1W4V A;  1EV9 A;  1WIK A;  1U88 A;  2E2M A;  18GS A;  3J7Y b;  2WS2 A;  2YWO A;  3KCM A;  4NHZ A;  3DGQ A;  5JCU A;  2F9S A;  3KTL A;  3RBT A;  4OFN A;  1DE1 A;  1XWK A;  4PGT A;  2RII A;  4K1F A;  4BWQ A;  2VLU A;  3P7X A;  3QMX A;  3CMI A;  2VLV A;  2CAI A;  2AYT A;  3GN3 A;  3FZA A;  5ENU A;  3A5W A;  1OE7 A;  1A8L A;  1GTI A;  2H1B A;  3UEM A;  4MZW A;  3IK9 A;  3DXB A;  2VCX A;  5ECR B;  4EF0 A;  2GTU A;  2E2G A;  3WD6 A;  2V41 A;  1WP0 A;  4ZB6 A;  2NBS A;  2H75 A;  2KP2 A;  1FVJ A;  4MDC A;  2VOC A;  1M7T A;  2L6C A;  2A4V A;  4D73 A;  3IAS 2;  3LXZ A;  2H71 A;  2P5R A;  2AJQ B;  3UVT A;  4OCE A;  2FLS A;  3QOU A;  2FHE A;  3IK7 A;  3FY7 A;  3GRX A;  2DIZ A;  3SBC A;  4J56 E;  3VLN A;  4KCA A;  2WZ9 A;  4OO5 A;  3M0F A;  4I8B A;  5ABR A;  3TKS E;  1JLV A;  1G6W A;  5IMV A;  5COH A;  1K0A A;  2PGT A;  2V1M A;  3LFL A;  2DJJ A;  1ML6 A;  3QPM A;  1B48 A;  3Q18 A;  4I6X A;  3EIN A;  4N0Z A;  4KX4 A;  4ECB A;  3ZL5 A;  2I9H A;  3C1S A;  1PQN A;  1E6B A;  2EIR A;  4WBJ A;  1XWG A;  4QL9 A;  2HFD A;  3WGE A;  3S9F A;  5ECI B;  2FWF A;  3CRU A;  2MMN A;  1SU9 A;  2V6O A;  1OC9 A;  2CVD A;  3KXO A;  17GS A;  3GIX A;  3C7M A;  3M3M A;  1EV4 A;  3F4S A;  3LXT A;  4G10 A;  4TN8 A;  3V1W A;  1OC9 B;  1XW5 A;  3D4M A;  3HCZ A;  5JCG A;  2K8S A;  3RHB A;  1AUC A;  3ERF A;  2Z9S A;  3D5J A;  4HZ2 A;  4PQI A;  3F9U A;  1ZOF A;  3G7Y A;  5B7C A;  2B7K A;  2OBI A;  3LEF A;  2AUV A;  5DCG A;  3D21 A;  3GL3 A;  5CRH A;  2B6M A;  4HS1 A;  1XZO A;  1YF0 A;  22GS A;  5HQP A;  3WGD A;  1BQ7 A;  2H76 A;  3GUS A;  1ZYE A;  2WJU A;  1Z7R A;  1ERU A;  5H5S A;  1SJI A;  3BCI A;  1K0O A;  1SD9 A;  3TKQ A;  1V9W A;  4Q5R A;  1M2D A;  1URM A;  2VL9 A;  3BBY A;  4EVM A;  3IE3 A;  2LS5 A;  1GSF A;  3R2Q A;  5ECL B;  4LA1 A;  4GQF A;  3ZIV A;  1W89 A;  5EL8 A;  2HRF A;  3DRN A;  4GF0 A;  5GAN D;  4XHM A;  3F6D A;  1V98 A;  2VD1 A;  5DDL A;  1HQO A;  1QXH A;  3TRX A;  2L59 A;  5ECK B;  2H74 A;  2DJ3 A;  2H0I A;  1E2Y A;  1SJZ A;  2H6X A;  3QCP A;  2K8V A;  3CYN A;  2DBC A;  3CBU A;  4IKH A;  2H1G A;  4N30 A;  2ON7 A;  1XXU A;  3M9K A;  4I97 A;  3QFB C;  2VAF A;  5IIZ A;  3DD3 A;  2O89 A;  4F9Z A;  2O87 A;  1JLW A;  1YJ6 A;  2IPA A;  2H1A A;  2L4C A;  3M8N A;  5IMC A;  3QFA C;  1X5C A;  1H4O A;  3WYW A;  1I5G A;  3KIJ A;  2NVL A;  4TW5 A;  3F63 A;  3GUR A;  3FKF A;  1LU4 A;  3GKM A;  2H0H A;  1GTB A;  4OO4 A;  2V2G A;  4ILF A;  3E0U A;  4E8E A;  5DQS A;  3G7J A;  2H6Z A;  2EC4 A;  1AC1 A;  4OCF A;  5J41 A;  2N5B A;  5CYY A;  2CV4 A;  3TGZ A;  4IS0 A;  1S3D A;  2DML A;  3F0I A;  3P90 A;  3EYT A;  3UVH A;  3ZML A;  2IFQ A;  2TRX A;  1GLQ A;  4WR4 A;  3LYP A;  2C4J A;  1YEP A;  2HYX A;  4NV2 A;  2X99 A;  1AQW A;  1AXD A;  3GFK A;  2GSS A;  2OAC A;  2LNS A;  2IFQ B;  2XHF A;  1ERT A;  5C00 A;  4O32 A;  2EIQ A;  4K2D A;  5LCZ A;  3Q74 A;  3RDW A;  3DML A;  2WCI A;  2CQ9 A;  4K7I A;  2OE3 A;  2L6D A;  5IOX A;  3L78 A;  1TKD B;  4J57 E;  2F8A A;  1WRY A;  5CRD A;  5DAK A;  1GNW A;  1GRX A;  1YQ1 A;  2AV4 A;  4HUA A;  4WR5 A;  1F3A A;  2XPD A;  1GUK A;  3ERG A;  4MF6 A;  4JBB A;  3ZFB A;  4PUF C;  3DKS A;  5DBQ A;  1T4Y A;  5DAK B;  1K3Y A;  4NAX A;  5HR3 A;  3FYG A;  3L9V A;  1FVK A;  2LUS A;  3TB2 A;  3DIE A;  2GLR A;  3MSZ A;  1VF2 A;  2PU9 C;  3RPN A;  5KN2 A;  1HNB A;  2HZF A;  4ECI A;  1DE2 A;  1B9Y C;  1YKA A;  2LJA A;  3W8S A;  3CSJ A;  1OYJ A;  2DJ2 A;  4XS1 A;  1PL2 A;  2J9H A;  2G2Q A;  4JE1 A;  3HKR A;  3HDC A;  4Q5N A;  4F82 A;  3GSS A;  4YQM A;  2MBT A;  3FR3 A;  2WRT A;  3BOA A;  2L57 A;  3FHK A;  3FR6 A;  3VWV A;  1BX9 A;  1EGO A;  1U87 A;  5DJM A;  5G30 A;  4EKZ A;  4KW6 A;  1M99 A;  10GS A;  1EWX A;  3A2W A;  4F03 A;  4DVC A;  1OVN A;  2YWM A;  4V2L A;  3TRP A;  5GST A;  2ZNM A;  3IRA A;  3I9V 2;  1BAY A;  1TRW A;  2FY6 A;  3HYP A;  5JWR B;  3C71 A;  1B4Q A;  4OWY A;  3ME7 A;  5CNW A;  1VGL A;  3LOR A;  3Q19 A;  2YV9 A;  3UOM A;  3HZ8 A;  1TRU A;  2LJK A;  4L0W A;  1PKZ A;  1V2A A;  3P2A A;  2PER A;  4L0U A;  4YAP A;  5J9C A;  1XOA A;  4BPY A;  2D2Z A;  2FWH A;  2HZE A;  2OE1 A;  3EU4 A;  1Z7P A;  5FWG A;  2VCV A;  2E0Q A;  3EMP A;  4MP4 A;  1X9W B;  4RUV A;  4K8M A;  2P31 A;  1F37 A;  2HZE B;  3H8Q A;  5DJL A;  3MAK A;  4DSS A;  2BMX A;  2GDR A;  2YZU A;  2H8L A;  4MJB A;  4LL4 B;  1XVW A;  4O92 A;  2G0F A;  4IQ1 A;  4DSS B;  2RLI A;  2X8G A;  1ERV A;  3GNJ A;  5ECS A;  5J4U A;  4XRD A;  2H01 A;  1R7H A;  2O85 A;  3HJP A;  2FD3 A;  2YN1 A;  1RQM A;  5A4U A;  4XCS A;  2OAD A;  14GS A;  2CAQ A;  1IYH A;  3EE2 A;  3IAM 2;  4MLY A;  4YQU A;  4PNG A;  1R5P A;  1QGV A;  7GSS A;  3HD5 A;  1OAZ A;  4MH3 A;  2IMF A;  2JZR A;  4KND