4LL9A

Crystal structure of d3d4 domain of the lilrb1 molecule
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
196
structure length
194
Chain Sequence
b'VSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukocyte immunoglobulin-like receptor subfamily B member 1
publication title Crystal structures of the two membrane-proximal Ig-like domains (D3D4) of LILRB1/B2: alternative models for their involvement in peptide-HLA binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 194
sequence length 196
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ll9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ll9A01
3DRQB 5I1DB 4JY6B 4KU1A 3VXRB 4WNQB 4QRPB 1G7IA 3C8DA 3U36A 1II4E 1HHHA 4XP5L 5IM7B 1NUNB 1EGJH 4L1DA 1HK6A 32C2B 4N9OB 1LEKA 1MEXH 1B9ZA 1W2KT 4O2CA 3U7AA 4NBYB 3FN9A 4OFIA 1BFVL 1TFHA 1WGOA 4IOFD 3WE6B 2IBZY 3T0EB 2OTPA 4U6HB 5LGJA 3F65A 1WEJL 3PWJA 1NANI 2W38A 2R56H 3QUXA 4NSKA 5EZJA 4NN6B 4PRNA 5D7JA 3OV6A 4ELMA 3D39E 5C09B 1CICC 3VH8B 5TQ2L 4JO1L 2JIXD 3ARFD 3STZB 1FL5B 3SJVD 2V6HA 5T1DL 4BH8B 4GLRH 4KJPC 4LHQB 1ITBB 3RUGF 3RGVA 2QQLH 1JZ2A 4LHUB 3G5YB 5E6YA 1A1MA 4GFTB 4OD3H 4IRSC 1TTGA 1RULH 2PW2A 1LK3H 1MRCH 3NTCH 2VAJA 1FNSH 4QHUB 3VFGL 2CKBB 5B4MD 3SGJA 2OM5A 1EMTH 4JPKH 1YEHH 4Q9QL 1U91A 4GXUM 4NQCA 5I6XC 1QOKA 4K2UH 3PV6A 4XT1C 5KSVB 3IJSA 1CXIA 3JV4A 1JHTA 1SYSB 1RVFH 2B0SL 4MXQC 4FQQB 4HT1L 4H8WC 4PJAE 4XNQA 3TA3A 5DEFB 3ZKND 4BZ1L 3EJZD 3OAUH 3X12B 2AJUH 1BZ9B 3SDXB 2YD9A 4Z7UE 3ZE1F 1MAJA 4WI8A 4O5LH 4P3DB 5KSAC 4ETYA 4DQOL 4J4PC 2CKBL 3DJ9A 3GSUB 5BVPH 4LRNH 3SHSA 3MACH 3W39A 4PJXE 2AJZB 4MWFA 1CVRA 1FFQA 2GAZB 4Z78A 1HIML 1K9TA 2O93L 3TPKA 1QQDA 2ITCA 2K1MA 4ALAH 2QQNH 4L9DA 4G42B 4JFFB 2KBGA 3HZMB 1HHKA 5DXWA 1W72H 4P5TD 1MHEB 2B4CH 4HJ0C 5EZOH 1FPTH 2VLJA 4AEEA 3OHXA 1TETH 2N1KA 4P9MH 2FO4A 4I18B 4Z76B 2ZP0T 4N1HB 4LASL 3UTQA 5FECA 2HG5B 1IT9H 4Y4KC 5T3ZL 4U6XB 4Y4HD 2NY4B 2GKIA 1RHHA 2HFGL 2OP4L 2CH8A 5E70A 1WZ1H 4J1UA 2D9QB 4RRPG 3VXMD 4OD1H 2OTUB 4XPAL 4XBPB 5F9AC 3VFWA 4ZFGL 2VABA 3NOIA 5B38A 3JWOL 1CLZL 1NFDE 3M45A 5K59E 1G6RB 2FLBT 1WJ3A 3STLA 3T4YA 1D6EA 5F97E 5EOTA 4HMEA 4BZ2L 1NC4A 5FO8B 5SX4H 2BRQA 2DQJH 3V4PL 5FOBB 2R15A 1R5VB 4NFCA 5DUBB 2DMKA 3IXTA 1I1AA 3QI9C 3UCRA 1BVLB 1HNGA 3RWHB 4H25B 3RTQD 5FOJA 2X9YA 2VXVH 5EOQL 2KPNA 1QACA 4PJIF 4NHUB 3CFEA 1AHWC 2YUVA 3WD5L 3QCTH 5DJYB 1I8LA 3QDGE 1MCNA 1IC4L 1SM3L 3CVHH 2ZSWB 4D94A 3OR6A 3RVTC 5DYOB 3LQAC 4FNLH 1U8HA 2ENYA 3C2AL 2FJHA 3WL9A 4POUB 4E41B 1Q94A 1T7ZA 3EO1A 5LXGL 2AW2A 3EYFA 2GJ6A 4MNHA 3ETBF 3U1SL 3VFNB 1OTSC 3MNVA 4LLAA 4P2OB 3T3PF 1QHPA 5D72H 1I3RA 1LEGA 1E28A 3P3YA 1MSPA 4KROB 1YEJL 5FCUL 2ATPB 4L4TE 3BPOB 5FYKD 4U1GB 2Z8WC 1QA9A 2Y36L 2ZUUA 4OLWL 3V6ZB 4PYGA 1MFBH 4E5XB 4AMKH 4PV8A 4PV9B 1XCQB 2DLEA 4C56A 1NBVH 1NGQH 2X89D 4LCYB 3RIFF 5E2WH 5HYQA 1N4XH 4YBHA 5FA3B 2IAMB 3I2CL 4XXCA 3BKJL 4F7EB 4PS4L 3VI4F 1DDHB 1WBXA 3NA4A 4F57L 4G8FA 3CU1A 2O26U 3LZFH 43C9A 2BERA 4JPIB 3EO0B 2I60L 4KJWC 2Y6SD 4WO4D 3FFCA 3DX9A 2P5WD 5FM4A 1BBDH 3ARYA 1AY1L 1Q1JH 3RDTA 5IMKA 5ISZB 2AK4A 4HXAH 5GSVB 1D7FA 2M26A 2ADJA 2MWCA 1I9EA 5EU3A 4J3SA 1H8SA 5BOZG 4R3SB 2BY2A 3LY6A 4MS8D 5E8DL 3QULA 3BYYA 3QDJD 1AQKL 4KJQC 2AEPL 1KTLA 4UU9B 3R1GL 1OAZL 2ARJA 1NBZA 2OMBA 3QG7H 5IR1B 4WI3A 2VXUH 5GSRA 1U9KA 4L3EA 2A38A 1F3RB 5I19L 2FBJL 3VDCA 5IJKA 4IMLB 4IEFB 4P2RD 1KCVL 1E6JH 1RFDH 1J1XL 2EDKA 4DZBB 2N56A 4D0BB 4YK4B 1GIGL 4BK4A 3BH9A 4LSSH 3G08B 3O0RH 4NNYA 1NFDB 1SJXA 4MJ6B 4G8GB 2XY2A 3CZJA 5LAXB 5IBTH 4W81A 3HR5A 2FHBA 5GS0H 4MD0A 3L3IB 4ZTOL 3TBTB 1B4JH 1HQRB 4Z0BH 4Y5YB 3BDYL 2Z93B 4XAWH 4WGWB 5IB1A 3HUJE 1QEWA 5DMGD 1N5YH 2R4SH 2AEIT 4OGAD 3D39D 4AZ8A 4C83A 3WJJA 4ZDHB 2C1PA 1N3NA 1P69B 3CSGA 3L3GA 3ZHLA 1QKZL 1ACYL 2FGWH 5KSBA 4OI9A 2ZCKL 4NQSB 4IRJB 3BGMB 4NO3A 5DDHB 