4LL9A

Crystal structure of d3d4 domain of the lilrb1 molecule
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
196
structure length
194
Chain Sequence
VSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukocyte immunoglobulin-like receptor subfamily B member 1
publication title Crystal structures of the two membrane-proximal Ig-like domains (D3D4) of LILRB1/B2: alternative models for their involvement in peptide-HLA binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 194
sequence length 196
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ll9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ll9A01
3K4DA 4N68A 4UTBH 3S5LG 5IVXE 1WBZB 3O6FA 1VACA 2B39A 1YY9C 4IOFC 2Q8AL 3NAAH 4PJEF 1JPSH 4HBCH 1GHFL 3H9ZA 1UFUA 3GJFH 4GW1A 4LCUB 5KVGL 1INEH 1UACH 4XAWL 3SE8L 2R2HB 5BVJB 5GJTH 3MLWH 3VXSB 4Z78B 1EO5A 3Q2CA 1JIBA 1QD0A 1UWXH 2PXYA 4WUKH 4P46C 3HS0A 4OSUH 5I0DA 2D7NA 4JRYB 5ILTH 1AD9A 4BQCA 5LAXB 2F15A 1BBJA 1D3CA 2ARJB 3HAEH 4UQ3A 1H3TA 1KUMA 3GEWB 5DUPH 4XNMA 3G6DL 5D70H 4WHTA 1B6DA 3WS6C 3VRJB 1AD0A 1S9YA 4XP9L 5A2FA 4L8SC 4Y2DA 2FD6L 5KG9A 4O58H 5EU4A 3IFOB 2YPLA 4FQ2L 4XMKL 4JFQA 1RFDH 1S3KL 4O02L 3QDGD 2DM3A 3U7AA 4WFFE 4I4WB 1K9TA 5KVEH 3SOBH 5I73B 1MQKH 1TVDA 1IGTB 3LMJL 5IMMB 1AHWB 2IADA 4P2YA 3SBWC 4UUJA 6CGTA 2JIXD 2NX5A 4K3HA 2JKXA 3PHOA 1MPAL 3ARDA 1ROWA 4HAGA 3ZDZF 3D0LB 1T89A 1ZT1B 4KV5E 4JFZH 4HXAH 4WTZA 5MEPA 1MFNA 4HUWA 4ZPVB 5I1EL 2IAMB 2ZSVB 1G9MC 4U3CA 1RPQA 1DBMH 3CD4A 3LKPA 4PRPD 3BSZL 2GK0B 3GSUB 1BQSA 5IW1A 4U7MA 4WEUD 1X5KA 1I9IL 2AGJH 5FM5O 3RWHB 2AJZB 4Z7QF 3NGBB 5CWSA 1TNMA 5AD0B 3STZB 1NGYB 3MJ9H 4WHDA 1FSKC 1L0YA 3P0GB 2BZDA 4CVXA 4LCWB 2ATKA 5J0BA 5ACZB 2CUIA 1XEDA 3B43A 4XXCC 1OT2A 4KUZH 1U8LB 3VW3L 1TJIL 1GC1C 2WV3A 1IKFH 3CSYA 2W9LA 4ORZC 5K59E 3EFDL 4GW5B 1U8KA 3C9NB 3HZMA 4RA0C 3UTTD 3KPSA 4HWNA 1FVDB 1U0QA 5KSUA 3KPSE 3TLRA 1QR1B 1ZMYA 2Q7YB 2IQAB 4LP4A 1B90A 2I25N 3UC0H 1QQDB 1BJ8A 5FB8B 1MI5E 5GRVK 5KSBB 2HRPL 1ZANL 3CFDA 1HYSD 4YXHL 5CCKH 1YEIL 3A67L 3EFFA 4P2CG 2QSCL 4DTGH 1G7QA 4HX1B 2YRLA 1BQUA 4MQTB 1BFSA 1UWEL 3FQXB 5DFTA 1N64H 1ZLWH 3K7UA 2HMIC 1FFRA 5CBEB 4PB9H 5DD6A 1FFPB 3IXAB 4UBDD 3U83A 4AMKH 4PJ7F 3P30H 5HGAA 5ESQB 5I1DB 4PRIE 2YR3A 2WWKT 4GBXD 5D1ZA 3I6GA 3ZYOA 1LEKA 5ITFA 4MB5A 2VZOA 3VU2A 4H25A 3GSRB 5EO9B 2JTDA 3FN0H 3G5VB 5DJCA 1A3QA 4LSPL 4F8TA 4KKCD 4JZOB 5CEYA 1WUNT 5JDJA 2Z91B 1CICC 4JFHD 3G5XA 2W38A 1CT8A 1D9KC 1OAUL 4U1HB 4FQXA 2QKIB 1KJVA 1K4DB 5DO2C 5J9PA 2EDDA 4WI7A 3T77A 4XPBH 3D18B 3QNYA 3B3IA 5DS8B 4ZTPH 4Y8DC 3G5ZB 4KK8D 5AYQA 3QHZH 4XGZB 4PRBB 5E00A 3IJYB 5HI5D 2AERT 1NBVH 3C6LB 4FTVD 4IRSB 1IEAB 1AI1L 2DTMH 4N0RA 4GJTB 4EIZC 3MUHL 5IFAL 3WEXB 2YD9A 2UWEB 1CD9B 2ENSA 1YEEH 4K7PY 3D3VD 4J6RH 5IQ9B 4HH9B 4FFZL 4B7IA 4K9EH 2DQUH 2OSLA 3HLAB 1L9MA 3PABB 2Y5EA 1E27A 3T4AB 3O4OB 4X99A 2WSKA 3ULSB 2VXVH 5L2KA 2QL1A 3FT3B 3JXAA 4KTEL 4YNYB 4ODUB 5J11B 3DUUA 5LBSL 5GRJL 5HDQH 4ELMA 5L2KE 4EUPG 5D1QB 1EEQA 4ORGB 1YN6B 5D2NC 1FIGH 2BNRD 3EO1B 3I2CL 5J1TC 5IHZB 5JIPA 3DETD 4DGVL 4X6EA 3HMXH 3KPTA 4ELME 4H5SB 3NACL 1FGNH 1JF1B 3O3EB 1J9CT 3NIDF 1A1OB 3LEVL 1DFBH 1SBBA 3QNXB 4MVBC 1N59B 2DQDH 3M45A 4EUPB 2W9EL 4ODVH 1A02N 3AS1A 3VCLA 4FNLL 3QWRA 3NZHL 5JXEA 1RAMA 5F7MC 4X4XB 2VDKH 3CX2A 3QCVL 1OT1A 1K5NB 3GSXA 2F74A 4Y5XC 2BXYA 4CNIA 5F89B 4XCEB 1DQML 4YLQT 1EUTA 4EVNB 1MRDL 4PJXA 3O6LH 4W6WB 4JQIH 4K8RD 2F58L 5EU3A 4X4MA 5C0AB 2HLFC 3OF6A 4YUEH 3SO3C 1ZLSH 3CFIC 5CZXD 1MVUA 5T3XH 4NOBA 1UZ6E 3FO1B 3LIZH 4X4ME 4PP1D 3DV4A 1TPXB 2BCKB 2R0WH 1L0XA 2ZG3A 4IHOA 4MHHG 2ZPKH 4BSWB 4P4KA 1CVRA 1NCDH 5J3HC 3ECBA 3R8QA 5CSZA 4FZEH 1RZJC 1RI8A 1T2QL 5I30L 1G84A 3KYAA 1IGIL 1UA6L 3WHXA 5DMIH 1D5XB 1R3IH 4JZJB 5BOPA 2VDRH 1A6AA 1AQDA 5IB1B 4NQEA 3GDBA 4X6DE 3WE6B 3L7FA 5HHOD 3VI4E 4I77H 2ITCA 5CD5D 1J0IA 3DETC 4D3CH 4KKBD 4UV7H 1HWHB 4DVRL 3LN5B 4HUNB 1T5XA 2NTFA 4ZFFB 3RA7H 1IQWH 5F72S 4Q6IB 1JGLH 3CZFA 3GI8L 4HJGA 1MCEA 4QHNA 4HKJB 1S7SA 3SE9H 1C5BL 3SGJC 3PHSA 3RWEB 5IB2B 2YPVH 1U8OA 1SEBA 2E7MA 5K93A 3SE4A 5IIEA 1T5WA 1P84J 4PYHA 2W0FA 5L6YH 5ID1A 2PW1B 1NKOA 3FHAA 1FAIH 3RZCD 1IBGH 2AJSL 4I18C 2BNQD 2ZOLA 3S4SA 4MAUL 4OCXL 3LN4B 1DCLA 5T3ZD 4N9OB 4Y4KC 5AZ2L 1UM5H 4NQVA 2Q3ZA 5CZXC 3TT3L 4S1QL 5E1AA 1Y6KR 4KQ3L 1BFVL 4Q2ZB 4MMZC 5C8JB 3T1FA 4Y1AE 3ZKXC 4A6YB 4MYWB 4PY8J 4F7EA 3VFSB 3O6FD 3EHBD 3ZSSA 4DZBA 2H32A 2ZCKL 1WISA 1AXTH 1ZHLA 2HJLA 4NT6A 5C07B 5FO9B 4M62H 1BZ7B 4N9GA 4HKXB 2P45B 4R0LC 4G8IB 2D4DA 2JELL 1IRAY 4TULL 4Q7DA 2ARJQ 3HC0B 4U7KA 5IBLC 4CVUA 3U7YL 5K9JH 1EGJA 4I3SL 5F7DA 1C7SA 4EDXA 1Y18B 3ZKMD 2LU3A 4V1DB 3BKCL 2PXYD 1EMTL 4NQXB 1P6AB 1MFBL 3U46B 4TUOB 2OL3B 1GH7A 4KKBC 4ZS7H 2VLRB 6FABL 3ZHLA 1HINL 5IBTH 3U0TB 3EYSH 1YYMH 4IDJL 4Y2OA 1NGPL 5EZLA 3U7WH 4MA3B 4S0SD 3RNKA 5HYSG 5IGXL 5F1KC 1U8PA 4P2QB 4Z5RB 1NCAH 1SBSL 4OGAD 5DRWA 5DHXB 3UYRH 4GW4A 1CFVH 4EDWL 2YRZA 2WQRA 3ZL4L 5C0ND 3L3HA 3VGFA 1VKXA 4GRWE 1S8DB 3FONA 4U6XA 5HYSB 4P5KA 2YPLD 1KG0A 3GMPB 4OFYA 1IQDB 1NCWL 4K8RL 1T20A 1FL5A 4NZUH 5E8PA 2DICA 2VDMH 5F6IC 1QEWB 4LKCA 8CGTA 2ITDA 4MQ7A 