A;  5AIX A;  3FW2 A;  2F3M A;  2MMZ A;  3C73 A;  3LYK A;  3TJF A;  3VK9 A;  2C80 A;  3PGT A;  3QAW A;  2MZC A;  4TXV A;  2AAW A;  1WMJ A;  4XRA A;  2FA4 A;  3GH9 A;  4PXO A;  3TOU A;  3GKK A;  2NDO A;  1ZZY A;  2GT5 A;  5D9V A;  1F3B A;  2DJ1 A;  1O73 A;  4N11 A;  5IQY A;  2ZUP A;  4CW9 A;  1SL0 B;  1K0C A;  3TOT A;  1TOF A;  3N9J A;  4ULX A;  1K3O A;  1AQV A;  3KMO A;  1GUL A;  4GXZ A;  5ELA A;  3U6V A;  1UC7 A;  3OR5 A;  4FYC A;  2RM6 A;  1A0R P;  1RW1 A;  1M0U A;  1TJD A;  1TK5 B;  1FAA A;  4I2U A;  5ELG A;  1F2E A;  2FGX A;  1F9M A;  4OD7 A;  2YPM A;  4WF5 A;  4EC0 A;  4HZ4 A;  3TRQ A;  1OC3 A;  4FIW A;  3GKN A;  3PH9 A;  2YWN A;  4X1U A;  1J9B A;  5AIS A;  3O6T A;  5J5N A;  5EVO A;  2X8C A;  4P3Y B;  2C0E A;  3KP8 A;  4E8H A;  3LSZ A;  5IO0 A;  1DSB A;  3IOS A;  19GS A;  1AIU A;  1B4P A;  1CQG A;  2VCT A;  2XPE A;  4IBP A;  3UBL A;  1GLP A;  4HDE A;  1T8E B;  2V6K A;  4N0V A;  2GQL A;  4HEA 2;  5IMF A;  4I2T A;  3ED3 A;  2XBQ A;  2J23 A;  2LQQ A;  3APS A;  1T00 A;  4RQX A;  2YZH A;  1G6Y A;  6GSX A;  1Y6E A;  1LBK A;  2LQO A;  3KJY A;  2R37 A;  1HNC A;  1T4Z A;  3PIN A;  4Q5F A;  3FEU A;  1S3A A;  1Z3E A;  1M2A A;  1AQX A;  1X5E A;  1JZO A;  1SJ6 A;  1YY7 A;  2HRN A;  1PKW A;  4MZC A;  1MDI A;  2OE0 A;  1PD2 1;  2VM1 A;  1TP9 A;  2VD0 A;  3HVX A;  4FH8 A;  2B3S A;  2LRC A;  2OJL A;  2RUE A;  2M80 A;  6GSV A;  4LLR A;  4RQR A;  4MZB A;  1YDK A;  2VIM A;  4GSS A;  3CXG A;  2LEG A;  1MTC A;  1UN2 A;  3TJB A;  1I9D A;  1RK4 A;  3GX8 A;  3QDN A;  1ABA A;  2QKE A;  5ECN B;  2IN3 A;  1X5D A;  2H73 A;  3EVI A;  1FW1 A;  5CRG A;  1SKW B;  1U3A A;  4NV5 A;  3E3E A;  4HJ2 A;  4ZBB A;  1HD2 A;  4LMV A;  1A2J A;  3EC3 A;  3LJR A;  1G7E A;  3MDK A;  2R3X A;  1Q98 A;  2WUL A;  1X9S B;  3IC4 A;  1Z5Y E;  4YAV A;  3WT1 A;  2M72 A;  2QSI A;  3DYR A;  5DQY A;  4AGS A;  4MF5 A;  4GTU A;  4NWY A;  1A2M A;  5LD0 A;  4BVX A;  1PX6 A;  4ZBD A;  4ZL7 A;  2PVQ A;  5A4V A;  1THX A;  2IMK A;  4V1A g;  2IMD A;  1OC8 A;  2VO4 A;  4KGI A;  1PX7 A;  5ECO B;  2PN8 A;  2QGV A;  1NHO A;  1WE0 A;  2PPT A;  3GA4 A;  2L5L A;  4PUA A;  5FHI A;  2GQM A;  5B6M A;  1ZL9 A;  2PVO C;  2YJH A;  2IMI A;  3KTB A;  1U3I A;  2B5Y A;  1SYX A;  1UA5 A;  3RHC A;  1JZR A;  1A23 A;  3IHQ A;  1ERW A;  1AW9 A;  4YH2 A;  5IPH A;  1EZK A;  1SKR B;  5HFG A;  3VWW A;  2C3T A;  4IVF A;  4MJE A;  2L5O A;  1N2A A;  4HJM A;  1THO A;  4ML1 A;  4GCI A;  2JZS A;  3UL3 A;  2DJK A;  4POM A;  5F06 A;  3C8E A;  5ECH B;  5HFK A;  2HNL A;  2X64 A;  5E59 A;  2C8U A;  1QUW A;  2NTO A;  2MMO A;  2VCQ A;  4JR6 A;  1V57 A;  4GST A;  5GZZ B;  5A4W A;  3NIV A;  1USB A;  2R6K A;  13GS A;  2CT6 A;  1H75 A;  4MH2 A;  4X43 A;  5F8B A;  3L0H A;  2B1L A;  4GLT A;  5HR0 A;  4ZB8 A;  4L5O A;  5IMA A;  1T3B A;  4MAB A;  2K18 A;  3C1R A;  1VF3 A;  4KB3 A;  3ZMK A;  2YOI A;  3A2X A;  2GZZ A;  2H30 A;  1K3L A;  2F8F A;  4TR4 A;  4ISD A;  4PUR A;  2YCD A;  4K9Z A;  4NPB A;  2GZP A;  3TCO A;  5KN0 A;  1EOG A;  3KP9 A;  3L9U A;  4OFT A;  4FYU A;  1TDI A;  3UAP A; 
#chains in the Genus database with same CATH topology
 2DC5 A;  3PR8 A;  4MK3 A;  3VFI A;  4ZBA A;  4MF7 A;  2VCZ A;  2YJ7 A;  3LG6 A;  2YP6 A;  4K0N A;  3GMF A;  4KAE A;  2JL4 A;  3GST A;  5JWQ B;  4BA7 A;  5D96 A;  3ME8 A;  3ZRD A;  4Z2T A;  5IO2 A;  3TDG A;  3ZIT A;  2IJY A;  1XFL A;  2PWJ A;  1U6T A;  3HA9 A;  1M2B A;  1ZGN A;  1J0F A;  2LNT A;  2KP1 A;  3IDV A;  2BTO T;  1OKT A;  1KTE A;  1F6M C;  2O7K A;  2ES7 A;  3IXR A;  1SK2 A;  2X8H A;  2ZCT A;  2YV7 A;  3F3R A;  2HRK A;  2RM5 A;  3FZ4 A;  2YNX A;  4FYB A;  4ZIJ A;  2JSY A;  4PNF A;  4BL7 A;  2E7P A;  1G7O A;  3VUR A;  1DUG A;  3AY8 A;  5BRT A;  3M9J A;  1GNE A;  2KHP A;  5AGY A;  4BL7 B;  1DBY A;  2WDU A;  2FUG 2;  4KDY A;  2L4Q A;  1R4W A;  3D4T A;  2YWI A;  3KEB A;  1O81 A;  4IEL A;  4EE0 A;  2A2S A;  4BVY A;  2LKU A;  1XBS A;  4CY6 A;  1R26 A;  1A0F A;  3G7I A;  1YEX A;  2REM A;  4G0K A;  2I3Y A;  1SKS B;  2HSH A;  4XIH A;  3UAR A;  2CVK A;  5IM9 A;  1EEM A;  4XS4 A;  1TRV A;  2HXK A;  3CTF A;  4V1A p;  4KDX A;  2B7J A;  5D9W A;  1UVZ A;  5ECQ B;  1GL8 A;  2GVP A;  2LRT A;  3HVS A;  1PGT A;  5C04 A;  3CTG A;  3GX0 A;  1NHY A;  1O85 A;  5IMZ A;  1PRX A;  4X0X A;  4G2E A;  2HLS A;  4XS4 B;  4IN0 A;  3UIW A;  4ECJ A;  2GGT A;  2LRN A;  3EUR A;  4DSQ A;  2H70 A;  2YAN A;  1TTZ A;  3HVV A;  2C0D A;  4YQV A;  2GSQ A;  2LST A;  4IQA A;  4OMV A;  2N5A A;  4K7N A;  3Q6O A;  2C3N A;  4G19 A;  2VL2 C;  2PMT A;  1OE8 A;  11GS A;  3QD9 A;  3VI5 A;  5HFI A;  1GSU A;  3TJK A;  4AJ8 A;  4K5S A;  1GUM A;  3EU3 A;  2CX3 A;  4NHW A;  2VL2 A;  1FB0 A;  4LL1 B;  5INY A;  4L8E A;  2WGR A;  