1FGNH 3OAYH 5JDSA 2DTMH 1J1OL 1A14H 3ARDB 4OV6F 5JXEA 1CR9L 3TZVC 1XGTB 2FH8A 1JVKA 4I4WA 1A7QH 5SWZB 3AFLA 5DK2B 1R0AL 3P4OB 1OP3H 1PQZB 5JZ7C 5AAWA 3WS3B 4KKCD 2X1WL 3MV7B 5IESL 3MA7B 5DRNB 2PTUA 4XVTH 5GS1B 4ZXBB 4QNPF 4Y2DD 4LCWE 3RIFK 2WP3T 2I9TA 1N2RA 5I18L 1I1FA 5C3TA 2XFXA 3JTTA 5GZOC 2HYMA 1WBYA 4HX1A 1CBVH 4JN1H 5C2UB 3MA9L 5CP3A 1DBJL 2OZ4A 2ZCHH 1C12B 3EOYG 1R3HB 4MXVF 1OAUH 2KQNA 3MGOA 1WZMA 4Y16D 1MAKA 5HHXH 3OKNA 2CMRH 4V2BA 1CGTA 1SMAA 3B9EA 1JGVH 3MSPA 1UEMA 3ZE0F 1FDLL 1RZJC 5DJ2B 5D2NC 4Q74A 4XBGA 1QFWL 2XN9B 4JPWH 5IK3A 1FZOA 3UTSB 2HMIC 1UH3A 2AQ2A 5JR1H 1UENA 4S2SA 5F1KC 4JDTL 4OLEA 4LLQB 2OSLB 4YR6B 4R2GC 4DVBB 2HJKA 3K2UH 4KKNA 43CAB 1FNAA 2IWGA 3AMKA 4XTRD 3WFZA 2J8OA 1MUJA 4KQ4L 1Z9SA 4GUPB 5GJSH 1NDGB 4YHNA 2CK0L 4UIKL 4XMLL 1RUAH 5B3JF 4QRSB 3ZL4H 4EDWH 1W0YT 3MZGB 4ODWB 3V5KA 5C0ND 4JKWA 2XNAA 5F1IA 4OCSH 1A3QA 4DJMA 3CXDL 3L3OB 1P9MA 5ERWB 1OP5K 2FYYA 3AGVA 3V79C 1AXTH 2V9TA 4N5ED 5DQJB 5D7IB 4MJIA 2ICEA 3ROOB 3QXDA 3PQYE 3WS6C 5I1EH 5I8OH 3F6LA 4BQ9A 2Z31C 2WLZA 4OF0A 3ES6B 4WI7A 4P59H 4OZFA 3G04A 5IW6A 2DBJA 4UIMA 4I77L 1AFVL 5F3BB 2CXKA 4WW1B 5ITBL 5KVFL 4GS7C 5J11B 1YPZA 1MCPH 1FRGL 3BP6A 3FQRB 3IDNA 4YHKL 4JCLA 2LV4A 2FX7H 3S35L 2BNRE 3IFOB 4Y5VC 3LPWA 3SDCB 1V8HA 3F5WA 2H32H 1JF1B 4JM4L 4NWUH 5FV2A 3NAAL 4MDIB 4M1GL 2Q8AL 3U0WH 3B9KD 4GRLD 5EWIL 6CGTA 4HIHB 4A2LA 4NZUL 4LCCC 5FYJD 3VG9B 5CAYB 3GRWL 4YX2H 5IFHH 4F3FB 3OXSA 1M4KA 3F62A 3MBEB 4KHTL 4QKXB 3RNKA 1H0DB 1QR4A 2B20A 2R1YB 4N0CD 4OLXL 3NCYS 4WCYH 1AKJD 4NRYB 4XNZC 1GGBH 2XACC 3VXTA 2FO1A 2YD1A 1IGJB 1FSKB 4JKKA 4IOSD 1CD0A 1FVDA 1HXMA 5CJ8A 4BQ8A 1U92B 2VAAB 1MFCL 2EDJA 4OTXL 2FNBA 1HH6B 5HGHA 4W6XB 1WWCA 3KPQB 5C08A 3V6BR 1QFPA 5EBGA 4GKNB 1KLGB 2BNUA 3NZ8B 4DN4H 1FL3B 5FDWB 4LEOB 2AS5M 2XQYK 3C08H 3U46B 4GBXA 4PYHA 4X6DF 2AERT 3FO2B 5MERB 3QCVH 3MLXH 4LVOB 4JFYB 2GHWB 5D2LB 1F8TL 3LVEA 2QEJA 5D7JD 2W59A 4M6MH 3Q3GB 2W65A 5F70A 1OT2A 1U8IB 3GJFK 4X6BA 4MZ3A 3LQMA 1X4YA 3TT3H 3VWJB 3W9EB 2H9GB 2R2EB 3VGAB 3E8UH 1JPGA 3O8XD 1CFSA 1XF5A 3IDGB 5GZND 4K07A 1OGAB 2DMBA 4Z7WF 3NH7H 4R7DA 3V5HB 2F74A 2EICA 3N85H 3DMMB 2Y9RT 5DK3A 5HVHB 2DBLH 1EGJL 4PG2A 1R24A 1P7QA 2YSSA 4X99B 2XWTB 1MEXL 2HAZA 3IFNL 1F6AA 2PYFA 4G8IB 1KPRA 1BAFH 2P5EA 5KAQG 3L3HB 3CH1A 3QDMA 3MV9A 1X5IA 4S1SL 1J86A 1D9KC 4PP1C 4F2MB 1E4KC 3PQYB 3RNQA 3GZKA 3BE1H 4JRYA 3OGOE 3JWDC 2R56L 4M6OH 4UQ3A 2WK2A 5HYSB 5IVNA 2UVEA 2W9LA 3MJ8B 3GK8L 3RL2A 4GRWH 4ENED 4QYOA 3TA3D 4BFIA 5CHNB 2GK0A 3TN0C 2EH7H 4NC1E 3T0AA 3MV8A 2Q7YA 1FO0A 2F53E 3MUGA 2ADGA 2K3TA 4HS6B 1GOHA 2QQLL 3BW9B 1U8QA 1CN4A 3MRHA 1AO7A 3GMMB 2VXTL 4WFFE 1BQHG 3AU1B 4OD3L 3VFPA 3GMRA 5DEGB 1RULL 1MRCL 3NTCL 1CI5A 1UZ8B 1LO4H 2J8UA 1SEQL 4JJ5B 3Q5TA 2WUCH 2DQHH 3NA9L 1U2CA 4JPKL 1P7KB 1C16B 1YEHL 3MUHL 2G75B 2VL4A 1CDGA 1C7SA 4N8PA 4K2UL 4U1KB 2CDGA 4Q9RH 5EDXA 1RU9L 3HG1B 2BVOB 1XGQA 2VB5A 3E2HC 1GRWA 4RISH 4DCQA 1C5DB 4Q6IB 3T1FA 1ZHBA 3VRIB 3DECA 3OX8B 3TYFA 3DPBA 3OAUL 1KEMH 1D5IH 4RGMC 4K9EL 1Z9OA 3FRPA 4MDJB 2P46B 4P57A 2VN7A 5ELIA 4G6KL 2FH6A 4NKOA 5F1NA 1YN7A 4PLJD 4O5LL 5B39G 1J5OH 4H0GA 3L3KB 4IBLT 4XVSH 4YDLB 1I75A 1NANH 5D5MB 3TBYA 4P2QD 5BVPL 1L0QA 4LRNL 4FP8L 3MACL 4WU5A 2J6EA 4TUOB 2XKSA 4QRUA 1U2HA 1YDPB 2BMKB 2QQKL 2VDNH 3WN5A 4XH2B 1L7IH 2UYLA 1NC4D 1CGYA 4XRCA 4UILL 1TJGH 1CDCA 4IOFC 5IHUH 3CC5B 1N5AA 1W72L 5JMRA 2B4CL 4XHJD 3OR7A 3TT1H 4LLMB 5T5NG 5EZOL 1TETL 5D6DC 1CXLA 1YNTA 1S9XB 3BP4A 3UBXA 5GQBA 1DBKH 2HFEA 3P0VH 1IT9L 3DIFB 3DRQA 2HKHH 4JY6A 5I1DA 3VXRA 4M6NL 2B5IB 2SEBB 1PFCA 4QRPA 1EFQA 4WNQA 12E8L 3WDJA 1DLHB 5IM7A 3ARFC 5I76B 4OD1L 32C2A 3O45B 1FLRH 3I9GH 1GAFH 1P5UA 3ROLB 1A3RH 1F6FB 5T5FH 4DWHA 1JHKL 4DFIA 1QR1B 3WE6A 1NUDA 3TFKD 3T0EA 3WEXB 2I26N 4U6HA 3K4AA 3H9SD 2OI9B 2X4RB 2QHRH 4NQEE 5B4MC 2DQJL 2OQJB 