2BOCA 2CO7B 3TJEL 3U0WL 1YNKH 4FFYH 3AAZA 1SJHB 2NX5D 2R1XB 5IW6B 3UTPE 3ARDD 3LQAC 4XH2B 1ZT4B 4KK6C 2H6PA 2YZ8A 1NJ9A 4XPHH 2CKBA 2Y6SD 2X4PA 2IQ9L 2VZUA 1RIVH 1UWGH 1NCNA 4JM2B 2X7LB 4LSQL 1T4KA 2MKLC 3X13B 3BH8B 3WO3B 2BK8A 3AS0A 3EO0B 4W6XB 5DVLA 2X1QA 1HOCA 5BZWB 3DYOA 35C8H 3VA6A 2FBJL 4NN7C 3RQ3A 3B9KA 3LY6A 3TFKD 1HH9B 3NIGE 3EO9L 4JCLA 4WY7H 4YBHA 3RVVC 1NAKH 2F53B 3VXTB 4X5LA 4Z7UA 3TESA 2WBJA 5GSVB 2DIBA 1YUHA 3EYOA 4TQEL 5EC2B 3QFJE 4NO3A 4Z7UE 2CGRH 5B4MD 3LH2L 3MRNA 5BXFA 1BOGB 1OGAD 1NFDB 2VAAA 3KPSD 2APFA 4Y2DC 1MF2H 4FXLA 2OZ4A 3CUPB 2R0KH 4NSKB 3MFGB 3KLAB 3EJZD 3H7BB 4YHLH 4XCYA 1ZTXH 2JJVA 4LHJB 4NHCH 2PKDA 1T1ZB 1CFTB 2GEEA 4LGRB 1X5LA 3ZTJH 4G9FE 5E1HB 1V3LA 2VQTA 2FR4A 5T3ZL 3NCJH 3ARRA 4M43H 4M7LL 2ICWA 4MJ5B 4EEEA 1N7ML 3LKNA 4JDZB 3SDAC 4ZPTA 5JOPD 5ANMA 2X9WA 1NEZG 3RAJL 1F58H 1JWMB 1M4KA 4HEME 5C6TH 5ANME 4PJBA 2C1OA 2CDEA 4KVNL 2Y6SC 2R29H 4CU8A 2WIIA 4X6CE 3RWDA 4OLVH 2R69H 3RUGA 3DXAD 2O5ZL 4IMLA 4R8WL 5D1ZD 3STBA 4DCQB 3BT2L 1P9MC 4N0YL 3RUGE 3TV3L 2D7QA 5DD1H 5D96C 1VDGA 3BPLB 3ZDXF 1UKTA 4RISL 4KTDH 4D0DA 4MJ4A 4DK6A 3K2UL 5DD0H 1BEYL 1EEUA 5CEZE 1YEHH 4PJXF 4WFHE 4RNRA 1PY9A 3TFKC 4NRYA 1BQHA 2H3NA 2BFVL 3G08A 5FYJE 4FQXD 1DQDL 3MRJB 1A6UH 1V3MA 4GQPH 2BERA 2R2CA 4HIJB 2HFGL 4S1DC 5F9WB 4KKLD 1KCLA 2LAAA 3MV8B 1WIOA 4HS6B 3K1DA 3MLTB 2QV2A 4KAQL 3C2SA 4OKVA 2Z8WC 3L3IB 5T1LA 3WFBH 5F88B 3QUML 1CDJA 3PGCB 3EJZC 1QNZL 4KHXL 2R9HC 1ZA6A 4ACPA 5M95B 2D31A 4P2OA 1HNGA 4HGKC 2APXA 1BX2A 5BMFH 4ZNEA 5IB4B 3OKOA 1RJYB 3G6JF 2BC4A 1M05A 3GSQA 4R2GD 2XTJD 2XRAH 4X0KA 5E7FA 1WBYA 5KJRL 4X98B 32C2A 4ZFZB 5L2KD 1MSPA 4QXGL 1AP2B 1JWSB 3TZVD 2DQEL 2KBGA 5J12C 5D6DC 1JNHB 3HR5B 1KYOJ 3NTCL 4M6NH 4RFNC 1MCRA 4RQQA 2PTVA 2PYEA 5C6PB 1R5WB 3AC0A 1MH5B 3ARQA 2PETA 3MFFA 5JIIA 4KQ4L 1ZT7A 1R5IA 4DQOL 4LSTH 4KK9C 3QHFH 5DQ9A 4BKLA 5FO8A 5JW3L 4R7NB 1H8SA 3QWRD 5JXED 2V9RA 2ZSWA 2AABL 4P2RA 5HHNB 3HG1B 2Y07H 2P8PA 3Q1SH 1FH5L 1IAKB 1F45A 1NMAL 4I0KA 3QDJA 4FQXC 1RIUH 4GQ9H 3GMOB 2EEDA 4P2RE 2XQBH 3KYKL 3MMEA 4L8BB 5E8OA 3SGEH 1FVCA 5KSVB 3QDJE 1TETL 4Y88A 4OAWA 2VLJB 2Z31B 3K74B 3OF6D 1VFBB 3SN6N 2A9NL 5JW4R 3CLEL 4NZJA 2Y72A 5GGRA 5KS9F 4F9LA 1CGSH 4OLXL 4LEOB 4XCCL 1G9NH 5FHAL 4HWBA 4P4KD 4NQCB 1F4WH 1S9XB 2XG5A 1YN7B 2WP3O 2EDOA 5B38G 5FA4B 2ZJSL 1RZIB 1CVSC 4WJ5B 2ZUSA 4R2GC 4E0RA 4I48B 3VFNA 3QBTB 3QUXA 3QT2A 5ERWA 3BO8B 5EO0B 2AK4B 3ARPA 3KWWB 5DC0A 1DE4B 1UYWH 4LARL 1EAPA 4PV8B 3OPZH 4NQED 2D0HA 3RWCB 3RU8L 5CINH 2J7LA 1UH2A 4V2BA 4K3JH 1QOKA 3ARGC 3QDMA 3MRBA 3FQRA 3L3DB 4TYUA 1KCUH 3VG9B 4IRJA 2E8ZA 3VFPA 2FX9H 4IOSD 3OB0H 5EUKB 2HAZA 2VUOA 1HHJA 2HVJA 2HG5A 3BN3B 1RSFA 3BZDA 3M1BB 3V79C 1OAYH 1XF5A 1ZVSB 1CF8H 1WCBB 3MNWB 3F7YB 3MPCA 1EK3A 3FHQA 4LSSH 1JV5A 5DC9B 2V5TA 4UB0H 3GSNH 3MUZ1 1QSEB 1MQ8A 5GS1C 1YMHA 4RDQF 2SEBA 3V4PL 1TMCB 1CDHA 4CMHC 3CLFH 4P23A 2AAVA 3FO2A 1MJJA 1WZ1L 1C5CL 3D39E 3NIFE 1E4XH 1PZ5A 3IU4H 1HIMH 5DRXA 4NNXA 1FAKT 4KRPB 1ADQL 3TO4B 3QEHB 5JHDA 2DD8H 3CFKB 3L5XL 3PWNB 5C0CA 2CKBH 4HLZH 1LO0H 4HUUA 3D48R 5GS0L 5E2TH 4NM4H 5D7KD 2ESVB 2J5LC 3L1OL 1G7IB 4Z95L 3ZKNC 3GMNA 3Q3GB 1OTSD 5C0IA 2J8UA 1FG2A 2X4NA 4X5WB 3T2QA 1D6VH 1FZOA 3EUUA 3FO0H 1JK8B 1FLTX 2DJUA 4EI6A 1Z9MA 1RHFA 2CLZB 2J8UE 2WUBL 3MBXH 4ZODA 1W72B 3ZKQD 3BRDA 2R4SH 1ZV5A 1J87A 2V9QA 3LQZA 2HTLD 3V6FB 1H9VA 2OTWA 1B0RA 2AJUL 2J12B 5D1XC 4DW2L 4HIIB 5EZOH 3KPOA 4N1CA 3LPFA 4WNQA 1F42A 2B1HH 2DL2A 2RHEA 2IAND 3QCUH 1CFNA 4P46B 5TFSL 1MEXH 5EOCJ 3UJIH 5EOQH 5JW4M 2AV7B 2C3HA 3SE4C 3P4OB 2ICEA 3P73A 1EEYA 4WI6A 1DN0A 1ITCA 1IZKA 3GSWB 5DSCB 1E0OB 4ODTL 5J6GB 4HIHB 3SDXA 4N0FA 1JL8A 4LPYA 4YDIH 2R1YA 2DJSA 1F6AA 1LHZA 1XF3B 4YHPB 3ISWA 4PJBF 3UDWA 4L8SB 3P4LA 3UTPD 3WXVL 2V5SA 2YD4A 3NZ8A 4LHQB 1UKQA 1JHTB 1X5IA 3VE0A 4EI5C 2GUOB 1EVTC 3QUKA 4ZUUB 2Q8AH 3VFGL 5FF6B 1BZ9B 1MWAA 1RUPL 2MNUA 2GJZA 1G9NC 2W07A 3OKMB 2E9JA 2WWMC 4R4FL 3WNNA 5KVGH 1FC2D 4JY5L 3BISA 4ZUWA 3SE8H 1IAIM 4RMQA 1U3JA 4JFFB 4PP2A 2ZCLL 4QY8B 5DQJB 4QHMA 5J1AA 5CEZH 1D5IL 5J56B 2X2YA 1Z0NA 4NNYB 1YEFH 4WIQA 5I76B 1URLA 1J1OL 5C3LD 3F62A 3OTTA 1EH9A 2ZWLT 1QLFA 1HI6A 1E6JL 2PTTA 4PLKC 4AH2A 3FFCA 5DJ2A 3B9KD 3NCCB 5DGQA 3CK0L 3RWFB 4M6OL 3CVIL 4MJ6A 4NCC1 5CS7A 4XP9H 1BIIB 4ODBD 4OGYH 1B88A 5I15L 2D7TL 4XC1L 1VGKA 3T65B 1MRCH 2VDQH 2NR6D 3OKLA 5DJZB 5HGDA 4FQ2H 1FSKB 4XMKH 4O02H 2NXYD 1S3KH 3QRGL 3DI3B 4AEIH 2PW2B 4RIRA 2HT3C 4KKAD 2VO5A 1EX0A 3T3ME 5J8OA 2Z8VC 4E5XB 2R39A 3LMJH 4OZ4B 4XHQA 1MCOH 3MLYH 1FE8L 4MCZA 3UBXA 2FH8A 2DQCL 4Y7MA 1IEBA 3WO4C 2J6EA 2DB8A 5BO1L 1KIRB 4KHTL 3QQNA 1OGTB 1MPAH 4N1HB 3WNLA 1C7TA 4HUKB 1QFPA 3BEVA 3JWDH 3UYOD 3RWJA 2ED7A 1UQSA 3P2TA 1MHCB 3KXFA 1A6PA 1KXQE 3QDGB 2R8SL 3I02A 4BFIA 1I1FB 1WZLA 1ZHKB 1I9IH 5KVDH 2DQTL 5KAQF 1QFOA 5HYJE 5TDPA 1KJMB 4TRPL 3NCFB 2Y4SA 1I85C 4K94L 3MRIA 1GZQA 1QA9B 1OW0C 4ZOCA 4XNYL 1BVZA 4HZLB 1PG7W 4XNZC 1N4XL 5TE4H 2N1KA 3NCEB 1VPOL 1SMAA 5FYJD 1YQ2A 4TTGA 2AK1L 2NW2B 5DYOA 4R7DA 5F7FA 2XFXA 1DQJA 2GCYB 3BP6B 4KZDH 4NO0B 2WBJC 4U1KA 5EU7E 1NLDL 2P8LB 3GJFB 2XN9E 3DUHA 2FCBA 5ADPH 1CIDA 4G43B 