2DIY A;  1SK0 A;  1B8X A;  2H1D A;  4WXT A;  3D6I A;  2C0G A;  4IGJ A;  3CSI A;  3IPZ A;  4MCU A;  2B5X A;  2A2R A;  1O8X A;  5J3R A;  2DKH A;  4KDU A;  1B9X C;  4NXI A;  4DSR A;  2O8V B;  1QK8 A;  4QL7 A;  16GS A;  5HR2 A;  1PN9 A;  4O5U A;  2XBI A;  4G0I A;  3DEX A;  1GWC A;  3ZRE A;  3KH9 A;  2R0G A;  1TI3 A;  4IJ3 A;  4PQ1 A;  3ZVJ D;  1M3I A;  3ZIJ A;  4GWR A;  3HJO A;  3WGX A;  3E9J B;  1G0T A;  2MYG A;  1HYU A;  2JZT A;  3VWU A;  8GSS A;  4F0C A;  4JRR A;  3J7Y k;  2HE3 A;  6GST A;  2I1U A;  6GSU A;  4TXO A;  3IA1 A;  2KUC A;  4HOJ A;  3KGK A;  5EPF A;  5JCW A;  1EOH A;  5G31 A;  4MJC A;  4POK A;  2LV3 A;  4TXO B;  2P5Q A;  2JAC A;  4MPG A;  4Z7X A;  4KA0 A;  3FR9 A;  1TK8 B;  4ZL8 A;  4V2N A;  4IHU A;  1YF1 A;  1LJR A;  2TIR A;  1GSD A;  2FWG A;  4F0B A;  3H1N A;  6GSS A;  2LTK A;  3F8U A;  3ZZX A;  1XOB A;  2GSR A;  3HZ4 A;  1ON4 A;  3KZQ A;  4ECC A;  4EO3 A;  6GSY A;  1T7P B;  1ILO A;  4D73 B;  2K6V A;  1TI1 A;  3APO A;  3RAZ A;  1Z9H A;  5IMD A;  5D8I A;  2H0G A;  2LJR A;  4JR4 A;  5G5E A;  3ZFL A;  3D0Z A;  4JU5 A;  3DVX A;  1SD8 A;  1VF1 A;  1SL1 B;  5J9B A;  3W8J A;  4G9H A;  3FZ5 A;  1EP8 A;  4F2I A;  2HT9 A;  4AJ7 A;  1FOV A;  4OFM A;  4K6X A;  4AJ6 A;  4POL A;  2OKA A;  1BED A;  4Z2U A;  1PSQ A;  5CP1 A;  1ST9 A;  4PTS A;  4KE3 A;  3NZN A;  1GSS A;  1BJX A;  3H4K A;  9GSS A;  5G1L A;  1AAZ A;  4GSN A;  2AB6 A;  3QAG A;  3VPQ A;  1PFO A;  5A5K A;  2ON5 A;  4K0G A;  3H79 A;  3G9B A;  5FT3 A;  4GQC A;  4ZL9 A;  2PUK C;  3N5O A;  2VLT A;  4CDO A;  2MMA A;  3HHV A;  4HQS A;  2JSZ A;  4HU7 A;  1ZYQ B;  2H66 A;  1WJK A;  2DMM A;  5CAX A;  3KMN A;  1EP7 A;  2EIO A;  2NPB A;  1SYR A;  3MNG A;  4ACS A;  2XC2 A;  2VM2 A;  4KSO A;  4EDY A;  1ACV A;  5H5R A;  5G5F A;  3KD0 A;  1K0B A;  2M46 A;  1XCC A;  2FNO A;  3LGC A;  3LQ7 A;  1O6J A;  3UMA A;  4XS6 A;  1JHB A;  5IPG A;  4O5R A;  5D73 A;  3EMX A;  5HR1 A;  2MBS A;  4K7O A;  2QC7 A;  1GSQ A;  4V2M A;  4JED A;  4I5Q A;  1ZYN A;  3A5I A;  1JZW A;  2R4V A;  4NMU A;  2JU5 A;  1TXX A;  5B6N A;  4ICY A;  3ZTL A;  3BCK A;  1J08 A;  3TJJ A;  3F6F A;  4EDZ A;  3GHA A;  2B1K A;  1K0N A;  3UJ1 A;  2H19 A;  2BJX A;  2IL3 A;  1KBN A;  2OA7 A;  4WKW A;  2WB9 A;  4WF4 A;  3FRC A;  3IHG A;  5E4W A;  4PQH A;  4Z2R A;  5B8B A;  3ZVJ A;  4KCE A;  3IC8 A;  4FO5 A;  3MWH A;  1FB6 A;  3GV1 A;  2V32 A;  2VUP A;  1V58 A;  1YKC A;  2C3Q A;  1QQ2 A;  1CQH A;  1YZX A;  4EUY A;  4IP6 A;  4LMW A;  2H6Y A;  4XTS A;  4USS A;  1Y25 A;  1VF4 A;  4ZXG A;  3APQ A;  12GS A;  4PX1 A;  2KOK A;  2GQK A;  2CZ3 A;  2WFC A;  1N8J A;  5GAP D;  2DLX A;  2FWE A;  1C72 A;  4TR1 A;  4N10 A;  5CRE A;  3BJ5 A;  1TW9 A;  4RI6 A;  2P0G A;  5B8A A;  5AN1 A;  1TU8 A;  3IR4 A;  3KH7 A;  5EY6 A;  4EIP A;  3W6G A;  4TR1 B;  3GTU A;  2KLX A;  1XWB A;  2GST A;  1Q4J A;  3ZLP A;  4KSM A;  5LNK e;  5CO3 A;  6GSW A;  3A2V A;  3M1G A;  1ZCP A;  2AHE A;  3GTU B;  4CY8 A;  5GSS A;  1QFN A;  2TRC P;  5KN1 A;  3VWX A;  5ECP B;  1Z6N A;  3IV4 A;  3PPU A;  2FA8 A;  3O76 A;  1XWC A;  4H86 A;  1FOH A;  1KNG A;  2GT6 A;  2DSA A;  4MMM A;  5D93 A;  3H93 A;  3TKP A;  3WT2 A;  4EL1 A;  4TOP A;  2HI7 A;  1QMV A;  3NOF A;  2CZ2 A;  1PA3 A;  1NW2 A;  2HSY A;  4TKY A;  1IYI A;  1SL2 B;  1GSY A;  3FZ9 A;  5H5Q A;  2VCW A;  4TVE A;  1XW6 A;  1M9B A;  4WEY A;  3I43 A;  1PN0 A;  3I69 A;  3IBH A;  4JZQ A;  3JCM L;  2GS3 A;  2R5G A;  4HQZ A;  2IME A;  1JZD A;  1MDK A;  1MD3 A;  1TU7 A;  4ZIL A;  4ID0 A;  2N5F A;  1TK0 B;  4POB A;  1XWA A;  5ID2 A;  1SEN A;  1O7U A;  4GRF A;  3F4T A;  2CA8 A;  3O3T A;  2FCH A;  1KEB A;  2QA2 A;  1PMT A;  4WET A;  2GZY A;  5F0G A;  5AIV A;  4IP1 A;  2I4A A;  4TRX A;  1K0M A;  5ID2 B;  1FG4 A;  1GTA A;  3P8W A;  3MIX A;  3DWV A;  5F07 A;  1WPI A;  5KN3 A;  1XIY A;  4HI7 A;  3DVW A;  4IW9 A;  5CRW A;  4MJA A;  1MDJ A;  3ERW A;  1S3C A;  3EWL A;  1EGR A;  3ISO A;  3US3 A;  3HXS A;  3D22 A;  3SWL A;  4QQ7 A;  1XVQ A;  1XW9 A;  4HU9 A;  1O8W A;  1T1V A;  3TJG A;  1X0R A;  5D9T A;  2VL3 A;  1JFU A;  5L71 A;  3HY2 A;  3CSH A;  1OKD A;  1BYE A;  4J2F A;  5ECM B;  2DJ0 A;  5F05 A;  1WOU A;  4TR3 A;  1VRS D;  3VPT A;  1GH2 A;  1EEJ A;  4CHS A;  1NSW A;  4L5L A;  1FO5 A;  3I6A A;  1GSE A;  3FK8 A;  4O7H A;  2JAD A;  4RI7 A;  3TKS C;  3KM6 A;  2B5E A;  3QR6 A;  2CVB A;  1A2L A;  1TRS A;  4WBR D;  2ALB A;  4DEJ A;  3CRT A;  1GUH A;  4TR0 A;  4MPF A;  5DCH A;  3U5R E;  1A8Y A;  3BD2 A;  3RPP A;  3TKS A;  5DVB A;  2C0F A;  5KEJ A;  1GTU A;  2RUF A;  1ZMA A;  2K9F A;  3QAV A;  4IJI A;  2IIY A;  5G1K A;  3GH6 A;  1MEK A;  4ZB9 A;  1WWJ A;  5JWO B;  1BG5 A;  2OBK A;  3UBK A;  5D9X A;  3VI7 A;  1SK1 A;  2IWT A;  3GKX