4DGVH 5ACZB 2R0KH 3RBGA 2WWKO 5C09A 2EKSB 2UWEF 3VH8A 1MCCA 4NKIH 4C56D 1QFUH 3S35X 4PJ9B 3STZA 1FL5A 4GAYB 5I16A 3RHWF 2VXVL 4BH8A 2YPVH 3LKPB 3VI3F 4LHUA 5IUSA 3G5YA 4PJ8C 5DD3H 3ZKNC 3EJZC 5F7NC 3G5XB 4M7LH 3CVHL 1EHNA 1ZANH 5J13C 3DUHA 4QHUA 2YD7A 4N8CH 4J3OC 2FJFB 1F42A 4FNLL 2CKBA 1SQ2N 3CIQA 2AK4D 4ZPVB 1YEEH 2AEWA 3OKKB 1IGFL 1SBSL 2UZIH 1GC1H 4C4KT 3MRMB 3GIZH 5KSVA 1SYVB 4NPYB 5BS0E 3HNSH 3L3JB 1SYSA 2P8MB 4LVHC 4ONGH 4FQQA 3HI5H 3QB7C 2M2DA 2D7MA 1CVSC 3D85D 1MFBL 4P5TC 5DEFA 5E8PB 4BA8A 5CKGA 3X12A 1NBVL 4JFPB 1BZ9A 2ENSA 3SDXA 1NGQL 3EFFB 5F21B 3OG4B 4G9FE 5E2WL 1N4XL 1PYWB 4OAWB 1OVZA 4TRPH 4P3DA 3WHXB 1X5JA 1UWGH 1DUZB 5T3XH 3GSUA 3K8LA 4Y4HC 2V2TB 2NY1B 2AJZA 2NMSA 2GAZA 3TV3H 4FXLA 2Q3ZA 5CCKH 2NLJB 3N50A 5TE7L 3BIAX 5ID1B 3VMOA 1Q1JL 2H8PB 4HXAL 2H6PB 4H20H 3MV01 4G42A 5F89B 4JFFA 3HZMA 1HKFA 2YZ8A 3JXAA 1MHEA 5F7LB 1Y18B 3GEWB 4QXGH 1FC2D 2YZ1A 3ZKSD 1GGIH 4AT6B 4CUCA 1JI1A 3IFLH 1LO0H 4I18A 5GXBB 4Z76A 1NGYB 3QG7L 2HG5A 4JKMA 3K80A 4U6XA 4MNQD 2PN5A 5ECJE 1DQLH 5C0IB 1E6JL 1RFDL 3SQBA 4EKXA 2DN7A 3RTQC 2OTUA 4XBPA 1CGWA 3RAJH 1IQDB 1KPUB 2FGZA 5DEZA 1BX2B 4LSSL 1LEIB 1G6RA 3O0RL 3P0YH 4V1DB 5KW9H 4H0HB 5IBTL 4JVUA 1JPTH 3MLPA 3FO1B 4XCNB 4UT9H 1KJ3H 3ZDZF 3OKLB 5FO8A 4Q97A 3ARZA 5FOBA 1R5VA 4Z0BL 5DUBA 1EIBA 4FS0A 5IB5B 3RHWK 2ICES 4MNGE 5HXMA 3EHBD 4LRIC 4ONFH 4XAWL 2NXYD 1BVLA 4L8CB 4ELMF 3HE7D 5F71A 4WEUD 2NNAB 5F7WC 2R4SL 3RWHA 4H25A 1PY9A 5I0ZA 2D7NA 4NHUA 3VE0B 1KXVC 4G43B 5LKNA 2FGWL 5DJYA 5F44A 1N64H 2F53D 1BVZA 1A6VH 4X6CF 4YLQT 1CIUA 4OZIF 3F6IA 4WFFD 2ZSWA 1LO3L 2VLLB 3AY4C 5DYOA 2YPLE 1DE4B 3ARGD 1A7QL 4E41A 1ZK9A 3V7MA 1UH4A 4F7PB 1CF8H 5DVMA 3V0AC 4LAJH 5FDYA 3VFNA 1X5GA 3ZT6A 5DHVH 3QRFM 4P2OA 4P4RB 2WAHA 4WO4C 2Y6SC 1YNKH 5JIPA 4XVTL 2ATPA 3B6SB 4LPVA 4WTZA 3O6MH 3V0VB 4LGPB 2VZ1A 3X11B 4PGEB 5EN2A 5KVEH 3V6ZA 1VACB 2DI7A 4E5XA 4PV9A 1T0MB 1XCQA 4MS8C 1KJVB 4LCYA 1CBVL 1BFTA 4JN1L 4KDTA 4P4KD 2ZCHL 4N68A 4G9FB 5FA3A 1T89C 4PJDB 1UM6H 2IAMA 1EERB 4F7EA 5HHXL 1DDHA 3QXTA 1RAMA 3S8WA 5FO9B 1CXFA 5EBMB 4JPIA 3EO0A 4JPWL 1PEWA 1TJIH 3GSRA 5ISZA 1ED3B 1FG9C 5GSVA 4KXZI 3ET9F 4YWGH 1J05B 4JE4B 4M1DH 2YD2A 5F7DB 4R3SA 2NYYC 3RY5A 4PJGB 3SY0B 1KB5B 1PZ5B 4GRWE 4QTIH 4G3YL 1RUAL 3HI1B 3ZL4L 2D3VA 4EDWL 4UU9A 1VFUA 4Z7VE 4GW5B 4YC2C 5GS0D 5IR1A 4KTYA 2NY0D 2IGFH 2BJMH 4IMLA 2E9BA 5DMGC 5GISH 4OGAC 3DWTA 1AXTL 3M07A 4FFWD 4DZBA 2ZPKH 4D0BA 2H32B 3AC0A 2W0KA 2BXZA 3VFUB 5I8OL 3G08A 1NFDA 2IAND 3NPSC 4MJ6A 4G8GA 3BQUB 2V17H 5LAXA 2P43B 4I2XB 4P59L 3QFJE 3LCYA 4JHZA 1TVHB 1DQJB 3L3IA 4N8VB 3TBTA 1S7SB 1HQRA 5C71A 1SJVA 2AXGB 4Y5YA 5BRZD 2O5XL 5C86A 1I85A 1IGYB 2JJTA 2NXZB 2WANA 3RQ3A 2FX7L 3MRFB 4Y2DC 3V8OA 1J88A 4W4OA 4ZDHA 4N0RA 2NY2D 1IRAY 4GBXD 4JGUA 5FKPB 3U0WL 2VQUA 4NQSA 4IRJA 2B7DT 2HA1A 3NGBC 1JZ5A 3BGMA 4O2FB 5DDHA 2NY5C 4Y19B 3C5ZA 3IDYC 4HC1L 5IFHL 4OCXH 1MWAB 3TJHD 3ARDA 3X14B 4Y16C 5F9OH 5JHDD 4XB7A 1XGTA 2EDOA 2DLIA 4X4MA 3VU2A 5SWZA 4WCYL 5DK2A 1IM9B 3P4OA 2JCCE 1PQZA 2Q76B 1ZLUK 1RURL 3WS3A 3MRDB 1ADQL 1GGBL 3MV7A 4RSVA 3MA7A 1WCBB 3QUZB 3RI5F 5DRNA 5B8CC 5ESVB 3JSSA 4XC3H 5GS1A 5L9DL 4ZXBA 1T0PB 2WQ8A 4OGYH 3SE9H 1BMGA 3D0LB 2EO9A 4XPHH 1CZ8H 3Q6FB 3MO1B 4OM1H 1ZLSH 4M6AA 4NN5B 4MQXD 3GKWH 2VTFA 3G6JE 4P23B 1C12A 2P5ED 5GRXG 4DN4L 3QDMD 1R3HA 4JFHD 3PNWB 1TQCC 2ZUSA 5C0NC 4JRYD 1RZKL 3ARVA 3K1DA 4P9HC 3QCVL 3MLXL 5DJ2A 4CVZB 4XZUB 3UTSA 4UV7H 4LHUG 4PJFF 1Q8MA 2PW1B 4N5EC 2VZUA 3B8SA 3LKNB 4PLKD 1DVFD 4LLQA 2OSLA 2YD3A 4YR6A 4YZFE 5ACMA 1ZHLB 5IBUG 4DVBA 2E8YA 3RVUD 1AC0A 2Z9TA 3TT3L 4Q9CA 3UTOA 2R2CA 1R6VA 43CAA 2N7AA 3BXNB 4S11A 5HHPB 1F4HA 1I1CA 4GUPA 1NDGA 3NH7L 3NACH 1G9MH 3ZHDA 4QRSA 3N85L 2G2RB 4YXLH 4K3JH 4OFDA 2DBLL 4ODWA 3ALXA 4ZUSB 2APTA 2XWJB 3L3OA 5ERWA 3P11L 3LKQB 5MENE 1TTFA 5DQJA 5D7IA 4B0MM 3ROOA 1JV5B 