5H37H 2NNAB 3CVHA 1W0WA 3O8XD 4PGDB 3HRPA 2NXYC 5F9AC 1ETZB 4YAQA 1UM6L 1CICB 1XMWA 2VLKB 4OZFG 5T1LD 3W82A 1D9KB 1WFNA 3O2DA 1H3GA 1ZANH 4HWBH 5F70A 2GFBA 4AYFA 4YXHH 3S96B 1X44A 4P2OD 3A67H 3HAEB 2QR0B 2QSCH 1OF2B 3LD8C 4JEGB 2VXUL 2EZ0C 1D5BA 5DFVD 2CMRH 3MOQA 5ACMA 2WINB 1P4IL 1CXFA 3BMVA 4C56A 4MA7H 3WS3B 4Y19A 5HGHA 4MXWL 2YRPA 1PAMA 5INCB 4Q9RH 4ZDHA 4C56E 4X7DC 2VB5A 5CEXA 4Y19E 1DBAL 5IUSA 5JPNB 3KYMA 4PRAB 4DN4L 1I3VA 4U31A 1XR9B 1BJMA 2K9UA 3I6LE 2NYYD 2XIDA 3VXNB 3FB7A 5F8RC 3CMGA 3E6HA 2PYED 3VXRB 1JF5A 2K7QA 5DD5H 1R3JA 2A83A 4LSPH 3BWUC 5I6XC 2JCCE 1H0DB 5BS0B 4PREA 2W0LA 1M7DA 2AVGA 3VI3E 5D2NB 3H9YA 4K3DL 5HYQB 1EAJA 3SKOB 2OXHA 3HN3A 3MV9B 4P2RD 1Z5LA 1BD2E 4MJIB 2VISB 4KDVA 3BVNA 3L5WA 5EUOB 2Q1EA 1A7OL 1X7QB 4NJ9L 3WLBB 3QDJD 4ODHL 1XF4B 3PWLA 5A43C 3V7MA 1YPZF 3BKML 4OCRL 1AI1H 4PJAF 1LO5A 5IFAH 2FHFA 5CJXC 5I19L 1CDGA 3IB4A 1U8HA 3JWOH 3V8OA 3FTGB 2F8XC 4NGHL 5EA0L 5B22A 1EJ6A 4LF3B 2X1WL 3CNKA 2ED9A 4MDJA 1I4FA 1NC4B 2AJ3A 4Y5XB 3S37X 2OZ4L 4NHUB 1OP5H 5EOTB 1M7IA 5FCUL 3IKCB 1QRNA 4APQD 1KCVL 4ENED 4X7TB 2NXZD 4KTEH 5MEOB 4HKZB 3BAEH 3SO3B 3AM8A 2BXZA 4I2XA 4MS8D 5GRJH 5LBSH 2GJ6B 1DQQB 3WL9A 4KWUA 2DJ4A 3TEUA 3I84A 4HLJA 4LSRL 3IAQA 3M07A 4LLYB 3I2CH 4D9LL 3JWDC 3LKQB 4YQXH 3NACH 1KLUB 3TN0A 2EDXA 3F12B 4NFDA 5IQ7L 3LEVH 3HUJB 3QDMD 5DHYA 2ZP0T 2NYYC 1RZFL 5HHPB 3TBYA 4CDGC 1U8NB 2XWBA 5IOPA 4IRJD 5E95B 5B8CA 2C3GA 4OB5L 3WHE1 3RIFF 2W92A 4UIMB 4U1LB 4DOHB 1XGUA 4JO1L 4OF5A 3P9WB 1DQMH 4ZFGL 3NCBB 3SDXF 4HW6A 1MRDH 2F58H 4OGZA 4F7PA 4L5FL 4M7LT 4PUBH 5KTEL 1MFEL 5MERA 3VDBA 3SY0B 5JXAL 3S37L 1MIML 5F7YC 5INDB 2P5WA 3KPRE 5GIRA 3MNZA 4NCDA 2A38A 3WNPA 3D9AH 1U8QA 4PG9B 1NAMA 4PJGB 5H35A 3AMLA 4ZXBC 3JV5A 1NFKA 1XIWC 2P5WE 4LCCC 1CTNA 2B5IC 3CPLB 4JFEE 4F9LC 1GGCL 1MWAH 5SWQA 3MROA 5JHDD 1LD9A 2GK2A 5C0CD 5I1JL 1WTGT 4I18B 3T3PE 3CFBA 3BE1H 5HDLA 1H15A 4XMPL 4Y4KB 5GRUH 3QUXC 2R2BB 3X14B 4AIZA 3FN9A 4Y16A 3LS5H 3MA9L 1OB1A 3QEQA 1DR9A 2A0LC 3QO0B 3ZKXB 2WWKO 3BP5B 5D4QA 1FFNB 4HIXH 4PR5B 4PJ5B 5ICZA 2F54A 4JDVA 3S3SA 2HRLA 3IAGC 3GI8H 1H3UA 2NY4C 4R0LB 1P4LA 2P5EE 5IMLA 3E6FA 4XBGB 4AM0A 2C5DC 5C2UB 2JJSA 4J3WA 4F2MB 2DN7A 4JJ5A 4D2NA 4GT7A 3O9WA 4YBLC 4IJ3C 2IBGA 4NRZA 3MV01 3EGSA 3IT8D 5C92A 2KDGA 1JYWA 4H0GA 3N50A 4M61A 4OZGB 4MAUH 4OCXH 1J1PL 1VESA 5EBMB 5I0ZA 4IOIA 4M4PA 2A6DA 5IV2A 1GJIA 4QOKE 5EFIB 1PW3A 2VIRB 9CGTA 3C60A 4P23C 1JPFB 4DVBB 4KJPC 3QG7H 1U3YA 1WCQA 3JWOC 2YK1L 2EEBA 5JNYA 2ZCKH 2EDBA 3HNVH 3VFWA 3GIVB 3VD3A 3VXQA 1DLHA 3Q5YA 3PXHA 4X4YA 3K3QA 4EIGB 1S7TA 2DMKA 2K3TA 3L95A 4RAUB 3FQNB 4JRXD 3VXUA 1OP9A 4TUJA 2JELH 4Y5YA 3X3FH 5F6IB 3U7YH 3LKOA 4PJHB 3GSVA 4XVJL 3KYOA 3VXUE 3KLHC 4XCNB 5IVXB 3P0VL 15C8L 3BZEB 5TH2B 1EMTH 5C0RL 1IAOA 1II4E 4MCYA 4YDVA 1WK0A 1CE6A 1PX3A 3GFUA 2G60H 5F7KC 6FABH 4WFGE 1HINH 2H41A 4IDJH 1NGPH 2EDHA 2L4OA 4GKSA 1J1XL 5IGXH 3FFCD 4Y5VC 3RGVD 5TGBB 1KJ2A 1SBSH 3WD5H 2F9BT 2ATPA 1YY8B 5KN5B 3ZL4H 3JTSA 5JW4N 1L7TH 4MGXA 3RDTA 4UAOC 5C0BE 4LAQH 1U3HC 1I8MB 4I0PD 4NN7B 2ENYA 3HS0B 3BZ4B 3RIAK 1FORL 2Q6WB 5GPRA 1HK6A 1NCWH 1UC6A 1BBJB 1MJUH 5CJQL 3QPXL 4HFWB 3LEXA 2PO6A 2V2WA 2NY1D 4M5YL 4XNMB 3U0WH 3CDYA 4OLWH 1BZQK 3DVNA 2Z9TA 3S35X 3EOAA 4XVUC 4HCRA 1CXLA 3EYUL 4Y2DB 3G9AB 2ZUQC 5E9DA 2EKSA 4WTWA 3KXFD 5EIIB 2IQ9H 3MRRB 4NIKB 3N0PB 4LSQH 5E9DE 3KLSA 1RZGB 3KLDA 1IGYA 1RZ7L 4NYLB 1X5JA 4JREC 3CCHA 2IADB 5C0GA 1NBYA 4M7JH 3DO7A 1A7QH 3SDAB 3D1MC 4ZYKB 4ZSOE 4ODXA 1NDGA 3PHOB 3OAYH 4HG4K 3EO9H 3S36X 4LCYA 3TPKA 2X4TA 3KGRA 1LK2A 5MEPB 1A0QH 1X5GA 4HUWB 4QWWC 3IS0X 3V0WL 4NBYB 2VL5B 3MV7A 4HS3A 5F7EH 5ITBL 1E6OL 1CS6A 2WLYA 3I85A 5D96B 4Y4HC 2QLVB 2HKFH 2MPAL 4EN3A 3AFLA 1H8OA 3TBWB 4OIIL 3QG6B 3SO5A 1N0LA 4OD3L 4CVXB 4WEMB 2IPKB 1F4AA 3S35L 4B5EA 5D7LA 4L8CA 5T5FL 1N5YH 4OZIE 1QFWI 1N7MH 1GGTA 3IDYC 3HI1B 3CSYB 5D7LE 4ZFOL 5ESAA 1CDUA 1U8KB 3BJLA 5ISZA 1AGFB 3PGFL 4N5EC 5I1IL 3WLWD 3IVKB 1MCKA 3KPSB 2HTKD 3U4EA 1J86A 2YUXA 1YEDA 3J8F7 3MRQA 4Y19D 2UYLA 5ISZE 1MI5B 4U1NB 3HI6L 1ODAA 2O5ZH 4R8WH 3V8CA 4OBSA 4S1RL 3W0WE 5HSFA 4N0YH 1BLNB 4OF6A 1YQVL 2DYPD 1RD6A 3S36L 4O9HL 4RISH 3EFFB 3K2UH 3IU3B 1BEYH 5BW7A 1MHEA 5TE6H 3FRPG 3VD7A 4OGXH 3ILPB 4PRIB 3CH1A 2BFVH 2BY3A 5J12B 1ZSDA 4L3ED 1F3DJ 1A64A 1QSZA 3O6KL 3F58H 3WUWA 4CUCA 5EU7C 2D9QB 4O5LL 2HFGH 1UH4A 4I9WD 4RFNB 3GJFK 4HC1L 1A47A 3UZVB 1ZEAL 4IEFB 5KBNC 3QUMH 5EWIH 3V5KA 1ED3A 2AJXL 2ID5A 2VWEE 4JR9L 1CT8B 2K7PA 1BQLL 1U2HA 4FQXB 1S9VA 3OJDA 2PF6A 1WZKA 3GBML 1QRND 1UXWA 3T77B 1MCIA 4LLAA 1KULA 2ICES 1G6RL 4QXGH 4AG4L 1A8JH 2J6EL 5E00B 3WLWC 3BP4A 3F7RA 3IF1A 3ZTJG 2DQEH 2VTFA 1FRGL 5DVOA 3MREA 2W65A 5D9SA 5I2IA 3OXRA 4PJCF 3HPLB 4QRTA 2PNDA 3K8KA 5DZLA 4NC2B 3RVTD 3NTCH 3TN0D 2OSLB 1ZHBB 1FO0L 1E27B 3MSPA 4KI5E 4KQ4H 4Y0GA 2A73A 3LEYL 4GAGL 4R2GB 2ADJB 3P0YH 4X80L 5L2KB 2LV4A 5FUZH 4JGJA 2I9TB 4OCNC 3DUUB 5F7NC 3DYPA 3UZEA 4ELMB 2AEIT 5ICYA 5IB3A 5I1AA 3ARGB 1WBZA 5BZDB 4XPGH 4PJIB 4GAFB 4YHOH 5BJTB 4GMTL 1OAQL 1NGWB 5IROA 3CLEH 2IWGA 4LCUA 4OLXH 3QHTC 5CP3A 3CVHL 3VCLB 2RBLA 3S5LA 2R2HA 2XWJB 5BVJA 1GGIL 4PGBB 