A;  2I81 A;  1NM3 A;  3HJM A;  5DAL A;  1Z6M A;  1K0D A;  3GYK A;  2PBJ A;  2C1Y A;  2A2P A;  5G2Z A;  1PL1 A;  3LWA A;  5DAL B;  3L4N A;  1GP1 A;  3L9S A;  4AF2 A;  4KH7 A;  1XPV A;  3TKR A;  4KUN A;  3F4R A;  3GL5 A;  3ZYW A;  1M9A A;  1A24 A;  4ML6 A;  2R0P A;  4Q5Q A;  4EXJ A;  4BWS A;  1X9M B;  1R5A A;  3A3T A;  1FHE A;  3F3Q A;  3K8N A;  1MD4 A;  2R2J A;  1HNA A;  1V40 A;  3TUE A;  2F51 A;  20GS A;  4MA9 A;  2CX4 A;  5IOW A;  2H72 A;  1W4V A;  1EV9 A;  1WIK A;  1U88 A;  2E2M A;  18GS A;  3J7Y b;  4A5P A;  2WS2 A;  2YWO A;  3KCM A;  4NHZ A;  3DGQ A;  5JCU A;  1M3J A;  2F9S A;  3KTL A;  3RBT A;  4OFN A;  1DE1 A;  1XWK A;  4PGT A;  2RII A;  4K1F A;  4BWQ A;  3MYD A;  2VLU A;  3P7X A;  3QMX A;  3CMI A;  2VLV A;  2CAI A;  2AYT A;  3GN3 A;  3FZA A;  5ENU A;  3A5W A;  1OE7 A;  1A8L A;  1GTI A;  2H1B A;  3UEM A;  4MZW A;  3IK9 A;  3DXB A;  2VCX A;  5ECR B;  4EF0 A;  2GTU A;  2E2G A;  3WD6 A;  2V41 A;  1WP0 A;  4ZB6 A;  2NBS A;  2H75 A;  2KP2 A;  1FVJ A;  4MDC A;  2VOC A;  1M7T A;  2L6C A;  2A4V A;  4D73 A;  3IAS 2;  3LXZ A;  2H71 A;  2P5R A;  2AJQ B;  3UVT A;  4OCE A;  2FLS A;  3QOU A;  2FHE A;  3IK7 A;  3FY7 A;  3GRX A;  2DIZ A;  3SBC A;  4J56 E;  3VLN A;  4KCA A;  2WZ9 A;  4OO5 A;  3M0F A;  4I8B A;  5ABR A;  3TKS E;  1JLV A;  1G6W A;  5IMV A;  5COH A;  1K0A A;  2PGT A;  2V1M A;  3LFL A;  2DJJ A;  1ML6 A;  3QPM A;  1B48 A;  3Q18 A;  4I6X A;  3EIN A;  4N0Z A;  4KX4 A;  4ECB A;  3ZL5 A;  2I9H A;  3C1S A;  3CQF A;  1PQN A;  1E6B A;  2EIR A;  4WBJ A;  1XWG A;  4QL9 A;  2HFD A;  3WGE A;  3S9F A;  5ECI B;  2FWF A;  3CRU A;  2MMN A;  1SU9 A;  2V6O A;  1OC9 A;  2CVD A;  3KXO A;  17GS A;  3GIX A;  3C7M A;  3M3M A;  1EV4 A;  3F4S A;  3LXT A;  4G10 A;  4TN8 A;  3V1W A;  1OC9 B;  1XW5 A;  3D4M A;  3HCZ A;  5JCG A;  2K8S A;  3RHB A;  1AUC A;  4O5Q A;  3ERF A;  2Z9S A;  3D5J A;  4HZ2 A;  4PQI A;  3F9U A;  1ZOF A;  3G7Y A;  5B7C A;  2B7K A;  2OBI A;  3LEF A;  2AUV A;  5DCG A;  3D21 A;  3GL3 A;  5CRH A;  2B6M A;  4HS1 A;  1XZO A;  1YF0 A;  22GS A;  5HQP A;  3WGD A;  1BQ7 A;  2H76 A;  3GUS A;  1ZYE A;  2WJU A;  1Z7R A;  1ERU A;  5H5S A;  1SJI A;  4K2X A;  3BCI A;  2QA1 A;  1K0O A;  1SD9 A;  3TKQ A;  1V9W A;  4Q5R A;  1M2D A;  1URM A;  2VL9 A;  3BBY A;  4EVM A;  3IE3 A;  2LS5 A;  1GSF A;  3R2Q A;  5ECL B;  4LA1 A;  4GQF A;  3ZIV A;  1W89 A;  5EL8 A;  1ZYP A;  2HRF A;  3DRN A;  4GF0 A;  5GAN D;  4XHM A;  3F6D A;  1V98 A;  2VD1 A;  1HQO A;  5DDL A;  1QXH A;  3TRX A;  2L59 A;  5ECK B;  2H74 A;  2DJ3 A;  2H0I A;  1E2Y A;  1SJZ A;  4YKG A;  2H6X A;  3QCP A;  2K8V A;  3CYN A;  2DBC A;  3CBU A;  4IKH A;  2H1G A;  4N30 A;  2ON7 A;  1XXU A;  3M9K A;  4I97 A;  3QFB C;  2VAF A;  4G0L A;  5IIZ A;  3DD3 A;  2O89 A;  4F9Z A;  2O87 A;  1JLW A;  1YJ6 A;  2IPA A;  2H1A A;  2L4C A;  3M8N A;  5IMC A;  3QFA C;  1X5C A;  1H4O A;  3WYW A;  1I5G A;  3KIJ A;  2NVL A;  4TW5 A;  3F63 A;  3GUR A;  3FKF A;  1LU4 A;  3GKM A;  2H0H A;  1GTB A;  4OO4 A;  2V2G A;  4ILF A;  3E0U A;  4E8E A;  4FQU A;  5DQS A;  3G7J A;  2H6Z A;  2EC4 A;  1AC1 A;  4OCF A;  2X49 A;  5J41 A;  2N5B A;  5CYY A;  2CV4 A;  3TGZ A;  4IS0 A;  1S3D A;  2DML A;  3F0I A;  3P90 A;  3EYT A;  3UVH A;  3ZML A;  2IFQ A;  2TRX A;  1GLQ A;  4WR4 A;  3LYP A;  2C4J A;  1YEP A;  2HYX A;  4NV2 A;  2X99 A;  1AQW A;  1AXD A;  3GFK A;  2GSS A;  2OAC A;  2LNS A;  2IFQ B;  2XHF A;  1ERT A;  5C00 A;  4O32 A;  2EIQ A;  4K2D A;  5LCZ A;  4K5R A;  3Q74 A;  3RDW A;  3DML A;  2WCI A;  2CQ9 A;  4K7I A;  2OE3 A;  2L6D A;  2UZ8 A;  5IOX A;  3L78 A;  1TKD B;  4J57 E;  2F8A A;  1WRY A;  5CRD A;  5DAK A;  1GNW A;  1GRX A;  1YQ1 A;  2AV4 A;  4HUA A;  4WR5 A;  1F3A A;  2XPD A;  1GUK A;  3ERG A;  4MF6 A;  4JBB A;  3ZFB A;  4PUF C;  3DKS A;  5DBQ A;  1T4Y A;  5DAK B;  1K3Y A;  4NAX A;  4BIK A;  5HR3 A;  3FYG A;  3L9V A;  1FVK A;  2LUS A;  3TB2 A;  3DIE A;  2GLR A;  3MSZ A;  5BMU A;  1VF2 A;  2PU9 C;  3RPN A;  5KN2 A;  1HNB A;  2HZF A;  4ECI A;  1DE2 A;  1B9Y C;  1YKA A;  2LJA A;  3W8S A;  3CSJ A;  1OYJ A;  2DJ2 A;  4XS1 A;  3HVN A;  1PL2 A;  2J9H A;  2G2Q A;  4JE1 A;  3HKR A;  3HDC A;  4Q5N A;  4F82 A;  3GSS A;  4YQM A;  2MBT A;  3FR3 A;  2WRT A;  3BOA A;  2L57 A;  3FHK A;  3FR6 A;  3VWV A;  1BX9 A;  1EGO A;  1U87 A;  5DJM A;  5G30 A;  4EKZ A;  4KW6 A;  1M99 A;  10GS A;  1EWX A;  3A2W A;  4F03 A;  4DVC A;  1OVN A;  2YWM A;  4V2L A;  3TRP A;  5GST A;  2ZNM A;  3IRA A;  3I9V 2;  1BAY A;  1TRW A;  2FY6 A;  3HYP A;  5JWR B;  3C71 A;  1B4Q A;  4OWY A;  3ME7 A;  5CNW A;  1VGL A;  3LOR A;  3Q19 A;  2YV9 A;  3UOM A;  4KF9 A;  3HZ8 A;  1TRU A;  2LJK A;  4L0W A;  1PKZ A;  1V2A A;  3P2A A;  2PER A;  4L0U A;  4YAP A;  5J9C A;  