4HZLB 4NDMB 1OAQL 3BE1L 3WNLA 2A1WL 1QSFD 3B9KC 3IDXH 2P48B 4GRLC 2AXFB 4M6OL 5CGYD 4K94L 5E4EB 1IGMH 3GRWA 1NCDH 1MJJB 2AI0H 3UTTE 1QFWM 3D25B 2EDQA 2DF3A 2VQ1B 4WW1A 3WDIA 5F3BA 1GHFH 3U30C 4N0CC 5GS2D 3LPGA 1PDKA 4X98B 4NM8H 3LSOB 3T04D 3ZLQC 2EH7L 3UAJD 3SKMB 3MREB 1CD9B 3FQRA 2F5BH 2D4DA 3IFOA 5DHXB 4X80H 1NMCC 3SDCA 4L9LB 2R0ZH 1CDUA 4P3CL 1JF1A 2BSTB 2P24B 2D2OA 4MDIA 4LAQH 4GOSA 4FXGB 1LO4L 5T3XE 4UOW0 5L6YL 1ITCA 2DQHL 2G5RA 4HIHA 4OJFH 1FYTB 5KSBF 2PYEE 2X2YA 4F3FA 3MBEA 4JFEB 2DQTH 4Q9RL 4LF3B 3RI5K 1H0DA 2R1YA 1XGRB 1YEIH 5DI8B 3RUGB 4QRQB 2DLFH 2EXWD 4XI5D 3FN3A 4NRYA 2KDGA 4TYUA 3IS1X 3MLUH 4RISL 4GH7B 1MJ8H 1HQ4B 1KIRB 4JFDD 1WFNA 1IGJA 5D7JC 4B53A 4N0FB 4M00A 2VH5H 4FZ8H 1KEML 4QRPD 2P45B 1U92A 1DQML 5C0FB 1HH6A 4XVSL 5HBBA 1PX4A 3KPQA 4H5SB 5GZNC 1HSBB 3RGVC 1XGYH 1KLGA 4GKNA 3NZ8A 4E42B 1ZVHA 3KLDA 1FL3A 3O41B 2LVEA 5FDWA 1TTUA 4LEOA 3ZO0A 5DWUH 5D1QB 1QBLL 2X1OA 5DD1H 3U79A 3U46A 5BV7B 4OLUH 2DM4A 2VDNL 1KT2B 5HI5D 1L7IL 3DVIA 3FO2A 5MERA 3FB8B 4JFYA 4V2CB 5ICXB 5D2LA 1TJGL 4HCRL 3L5JA 4EJ1C 5HYFA 4X9GA 1EHLH 5I1KL 3Q3GA 3LKOB 3TT1L 3ZDYE 3SGDI 4PJ7F 1U8IA 1X4ZA 1F4AA 5INCB 3VWJA 3W9EA 5C0DB 2H9GA 1SHMA 2GJZB 2R2EA 4MAYB 3IDGA 4U4BA 2EIZB 1OGAA 4Z7QF 2VLRB 1DBKL 3P0VL 2NY7L 2ZUQC 2HKHL 3V5HA 4LHUD 4WUUE 4OCMC 5J1SC 3TA3C 1XZ0B 1CS6A 3DMMA 4IM8A 2FR4B 4YH6A 4Z7NF 2XZCH 3HLAB 3NCEB 5BV7L 4KK5D 4BK5A 3ULUH 4X99A 2XWTA 1FLRL 3I9GL 1FL6A 1GAFL 5GGTH 2DKUA 1B90A 4G8IA 1RZ8B 1A3RL 4ZFZB 3DVNB 5T5FL 4KZEH 4OZGF 4F2MA 4PB9H 3PQYA 4ZD3H 4CL7A 2X7LB 3R8QA 2QHRL 4L3AA 5AG8A 2VRAA 4ODUB 3GO1L 5FEBA 2NY6D 5I8KL 4DGVL 5HYSA 2R0KL 2CK2A 3MJ8A 2DM2A 3UTTB 2DQCH 4NRXB 5CHNA 2GYSA 4NKIL 1QFUL 5L7XH 3GSWB 1NBYB 4LFHG 1E4XI 2YPVL 1GXEA 2GI7A 4HS6A 3X3FL 3BW9A 1I1RA 4QOKE 3GMMA 4GG6F 2FX8H 3AU1A 4M7LL 1I8MA 1ZANL 1H3UA 4ODTH 5DEGA 3UYRL 4PLJC 1AP2B 1UZ8A 1BP3B 4N8CL 1U3HB 3MJ7B 4JJ5A 1YEEL 4U3HA 1H15B 1C16A 1P7KA 1K3ZA 2C26A 2G75A 2PYEB 1FV1B 4JFFD 5FGRA 2UZIL 2Z35B 5IQ7H 4U1KA 2ZOKB 5F9JB 1HE7A 3GIZL 5CINH 3HG1A 2BVOA 3CH8A 3HNSL 3L5WB 2VDRH 1NEZB 5HI3D 1SY6L 4PJHE 1C5DA 4Q6IA 3VRIA 3OX8A 1I1AC 1KCRH 4GQ9H 4PJ5E 4XHJC 2NY4D 3MXVH 4RZCB 1TZGH 4YNYB 2FCBA 3D3VB 4MDJA 3WFCL 2FIRT 3CPLB 4QWWD 1XR8B 4DAGH 4TRPL 4XAKD 3L3KA 5ID0B 2WW8A 3QUYD 1UWGL 5D8JH 5T3XL 3TCLB 3LDBC 4YFEA 2O5YH 2JLLA 5HHQB 4AL8H 1MFDH 2H26B 3MRCB 1HXYB 4NWTL 4TUOA 3TV3L 1YDPA 2BMKA 2BK8A 5I15L 5CCKL 1OL0A 4XH2A 2Q8BH 2CIKB 2IADB 4XNUL 3RPIB 1CDBA 1RY7B 1KEGL 1JUFB 4H20L 1QLEH 1RJCA 3CC5A 1DN2A 3TFKC 1A3LH 1A6TB 3G6DH 4QXGL 4LLMA 4HGMA 1GGIL 3IFLL 1LO0L 1S9XA 3VA2C 4N0UE 1XAUA 3DIFA 2Q7NA 2XG5A 1PKOA 3MODH 1MCIA 3K7UA 2SEBA 1YMMB 1DLHA 5I76A 5DRZB 3QA3B 3DGCR 2AQ1A 3O45A 5CMAB 2C4FT 3SEPA 3SQOH 4HIXH 4ZAKB 1T2QH 3ROLA 3UTZB 2XOTA 3P0YL 1QR1A 4YHLH 3GMPB 3WEXA 5KW9L 5GGUB 5MEND 5ALCL 1ZXQA 1JPTL 2AP2A 4HIJB 3ZMRA 5IVXE 1KJ3L 2X4RA 4LPYA 1KF9B 4O2EB 2OQJA 5FF6B 5JW4R 5DHYB 4BSWB 2BZDA 3BPNB 5ACZA 4U1MB 2EKSA 4ONFL 1YEGH 4B41A 2COQA 1U95B 2YMXH 8CGTA 4PJ9A 5F8RC 4GAYA 3GSQB 1N59B 4H8WH 3LKPA 5C6PB 3BEWB 4PLNC 3G5XA 2ZJSH 3NIGE 4FFVC 3GSOB 1Y6MR 1A6VL 1Q0YL 1WAAE 3B2UC 1NMAH 1EVTC 4HIEB 3BEVB 5DSCB 2FJFA 5ISZD 2W60B 4ZPVA 3ELAT 5GRUH 3OKKA 5C70A 1CF8L 1A8JH 1RIVL 1X5HA 4ZTPL 5FKAB 1YNKL 1SYVA 4NPYA 4UI2A 3MV11 3K8MA 3L3JA 3AB0B 2P8MA 3MBXL 4GAJH 3O6ML 1JHLH 5D93B 4KI5E 4GT7A 4PJHB 1CGXA 3EDFA 5KVEL 4OLVH 4L4VB 2FECI 2ARJQ 5E8PA 1EDQA 4JFPA 3EFFA 1KV3A 4GQPH 2CRYA 1PYWA 4OAWA 3WHXA 3VCLB 3WJJC 1DBMH 4AJ0A 1DUZA 2EDDA 2R29H 1OAYH 4NZDA 4AG4H 2I27N 3HNTH 4L8SB 4CU8A 1QZ1A 4XBEH 5LWYH 2UY7A 4DUWA 4R8WH 2NLJA 5ID1A 5BMFH 2H8PA 3NIFE 3B4NA 4TTDD 2H6PA 4DKAA 1NCCH 1I7UB 4GKOA 4YWGL 5F89A 1UWXH 4M1DL 5CIPB 1Y18A 2VDOH 3QUMB 3OL2A 3G9AB 4ZO9A 3KPRE 1JIBA 1LE5B 4AT6A 4JQIH 1WC7B 1S5IH 3TH2T 5EG6C 5BVJB 