4X8XA 3C8KB 3GSXB 2MCPL 4YDKL 5GS1B 3DRTB 4CNIB 4KK5D 2ZJSH 2YZ1A 2EKJA 4JRYA 4ISVB 2YXMA 3QPQD 4CMHB 3UXFA 3D5OF 3QP3A 1OQOA 5HHMD 3JSSA 3T0EE 1MVUB 4DGYH 4LARH 4FZ8L 5CUSL 5C08B 4Y16D 3QEQD 3DV4B 4G8FA 3DPBA 3WIHA 3NA9L 3VRJA 3RL2B 4D9QE 2AEWA 1CDBA 1Q9OA 4QCIB 4C83B 5GS2D 4M48L 4FQHB 2FECI 2IJ0C 3V5HB 3ECBB 2F54D 4LHUG 2J5LB 3X3GH 4I4WA 5FYLD 2OXGA 3WHXB 1IGTA 3T2NH 4X6DB 1ZLWK 1FFQA 2G5BA 4LEXH 2EIZB 2BP3A 1AHWA 3DIFA 3RRQA 1A6AB 5HI4C 2X9XA 1UB6B 3O0RH 3O9WD 1WQVT 3EYQC 1T83A 5CILH 3V4PH 2P24B 3L7FB 4Z0XB 4R9HA 1ZT1A 1T5XB 4HF5H 2NTFB 4WI9A 2AJVH 1R24B 5D1XB 1WZ1H 1S7QB 2ZSVA 1KEGL 2Z0BA 2LU7A 5T5NF 4QHNB 2DKUA 5DJ8A 2GK0A 3OV6A 1TQBC 5D2LE 1S7SB 3C60D 1ADQH 2A77H 1S9KC 4XB8A 1CYGA 2AJZA 5FUCE 1LQSR 5HHVL 2WUCL 1SEBB 5GS0H 3STZA 1KIPB 1PEWA 1T5WB 4M1DL 1V7ML 4NZRL 2GT9B 1JHKL 4LCWA 2O5XL 3G5YB 1I3GL 5AZEH 5ACZA 2GAZB 3FQUA 4X6FA 1UEYA 4JKWA 3PNWB 2HJFB 1FL3A 2EECA 2Y36L 4Y1AB 4LCWE 1WIPA 4NQVB 2NTSP 4OLEA 4GW5A 4EI5B 5F3BB 4Y16C 1TVBB 3C9NA 1Q0XL 1F2XK 2WUBH 1JYNA 3T1FB 3T4YB 1NUNB 4F7EB 1I8LC 1FVDA 4PBWD 4DZBB 1J7VR 1QTYT 1F11A 2AJUH 1F97A 3WFHB 1ZHLB 5SX5K 4I3GA 4NT6B 4XI5D 2Q7YA 2ZCHL 1JNNL 5JOEA 2BSTB 1QQDA 4YFEA 4N9GB 5FB8A 1BAFH 4OD2B 5HD8D 4K3EL 1WZMA 4YO0A 5TFSH 2JJSC 3QUZA 4KMTL 2D3VA 1EFQA 3REWB 4LOUD 4ZAKC 2YUZA 4IIQA 1A3RL 4HX1A 2XQYG 3TT1L 2NZ9D 2R0ZL 3V6OA 3FQXA 1NLBL 5GGSB 5C0EB 3PWJB 2ZUWA 3IXAA 4JFYB 5EOCH 3TH4T 1HQ4B 3NABL 3V6OE 5I1DA 4Z7VF 2C9AA 3AB0C 2PO6D 3WXVH 1U8PB 3BYTA 1T1WB 2LU4A 4CGTA 5JA9A 3C08L 1BHGA 3VFGH 2YKLL 4KRMB 1NAML 1CR9L 3GSRA 3MGAA 5EO9A 4L3CB 4F7TB 5I1HH 3G5VA 4R4FH 3MXVL 5E9DD 3MYJA 1TENA 4MNHB 4JZOA 4YIQB 1KG0B 4LASL 2ZCLH 5ICXA 1D5IH 3WO4B 1T20B 1FL5B 4HLZG 3B2VL 4R26L 3PXJA 3GUTB 3IKKA 1XF2A 2ITDB 3LAFA 3ZTNL 3D18A 4MQ7B 1J1OH 1WBXA 3G5ZA 4XGZA 2VXQL 1J8HA 1IEAA 3CK0H 2UZXB 2YXFA 3CVIH 2UWEA 2CKBB 3MLXL 1FV1B 2AQ1A 1J8HE 5IQ9A 3MGTB 1ERNA 5I15H 3ZHKA 3HLAA 1KB5L 5FYLL 3MV7D 1T4KB 4JKKA 5IFHL 3QRGH 3T4AA 4LOUC 5GRVL 5IHUH 3RDTC 3ULSA 1HOCB 4XNZB 2YHGA 4EN3D 3FT3A 4GS7C 4DAGL 4EBQL 2C3VB 4ODUA 3X11A 1FE8H 2DQCH 5D1QA 4F37K 5D7LD 4YWGH 2X4OB 3QFJB 3DRQB 4NBXB 3H9HB 4KHTH 4Z7UB 2I26N 1G6VK 5BO1H 1GCFA 3EO1A 2WBJB 5IHZA 2F5BH 4H5SA 4NC1E 5CSGA 4B53A 3EYOB 1JF1A 3PE9A 4NO3B 5TQ0L 2HYMA 5D7IE 4NJAH 1A1OA 5BXFB 1MAJA 1OLLA 3QNXA 2VAAB 2NXYB 1N59A 2R8SH 2HVKB 1XH3B 4M7KL 4EUPA 1JPTL 4UTAL 4Y4FC 2RJMA 2DQTH 4G9FB 4YXKL 4JVWA 1OAXL 4O2FA 4XRCB 3RP1A 4XNYH 3N06B 5F89A 3LD8B 5C6WH 3L5HA 2FR4B 4FQ1L 2ICWB 1PSKL 1JHLL 1N4XH 3B5HA 1T3FB 5FYKE 1Q9LB 2VE6A 4TVPD 2AEPH 1N26A 4X6CB 3DUSB 3FO1A 2GIYA 3K4ZA 2WIIB 1NLDH 3RWDB 2Q76B 4BSJA 2XYCA 3RUGB 5I16B 4BSWA 1KJ2L 2PTUA 1A4JB 5AG9A 5I1LA 1VHPA 2DM2A 4I3RL 1AXSB 5I6XB 1UM6H 3QAZC 2ADGA 5HDBF 5CP3H 1W2KT 4JZJA 4U6VL 4NWUL 5DZNA 3CIQA 4XP5H 4RNRB 3U1SH 4NRYB 1BQHB 4WVRA 1WFOA 5IB1A 3G08B 3WE6A 2B4CC 2VXUH 1KTLB 4BSVA 1P4IH 2JE8A 3LN5A 3MRLA 1TZGH 5I1GL 1XFPA 4ZFFA 4PJDA 1V3KA 4Q6IA 1S5IL 1IM3B 2MQCA 1WAAE 4HCRL 5T1LB 2OJEA 1C1EL 4D8PB 1B9ZA 4PJDE 1KF9B 1Q38A 3F6LA 3RWEA 5IB2A 4NZTL 4FFVC 1FCGA 3G9VA 4KI5D 5DT1L 3ROOA 5IF0B 1RJCA 3DX6B 5C7XL 2FJGB 1M05B 2EXWC 4X0KB 5DI8B 4LDEB 1QUNA 4R4BB 3LN4A 3U9PL 3CU7A 4G5ZL 4K3DH 5BW7C 3MLZL 3GBNH 2B8OT 2AV1B 1RZKL 1P1ZA 3AREA 1I1AC 2DBLL 1A7OH 5MI0C 4ODHH 5EULV 4YPJA 3RTQC 3T0BA 3QDHA 3HR6A 3VFSA 4JQVC 5DK3A 2X4SB 4WWKA 5FUOH 2DQFB 5J57B 3TCLA 5I19H 2FEDC 3V5DB 1MJ7L 5I9QC 1BZ7A 4HKXA 1ZT7B 1R5IB 3KPNA 5HYIA 3HC0A 2DWEA 3TM6A 4ZS6C 5FCUH 3MCKA 2GSIB 4P2RB 4HIEB 4S1SH 3VXSD 1JFQL 1KCVH 2DMBA 4AEFA 3WXWL 3K0WA 1A1MB 1HQRA 1PQZA 3HC3L 3U46A 4TUOA 1KFAH 3P40A 4JRYD 2CUHA 1FVCB 4LSRH 2EC9U 2CK0L 4MA3A 3H0TB 4D9LH 5DMYA 3FQWB 3P9MB 3AU1B 4ZXBB 4P2QA 4Z5RA 2G2RB 1XIWB 4MA1C 3V6BR 1WIUA 2FIRT 4LCCB 3V4UL 2B5IB 5GGRB 2F5AL 1QFWL 1BFTA 1PD6A 1RZFH 3LV3A 4KI5C 5KSBF 3I6KA 4NQDB 4OB5H 3RX5A 1OPGL 4XAKE 5HYSA 2OR9L 5EZJB 2Z35A 4S2SB 3GMPA 4UT9L 3QUXB 4JO1H 5SV4A 1LP9E 1IQDA 2Y1VA 2EIDA 5ERWB 4ZFGH 1QEWA 4KXZI 2CLVA 4N5UA 4OTXH 4EQ3A 4X9GA 1EAPB 4L5FH 1MFEH 1G0YR 1SJHA 4MXQD 2R1XA 5IW6A 4XH2A 1F90L 2NY4B 2BHYA 1YNLH 4UDTA 4M1GL 3V0VA 2IFFL 2HVJB 2FIKB 1XF5B 5DR5L 4LK4A 3TO2B 2X7LA 3BPCB 3QXAA 4E42B 4LU5L 3X13A 4YBLB 4IJ3B 1JV5B 4YHKH 3PWUB 1ONQB 3EO0A 3TA3A 2Z92B 1CQKA 5B3JF 5I1JH 2VRAA 5BZWA 4GG8B 1VEOA 4H88L 4KH2A 4CN6A 2SEBB 1HH9A 1C12A 4P3CH 3T0AA 4LCWD 3D39B 1CWVA 4PIRF 1R3HB 3T0EC 4JM4H 3PJSB 4Z7OF 1JE6A 1CD1B 5CGTA 4P23B 2ZKHL 3VRLF 3CXHJ 2UWEF 5EC2A 3VFUB 4YXLL 5DRXB 1T6VN 3UPRB 4U49A 2H45A 1NFDA 3PWPE 5IT2H 3U48A 1NMBL 3EOTL 1P4BL 4NSKA 1DUZB 1A14H 1NFDE 5MENB 3KLAA 2MSPA 4NQSB 3H7BA 5EN2A 3M17A 4HUXA 5E8DL 4UU9B 4GO6B 2J8UB 4JZNA 5SWSA 3MJ8A 2JB5H 1Q72L 4MJ5A 3R4DA 4JDZA 5E6ZA 5SWSE 4Q6YA 1JWMA 1T83C 3FAXA 3B2UD 4OUOA 4Y5VB 4AEHL 4P9HL 4HDIA 3DJ9A 3LQZB 1ORSB 4OQTA 2OTWB 4WI5A 2BX5A 3MLUL 4PJEB 1TQCC 4Z7WE 3HB3D 3KPOB 2EH8H 5JQ6H 2CO6B 4HPYL 1A21A 4UAOB 4KFZC 5FUCC 3RX7A 4DCQA 1IILE 1U3HB 1HHKB 1NEZA 1CFNB 4UDUA 3GMRA 2DQJH 3MCLL 4PJFE 2O5YH 4X7CC 1CIUA 3P0VH 4JN1H 5EBGA 1KBGL 4YHZL 5F93C 4N0FB 1UH3A 5C0RH 3MRJA 1Z2KA 3R8BB 