1XOA A;  4BPY A;  3EU4 A;  2D2Z A;  2FWH A;  2HZE A;  2OE1 A;  1Z7P A;  5FWG A;  2VCV A;  2E0Q A;  3EMP A;  4MP4 A;  1X9W B;  4RUV A;  4K8M A;  2P31 A;  1F37 A;  2HZE B;  3H8Q A;  4BVY B;  5DJL A;  3MAK A;  4DSS A;  2BMX A;  2GDR A;  2YZU A;  2H8L A;  4MJB A;  4LL4 B;  1XVW A;  4O92 A;  2G0F A;  4IQ1 A;  4DSS B;  2RLI A;  2X8G A;  1ERV A;  3GNJ A;  5ECS A;  5J4U A;  4XRD A;  2H01 A;  1R7H A;  2O85 A;  4MNN A;  3HJP A;  2FD3 A;  2YN1 A;  1RQM A;  5A4U A;  4XCS A;  2OAD A;  14GS A;  2CAQ A;  1IYH A;  3EE2 A;  3IAM 2;  4MLY A;  4YQU A;  5KOX A;  4PNG A;  1R5P A;  1QGV A;  7GSS A;  3HD5 A;  2DKI A;  1OAZ A;  4MH3 A;  2IMF A;  2JZR A;  4KND A;  5AIX A;  3FW2 A;  2F3M A;  2MMZ A;  3LW9 A;  3C73 A;  3R3E A;  3LYK A;  3TJF A;  3VK9 A;  2C80 A;  3PGT A;  3QAW A;  2MZC A;  4TXV A;  2AAW A;  1WMJ A;  4XRA A;  2FA4 A;  3GH9 A;  4PXO A;  3TOU A;  3GKK A;  2NDO A;  4HSC X;  1ZZY A;  2GT5 A;  5D9V A;  1F3B A;  2DJ1 A;  1O73 A;  4N11 A;  5IQY A;  2ZUP A;  4CW9 A;  1SL0 B;  1K0C A;  3TOT A;  1TOF A;  3N9J A;  4ULX A;  1K3O A;  1AQV A;  3KMO A;  1GUL A;  4GXZ A;  5ELA A;  3U6V A;  1UC7 A;  3OR5 A;  4FYC A;  2RM6 A;  1A0R P;  1RW1 A;  1M0U A;  1TJD A;  1TK5 B;  1FAA A;  4I2U A;  5ELG A;  1F2E A;  2X4A A;  2FGX A;  1F9M A;  4OD7 A;  2YPM A;  4WF5 A;  4EC0 A;  4HZ4 A;  3TRQ A;  1OC3 A;  4FIW A;  3GKN A;  3PH9 A;  2YWN A;  2A4H A;  4X1U A;  1J9B A;  5AIS A;  3O6T A;  5J5N A;  5EVO A;  2X8C A;  4P3Y B;  2C0E A;  3KP8 A;  4E8H A;  3LSZ A;  5IO0 A;  1DSB A;  3IOS A;  19GS A;  1AIU A;  1B4P A;  1CQG A;  2VCT A;  2XPE A;  4IBP A;  3UBL A;  1GLP A;  1S3R A;  4HDE A;  1T8E B;  2V6K A;  4N0V A;  2GQL A;  4HEA 2;  5IMF A;  4I2T A;  3ED3 A;  2XBQ A;  2J23 A;  2LQQ A;  3APS A;  1T00 A;  4RQX A;  2YZH A;  1G6Y A;  6GSX A;  1Y6E A;  1LBK A;  2LQO A;  3KJY A;  2R37 A;  1HNC A;  1T4Z A;  3PIN A;  4Q5F A;  3FEU A;  1S3A A;  1Z3E A;  1M2A A;  1AQX A;  1X5E A;  1JZO A;  1SJ6 A;  1YY7 A;  2HRN A;  1PKW A;  4MZC A;  1MDI A;  2OE0 A;  1PD2 1;  2VM1 A;  1TP9 A;  2VD0 A;  3HVX A;  4FH8 A;  2B3S A;  2LRC A;  2OJL A;  2RUE A;  2M80 A;  6GSV A;  4LLR A;  4X4J A;  4RQR A;  4MZB A;  1YDK A;  2VIM A;  4GSS A;  3CXG A;  2LEG A;  1MTC A;  1UN2 A;  3TJB A;  1I9D A;  1RK4 A;  3GX8 A;  3QDN A;  1ABA A;  2HRA A;  2QKE A;  5ECN B;  2IN3 A;  1X5D A;  2H73 A;  3EVI A;  1FW1 A;  5CRG A;  1SKW B;  1U3A A;  4NV5 A;  3E3E A;  4HJ2 A;  4ZBB A;  1XG8 A;  1HD2 A;  4LMV A;  1A2J A;  3EC3 A;  3LJR A;  1G7E A;  3MDK A;  2R0C A;  2R3X A;  1Q98 A;  2WUL A;  1X9S B;  3EPT A;  3IC4 A;  1Z5Y E;  4YAV A;  3WT1 A;  2M72 A;  2QSI A;  3DYR A;  5DQY A;  4AGS A;  4MF5 A;  4GTU A;  4NWY A;  1A2M A;  5LD0 A;  4BVX A;  1PX6 A;  4ZBD A;  4ZL7 A;  2PVQ A;  5A4V A;  1THX A;  2IMK A;  4V1A g;  2IMD A;  1OC8 A;  2VO4 A;  4KGI A;  1PX7 A;  5ECO B;  2PN8 A;  4BVX B;  2QGV A;  1NHO A;  1WE0 A;  2PPT A;  3GA4 A;  2L5L A;  4PUA A;  5FHI A;  2GQM A;  5B6M A;  1ZL9 A;  2PVO C;  5KOW A;  2YJH A;  2IMI A;  3KTB A;  1U3I A;  2B5Y A;  1SYX A;  1UA5 A;  1TDI A;  3RHC A;  1JZR A;  1A23 A;  3IHQ A;  1ERW A;  1AW9 A;  4YH2 A;  5IPH A;  1EZK A;  1SKR B;  5HFG A;  3VWW A;  2C3T A;  4IVF A;  4MJE A;  2L5O A;  1N2A A;  4HJM A;  1THO A;  4ML1 A;  4GCI A;  2JZS A;  3UL3 A;  2DJK A;  4POM A;  5F06 A;  3C8E A;  5ECH B;  5HFK A;  2HNL A;  2X64 A;  5E59 A;  2C8U A;  1QUW A;  2NTO A;  2MMO A;  2VCQ A;  4JR6 A;  1V57 A;  4GST A;  5GZZ B;  5A4W A;  3NIV A;  1USB A;  2R6K A;  2HSM A;  13GS A;  2CT6 A;  4YKF A;  1H75 A;  4MH2 A;  4X43 A;  5F8B A;  3L0H A;  2B1L A;  4GLT A;  5HR0 A;  4ZB8 A;  4L5O A;  5IMA A;  1T3B A;  4MAB A;  2K18 A;  3C1R A;  1VF3 A;  4KB3 A;  3ZMK A;  2YOI A;  3A2X A;  2GZZ A;  2H30 A;  1K3L A;  2F8F A;  4TR4 A;  4ISD A;  4PUR A;  2YCD A;  4K9Z A;  4NPB A;  2GZP A;  3TCO A;  5KN0 A;  1EOG A;  4EIQ A;  3KP9 A;  3L9U A;  4OFT A;  4FYU A;  3FMW A;  3UAP A; 
#chains in the Genus database with same CATH homology
 2DC5 A;  3PR8 A;  4MK3 A;  3VFI A;  4ZBA A;  4MF7 A;  2VCZ A;  2YJ7 A;  3LG6 A;  2YP6 A;  4K0N A;  3GMF A;  4KAE A;  2JL4 A;  3GST A;  5JWQ B;  4BA7 A;  5D96 A;  3ME8 A;  3ZRD A;  4Z2T A;  5IO2 A;  3TDG A;  3ZIT A;  2IJY A;  1XFL A;  2PWJ A;  1U6T A;  3HA9 A;  1M2B A;  1ZGN A;  1J0F A;  2LNT A;  2KP1 A;  3IDV A;  2BTO T;  1OKT A;  1KTE A;  1F6M C;  2O7K A;  2ES7 A;  3IXR A;  1SK2 A;  2X8H A;  2ZCT A;  2YV7 A;  3F3R A;  2HRK A;  2RM5 A;  3FZ4 A;  2YNX A;  4FYB A;  4ZIJ A;  2JSY A;  4PNF A;  4BL7 A;  2E7P A;  1G7O A;  3VUR A;  1DUG A;  3AY8 A;  5BRT A;  3M9J A;  1GNE A;  2KHP A;  5AGY A;  4BL7 B;  1DBY A;  2WDU A;  2FUG 2;  4KDY A;  2L4Q A;  1R4W A;  3D4T A;  2YWI A;  3KEB A;  1O81 A;  4IEL A;  4EE0 