4XVUD 1NGYA 3HB3D 4OB5H 4N0UB 2UY6A 3D2UD 1I1YB 4KZDH 2NXYC 3EAKA 5C0IA 4OZHE 3HE7C 4IRJD 3GUTB 4QF1B 5GISL 1IZJA 4WUUD 5CJXC 3MRLB 2FLRT 3PE9A 5DLMH 2ZPKL 3QT2A 3RGHA 3F7VB 3DETD 1IQDA 3ARDD 2HJFB 1KPUA 4NC1C 3A67H 1BX2A 1LEIA 3GJFB 2X1PA 5SWZD 4LKCB 4PP2B 2V17L 4V1DA 3QUML 3KGRA 3MV7D 3U9UB 3FO1A 4XCNA 4UZGA 1V3KA 4RNRB 3OKLA 5L2KE 4GXUN 1X6LA 1DEDA 3ARGC 2Y23A 1UCBH 4HWEH 3KPMB 5IB5A 3TIDB 5IB2B 2BHUA 3RWJB 4L8CA 2NNAA 4XX1E 2MNUA 4L4JA 5AD0B 4QGYA 1Q9WB 4YHMH 2DICA 1W0WB 3NPZB 4TSAL 4ZNEE 3VE0A 2YWZA 4G43A 1JGDB 2DQDH 1NPUA 4DN3H 4KXZH 4A6YB 1RUQH 1P9MC 1TJHH 2XN9D 4QOKD 5DMKB 4PJCE 4P4KC 3UTSD 2DQGH 3BWAB 5CEZL 2JB5L 2VLLA 4OCXL 1PLGL 2KH2B 2AABL 2EE2A 5DS8B 1DE4A 4XP6H 5F8QC 1BGXH 4F7PA 3FAXA 3FHAA 2F58H 5DD5H 4PGZA 4P4RA 1B0GB 1F58H 3KPTA 5CSZB 3U7WH 1FFPB 3IU4H 5AWNH 3UXFA 1HKLH 3B6SA 3H7LA 3V0VA 3QZWG 2EECA 3X11A 4XPHL 4PGEA 1CZ8L 1VACA 4ODSH 1ZLSL 1T0MA 1KJVA 2QBWA 3GKWL 3JVGC 4A6YL 5HYSG 5KTEH 3D0VB 4RFNB 4GMSH 4AEIH 3ZYIA 4G9FA 4PJ5D 2EE3A 1WTLA 4PJDA 4MZ2A 2E5EA 3TWCH 1UJ3B 1A7OH 5GS0C 1YUHB 3T2OA 4Z95L 3ULUE 2LU7A 1B4RA 4GKSB 2VC2L 1S9WB 2NY0C 5EBLB 5FO9A 2ZWLT 5F7UA 5EBMA 1BQUA 2BX5A 4FFWC 3BPLC 5L8LB 2BP3A 4DKEH 1BOGB 1ED3A 5TQ0L 1ZVYA 3V4UH 4G6AD 5D96B 1J05A 5ICYB 1U8JB 5F7DA 3WFDL 5H94B 3KPSE 4JQVA 2ZG2A 4E0RB 2GUOB 4PJGA 3SY0A 1PZ5A 4YFLF 3KPRB 3NACL 1ES0B 1G9ML 3HI1A 1G9NH 4NT6B 2RFXA 4O02H 4CMMB 4YXLL 2JELL 4GW5A 5F3HB 1IFHH 2KZWA 5L0QB 3QSKB 2RHEA 4LPTA 1FZKB 4WFED 2ZCLH 3GGWB 1JPSH 4FN0A 2H32A 3MBED 2NY2C 2ESVE 2OTWB 3DSNA 3VFUA 4GBXC 4HXBH 4YHPB 4QY8B 3C60D 3IDXL 3BQUA 5D70H 4I2XA 3LMJH 4QGTA 1NCDL 4HC1A 2AI0L 4JREB 1TVHA 1GHFL 1CYGA 1DQJA 4N8VA 1S7SA 5E8NB 1CCZA 2AXGA 5KANI 4FFZH 2EE9A 1LDPH 3OF6A 1ADQA 1IGYA 2F5BL 3PHQB 1MQ8A 5EU7E 4GRMB 4X80L 2R0ZL 4ZUUB 4G6FD 3AMLA 4NN7C 4LAQL 4HUWB 4PG2C 5D7LE 2LTQC 5IQ9A 5FKPA 4MQXC 5D4QA 1H5BC 4OJFL 2IH3B 4FTVD 4O2FA 5GJTH 5IEKB 4Y19A 4NKQB 1MWAA 5J9PB 2DQTL 2QTEA 3X14A 4KDWA 5SWQB 1RZJH 1YEIL 2X41A 5I74B 4HUXA 1IM9A 2DLFL 1YYLL 1F5WA 2Q76A 3MRDA 1EX0A 5HHMB 2EDEA 4HQQH 1WCBA 3QUZA 5ESVA 1Q9OB 4M7ZB 3PP4L 3F7RA 4PLKC 1F3DH 1N26A 1DVFC 4PD4K 2VH5L 3D0LA 4FZ8L 3SCMB 3N1GC 3BO8B 3DMMD 2KL6A 3RVUC 1JRHI 4Y89A 3Q6FA 3MO1A 1OSPH 3FT3B 2MPAH 3ILQD 4OGZA 3CSBA 4PJAF 3PWVB 4ONHB 4P23A 3KPPB 1INDH 1JTPA 3T2PA 4Z7UF 3PNWA 5DWUL 5D7KD 4OLUL 4F9LA 5F9WB 3FB7B 4NFDA 1I7TB 4CVZA 4XZUA 1A6UH 3IXAB 4UT7L 5IB4B 4PJXF 5K93A 2CXGA 2PW1A 2L7UA 2PCPB 1S9YB 3KR3H 3LKNA 1EHLL 2FB4H 2YRPA 1ZHLA 1JZ7A 4HWUA 3SN6N 5DFVD 1NJ9B 3BXNA 5CGYC 5HHPA 2AK1H 5I1LB 3RBSA 1A4KB 2ORBH 1IAMA 2BVQB 2IBBA 2G2RA 4NP4H 2VN4A 1QBAA 2EDLA 2N4IA 3P4MB 4JAMB 2XZCL 3ULUL 3GBLA 3S97C 2NZIA 4ZUSA 2XWJA 4URTB 5D1ZB 4YXHH 3LKQA 4KKLD 4D2NA 3KS0J 4KZEL 4WVRA 1CFNB 3ARBD 1OWRM 1JV5A 4HZLA 4PB9L 4NDMA 4ZD3L 3WN5C 3KJ4B 3PIQB 2BSED 1TVBB 2AXFA 1AXSB 1NFDF 5K59F 2GJJA 3WJLA 1MJJA 5HYJE 2FSEB 4PRHD 3D25A 2CGRH 2DQCL 2VQ1A 3FCTB 3FAWA 3HAEB 2X4QB 5L2JB 4HK3N 4X98A 2GEEA 3LSOA 5L7XL 3SKMA 1UB6B 2EXWC 4XI5C 4AY0A 4Z9KB 4KUZH 2YXFA 5LG1A 4KRPD 1YQVL 1B6DA 3H9ZA 4YEEA 4X9IA 5T1KB 3A0OA 4KV5E 2FX8L 4L9LA 5JLZB 2A9NH 2FATH 2BSTA 4YBQD 4ODTL 5DVKA 3EDKA 2P24A 4RQQB 2HJLB 5CEYB 3SGDH 4UB0H 4FXGA 3VXUB 4KC3B 2UWEB 1FYTA 5I8CB 3ZSSA 3C09C 4JRXD 3V4VH 2V2XB 4J3WA 4JFEA 3B9AA 3GSNB 3IKCB 5IQ7L 4LF3A 3WFEH 3T0EC 1XGRA 3CFCH 1G0YR 2JJSC 5DI8A 3RUGA 5HI5C 3TP4A 2H3NB 4QRQA 3VFOB 2VDRL 3DI3B 4J8RB 1KIRA 4HCRA 4NN6C 3O4OC 2YUWA 4LCIH 4RA3A 1KN2H 5DQDL 4GQ9L 4N0FA 1MCKA 4NQUA 4LPWA 2Z8RA 1UEYA 5KOMC 5IB3B 1UKTA 5C0FA 4DAGL 3QHFL 5MEQB 3TBVB 5I30H 5D8JL 4H5SA 4WTXA 3ZTNL 4HJJH 4NQDE 1HSBA 3QHZL 5ACLA 2O5YL 2ZUTA 5C0RL 1OD9A 2YHGA 3REVB 4E42A 4EIZC 3GHBH 1MI5E 3O41A 1JNJA 3THMH 4TNVF 3GSNL 5D1QA 3LEVH 4KK5C 1KT2A 2YS4A 2Q8BL 3FB8A 5IG7B 3NCBB 1EJ6A 4CADB 3G9VA 5ICXA 4IRSB 