3VXOB 3BRGC 2E7HA 2QADC 3KPPB 1OAKH 2X42A 3NZ8B 2Y06L 4OFVA 3MV8A 2ZUQB 1EO7A 3MODL 3QUKB 4HS6A 3VWJC 3FCTA 3MLTA 3ULUF 5HY9A 1MWAB 1D6EB 3DSFL 1AKJB 1CBVL 1P7HL 1EUUA 5DVKA 3VGHA 5F88A 4TPRL 5IBUG 4KKNA 4P9ML 4ZUWB 3PGCA 1SY6A 1T7ZA 4H0IA 4JREB 5LGHL 4PP2B 5F9OL 4QHMB 1PG7X 4RGNE 1RJYA 3QUZC 1Y0LA 2IGFH 4X7EC 1FORH 1MCPL 2FECL 1FYTE 1LO4L 4IIQC 5CAYB 4ZFZA 1AP2A 2PTTB 1AY1L 4UIKL 1JWSA 3RKDC 2FX7H 5DJ2B 3HI5L 3T1WA 1T03H 3QUYC 1IC4L 4KPHH 1WF5A 3BKYH 4M5YH 3I9GH 2CK2A 5D1QD 3RJQB 1JNHA 4FP8H 1TNNA 3UROR 2GQHA 3HB3C 4BUHA 1JRHI 4Y4HB 4XNXH 4V2CB 4WW1B 1BBDL 1MH5A 1XGYL 4F80A 2QEJA 4KJWD 3W11C 2VABB 1NCBL 5LCVL 1J5OH 3C2AH 3HG1A 5EU6B 4QTHB 3UBXB 2G9HB 3IDYB 1VEPA 4NQUA 1T66D 3BIKA 3WSQL 3GMOA 1V7NH 5FYKD 3ZE0E 4F58L 4L8BA 5KSVA 4OD1L 3GKZA 2BSSA 4WU5A 3UTOA 4L9LA 2VLJA 3RWJB 2Z31A 1MREL 4QGTA 4C57C 5HYJB 1MAKA 3S7GA 3V0WH 3WJLA 3SGKA 3I02B 3VMNA 1PG7L 3WHE0 4BFIB 5ITBH 1E6OH 3V4VL 5FGCE 2MPAH 4NQCA 3ULUD 3KDMA 1KCKA 1N0XH 2BVYA 1YN7A 3A6CH 4OIIH 4NO5A 5FA4A 1F3JB 1RZIA 3QWQB 4WJ5A 4I48A 1MLBB 1X6LA 3BO8A 5EO0A 5T5FH 2AK4A 4JY6B 1VA9A 4HSQA 3RVUC 3KWWA 3V52H 1FNGA 2D0GA 1K4CB 3WYRA 2XN9B 4M6MH 4NFBA 4NC1C 4PV8A 5DYOB 2AK4E 3RWCA 2HT2C 5E2UH 4CADB 4OBRA 4U7SA 3PL6C 4U1KB 5B38A 2YD7A 2J4WL 1OD7A 2EXYC 4HWZB 3HI6H 4WCYL 3O3BB 3M1BA 4YAQB 1ZVSA 1WCBA 1WWAX 1UGNA 3F7YA 3NFSH 3TIDB 1KB9J 1IKNA 1YQVH 2GFBB 3MXWL 3S36H 4Z9KB 1ES0B 4NP4H 3QNZB 2A1WH 1T66C 2DLGA 2EE6A 5IEHA 3DO3A 4X7SL 2CUMA 3PP4L 4C56B 2EE9A 4Y19B 3O6KH 2YUWA 1K8IB 4FXGB 4L29A 3BH9B 4K7PH 3IDMB 3LSOB 4EOWL 4OCMC 4HC1H 1DL7L 5DRNB 1P7QA 3OGOE 2FB4L 3O45B 3QR2A 3TO4A 1S7XA 1A6TB 3QEHA 3CFKA 3PWNA 1YDPB 4JM2F 1TXKA 2CIIB 4QHKI 3E6HB 1FJ1A 2JCCB 2HT4D 5J06A 4LVEA 5C07D 3LHPH 3OX8A 1R3JB 3IFPA 1N2RA 1G7IA 2CH8A 4OFDA 1LE9B 3MLSL 4PREB 1BD2B 3FJTA 1MLCA 4X5WA 4POZD 4LQ1A 1IEHA 3GBMH 5EORL 1J0JA 1A9EB 5L9DL 1JK8A 3FL7A 4V1DD 3CFEB 1G6RH 2CLZA 3L5WB 4AG4H 3O2WH 1W72A 4D9RE 3MRHB 2DL9A 2VDOH 3PWLB 1X5AA 3BUYB 5LGJB 1TJHH 4OCSH 3V6FA 2VLRD 1NANI 1LO5B 1U58B 2QHRH 5E08H 4FQQB 4HIIA 3MACL 4P3WA 3OKDB 4LP5A 4P2QD 5IM7A 5GGQH 3QRFM 1I4FB 1FO0H 4XAKD 4YDLC 3GHEL 3HMWL 4GAGH 5CJBA 1AR1C 5CFHA 1HDMA 4X80H 4HK3J 3P4OA 3C5SB 3GSWA 3HC4L 1OHQA 5DSCA 4F7MB 3WS6A 1MFCL 3SKJL 4L8SA 1HSAA 2VQUA 3AREC 1GGBH 3LB6D 1QFHA 4GMTH 5FF6A 4OQTH 4AL8L 4XVTH 1P69B 1T21A 4WWKC 1OD9A 3OKMA 5D71L 3F7PC 3IFLL 3ULUL 3ZE2F 2M8XA 2FO4B 1QP1A 5A2IH 4JFFA 1GGIH 2E6QA 4QY8A 5DQJA 3OXSA 3F6IA 4YDKH 3SBWA 2IMNA 4POZC 2V9TA 3TA3D 1HHHB 4JPIB 4YZFF 5I76A 4KJQC 4F7PB 4KI1A 2EDWA 3N85L 3KPRB 4MAYA 1UVQB 3Q5OA 2GY5A 4LCIL 5CUSH 4FZ8H 3RWFA 5FM4A 1WV7T 1TQBB 4JFOB 1PX4A 2P5WB 2PUQT 3QEGL 3MNZB 3WKNA 3LPGA 4JFEB 1U8QB 1BIIA 3O3DB 5I74C 4M48H 3WFDH 3T65A 1JZ3A 1I3UA 5DJZA 3MROB 5HHXL 2PW2A 2YSSA 4LFHG 3QXTA 4MNGE 3U4BL 4XXCA 4FQJH 3CFBB 3VFVB 4OZ4A 4E9LA 2VZSA 4Y16B 1OB1B 4NDMA 2D0FA 1OGTA 5SWSD 3MBEC 2X6MA 2IH3A 4KJYB 3L5JA 3P77B 4J3UA 3LB6C 1IARB 4N8CL 2P5EB 4A6YL 4JDVB 2KQMA 4HPOH 1E28A 1KEGH 4LPCA 4PGCB 1P4LB 1I1FA 3E6FB 1ZHKA 4AM0B 1N6QL 1KJMA 4ZAKB 1QA9A 1FLRH 1T04A 4L4JA 1V7MH 4NZRH 2OLDA 4HZLA 4NRZB 2V17L 2OQJB 3EGSB 1JHKH 3TA3C 2O5XH 3VFRA 2YPKA 4PLJD 2J88L 1D5ZA 4QOKB 5E99L 4G80B 1I8IA 1MAML 1NC2A 1J12A 4G6JL 5LVEA 2A6KB 4IOIB 2Y36H 3AB0B 2NW2A 2OL3L 4JPKH 1Q0XH 4G6AC 1QVOA 1AC0A 1OARL 3C60B 2GCYA 3BP6A 3IETA 4NO0A 2P8LA 5A40E 3IDIA 3MUY1 1JGDB 3MV8D 4JHZA 4PGDA 1DLHB 1JNNH 2HFTA 4X4YB 5T1KB 1S7TB 1CICA 3EJYC 3VXUB 1D9KA 3ARFC 4TUJB 4K3EH 1ZOXA 3BW9A 2FLBT 4KMTH 3KYNB 3S96A 1KENH 4OJFL 3HAEA 2MJWA 1A3RH 4GLRI 3DWTA 2R0ZH 1IAOB 4KVCH 5I18H 4JDTL 2WINA 4PJ8C 4HWEH 1CE6B 1EHLL 3MC0A 3WS3A 5BOZG 3WN5C 3NABH 1LEGA 4NNPH 5INCA 4JHWH 3RNQB 2DLFL 5JPNA 3Q0HA 5C0BB 2ATPB 3C08H 4ZD3H 5T33L 4GAYB 1Q9WB 5C0JA 2DI7A 4RAVB 4TSBL 1XR9A 1PLGH 3VXNA 5I8OL 3MOBL 4R3SB 1CR9H 3RDTB 1XAUA 4QHUA 3PV6B 2OR7A 3SKMB 3RVXD 1DDHA 1KC5L 3MXVH 3N9GL 3VXRA 4GS7B 1DBBH 2DS4A 5TF0A 4CW1B 3LPWA 4F9PA 4FFWD 1H0DA 5BS0A 4JO4L 4GMSL 4MA8H 3VXRE 3B2VH 5D2NA 1LDPL 4PG2C 3A6BL 4YEEA 4FG6D 5T1MA 3SKOA 5BS0E 3MV9A 3HG1D 4MJIA 5F7HA 4XWGL 4NPYB 5EUOA 1SYVB 1X7QA 5D2NE 1U8IB 4PRNB 3DVNB 1XF4A 4HGWB 4UZGA 4KUCF 4OCWH 4FQPA 2E9IA 4O2EB 3FZUC 5FKPB 4Y4FB 2VLJD 3MLXH 2DMCA 2Z31D 4L1HA 1CLCA 1FL6B 3MJ9A 4RFOL 2ARWA 1FGVH 1NC4A 4Y5XA 1IGYB 1GL4B 1QFUH 3OAZK 4N0CC 4NHUA 5EOTA 4RGNC 4ZSOB 4NQCD 1FBIL 4X7TA 1NDGB 2VOTA 2GJ6A 1DQQA 4ZOEA 5F7WC 1ZVHA 5F96L 1VERA 4LCYB 2ZUTA 2AK4D 4LLYA 3LKQA 3IDUA 1KJ3L 3W39B 1IGMH 3SDCA 3HUJA 4H8WC 3QAZB 4OT1L 3KHOA 4M7KH 5L88L 2LABA 4HKBA 3HUJE 3ROLA 4YXKH 1INQA 1AGCB 1JNLL 4U1LA 4XNUH 4OZIB 4H1LH 3RIAF 1EIBA 4J4PC 1VENA 12E8L 3MRMA 4FG6C 3QCTL 4FQ1H 3THML 1PSKH 3HE7A 1QSED 2RCSL 4IS6B 1NH6A 4HQQL 1BGXL 5ISZB 1L0QA 1KTDB 2BOBB 1L9NA 1AC6A 2IF7A 2V2XB 5JR1L 5IB5A 1YEDB 1JYXA 4WV1C 2UYLB 5INDA 4L9LC 3QQ9C 4WO4C 4K07A 2IALA 3Q48A 4QRSA 3SGJA 3W0WB 1DBKL 1NBZA 4PG9A 5DUMH 3TYGH 4PJGA 1S7RA 2FEEI 3IDXH 2EDYA 3VXMA 5L2JA 3T0XA 1G7PB 3CPLA 3ILQD 1P7QD 1ZA3B 1F4YL 3QIWC 3S6CA 4KUCD 4GH7B 3TO4D 1S78C 2XA8L 3RVWD 1VFUA 3VXME 4JQXA 1G7JA 2VDNH 