A;  2A2S A;  4BVY A;  2LKU A;  1XBS A;  4CY6 A;  1R26 A;  1A0F A;  3G7I A;  1YEX A;  2REM A;  4G0K A;  2I3Y A;  1SKS B;  2HSH A;  4XIH A;  3UAR A;  2CVK A;  5IM9 A;  1EEM A;  4XS4 A;  1TRV A;  2HXK A;  3CTF A;  4V1A p;  4KDX A;  2B7J A;  5D9W A;  1UVZ A;  5ECQ B;  1GL8 A;  2GVP A;  2LRT A;  3HVS A;  1PGT A;  5C04 A;  3CTG A;  3GX0 A;  1NHY A;  1O85 A;  5IMZ A;  1PRX A;  4X0X A;  4G2E A;  2HLS A;  4XS4 B;  4IN0 A;  3UIW A;  4ECJ A;  2GGT A;  2LRN A;  3EUR A;  4DSQ A;  2H70 A;  2YAN A;  1TTZ A;  3HVV A;  2C0D A;  4YQV A;  2GSQ A;  2LST A;  4IQA A;  4OMV A;  2N5A A;  4K7N A;  3Q6O A;  2C3N A;  4G19 A;  2VL2 C;  2PMT A;  1OE8 A;  11GS A;  3QD9 A;  3VI5 A;  5HFI A;  1GSU A;  3TJK A;  4AJ8 A;  4K5S A;  1GUM A;  3EU3 A;  2CX3 A;  4NHW A;  2VL2 A;  1FB0 A;  4LL1 B;  5INY A;  4L8E A;  2WGR A;  2DIY A;  1SK0 A;  1B8X A;  2H1D A;  4WXT A;  3D6I A;  2C0G A;  4IGJ A;  3CSI A;  3IPZ A;  4MCU A;  2B5X A;  2A2R A;  1O8X A;  5J3R A;  2DKH A;  4KDU A;  1B9X C;  4NXI A;  4DSR A;  2O8V B;  1QK8 A;  4QL7 A;  16GS A;  5HR2 A;  1PN9 A;  4O5U A;  2XBI A;  4G0I A;  3DEX A;  1GWC A;  3ZRE A;  3KH9 A;  2R0G A;  1TI3 A;  4IJ3 A;  4PQ1 A;  3ZVJ D;  3ZIJ A;  4GWR A;  3HJO A;  3WGX A;  3E9J B;  1G0T A;  2MYG A;  1HYU A;  2JZT A;  3VWU A;  8GSS A;  4F0C A;  4JRR A;  3J7Y k;  2HE3 A;  6GST A;  2I1U A;  6GSU A;  4TXO A;  3IA1 A;  2KUC A;  4HOJ A;  3KGK A;  5EPF A;  5JCW A;  1EOH A;  5G31 A;  4MJC A;  4POK A;  2LV3 A;  4TXO B;  2P5Q A;  2JAC A;  4MPG A;  4Z7X A;  4KA0 A;  3FR9 A;  1TK8 B;  4ZL8 A;  4V2N A;  4IHU A;  1YF1 A;  1LJR A;  2TIR A;  1GSD A;  2FWG A;  4F0B A;  3H1N A;  6GSS A;  2LTK A;  3F8U A;  3ZZX A;  1XOB A;  2GSR A;  3HZ4 A;  1ON4 A;  3KZQ A;  4ECC A;  4EO3 A;  6GSY A;  1T7P B;  1ILO A;  4D73 B;  2K6V A;  1TI1 A;  3APO A;  3RAZ A;  1Z9H A;  5IMD A;  5D8I A;  2H0G A;  2LJR A;  4JR4 A;  5G5E A;  3ZFL A;  3D0Z A;  4JU5 A;  3DVX A;  1SD8 A;  1VF1 A;  1SL1 B;  5J9B A;  3W8J A;  4G9H A;  3FZ5 A;  1EP8 A;  4F2I A;  2HT9 A;  4AJ7 A;  1FOV A;  4OFM A;  4K6X A;  4AJ6 A;  4POL A;  2OKA A;  1BED A;  4Z2U A;  1PSQ A;  5CP1 A;  1ST9 A;  4PTS A;  4KE3 A;  3NZN A;  1GSS A;  1BJX A;  3H4K A;  9GSS A;  5G1L A;  1AAZ A;  4GSN A;  2AB6 A;  3QAG A;  3VPQ A;  5A5K A;  2ON5 A;  4K0G A;  3H79 A;  3G9B A;  5FT3 A;  4GQC A;  4ZL9 A;  2PUK C;  3N5O A;  2VLT A;  4CDO A;  2MMA A;  3HHV A;  4HQS A;  2JSZ A;  4HU7 A;  1ZYQ B;  2H66 A;  1WJK A;  2DMM A;  5CAX A;  3KMN A;  1EP7 A;  2EIO A;  2NPB A;  1SYR A;  3MNG A;  4ACS A;  2XC2 A;  2VM2 A;  4KSO A;  4EDY A;  1ACV A;  5H5R A;  5G5F A;  3KD0 A;  1K0B A;  2M46 A;  1XCC A;  2FNO A;  3LGC A;  3LQ7 A;  1O6J A;  3UMA A;  4XS6 A;  1JHB A;  5IPG A;  4O5R A;  5D73 A;  3EMX A;  5HR1 A;  2MBS A;  4K7O A;  2QC7 A;  1GSQ A;  4V2M A;  4JED A;  4I5Q A;  1ZYN A;  3A5I A;  1JZW A;  2R4V A;  4NMU A;  2JU5 A;  1TXX A;  5B6N A;  4ICY A;  3ZTL A;  3BCK A;  1J08 A;  3TJJ A;  3F6F A;  4EDZ A;  3GHA A;  2B1K A;  1K0N A;  3UJ1 A;  2H19 A;  2BJX A;  2IL3 A;  1KBN A;  2OA7 A;  4WKW A;  2WB9 A;  4WF4 A;  3FRC A;  3IHG A;  5E4W A;  4PQH A;  4Z2R A;  5B8B A;  3ZVJ A;  4KCE A;  3IC8 A;  4FO5 A;  3MWH A;  1FB6 A;  3GV1 A;  2V32 A;  2VUP A;  1V58 A;  1YKC A;  2C3Q A;  1QQ2 A;  1CQH A;  1YZX A;  4EUY A;  4IP6 A;  4LMW A;  2H6Y A;  4XTS A;  4USS A;  1Y25 A;  1VF4 A;  4ZXG A;  3APQ A;  12GS A;  4PX1 A;  2KOK A;  2GQK A;  2CZ3 A;  2WFC A;  1N8J A;  5GAP D;  2DLX A;  2FWE A;  1C72 A;  4TR1 A;  4N10 A;  5CRE A;  3BJ5 A;  1TW9 A;  4RI6 A;  2P0G A;  5B8A A;  5AN1 A;  1TU8 A;  3IR4 A;  3KH7 A;  5EY6 A;  4EIP A;  3W6G A;  4TR1 B;  3GTU A;  2KLX A;  1XWB A;  2GST A;  1Q4J A;  3ZLP A;  4KSM A;  5LNK e;  5CO3 A;  6GSW A;  3A2V A;  3M1G A;  1ZCP A;  2AHE A;  3GTU B;  4CY8 A;  5GSS A;  1QFN A;  2TRC P;  5KN1 A;  3VWX A;  5ECP B;  1Z6N A;  3IV4 A;  3PPU A;  2FA8 A;  3O76 A;  1XWC A;  4H86 A;  1FOH A;  1KNG A;  2GT6 A;  2DSA A;  4MMM A;  5D93 A;  3H93 A;  3TKP A;  3WT2 A;  4EL1 A;  4TOP A;  2HI7 A;  1QMV A;  3NOF A;  2CZ2 A;  1PA3 A;  1NW2 A;  2HSY A;  4TKY A;  1IYI A;  1SL2 B;  1GSY A;  3FZ9 A;  5H5Q A;  2VCW A;  4TVE A;  1XW6 A;  1M9B A;  4WEY A;  3I43 A;  1PN0 A;  3I69 A;  3IBH A;  4JZQ A;  3JCM L;  2GS3 A;  2R5G A;  4HQZ A;  2IME A;  1JZD A;  1MDK A;  1MD3 A;  1TU7 A;  4ZIL A;  4ID0 A;  2N5F A;  1TK0 B;  4POB A;  1XWA A;  5ID2 A;  1SEN A;  1O7U A;  4GRF A;  3F4T A;  2CA8 A;  3O3T A;  2FCH A;  1KEB A;  2QA2 A;  1PMT A;  4WET A;  2GZY A;  5F0G A;  5AIV A;  4IP1 A;  2I4A A;  4TRX A;  1K0M A;  5ID2 B;  1FG4 A;  1GTA A;  3P8W A;  3MIX A;  3DWV A;  5F07 A;  1WPI A;  5KN3 A;  1XIY A;  4HI7 A;  3DVW A;  4IW9 A;  5CRW A;  4MJA A;  1MDJ A;  3ERW A;  1S3C A;  3EWL