1E4XH 1QVOB 2MHAB 3QJFB 4U6VH 4F7MB 1A3LL 3LKOA 3JWDH 3G6DL 3H3KA 4F8TA 4FQ1H 5JTWA 1CLCA 5INCA 5C0DA 2GJZA 4M7JH 4MAYA 4PJ9D 4N5UA 1RUMH 2NY6C 5I6XB 4K3DH 2EIZA 2VLRA 3T0XA 3WFBH 2JB6B 1J11A 3MODL 2ITDB 3DNKA 4HPOL 1FNLA 1XZ0A 2I24N 3X17A 2EYTB 1AI1H 5MHSD 2FR4A 3RIAK 3WCYA 4HBCH 3HLAA 3WUWG 3SDYL 1KYOK 4HIXL 4R7NB 1NBQA 5GRYA 3OAZK 1RZ8A 3QXUA 5J1TC 5C0BB 4ZFZA 3DVNA 4YHLL 1YYML 4MJ2A 3TNNB 1A02N 1QRKA 2XTJB 2PO6B 2X7LA 3MFFB 2AGJL 3KLAB 4KRLB 4ODUA 4R97C 3BZEB 1T6VN 3UTTA 2K7QA 1YEGL 4NRXA 4RGOH 2YMXL 3F7YB 3GSWA 1NBYA 1KLUB 2ED9A 5HI3C 2D31B 4H8WL 1SY6A 4I18C 1PG7H 4B7LA 1EFXB 3QEQE 2DQIH 3EOTH 5H35B 3HUJF 3GI8H 2NY4C 1I9IH 1CE6B 1CD1B 2ADFL 3S37L 1NMAL 1AP2A 1U3HA 3MJ7A 1Q9KB 4LIQL 5DJ6A 5D7LD 3VXSB 1KUMA 2PYEA 3OJMB 1FV1A 3LKSB 1TPXB 4NHCH 2A6DB 2Z35A 5F7EH 5EUOE 5D6CB 2ZOKA 3F12B 5F9JA 1MFAH 2DQUH 2CLZB 4UTBH 3L5WA 1NEZA 2J3SA 4XXDA 1JHLL 4X6CB 1XFPA 4OZIB 4OLVL 1RJYB 2FL5B 4RZCA 4EIGB 3D3VA 5JIHA 2J12B 3CPLA 3WNNA 1XR8A 1DBML 5ID0A 1QBMH 1VHPA 3QI9B 5IVZB 3TCLA 2R29L 1OAYL 3QFDB 5HHQA 1CICD 4P2CG 5JORB 1MI5B 2H26A 1HXYA 3MRCA 5LWYL 4LPXA 4R8WL 4V1DD 1AHWB 1BD2E 4RAVB 2APVA 2CIKA 5BMFL 2IADA 3HS0B 3RPIA 3SKUD 3LH2H 1JUFA 2DKMA 1AR1D 1NCCL 3L6FB 1A6TA 2IG2H 4NO0D 3IVKB 4P2OC 3VDBA 5J12C 4LK4A 1KJ2B 1MY5A 4KROC 2OK0H 4JQIL 1S5IL 3VXOB 4OB5L 1A5FH 4N90D 1A1NA 1CTNA 3MMEB 1QUNA 3I50H 4HLZH 4I9WD 1OAXH 4F15B 4MQ7B 1MCRA 3CFDB 1GC1C 2VR5A 1OARL 4PGCB 5DRZA 4KDTC 3QA3A 5CMAA 2IAMC 4ZAKA 3ZYOA 5MEOB 3UTZA 4ERSH 1S7RB 4QT5B 2G9HB 3TYGH 1RD6A 4ZSOE 2QLVB 3GMPA 3HC3H 3LQAL 3T65B 5GGUA 4RWYH 1XMWA 4M1CD 4HIJA 4EUPH 5KSAD 3C8KB 5D2NE 4KVNH 4O2EA 1E0OB 5JQ6H 4U0QB 2ILLA 5DHYA 5EU5B 4BSWA 5I71C 1MVUB 3IETB 4U1MA 1RHHB 3FMGH 3WNKA 3BKCH 4X6EB 4JDVB 2P1YA 3GSQA 1OP9A 1N59A 3PWPE 4YHML 4ZFOB 2WV3A 4XNXH 5DD6B 5FYLD 3NVQA 4O00A 2D4FA 2DQDL 3BEWA 4DN3L 3T4YB 4HWBH 1WV7T 3QEQB 4KY1L 3ZKMD 2Y7QB 3GSOA 1RUQL 1TJHL 2GFBB 3LKRB 3QHTC 1FIGH 5EO1B 2DQGL 4HIEA 3HZKB 3BEVA 5DSCA 1WF5A 4PRPB 4YK4C 4Y4KD 4XP6L 2W60A 3KXFE 2MTPA 3UDWA 4YBLB 4PRIE 1IEHA 2F58L 5FKAA 5GHWH 4LMQI 1F58L 2F54D 1YY9D 1N6UA 3QNXB 2NPLX 3IU4L 5AWNL 2ZNWA 5CGTA 4ZFOL 4TTDC 5IGXH 4DOHE 4PJHA 4NQVB 4JQXA 1D5XB 5A1AA 4L4VA 4ODSL 3CJJA 1VDGA 1I85C 1OD7A 5JXAL 5KTEL 1IGIH 3E0GA 4G80B 4GMSL 4AEIL 2D03H 3ECBB 2Q87A 3J7HA 2F8XC 3VCLA 3TWCL 4XVUC 3HB3C 4LVEA 5EUKB 1JE6A 4PFEA 3TJEL 1EAJA 3QEGH 3AROA 1ZLVK 1WTGT 3ZYJA 4UINH 4L8SA 4EOWL 4NQDD 4IRJC 2QSTA 3BQUD 1B0RB 2XRAH 4EXPX 4ESKA 3DETC 3STBA 3ARDC 3V4UL 4HWNA 1M7XA 1I7UA 4RMVA 4Z5RB 2FDBP 4K8RD 3KPOB 5CIPA 5A2FA 3QUMA 3TZVB 5SX4I 3V9FA 1LE5A 1TZIB 1WC7A 2A6JB 4PUBL 5BVJA 4O02L 4NQTA 3NABH 2PNDA 1XR9B 4N0UA 4PJFB 1IFHL 3FQXB 4K7PH 1I1YA 1L4IA 2G5BB 1A6ZB 3GUTA 5FYKH 4QF1A 3N06B 3RKDD 2Y5EA 2ZCLL 3MRLA 4Y19D 1JPSL 4M8VA 1IAIH 3EDJA 3F7VA 2HJFA 2EC8A 3ARTA 3D9AH 4KTEH 1KC5H 2KUTA 1BOYA 1EEUA 1EZVX 3GJFA 4HXBL 4LKCA 1MCQA 4LCUB 2YC1B 3HC4L 4PP2A 5D70L 2VXSH 3G5VB 3U9UA 1A6WH 4RNRA 4Y5XC 5DTFB 3KPMA 5LCVH 1FC1A 3TIDA 4FFZL 4JFZH 5IB2A 4RGNE 4K3GA 4KJWD 3RWJA 4LKXB 4ZG1A 2ZUYA 4R2GB 5TE6H 1PVHA 4WV1B 2BY1A 4UOJA 5AD0A 4P23D 1Q9WA 3S37X 1W0WA 3UX9B 5KN5B 1Z5LB 2E7HA 2ZZUT 1JGDA 5E0QA 3QIWB 1VB9A 2RQ8A 1U36A 4A6YA 2VWEC 3BGFB 1R3JB 4IDJH 5DMKA 4P2YA 4DTGH 2OS7A 3BWAA 1B3JA 1R3LB 5DS8A 1RZJL 4BSVB 3KXFB 3QQ4B 2QSCL 1CFTB 4MHHI 4PRIB 5HGDB 5A2JH 1AQDB 1B0GA 2VLMD 2ARWA 4J2XA 4XPTH 5CSZA 1FFPA 4MSWB 2Z31B 4G6AC 1OQXA 3K2MC 3PG2A 2NX5E 3L5IA 4NC2B 1OSPL 1SMOA 2ED7A 2MPAL 4NO3B 1V7NH 4GS7B 1CGVA 2IPUK 3D0VA 2FEEI 4TUJB 4JG1L 1INDL 2AXHA 3SDCC 1UJ3A 3FB5B 3Q6GL 5LBSL 1YUHA 2DWEB 1L0XA 4GKSA 3O3DB 4O58L 3O2VH 1S9WA 1D5MB 3RY4A 4Y5VB 2A0LD 5EBLA 3WIHA 4IOIB 1A6UL 5C0AE 3SO5A 2J5LC 3ZZ1A 1J8KA 3NCMA 5EO9B 2FB4L 3MBEC 1BOGA 3H0TB 5DUMH 2DDQH 2QSQA 1KFAH 3L5XH 5ICYA 1U8JA 3C60C 