4I18A 4ONFL 5ECJE 4NWUH 4L8DB 1FN4B 2DDQL 4J3XA 4XB7A 4Y4KA 3B9AA 4R6UA 1FCCA 3M8OL 4R96A 1I1AB 3X14A 4XHJD 1ZSDB 3S3PA 2ILLA 2UZIH 3QO0A 5MI0B 4C58B 3RTQB 2BY2A 2YEZA 3BP5A 3RJDA 4QXUL 4LLQB 4N8VG 5DHVH 1FFNA 3H6JA 4PR5A 5C09E 4PJ5A 5HTSA 5AUMB 5E70A 1YY9D 4IOFD 5DEZA 3EOBA 1RURH 1S5IH 5I9QB 4ONGL 4TVSa 4PJ5E 1SEQL 1C1EH 3DROB 4XBGA 3V5KB 1TTGA 2F19H 3OR7B 1PYWB 4QRRA 4HV8B 5IR1A 4F2MA 4UILL 4XPAL 4N8VB 4K7FB 4YHIB 5DT1H 1P5VA 4LIQL 4U0QB 4QRRE 4OV5B 1JRHL 3PP3K 4P46D 1GAFH 2BMKB 3EZ8A 1EO8L 4OZGA 1RUML 4GG6F 4WU7A 3HMXA 4WEBL 4XP6L 2P43B 3U9PH 3TPUB 3BP4B 4JG0L 3IF1B 3H3BC 2XY1A 2YD2A 1EZVY 1RZKH 2DBLH 4WGWB 4MX7B 3X17A 4MA1B 2W65B 2VIRA 3HE6C 5D9SB 3OXRB 4C54A 4DVBA 1RU9L 4J3TA 2AQ3A 2HA1A 1A6ZB 2NY6C 2W9DL 4TUKH 2K1MA 1RUQL 5DLML 1JVKA 1ITBB 1MJ7H 2APBA 1EDQA 4RAUA 3FQNA 5LXGL 4DKEL 1BREA 1GPOH 1H5BC 5EO1B 3OAYK 2XOTA 5I8EB 1GOHA 2QTEA 3HFML 4JFFD 4XCNA 2VR5A 1AGDA 2D2OA 2AXGB 5I1AB 4M02A 2VZ3A 4K71C 3KR3L 2NCMA 1XGTB 4QNPE 5T3XE 2CK0H 5LG1A 1CDYA 4FQCL 1LGVA 4MAYD 1W8NA 1QHPA 3ARWA 4YE4H 5TGBA 2QQLL 5CMAB 3V4UH 4FQIH 5TJWK 2F5AH 1YY8A 3UZQA 4RDQG 1QFWH 4MXVE 2YA0A 4WW2C 5KN5A 1B0WA 3S5LB 1XZ0A 5GGRY 5IESL 5ID0A 1I8MA 1OPGH 4YC2C 3RZWA 1KN4H 2OS7A 3BZ4A 2Z8RA 2Q6WA 3T0EB 4J3VA 1U6AH 5BCAA 2FL5A 4HFWA 2FYYB 1PVHA 2OMNA 4XPTL 4HUVA 3CSGA 2BVOA 1KT2A 1E4WL 4G8FB 5JW5B 3C09C 5HDOA 4OZFH 4A2MA 1Q9OB 1CK0L 1K6QL 1LO2L 1QSFE 3C8HA 1JPGA 4LBEA 4LPTA 5EIIA 3MRRA 3ARYA 1NQBA 2BJML 4YBQC 3RI5K 4MQXC 1RZGA 4LU5H 3WKML 4QHKJ 4NYLA 4JN2A 2G5BB 2NY0C 3RX8A 2IPUK 5IKCB 3DIFB 3SDAA 1I8KB 3PIQB 4ZYKA 2PYFB 1DEEA 1TFHA 3H3PL 1RZ8B 3VDCA 1GGUA 5EUOF 3VG0H 2HMID 3MA7B 3D6GA 1CL7L 1E4KC 1NC2D 2ZKHH 5DMGC 5D2LB 3PG2A 1FVEB 4PPTA 1MCLA 1TQCB 1W72L 3IDNB 4I13B 4MAYC 4I8DA 4FS0A 3KVQA 4G6KH 5DUBA 4YXLH 4KMLB 5DJ8B 2VL5A 4DKFH 1P9MA 4NO0D 3DARA 4AK1A 1T1XA 1CE1H 1L7IH 2Y7QB 3E8UL 1NMBH 2A6JB 4TTDC 4PYGA 1I75A 3O2VH 1P4BH 3QIUC 1GSMA 2MTPA 3TBWA 3QG6A 4TSAH 2ZUYA 2YC1B 4MD0A 5GZOC 1CICD 2VLKD 2IPKA 2YMXL 3STLB 1D9KD 4JO2L 3FQUB 3F7VB 4X6FB 5E8EB 5DO2D 1FL3B 1P7KB 1BWMA 5JMRA 4O51A 2QADB 3PQYE 3HI1A 1YEGH 2LFGA 4XPFL 1RZKC 3ARXA 1AGFA 1KPVB 3QH3A 3VWJB 3IVKA 3MNVB 3EDEA 1A5FL 3CFCL 4P9HH 2DKMA 4OFKA 3C5JB 5EIVA 3KPMB 2MQ3A 3OB8A 1F11B 1HHGA 3OJ2C 1MI5A 4U1NA 2MCG1 1LO3L 1A9BB 2XNAB 5MHSE 1AO7E 4DK3A 4AY0A 1BLNA 3MCLH 2FATL 4YO0B 3QUZB 2GHWB 3C87A 4HG4J 3MGOB 4IIQB 2XA3A 3IU3A 4QRPB 3MLPA 3VXRD 1J0HA 3ILPA 4PRIA 1KBGH 1KPUB 3QUYB 5BS0D 2NY2C 5A16B 5D6DA 3BFOA 1IT9H 4NO2B 5KOVC 3ULVE 1WJ3A 4UINL 5DK0B 1UB5B 5CIPH 4OKDA 2AI0L 3MV9D 4MJID 1G9ML 4MB4A 1DLFL 4PJGF 3MODH 1UKSA 4LSDA 4G9DB 5ALCL 2E6JA 3QEUA 1A3LL 1OY3B 3MX0A 4MVBD 3DSFH 1WEJL 3EJJX 1P53A 3MYJB 1YEKL 4OLYL 1C8PA 5F97E 4EZMA 5HGBB 1B2WH 5F9OH 1NPUA 1NC4D 5ICXB 5TF1L 1NGQL 1XF2B 1MCPH 1GC1L 1LO4H 4WFED 1WBXB 3WBDA 2HLFD 1AY1H 2YBRB 3WJJA 5KAQG 3HI5H 3QIBC 3K8MA 1J8HB 2GJ6D 3SKNA 3F5WA 1DVFA 3HPLA 4OLUL 1X5FA 1QPXA 1UG9A 25C8H 5KW9H 3FAWA 1NBQA 4Q0XL 2M2DA 1XGYH 1ZHBA 1MELA 3SDCD 5J3HD 4HT1L 3ZT6A 4LLDB 1NCBH 5LCVH 2ADJA 5D6CB 4NKIL 2G5RA 1SVZA 1A7RL 4JO3H 1V05A 2MHAB 4OZGF 4Q9QL 1QBLL 2I9TA 3X11B 4F9PC 3UTSE 1DBJH 3B9VA 4UTBL 2OI9C 3WSQH 2CXKA 5D7IB 3ARGA 2E9BA 3PL6B 3PV7A 5BZDA 1K2DB 4PJIA 3AMKA 4OD1H 3HE7D 4LSVH 3EKCA 2X1PA 4U05A 1MREH 5BJTA 4PJIE 4HBCL 2DAVA 4UQ2A 1JI2A 3ESVF 1G9EA 1NGWA 3LCYA 1PG7H 1INEL 2APVA 3V4VH 1OAZL 3FT2B 4IRZL 2VC2L 2XWJA 5HHQA 5GQBA 4D94A 4Z7NF 3PWVB 3VXMD 4PGBA 1KEML 4O2FB 3C8KA 4PJHF 5GS1A 1FFOA 3DRTA 1OTUC 5IVXF 3BIAX 2D03H 3RWIA 4ISVA 1CCZA 3BN9C 1XGPA 1XCQA 4GRLC 1RY7B 2VE6B 2XT1B 1N3NB 4Y4KD 1YNTA 3TBVA 3H2WA 2Z4QB 5C08A 4CN4A 4P5TC 1J10A 3IJHB 3S88H 5E6IC 3RL2A 1OSPL 4D0CB 5C08E 4QCIA 3E2HC 4PJ5D 4RX4A 4C83A 5I1LB 2XZAL 4FQHA 4L4TA 1BF2A 4BUGA 1CGTA 3SDCC 3V5HA 4JAMB 3SCMA 4M1CC 4NUGH 5KVEL 2ERJC 3SOBL 2MMXA 1MQKL 2AQ2A 2ADGB 4L4TE 3O3UN 1JI1A 1Z9SA 5DURB 3RY6A 1L6XA 3CDFA 5IBLD 2R2EA 4OCYH 4QRRD 4X6DA 2EIZA 4UMGA 3DHMA 3ZDYE 1SYSA 1UB6A 1B4RA 2XZCL 4F37F 2VZVA 2P24A 4X7SH 2OTUA 4BSVB 3QQ3A 4JFZL 4Z0XA 3HE7C 3MRLB 1OTTC 5A1AA 1R24A 5D1XA 2WANA 4PJDB 1S7QA 4XP4L 4C55A 1YPZB 5K9QI 2BSRB 5JMOC 4P99A 3JV6B 2AGJL 2OJEB 4JPWH 2FB4H 4MLSA 2N56A 4QGYA 4CVZB 4YDLB 1RHHB 3R1GH 2W60A 5I17B 3QYCA 2JK5A 1JCKA 3ROOB 1KIPA 4M8QA 4J3SA 4U6HB 4U1IA 2GT9A 4L9DA 4B41A 2JF1A 4JQXC 3G5YA 1A7PH 4KUZL 4KV5F 2GAZA 4QXTB 3PNWA 2HJFA 1IKFL 4Y1AA 4XBEL 4OCLC 2PN5A 1P1ZB 2V5MA 3AREB 5F3BA 4EI5A 5T3XD 1TVBA 2NY5H 3SJVE 2ZG2A 4OLZL 4H20L 3T4YA 4KK6D 4N90E 4WWKB 3VRIA 5HJ3B 3W81A 4LSUL 3WFHA 3TCLB 4K9EC 4K3GA 3WFCH 2BSTA 4FQLH 1RZJL 1C5DB 4PV9B 2CXGA 3KPNB 4OD2A 5CCKL 1HCVA 3EBAA 4L4VE 2DWEB 4OI7A 3GHEH 5KVFL 3REWA 3MCKB 1NFIB 4QTIH 1YC8A 5K59F 3MCG1 1BMGA 1HQRB 1OCWH 1PQZB 3HC4H 5GGSA 4PB9L 1F6LL 3TH3T 3RVVD 2P8MB 5C0EA 3PWJA 4JFYA 3F7QA 1HQ4A 4OZHE 5BVPH 5KANI 1MFCH 1WWCA 3RHWK 4XWOC 3DV6A 5EIQA 3SKJH 2WAHA 5DD3H 3Q5TA 4PLOB 4FABL 5ESVB 1WITA 1NGZA 2C1PB 2XTLA 1T1WA 5A2LH 4XCFL 5FGBC 3FN0L 4AL8H 3LV3B 1JZ7A 2W59A 1I9EA 4F7TA 4L3CA 4Y2DD 3GSNA 2IFGA 4WFFD 3I6KB 3IFLH 1LP9B 4MNHA 2XKUA 4YIQA 