A;  1EGR A;  3ISO A;  3US3 A;  3HXS A;  3D22 A;  3SWL A;  4QQ7 A;  1XVQ A;  1XW9 A;  4HU9 A;  1O8W A;  1T1V A;  3TJG A;  1X0R A;  5D9T A;  2VL3 A;  1JFU A;  5L71 A;  3HY2 A;  3CSH A;  1OKD A;  1BYE A;  4J2F A;  5ECM B;  2DJ0 A;  5F05 A;  1WOU A;  4TR3 A;  1VRS D;  3VPT A;  1GH2 A;  1EEJ A;  4CHS A;  1NSW A;  4L5L A;  1FO5 A;  3I6A A;  1GSE A;  3FK8 A;  4O7H A;  2JAD A;  4RI7 A;  3TKS C;  3KM6 A;  2B5E A;  3QR6 A;  2CVB A;  1A2L A;  1TRS A;  4WBR D;  2ALB A;  4DEJ A;  3CRT A;  1GUH A;  4TR0 A;  4MPF A;  5DCH A;  3U5R E;  1A8Y A;  3BD2 A;  3RPP A;  3TKS A;  5DVB A;  2C0F A;  5KEJ A;  1GTU A;  2RUF A;  1ZMA A;  2K9F A;  3QAV A;  4IJI A;  2IIY A;  5G1K A;  3GH6 A;  1MEK A;  4ZB9 A;  1WWJ A;  5JWO B;  1BG5 A;  2OBK A;  3UBK A;  5D9X A;  3VI7 A;  1SK1 A;  2IWT A;  3GKX A;  2I81 A;  1NM3 A;  3HJM A;  5DAL A;  1Z6M A;  1K0D A;  3GYK A;  2PBJ A;  2C1Y A;  2A2P A;  5G2Z A;  1PL1 A;  3LWA A;  5DAL B;  3L4N A;  1GP1 A;  3L9S A;  4AF2 A;  4KH7 A;  1XPV A;  3TKR A;  4KUN A;  3F4R A;  3GL5 A;  3ZYW A;  1M9A A;  1A24 A;  4ML6 A;  2R0P A;  4Q5Q A;  4EXJ A;  4BWS A;  1X9M B;  1R5A A;  3A3T A;  1FHE A;  3F3Q A;  3K8N A;  1MD4 A;  2R2J A;  1HNA A;  1V40 A;  3TUE A;  2F51 A;  20GS A;  4MA9 A;  2CX4 A;  5IOW A;  2H72 A;  1W4V A;  1EV9 A;  1WIK A;  1U88 A;  2E2M A;  18GS A;  3J7Y b;  4A5P A;  2WS2 A;  2YWO A;  3KCM A;  4NHZ A;  3DGQ A;  5JCU A;  2F9S A;  3KTL A;  3RBT A;  4OFN A;  1DE1 A;  1XWK A;  4PGT A;  2RII A;  4K1F A;  4BWQ A;  3MYD A;  2VLU A;  3P7X A;  3QMX A;  3CMI A;  2VLV A;  2CAI A;  2AYT A;  3GN3 A;  3FZA A;  5ENU A;  3A5W A;  1OE7 A;  1A8L A;  1GTI A;  2H1B A;  3UEM A;  4MZW A;  3IK9 A;  3DXB A;  2VCX A;  5ECR B;  4EF0 A;  2GTU A;  2E2G A;  3WD6 A;  2V41 A;  1WP0 A;  4ZB6 A;  2NBS A;  2H75 A;  2KP2 A;  1FVJ A;  4MDC A;  2VOC A;  1M7T A;  2L6C A;  2A4V A;  4D73 A;  3IAS 2;  3LXZ A;  2H71 A;  2P5R A;  2AJQ B;  3UVT A;  4OCE A;  2FLS A;  3QOU A;  2FHE A;  3IK7 A;  3FY7 A;  3GRX A;  2DIZ A;  3SBC A;  4J56 E;  3VLN A;  4KCA A;  2WZ9 A;  4OO5 A;  3M0F A;  4I8B A;  5ABR A;  3TKS E;  1JLV A;  1G6W A;  5IMV A;  5COH A;  1K0A A;  2PGT A;  2V1M A;  3LFL A;  2DJJ A;  1ML6 A;  3QPM A;  1B48 A;  3Q18 A;  4I6X A;  3EIN A;  4N0Z A;  4KX4 A;  4ECB A;  3ZL5 A;  2I9H A;  3C1S A;  1PQN A;  1E6B A;  2EIR A;  4WBJ A;  1XWG A;  4QL9 A;  2HFD A;  3WGE A;  3S9F A;  5ECI B;  2FWF A;  3CRU A;  2MMN A;  1SU9 A;  2V6O A;  1OC9 A;  2CVD A;  3KXO A;  17GS A;  3GIX A;  3C7M A;  3M3M A;  1EV4 A;  3F4S A;  3LXT A;  4G10 A;  4TN8 A;  3V1W A;  1OC9 B;  1XW5 A;  3D4M A;  3HCZ A;  5JCG A;  2K8S A;  3RHB A;  1AUC A;  4O5Q A;  3ERF A;  2Z9S A;  3D5J A;  4HZ2 A;  4PQI A;  3F9U A;  1ZOF A;  3G7Y A;  5B7C A;  2B7K A;  2OBI A;  3LEF A;  2AUV A;  5DCG A;  3D21 A;  3GL3 A;  5CRH A;  2B6M A;  4HS1 A;  1XZO A;  1YF0 A;  22GS A;  5HQP A;  3WGD A;  1BQ7 A;  2H76 A;  3GUS A;  1ZYE A;  2WJU A;  1Z7R A;  1ERU A;  5H5S A;  1SJI A;  4K2X A;  3BCI A;  2QA1 A;  1K0O A;  1SD9 A;  3TKQ A;  1V9W A;  4Q5R A;  1M2D A;  1URM A;  2VL9 A;  3BBY A;  4EVM A;  3IE3 A;  2LS5 A;  1GSF A;  3R2Q A;  5ECL B;  4LA1 A;  4GQF A;  3ZIV A;  1W89 A;  5EL8 A;  1ZYP A;  2HRF A;  3DRN A;  4GF0 A;  5GAN D;  4XHM A;  3F6D A;  1V98 A;  2VD1 A;  1HQO A;  5DDL A;  1QXH A;  3TRX A;  2L59 A;  5ECK B;  2H74 A;  2DJ3 A;  2H0I A;  1E2Y A;  1SJZ A;  4YKG A;  2H6X A;  3QCP A;  2K8V A;  3CYN A;  2DBC A;  3CBU A;  4IKH A;  2H1G A;  4N30 A;  2ON7 A;  1XXU A;  3M9K A;  4I97 A;  3QFB C;  2VAF A;  4G0L A;  5IIZ A;  3DD3 A;  2O89 A;  4F9Z A;  2O87 A;  1JLW A;  1YJ6 A;  2IPA A;  2H1A A;  2L4C A;  3M8N A;  5IMC A;  3QFA C;  1X5C A;  1H4O A;  3WYW A;  1I5G A;  3KIJ A;  2NVL A;  4TW5 A;  3F63 A;  3GUR A;  3FKF A;  1LU4 A;  3GKM A;  2H0H A;  1GTB A;  4OO4 A;  2V2G A;  4ILF A;  3E0U A;  4E8E A;  4FQU A;  5DQS A;  3G7J A;  2H6Z A;  2EC4 A;  1AC1 A;  4OCF A;  2X49 A;  5J41 A;  2N5B A;  5CYY A;  2CV4 A;  3TGZ A;  4IS0 A;  1S3D A;  2DML A;  3F0I A;  3P90 A;  3EYT A;  3UVH A;  3ZML A;  2IFQ A;  2TRX A;  1GLQ A;  4WR4 A;  3LYP A;  2C4J A;  1YEP A;  2HYX A;  4NV2 A;  2X99 A;  1AQW A;  1AXD A;  3GFK A;  2GSS A;  2OAC A;  2LNS A;  2IFQ B;  2XHF A;  1ERT A;  5C00 A;  4O32 A;  2EIQ A;  4K2D A;  5LCZ A;  4K5R A;  3Q74 A;  3RDW A;  3DML A;  2WCI A;  2CQ9 A;  4K7I A;  2OE3 A;  2L6D A;  2UZ8 A;  5IOX A;  3L78 A;  1TKD B;  4J57 E;  2F8A A;  1WRY A;  5CRD A;  5DAK A;  1GNW A;  1GRX A;  1YQ1 A;  2AV4 A;  4HUA A;  4WR5 A;  1F3A A;  2XPD A;  1GUK A;  3ERG A;  4MF6 A;  4JBB A;  3ZFB A;  4PUF C;  3DKS A;  5DBQ A;  1T4Y A;  5DAK B;  1K3Y A;  4NAX A;  5HR3 A;  3FYG A;  3L9V A;  1FVK A;  2LUS A;  3TB2 A;  3DIE A;  2GLR A;  3MSZ A;  5BMU A;  