4DUXA 2XTLA 5H94A 5CUSH 2UVFA 2R4RH 3ABZA 4E0RA 2GUOA 5EU6E 1KCLA 4P5MB 2R1WB 3KPRA 5BZWB 1ES0A 1JGLH 4NT6A 4RDQF 4FOMA 4NP4L 4CMMA 3OXRB 4XNZB 3SKJL 4D3CH 3MLRH 5F3HA 2WWMD 1IGTB 3FB6B 1RK1B 3OG6B 1FZKA 3TH4T 3S5LB 4YXHL 4G7VH 4LARH 4PJ7B 4FG6D 3PP3H 3GGWA 2E9IA 4IMKA 1BPVA 2GY5A 1C8PA 3HI6H 4JFED 2CR3A 4KHXH 1S78C 2OTWA 3ARSA 4YHPA 1KTKE 4QY8A 1OW0A 2NY5H 1A22B 4EBQH 1JYNA 4LVOC 4RFOH 4JZJC 3CZFB 1J8HE 2R1XB 3BIKB 2ZG1A 5JMOC 3GHEH 1FAIL 2CGRL 2XWBB 2QKIB 4OCWH 2AKRB 5E8NA 3OJVC 2JTDA 5E94B 1DBAH 4R0LC 4KUZL 3VGAC 4OZGB 1WIPA 5KS9E 3PHQA 1JWMB 4GRMA 4U3CA 4ZUUA 1LQSR 3DMMC 4W70A 1IC5H 5ANMB 3S36H 5BCAA 5HVHC 4HUWA 1QRND 3VW3H 4UB0L 3ILQC 3N1MC 4WY7L 3S9DB 2EYRB 4S1RH 5CD3B 2IH3A 4I0PB 5IEKA 3OKYA 3SJVE 3V4VL 4M7KH 3DYMA 5J9PA 5SWQA 4P9HH 3Q2CA 3CFCL 3QEHB 1KOAA 4WJ5B 4TVPL 4Y7MA 2VOTA 4GG6B 5FHAH 4M93C 1D9KB 4L1HA 1X5LA 2R2HB 1Q9OA 5IKCB 2VLKB 3W0WD 3SCMA 2EC9T 3BO8A 1HN1A 2CLVB 3N9GH 3FT3A 4MB3A 5DFVC 2WLYA 3UJJL 2YRZA 5I30L 4HJJL 1ZE3C 3RWCB 3PWVA 4MD5B 4ONHA 5I1HL 1MIEH 4JHBA 1OSZB 3KPPA 1T3FB 2BY3A 3GHBL 2MCPH 3MXWH 3THML 1N6QL 2IBZX 4LLUB 3BKYH 4GJTB 4P46D 3LEVL 1MPAH 4LSQH 3FB7A 4D9RE 4F58H 1I7TA 3IXAA 4QLRA 5IB4A 5EIQA 1E4XL 4LSUH 4M7LT 5HVWA 2PCPA 1S9YA 2GTWB 3ARBC 3JWDL 5E9DB 4FQ1L 3DUUB 5FYJH 2B8OT 3WXVL 4M7JL 1RUML 4FQXB 1NJ9A 1L7TH 4RBPH 4HGWB 4K3DL 4LSTL 1NLDH 5CJQH 1IL1B 5I1LA 5EU6B 1A4KA 4K7FA 3WFBL 3K74B 2CLRB 1CT8B 1OTUD 3I6KB 2BVQA 3EYSL 4X83A 3TVMD 5FA4B 5BZDB 3P4MA 4JAMA 4NUGH 5J06A 3P30L 1NFKA 2XPGB 3KLHC 1CGSH 1ACZA 4KRPC 4RGMB 4YDLC 1U3HD 5D1ZA 4NRZB 1ZT1B 4PD4J 3BP7B 1CFNA 2QV2A 4YBQC 3DLQR 2QHLA 2ESVA 3RX8A 4F37F 3PIQA 1TVBA 1AXSA 3CX5K 3VXME 3VMNA 1KENH 1BQLH 2FSEA 4FABH 4HPYH 3FCTA 3LS4H 1OP3K 2HLFD 4RGOL 3QIUD 5A43C 3HAEA 3HZYB 2X4QA 2HFFB 5L2JA 3D3VD 5JOFB 4JO3H 1MAML 1UB6A 4ODXB 1PG7L 2DI8A 5T1KA 1S7WB 1HI6B 5IT2H 3EOTL 3KLSA 4DW2H 4RGND 3GI8L 5JLZA 2B5IC 2YRLA 3CU7A 2J8HA 2HJLA 4RQQA 5CEYA 4H0IA 3VXUA 3L7FB 4WTWA 1UA6H 3D87B 4G8EB 3VGFA 1PY4A 3CSPA 2UWEA 3UYPA 3HNVH 5I8CA 4OQTH 1NC2A 3MOQA 2V2XA 1IKNC 4NHCL 5F7EL 3SJVB 3GSNA 1MFAL 1D3CA 2DQUL 3TO4B 1VCAA 4L3CA 2EEBA 3T0BA 3GM8A 2OI9C 4UTBL 2H3NA 3CFJB 3UTPD 3VFOA 1BFOB 4J8RA 5GRJH 2QL1A 1V3JA 1XIWD 1I3GL 4RMTA 5IW1B 2ZG3A 1K2DB 1YMMD 4KKBC 5IB3A 1JZ4A 3C6SB 2NCMA 4PJ9C 1NKRA 5MEQA 4KAQL 3BRGC 1QBML 3RY6C 4K3EH 1BFSA 3ULVH 1FCCA 1FCGA 1PG7W 3T0DA 3REVA 3FT4B 3WNOA 2BNQB 5FYKE 3TN0D 5D9SB 1I8KB 3MYJB 3QWRA 1Q9LB 5IG7A 2W9DH 4CADA 1CL7I 1ZHBB 5FUCC 4IRSA 5SWSD 5J13B 3DBXB 1QVOA 2BVPB 1G84A 2JF1A 2MHAA 3QJFA 4F7MA 1KCKA 2IG2L 3QO1B 1JI2A 2OLDA 1T83A 4QHNB 4MA8H 3O3EB 4ZUWB 1A5FL 4EI5B 2QJDA 2P5WE 2ZOLB 2JB6A 4HAGA 4YDKL 1KCSH 5IFAH 2ITDA 1N7MH 4OKDA 5C1MB 1MQKL 1OAXL 4LVHB 2EYTA 4GRWF 3VD4A 1JGUH 2GTZB 4Z7VF 3IJHB 3O4LE 4R7NA 5J6HB 3QDJE 4FXKB 4LP5A 5C0BA 1EEZB 2JJUA 5GIRB 1X6NA 1HHJB 3CMOH 1JYXA 1HEZB 3TYGL 3TNNA 3OTTA 3W2DH 3HC3L 2ZSVB 2FECL 4J4PA 2KQMA 5GGSY 4XP9H 2PO6A 4ZUTB 3O11B 3MFFA 1UZ6E 1C5CH 4Y4HB 4TPRH 5ABDE 3KLAA 4TVSa 3P73B 4P2RE 5JQ6L 2VDKH 4H1LB 3BZEA 3CVIH 1K8IB 1M71B 3VXMB 5A40E 3VGBA 3EYQD 1F6LL 4L4VD 3MOAH 1OM3L 1J8HD 2O5ZH 3EDEA 3F7YA 3OWEA 5AG9A 1ZLVH 4J6RL 1PW3A 1KLUA 4HZAA 2D31A 3DXAE 4K23H 4U33A 1EFXA 2X70B 2FHFA 4HWBL 5C07B 5H35A 5M95B 3ILPB 4P48A 4KTDH 1CE6A 1CD1A 5HD8D 2OR8A 3O3BA 1FIGL 1S8DB 4OIIL 1MRFH 4TQEH 4XC1H 3BN3B 1Q9KA 4D0CB 1LP9E 2MJWA 4TTGA 3VXSA 5I1CH 4TSBH 3LKSA 2A6DA 1CD8A 1U3YA 1X5ZA 1KSRA 3V95A 5D6CA 1BJ1H 3F12A 5KOVC 4OKVB 5I1IH 5B21A 3TBWB 3V7AG 5I16B 2CLZA 1TZHB 5FO7B 2Y06L 4KQ3H 1KYOJ 1EH9A 3WFHB 1AR1C 4BUHA 5IGXL 4BFGA 4X6CA 3B3IB 2JCCF 4C58B 4OZIA 2Y4SA 1RJYA 2FL5A 3VGDA 4WEMB 1IGIL 4WFGD 2D03L 3UC0H 3WLBB 5DGRA 3QI9A 3TLRA 1CXEA 3MRJB 4HDIB 1NUGA 5IVZA 2EYSB 3WNPA 4LP4A 4EXKA 3QFDA 3QEGL 1OGTB 4UINL 1MI5A 5JORA 5JPMB 1EK3A 3G6JF 