2F8VA 3OKNA 2Z35B 1EFXB 3U79A 1KELL 2FGZA 1SM3L 3RWGB 4XPBL 3GUTA 2FEEL 5C0FA 3BDXA 3MBEB 5JIHA 2CLVB 3ULVH 2NY3D 1NBVL 3SDAD 3N85H 1FPTL 1YYLL 3HA0A 2VXTL 5GGVY 3BQUA 4LCIH 1UJ3A 5AG8A 4Z8FH 3BDBA 4J6RL 1MFDL 1MHHA 3QEGH 3VD5A 4UDTB 1FV1A 3V0VB 5BRZE 2DQUL 3MGTA 3BKJL 4NWTL 1RMFH 4UOW0 1I85A 2OBGA 2E5EA 1OW0A 3QXAB 4U2YA 1JN6B 3ARSA 3NN8A 3TA3B 4X5XB 4PTTA 5D7JA 1BIHA 3K46A 3L3OB 4Q9BA 5FDYA 1F3RB 2N7AA 1M6OB 2C3VA 4R4NC 2R1WB 1C12B 3CXDL 2M26A 1A4KB 2ZG1A 4PS4H 5C86A 3IGAA 1FIGL 2X4OA 3GMQB 3DRQA 3QFJA 3H9HA 1FGNL 4P59L 2VXSL 3ETBF 3PWPB 4S1DD 5C71A 1LMKA 3MRCB 1DFBL 2OMBA 4N8CH 4OIAA 4ZUVB 2EDQA 4A6YH 4DKAA 1FO0B 4ODVL 2HVKA 1X9QA 1XH3A 3SE3A 3GRWH 4MD4A 3ARFB 5E5MA 1MI5D 2ICWI 1ZLVH 3W2DH 5JZ7C 1N6QH 4BQ6A 4G9FA 1X4XA 4ZO8A 2R9HD 5EN2B 3M17B 4HUXB 4XRCA 1VADB 4PGEB 3FOMB 4HAFA 3O6LL 2V17H 4JZNB 4JQIL 3BGFC 5SWSB 3MJ8B 4ELMF 4PJ8B 5IG7A 2HJKB 3E0GA 2NY3C 1T3FA 1MAMH 1ZLSL 3WN5B 2FSEA 3QULB 1Q9LA 4G6JH 5J11C 4HS8L 1S7WB 2AEQL 3HZKB 5CJOL 2NY5C 3QXWA 4X6CA 3DUSA 3G04B 4Z7WB 2OL3H 3LQAL 4HDIB 4PRID 1OARH 2DIJA 3N1GC 4NM8H 2ZPKL 4O2CA 2Q76A 3GZKA 3KPQB 5I16A 1NCDL 1A4JA 1EHNA 4PJFB 4FZEL 5FECB 1XGRB 3QDAA 1CLOH 1IE5A 1NEZB 4WUUA 4UDUB 3GMRB 1AXSA 1LNUB 1WSST 2GTWB 1R3IL 2WBKA 3OWEA 2VKWA 2VDRL 4KK9D 4WUUE 1QACA 1VGEL 1KLGB 1YMME 1UZ6F 5CP7B 7FABL 1UENA 2J1KA 4KZEH 5DJ0A 4I77L 5GZNC 4ZUTA 4D3CL 1JUFB 4UV7L 1KTLA 3RGHA 4JDTH 1U41A 1EHLH 1R3KA 3VGGA 1LEIB 3RA7L 3ORJA 1IQWL 5F9JA 5CJXA 3FCTB 1RVFL 1IM3A 1MCJA 1RIHL 2DLFH 3ARBC 5KOMC 2EH7L 5HY9B 2UY7A 2V5RA 3IRPX 4D8PA 1T2XA 2YPVL 4W70A 4TSBH 2QSTA 5I8OH 4RGNB 1WT5A 1MFAH 1KC5H 3N9GH 4X6DF 5IF0A 1FYTB 1FAIL 1WFTA 3DX6A 3VI4F 1YJDL 2FJGA 1QBMH 1Y0LB 3FFDB 3MRPB 5LQBL 2CKNA 4JO4H 5FIEA 4GMSH 5DI8A 5LKNA 2DLIA 4R4BA 4JHAL 4ZOAA 4FRWA 1LDPH 3A6BH 3BEWA 3ULVC 3HNTL 1XGQB 4ETQA 2AV1A 3FT4A 2AP2A 4ALAH 4WHCA 1KIUA 1QRKA 1ZVYA 3ARGD 1AXTL 2VL4A 1KXTB 2X4SA 2DQFA 1LK3H 2H2PD 2X70B 3V5DA 3HNSL 3O4LB 3P4NB 4RFOH 3P11L 1U42A 3X12B 2ZOKB 5K9JL 1YEJH 2XKNB 1J88A 5M94B 1S5HB 4NC0B 1T2JA 4LLMA 2GSIA 4HIEA 2CJUH 5DA0B 4OM0H 3TCXA 3BIKB 1A1MA 2DQGH 4ZS7L 3VDAA 5IBTL 3PDOB 5ADOH 3K1KC 5E2WH 5F96H 3DI2B 2BSSB 4WV1B 4WU5B 2P7TB 4L9LB 4WO4B 3NFPB 3BWAA 2QJDA 3H0TA 2VSCA 2EIEA 5SV3A 3WJJC 3DBXB 3FQWA 3P9MA 3QXDA 3AU1A 4ZXBA 2G2RA 5C08D 1XIWA 3UYRL 1KJ3H 4LCCA 1CFVL 1DVFC 4U1GC 5FGCB 3QIWB 2EYTA 5KZCB 2IEPA 1QYGL 4RX4D 4NQDA 3KDMB 4U6TA 4PTUA 1F5WA 5EZJA 3SCMD 5DC4B 1T7WA 4NO5B 3ZKND 3FO9A 4S2SA 3OHXA 4NQDE 5I71C 4BQBA 3MJ7B 12E8H 2FJHB 2FHCA 4LQFL 1J0ZA 1HKLH 5HPOA 2E27L 1DQLL 2I60L 1MCHA 3THMH 1NCUA 2V2TB 1YNKL 1FNGB 4FFYL 5E24E 4XC3H 1BGXH 1AFVL 5E8NB 5EBLA 1GXEA 2ZNWA 5B38B 4CU7A 5FXCH 5JR1H 4XPHL 4IMKA 4GRWF 3L3KB 1AGBA 1CGYA 4LVOC 5D1XD 5CGYD 2H2PC 1IL1B 1UWGL 4LDOB 2A6IB 1OP3K 2FIKA 5AAMA 5JTWA 3TO2A 3V2AR 3BPCA 4E42A 3WDIA 4LNRA 2RFXB 4FMFA 4P48A 3PWUA 1ONQA 2Z92A 5F7UA 1BJ1H 4KGLA 4XVSL 5E0QA 4GG8A 1U8MB 3Q6FB 1JZ8A 3TYFB 5IEHB 1FZJB 2FHBA 3MQIA 5J4MA 1GOGA 3D39A 2HFFB 1R3HA 3PJSA 3HE6B 1CD1A 3UJJH 1ORQB 1TZHB 1MOEA 4Y1AD 2CGRL 4NN5C 3JVGA 4L29B 2BY0A 5HVGB 3VFUA 1A6VL 1CTOA 1VFMA 1EEZB 4PJCB 3ZE1E 4EI5D 2X1OA 3UPRA 1P7QB 1HNFA 1Z9LA 1S7XB 1MF2L 3PHQB 2C7UA 2R0KL 1FJ1B 3TJHD 2LE9A 2WWMD 3FB8B 5D5MA 4ZQKA 1H5BB 1DUZA 3VJ6B 4YHLL 5MENA 1IGJB 4NQSA 3SCMC 3OX8B 3IFPB 3NIGF 4NHCL 4UILH 4XPAH 1N2RB 5H2BB 3WFEL 3BMWA 5D5ME 4KRNA 5MENE 4UU9A 3NCJL 3RY6C 1JRHH 4K71B 1MLCB 3O3AA 5DFWH 1EO8H 1RUMH 4LLVA 4Z7UF 1HSBA 4XP6H 1F58L 3MLRH 2YOCA 4H1LG 4PLKD 4UV4L 4Y5VA 1IGCL 2IH1B 1H3WM 1ORSA 1CD0A 1JYVA 2R29L 5FOJA 4OLVL 4PRPE 5CGYC 4PJEA 5GGTH 4CKVX 4WW2B 1SJVA 1NGXB 1CFSB 4F7CA 4EJ1C 2W9DH 4PB0H 2HWZL 5D93C 5IM7B 1RUQH 4PJEE 1U3HA 5DD1L 4H1LB 1HHKA 4KTDL 3C6SB 1HZHH 5JIKA 5A2KH 5LXGH 2HT3D 1HDMB 1YECL 4DFHA 4Y89A 3DNKA 1A6UL 4OFYD 2ADFL 4X6CF 3VXOA 3C09B 3KR3H 4NOFA 2JJWA 4YR6B 3KPPA 4MMXC 2ADIB 3UTTE 1HSAB 1PKQE 5I1CL 5ABDE 2VR4A 4FQCH 3RUGF 3MO1B 1X6NA 3BQUD 1D6EA 3DMMC 1AKJA 1JPST 4PBVC 4NKMB 5TE7L 1T21B 1GHFH 4N0UE 3TJHC 2VN4A 1REIA 4XAWH 5HPMB 3S98A 2W0PA 3WNMA 2NY0B 1IAII 3W9EA 2ZUVA 3OXSB 1HN1A 1TDQA 2VITA 3C5ZC 4RAHA 5T5NG 5D7JD 2XZQL 4BA8A 2FWOA 4HULB 4ZTOL 5DK2B 4NKDA 4BJLA 4GBXA 4MAYB 3WDHA 2WMPA 2JJTC 3G6DH 3MUGA 3QFJD 3MJ6A 4M6NL 2DBJA 3ZDZE 2WBJD 4I1NB 4Y4HA 5GRXG 1CK0H 1K6QH 2FD6H 1LO2H 3GGWA 4WW1A 4F8QA 3UBXI 3QIUB 4MNGB 1HEZA 4DGIL 2BJMH 2VABA 3QHFL 2YSSB 4JE4B 4AENA 4LVNC 1HKFA 2P47B 4Z7QE 1U95B 4LLWA 4G9FD 2HN7B 3CDCA 5EU6A 4QTHA 1I7TB 2G9HA 4CL7A 1RIUL 3B4NA 3NCYS 2IBZY 4IM8A 4NDMB 2EZ0D 5EU6E 3CGTA 2IH3B 4FTVE 5CJ8A 1P2CB 1UJTA 4ZO9A 3L5IA 5FA3A 3O41B 4Q74A 2VERN 5I1EH 3BQUC 4YGVB 2DKSA 5JDSA 1E28B 5HYJA 5I75C 1A2YB 1UJ3C 3BSZH 2DLEA 1HH6B 1F4WL 3E8UH 3VD4A 4XX1G 2X9YA 1XCTB 1EBPA 1T04B 1NDMB 4WUUD 1F3JA 5CEZD 1CXIA 1NANH 4WFHD 4L1DA 3VFRB 5D7JC 1EGJL 2YMXH 2YPKB 1MLBA 2NY2B 1D5ZB 4JO2H 1I8IB 1NC2B 4P57A 1UZ8B 4JY6A 3BX7C 1UYWL 3VW3H 3OPZL 1TJIH 1K4CA 2BNRE 2JB6A 5CINL 1RK0B 2XN9A 3EFDH 5IWLC 4PJ7A 1TCRB 1QVOB 1X4YA 5FHBL 4CADA 3IETB 3S9DB 3CFCH 4F57L 1GZPB 3IDIB 4PJ7E 3WDJA 2XACC 4HWZA 4CU6A 43CAB 