1VF2 A;  2PU9 C;  3RPN A;  5KN2 A;  1HNB A;  2HZF A;  4ECI A;  1DE2 A;  1B9Y C;  1YKA A;  2LJA A;  3W8S A;  3CSJ A;  1OYJ A;  2DJ2 A;  4XS1 A;  1PL2 A;  2J9H A;  2G2Q A;  4JE1 A;  3HKR A;  3HDC A;  4Q5N A;  4F82 A;  3GSS A;  4YQM A;  2MBT A;  3FR3 A;  2WRT A;  3BOA A;  2L57 A;  3FHK A;  3FR6 A;  3VWV A;  1BX9 A;  1EGO A;  1U87 A;  5DJM A;  5G30 A;  4EKZ A;  4KW6 A;  1M99 A;  10GS A;  1EWX A;  3A2W A;  4F03 A;  4DVC A;  1OVN A;  2YWM A;  4V2L A;  3TRP A;  5GST A;  2ZNM A;  3IRA A;  3I9V 2;  1BAY A;  1TRW A;  2FY6 A;  3HYP A;  5JWR B;  3C71 A;  1B4Q A;  4OWY A;  3ME7 A;  5CNW A;  1VGL A;  3LOR A;  3Q19 A;  2YV9 A;  3UOM A;  4KF9 A;  3HZ8 A;  1TRU A;  2LJK A;  4L0W A;  1PKZ A;  1V2A A;  3P2A A;  2PER A;  4L0U A;  4YAP A;  5J9C A;  1XOA A;  4BPY A;  3EU4 A;  2D2Z A;  2FWH A;  2HZE A;  2OE1 A;  1Z7P A;  5FWG A;  2VCV A;  2E0Q A;  3EMP A;  4MP4 A;  1X9W B;  4RUV A;  4K8M A;  2P31 A;  1F37 A;  2HZE B;  3H8Q A;  4BVY B;  5DJL A;  3MAK A;  4DSS A;  2BMX A;  2GDR A;  2YZU A;  2H8L A;  4MJB A;  4LL4 B;  1XVW A;  4O92 A;  2G0F A;  4IQ1 A;  4DSS B;  2RLI A;  2X8G A;  1ERV A;  3GNJ A;  5ECS A;  5J4U A;  4XRD A;  2H01 A;  1R7H A;  2O85 A;  4MNN A;  3HJP A;  2FD3 A;  2YN1 A;  1RQM A;  5A4U A;  4XCS A;  2OAD A;  14GS A;  2CAQ A;  1IYH A;  3EE2 A;  3IAM 2;  4MLY A;  4YQU A;  5KOX A;  4PNG A;  1R5P A;  1QGV A;  7GSS A;  3HD5 A;  2DKI A;  1OAZ A;  4MH3 A;  2IMF A;  2JZR A;  4KND A;  5AIX A;  3FW2 A;  2F3M A;  2MMZ A;  3LW9 A;  3C73 A;  3R3E A;  3LYK A;  3TJF A;  3VK9 A;  2C80 A;  3PGT A;  3QAW A;  2MZC A;  4TXV A;  2AAW A;  1WMJ A;  4XRA A;  2FA4 A;  3GH9 A;  4PXO A;  3TOU A;  3GKK A;  2NDO A;  1ZZY A;  2GT5 A;  5D9V A;  1F3B A;  2DJ1 A;  1O73 A;  4N11 A;  5IQY A;  2ZUP A;  4CW9 A;  1SL0 B;  1K0C A;  3TOT A;  1TOF A;  3N9J A;  4ULX A;  1K3O A;  1AQV A;  3KMO A;  1GUL A;  4GXZ A;  5ELA A;  3U6V A;  1UC7 A;  3OR5 A;  4FYC A;  2RM6 A;  1A0R P;  1RW1 A;  1M0U A;  1TJD A;  1TK5 B;  1FAA A;  4I2U A;  5ELG A;  1F2E A;  2X4A A;  2FGX A;  1F9M A;  4OD7 A;  2YPM A;  4WF5 A;  4EC0 A;  4HZ4 A;  3TRQ A;  1OC3 A;  4FIW A;  3GKN A;  3PH9 A;  2YWN A;  2A4H A;  4X1U A;  1J9B A;  5AIS A;  3O6T A;  5J5N A;  5EVO A;  2X8C A;  4P3Y B;  2C0E A;  3KP8 A;  4E8H A;  3LSZ A;  5IO0 A;  1DSB A;  3IOS A;  19GS A;  1AIU A;  1B4P A;  1CQG A;  2VCT A;  2XPE A;  4IBP A;  3UBL A;  1GLP A;  4HDE A;  1T8E B;  2V6K A;  4N0V A;  2GQL A;  4HEA 2;  5IMF A;  4I2T A;  3ED3 A;  2XBQ A;  2J23 A;  2LQQ A;  3APS A;  1T00 A;  4RQX A;  2YZH A;  1G6Y A;  6GSX A;  1Y6E A;  1LBK A;  2LQO A;  3KJY A;  2R37 A;  1HNC A;  1T4Z A;  3PIN A;  4Q5F A;  3FEU A;  1S3A A;  1Z3E A;  1M2A A;  1AQX A;  1X5E A;  1JZO A;  1SJ6 A;  1YY7 A;  2HRN A;  1PKW A;  4MZC A;  1MDI A;  2OE0 A;  1PD2 1;  2VM1 A;  1TP9 A;  2VD0 A;  3HVX A;  4FH8 A;  2B3S A;  2LRC A;  2OJL A;  2RUE A;  2M80 A;  6GSV A;  4LLR A;  4X4J A;  4RQR A;  4MZB A;  1YDK A;  2VIM A;  4GSS A;  3CXG A;  2LEG A;  1MTC A;  1UN2 A;  3TJB A;  1I9D A;  1RK4 A;  3GX8 A;  3QDN A;  1ABA A;  2HRA A;  2QKE A;  5ECN B;  2IN3 A;  1X5D A;  2H73 A;  3EVI A;  1FW1 A;  5CRG A;  1SKW B;  1U3A A;  4NV5 A;  3E3E A;  4HJ2 A;  4ZBB A;  1HD2 A;  4LMV A;  1A2J A;  3EC3 A;  3LJR A;  1G7E A;  3MDK A;  2R0C A;  2R3X A;  1Q98 A;  2WUL A;  1X9S B;  3EPT A;  3IC4 A;  1Z5Y E;  4YAV A;  3WT1 A;  2M72 A;  2QSI A;  3DYR A;  5DQY A;  4AGS A;  4MF5 A;  4GTU A;  4NWY A;  1A2M A;  5LD0 A;  4BVX A;  1PX6 A;  4ZBD A;  4ZL7 A;  2PVQ A;  5A4V A;  1THX A;  2IMK A;  4V1A g;  2IMD A;  1OC8 A;  2VO4 A;  4KGI A;  1PX7 A;  5ECO B;  2PN8 A;  4BVX B;  2QGV A;  1NHO A;  1WE0 A;  2PPT A;  3GA4 A;  2L5L A;  4PUA A;  5FHI A;  2GQM A;  5B6M A;  1ZL9 A;  2PVO C;  5KOW A;  2YJH A;  2IMI A;  3KTB A;  1U3I A;  2B5Y A;  1SYX A;  1UA5 A;  1TDI A;  3RHC A;  1JZR A;  1A23 A;  3IHQ A;  1ERW A;  1AW9 A;  4YH2 A;  5IPH A;  1EZK A;  1SKR B;  5HFG A;  3VWW A;  2C3T A;  4IVF A;  4MJE A;  2L5O A;  1N2A A;  4HJM A;  1THO A;  4ML1 A;  4GCI A;  2JZS A;  3UL3 A;  2DJK A;  4POM A;  5F06 A;  3C8E A;  5ECH B;  5HFK A;  2HNL A;  2X64 A;  5E59 A;  2C8U A;  1QUW A;  2NTO A;  2MMO A;  2VCQ A;  4JR6 A;  1V57 A;  4GST A;  5GZZ B;  5A4W A;  3NIV A;  1USB A;  2R6K A;  2HSM A;  13GS A;  2CT6 A;  4YKF A;  1H75 A;  4MH2 A;  4X43 A;  5F8B A;  3L0H A;  2B1L A;  4GLT A;  5HR0 A;  4ZB8 A;  4L5O A;  5IMA A;  1T3B A;  4MAB A;  2K18 A;  3C1R A;  1VF3 A;  4KB3 A;  3ZMK A;  2YOI A;  3A2X A;  2GZZ A;  2H30 A;  1K3L A;  2F8F A;  4TR4 A;  4ISD A;  4PUR A;  2YCD A;  4K9Z A;  4NPB A;  2GZP A;  3TCO A;  5KN0 A;  1EOG A;  4EIQ A;  3KP9 A;  3L9U A;  4OFT A;  4FYU A;  3FMW A;  3UAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...