4KC3B 3ES6A 4D0BB 3Q6GL 1CF8L 3O3BA 2OM5A 4U1SB 1O0VA 4LSSL 3SE3C 4LKXB 4JFDB 4UB0L 3TIDA 5HVWA 1AQKL 3E3QE 3BW9B 2FATH 2HRPH 1YEIH 1ES0A 2P1YA 4E41B 3QNZA 3OJMB 5IFJA 5FV1L 5LGKA 3BHBB 1UWEH 2CDFA 3QIBB 3CMOL 4KROC 4OZFB 4UINH 1LEGB 3IU4L 1HIML 3ZKSD 1K8IA 3TVMA 4FXGA 3EDDA 3BH9A 3IDMA 1G9MH 2X09A 3LSOA 3U4AA 5DRNA 2COQA 2DD8L 3BGAA 3O45A 4PY7A 5CZKA 1A6TA 5ALCH 5C0JB 2CKBL 5DGRA 1LO0L 1YDPA 1WEJH 4S10A 5E2TL 2CIIA 3ME0A 5TDOA 4QHUB 2JCCA 1F2QA 4NM4L 4RGMC 1DDHB 5DJ6B 1YEKH 2GW5A 4AQOA 1ZGLA 2DI9A 1LE9A 4M03A 4POYA 4ODWB 1BD2A 2P4AB 1OAUH 5EU5B 2OI9B 2X40A 4GKOA 3NIFF 5T1MB 1U36A 1QO3B 3MBXL 5HHOE 1A9EA 3CX5K 1CDCA 1GC1H 2Z8SA 4JVUA 3CFEA 4A2LA 2R4SL 3MRHA 2QQKL 3QO1B 8FABB 3BUYA 3LKSA 5LGJA 1U58A 4FQQA 3V6ZB 3OKDA 1J0KA 3P9LA 4FFZH 4ZXBD 3NIDE 1MJ8L 4Q0XH 2E7CA 2H2SC 1XIWD 3OKKA 1MEXL 1X5HA 1R5VB 2ICWJ 1WT5C 5FYJU 1A7RH 1BVKA 2J8UF 4NQDD 3VWKA 3C5SA 2BNQE 2FJFB 4GRLB 4Q9QH 1QBLH 1Z0MA 2I27N 5T3ZE 4F7MA 1FP5A 3QUXD 3A0OA 4YX2L 4P5TB 2GITB 3DECA 2A0LD 3DURA 4PRDB 5E6IB 4DGVH 3E2HB 4BH7A 4ODSL 4ETYA 3SDCB 1OL0A 2ERJB 3B8YA 1EZVX 2UZYB 2KH2B 2NY4D 4HKBB 2W9EH 3NPZB 4DUWA 1OAZH 3ROLB 4FNLH 4IRZH 2VC2H 3NZHH 2H26B 1INQB 2FO4A 1G7MA 2XXCB 5CEZL 1KEMH 2B0SL 3QCVH 4G6FB 5SX4I 3MRMB 1YEFL 2LTQC 5FYJL 3EYVB 5F6HI 1VB9A 1HHHA 4JPIA 3HE7B 5CIPB 3CDGA 1UT9A 2RR3A 3KPRA 1UVQA 4HJJL 5BQ7B 1OQXA 4RFEB 3D39D 5IB5B 4JFOA 3AROA 3QI9C 4P23D 4JFEA 2IALB 4QRSB 4KJPD 3QUMA 1NBZB 1OSPH 4OGYL 3UTZB 4YHML 1S7RB 3O3DA 4GLRH 1MRCL 3VXMB 2VDQL 4RBPH 5L2JB 2XZAH 4AEIL 2N7BA 3BP7B 1T2QH 5D8JL 5I30H 2BVPA 2YPLE 1G7JB 1IGIH 1UA6H 2NY7L 1CGVA 2DI8A 1CFQB 1MCOL 5MEND 3MLYL 3VFVA 3KLHD 4R96B 4UT7L 1EXUA 2R0LL 4XZUA 2XZCH 3JV4A 5C09B 1MRFL 1L4IA 3AS3A 2OR8A 1UXSB 2YEZB 3JWDL 2NX5E 3W5MA 1I8LA 1NUGA 4DVRH 4KJYA 3P77A 5T1DL 1DUYB 5EPMA 2P5EA 4EXPX 2PR4L 4XP4H 3EOBB 3PGDB 4PGCA 3UPAA 4IMKC 5FO7A 5KVDL 5GJSL 3T3MF 1C5BH 5HYFA 1LE5B 4DJMA 4QRRB 5IR1B 2VH5L 5J6HB 5A2JH 4ZAKA 3U6RA 1FZKB 1AE6L 4XNQA 1U3HD 4HFUL 4F33A 2OQJA 5TE4L 5I66B 2AJSH 4QOKA 4G80A 4WU7B 3IAPA 2Z93B 2A6KA 4Q97A 5AZ2H 4XBEH 3TT3H 4S1QH 3GSOB 4KQ3H 1BFVH 4KZDL 1OGAA 2Q86A 4OLZH 4H20H 5ADPL 1KXVC 4XVUD 3JVGC 1OGAE 1ZLUH 4LSUH 3R0MA 1JGDA 4P3DB 4RWYL 4DFIA 3R06A 4JJHA 5T1KA 1RZJH 1AKJD 4N1EA 4G7YL 4HWBL 4TULH 1U92A 3KYNA 4GKZA 2LAGB 5KVFH 4I3SH 4RMUA 1AGDB 3T8XB 2CMRL 3BKCH 5L0QC 4LRIC 2XPGB 3GMLB 1MFBH 3NOIA 4MA7L 5JOPE 3BDYL 4R97C 4HK0A 4M6AA 5B21A 1NUDA 4Q9RL 3FMGL 4BFGA 2VR9A 3DXAA 3RNQA 4QWWD 1CI5A 3B8SA 4FABH 3SQOL 2QSQA 4RWHA 4XXDB 3LQMA 4XCFH 5C0BA 5DTFB 3DXAE 4GAYA 1Q9WA 2DF3A 4EDWH 4RAVA 3TC9A 2I9LA 5HI3D 4R3SA 4Y4HD 1XZ0B 3PV6A 3SKMA 5DD5L 1CG9A 1FHGA 2IG2L 2YUVA 5ID0B 1KCSL 4CW1A 3RY4A 1G0XA 3D2UA 1KELH 2QQNL 1P6FA 4K8RH 3ELAT 1SM3H 5IJVA 2FL5B 1TTUA 5DJAB 3NFNA 2EIBA 5EU6D 3QWOA 3TJEH 4NPYA 1SYVA 3JWNC 1U8IA 4PRNA 4HUVB 1FPTH 1QSFB 2BVOB 1KT2B 1YYLH 2KZ1B 2VXTH 4N5ED 4HGWA 3MYZA 1ADQA 1C16A 3JWOL 4M3JA 4O2EA 1MFDH 5FKPA 5AYUL 3CJJA 4Y4FA 2G75B 1JPGB 4LBEB 4J3OC 2VJXA 2VUYA 2JCCF 3BKJH 1FL6A 4NWTH 5HYJD 1JTOA 5SX5H 3VI3F 2KQNA 1HYSC 4BZ1L 1F6FB 1SMOA 3BGFB 4XP1L 4JN2B 4ZSOA 1LDSA 4DKDC 1BF8A 4YFLI 1VFOA 2XTJE 2NY3B 3BAEL 3QZWG 4NFCA 3TZVA 2FBJH 4HZAA 1DEEB 3CXDH 4UBDC 4M3KB 1M71A 5CZVL 4JLRB 4YQXL 4GBXC 3BYYA 2L7JA 4P59H 2VXSH 4RRPA 3MZTA 4TQEH 3TNMB 2XN9D 4JFXB 4WDIB 5DUBB 4JG1L 3W39A 3QZWB 3LH2H 2D7OA 4Z0BL 2VLLB 3E1F1 3UEZA 5HI3C 1T0MB 1T1XB 5CKAA 1R3LB 4KKCC 4CDHA 3DVGA 2AXJA 1AGCA 3FB5A 2X41A 4OZIA 4MD0B 4PJ9A 4ONHA 1IZJA 3PQYB 3ZDXE 5T3ZH 4M7LH 4KK8C 1JMZA 4O51B 3SEPA 4PUBL 4IS6A 5HI5C 1ZAGA 4GXUM 2VQ1B 4PJXE 4HS8H 5IP4A 1KTDA 2AEQH 2BOBA 3QH3B 3RAJH 5CJOH 3D0VA 5J7CC 4Z18A 3IRZA 2V2XA 3ARBB 3LQAH 1Q1JL 4TOYL 4C56D 3D9AL 4WTXA 1HHGB 1DEDA 1QBAA 4KVNH 1AO7B 4YHYC 4TNWK 5SWZA 3W0WA 3I75B 4G8EB 3TVMD 3I6LD 1MWAL 4M4RA 3RI5F 1G7PA 3LKRA 3JBG7 3MRGA 1ZA3A 5SWZE 1RJZB 3BT2H 3HPJB 1I3RA 3LRSB 3TV3H 4QEGA 1TVHA 5IK3B 4NUJA 2YWZA 1WWWX 3BE1L 4L8DA 1FN4A 5IEKB 2XKSA 5GRUL 3G6JA 1VGEH 4WI8A 7FABH 3LS5L 1I1AA 1BD2D 1DQDH 3DYMA 3G6JE 1MUJA 4X9HA 4NQEE 4HIXL 3RTQA 1IAIL 1OLZA 5DJXB 4LLQA 4JQVA 3T2PA 5AUMA 4OUUB 3EDKA 1RVFH 1F4HA 1RIHH 3QEUB 5BV7L 2EH7H 1OWRM 4KAQH 1SJXA 3T3PF 5I8CB 3O6ML 1A22B 1UWXK 3DROA 3MOAL 3OR7A 1PYWA 4HV8A 1QNZH 4KHXH 3E3QC 1MHPL 4N8VA 4K7FA 4YHIA 4RMVA 2W1NA 4RGOL 1V3JA 2EYSA 4OV5A 4OIBA 1IM9B 1YJDH 4K8RC 5LQBH 2BMKA 5KJRH 3NH7L 4JHAH 3VWKD 3TPUA 3BD5A 2X4RA 3HNTH 4R90L 4PP1C 1MCSA 4MX7A 3F5WB 3SKNB 4U1GB 1DVFB 3QG7L 4AQ1B 2EE2A 1VFAA 1A6ZA 3D87B 3HNVL 5DEGA 3TVMC 5IHLB 4GKNA 5E56A 5KS9A 4QRQA 3OL2A 4H26A 4CBPA 3HNSH 4NZDA 3KNBA 3OBAA 3EOYG 5D7KE 5KS9E 3X3FL 3P11H 4DQOH 5I71B 3UTSB 1QPPA 3TBSB 4HJ0D 5JW3H 5EO1A 3AY4C 4DUVA 2V7HB 1PY4A 2AABH 5I8EA 1FH5H 4CN1A 2UUDH 4HD9A 5HI4D 5ACLA 1NMAH 3MLVL 5CD5C 2AXGA 3VFMA 3OQ3B 3ZSTA 2X4QB 2G60L 5FKAB 3EYQD 3KYKH 1XGTA 1IC7L 4LL9A 5JPMB 1B6UA 5EC1A 1TETH 4LPWA 4EKXA 4LVOB 4BQ8A 3KPRD 3WD5L 3CXHK 2IANA 3IXTA 4RCAA 4UQ2B 1S7VB 2A9NH 1BWWA 2UVEA 5CMAA 1I9RL 1L7TL 1V5JA 2P5WD 4JFED 4XCCH 3ALPA 2IANE 1QYGH 5FHAH 4LAQL 5HHQB 1CGUA 2WM0A 2FZ3A