2XRAL 3VFRB 1CU4H 1AHWA 4RAVA 5LVEA 3EIFA 1VGKB 3HS0A 3FOMB 3VRLE 1LK2B 3M1BB 4PJ8D 2D7TH 4D9RD 3DROB 3ARPA 3L6FA 2BSRB 5KG9B 1T03H 3IVKA 2E6PA 4M1CC 4WDIB 5FYKU 1JK8B 1KJ2A 4YZFF 2QQQA 1JWSB 5K9QI 3VXOA 4RMQA 3NABL 3BAEL 1ZT4B 4PJEE 2P5WB 2R9HD 3MMEA 4O4YH 4UTAL 3MYZA 4MQ7A 4XCCH 3CFDA 5E2VL 1NCAH 5FYKL 4CVWA 4PGCA 5SX5H 5IHLB 1IAIL 3PABB 4LU5H 4KTEL 2Z0BA 5E56A 5MEOA 1M7IB 1KC5L 1S7RA 1WZKA 5F6IC 4QT5A 4OSUH 2G9HA 3ZKMC 3HRZB 3T65A 2Z4QB 1AGBB 3OJ2C 2VXSL 4LPCA 3DOSA 1A6WL 4RMUA 5DVNA 3C8KA 1JFQH 4Q0XH 2AJVH 1PD6A 3GMQB 4DK3A 5EU5A 1MVUA 3IETA 4G7YH 3D6GA 5DC0A 4JFZL 4X6EA 1MRDH 4KVCH 4JDVA 1YY9C 2W91A 3C6LD 5TE6L 4Y88A 1MCWW 1OF2B 4ZFOA 4FZEH 1VPOH 5ESQB 5DD6A 4H88H 2FX9H 1U8PB 1HSAB 4LSPL 1ZHNB 4GAGH 3QEQA 2Y7QA 4XCFH 2GFBA 3LKRA 5KANG 3PL6B 4YC2B 4AH2B 1TITA 5EO1A 4DTGL 3H3BC 3D48R 3HZKA 3WYRA 1W0VB 5J57B 1IEBB 3U0PB 4PRPA 4Q58C 2A6IB 3DHJA 1RZIB 3H8NA 4QRRE 1LP9B 5E6ID 3D39B 3BQUC 2MSPA 4XPTL 5TE4H 3RL1B 3QNXA 1W8NA 3G6AB 4X5XB 5C6TH 4YFDB 3O6LH 5FYJE 2Y72A 4NQVA 5CEXB 2C3GA 1D5XA 4K8RC 1FG2B 3DX8A 1V7NL 1PKQE 4G80A 4X9BA 3ECBA 1A7NL 1VESA 2Q86B 1ZVSB 2V5YA 4PGJA 2C4FU 4HWZB 5EUKA 4NZRH 3O2VL 1EO7A 5CP3H 4Y2DB 1OTTD 1KGCD 3NCJH 1B0RA 1NL0H 5BW7C 3ARED 3RKDC 4AIXA 1FFNB 2IQAB 4CJ0A 3SKOB 5TDPB 4U1HB 1MH5B 5EN2B 5DUML 3NGBB 5EORL 3EKCA 1KFAL 1L6ZA 2PUQT 3TCXA 3L5XL 3H7BB 4PJAB 4Z5RA 1ZAGA 1RZKC 2EE6A 3UO1H 3KPOA 2R4RL 4YQXH 2HKFH 4Y16B 1E4JA 3TZVA 4Z7UB 3CD4A 4B5EA 1JGLL 1TZIA 3UZEA 2DWDB 2A6JA 3ZDYF 1QYGH 3MCLH 4D3CL 1XR9A 5FGSA 3UPCA 4PJXB 4PJFA 5B8CB 3QR2A 4PJEB 1E4WH 3FQXA 1X5XA 3CUPB 2G5BA 1A6ZA 1U58B 3HHRB 4G7VL 4LARL 1JNHB 1NH6A 1OWWA 3FTGB 3GSRB 4W6WB 4P23C 4GMTH 2EIBA 3HI6L 3ORJA 4KHXL 1QTYT 2B39A 4Y8AA 4F9LC 5MI0B 2NY5L 1JRHL 3O4LD 4XP1L 2BHZA 4LCUA 4EBQL 2YC1A 4L5FH 4RFOL 3DX7B 2AV1B 3G5VA 4DGYL 5DF0A 2VR9A 4MA1C 4ZODA 1MCSA 4Y1AD 5D2NA 5DTFA 4OCWL 4IIQB 4PLOB 4ZYKB 5GGQH 5FIEA 4HUUB 5C0CD 4NQCE 1T4KB 3GSVB 5CSGA 4LKXA 3B5HA 4WV1A 1DQDH 2P42B 5CZXD 3VD7A 1MCHA 1MCBA 1IC5L 2FD6H 3S36L 5KN5A 5FB8B 1Z5LA 1P2CB 3SDAB 3V6OC 3QIWA 3VW3L 3DXAD 2NYYD 3AS1A 1AXIB 1EBAA 3ULVE 4S1RL 5IROC 1R3JA 3BYTA 5ADOH 3RZCD 4HG4K 4IDLA 2C5DC 5DURB 5CJOL 4HAFA 4HULB 4P9HL 1R3LA 3L95B 1G9NC 4QHLB 1YC7A 1S7QB 2Y07H 5F96H 3BMVA 4BSVA 3KXFA 3QQ4A 1CFTA 2A0LC 4PRIA 5HGDA 3K46A 1AQDA 4AIOA 3MJ6A 3WS6A 5E4EC 2QADB 3BD5A 1QP1A 1DSFL 2AJ3B 3WJLC 4MSWA 1QSED 4XWOD 3B9KB 2Z31A 2X05A 4GRLB 4MYWB 3N9GL 3ZT5A 1TQBB 2YA1A 3QDGB 2ICWI 2OR9H 4PJHF 4Z7OE 3C5ZB 4OF7A 1ORQB 5D1ZD 1PKQB 1MIEL 2VLJE 4TUJA 1MELA 2WSKA 3FB5A 1EAPB 5FGCE 4PGBB 4AENB 2EIEA 2WWMC 2DWEA 3BKYL 3HRPA 3O3DA 5J56B 4LSQL 5FYJU 3S7GA 1D5MA 3TH3T 2C3WA 5I2IB 4Y5VA 1WT5C 3MUY1 4IOIA 5HHOD 1CWVA 3GM0A 4ZUVB 1JPFB 4LSVH 4FG6C 3CFBB 4LSUL 4YDJB 3JWNC 4L4TB 3E3QE 5EO9A 4JJHA 4QRTB 3H0TA 4P2QE 5JIIA 1GOGA 1YNLL 4X9FA 3QUKB 5FYJL 2FRGP 1XGPB 1L7TL 3BSZH 2DTSA 1PX3A 5CJQL 1IC7H 4P5MA 2R1WA 5BZWA 1UKSA 3EOAB 1NGXB 5FCSH 2R69H 3OXRA 2HH0H 1KBGH 1IGTA 4LEXH 3FB6A 3ARUA 1CGSL 2X9WA 1RK1A 2P8LB 3VXUD 4EN3B 1TIUA 1HDMB 3S5LA 4PJ7A 1X7QB 2Y5TB 3QEUB 3ZKQD 2AEQH 5TF1H 4NC0B 3O8XB 1GGUA 4FQ2L 3HC0B 1E6OL 5IV2B 1CLOH 4X7FC 2IMMA 4M5ZL 3UJIH 4CVXB 3CZFA 2R1XA 3BIKA 1KENL 5DZOA 1MJ7H 1BQLL 1IE5A 3HFML 2XWBA 4HPYL 3LS4L 4FABL 5L88L 3O9WB 2YK1H 2QKIA 2AKRA 1EUUA 5IVXF 1SBBA 4JO3L 5E94A 3P9LB 2GJ6E 5TJWK 3JUYA 4OZGA 2DM7A 2FEDD 3VWKD 3H9SE 3ARXA 2J88H 1JWMA 1T7YA 1F2QA 3BZFB 2RCSL 1UYWH 1ZHKB 4OLYH 5ANMA 1FO0H 3QWRD 1UA6L 4NUJB 2EYRA 2WINB 3GKZA 4C56E 4M3KB 5CD3A 3HNVL 4I0PA 1S9VB 4OQTL 1FORH 5I8EB 3NIGF 2V5MA 1WAAF 2HTKD 1C1EH 2P44B 4P46C 3QEHA 1CQYA 3NMEA 4U1LB 4WJ5A 1ZTXH 4EI6B 1UG9A 2RJMA 4GG6A 3TM6A 3HUJB 4MA3B 1LHZA 4XNMB 1D9KA 1DP0A 1MF2L 4QRRD 1E4KA 5MEPB 2R2HA 2R0WH 1N8ZB 5IKCA 4QCIB 3FFCE 3ULSB 2YKLH 5EBWB 1MHHB 2VLKA 5K9KB 1DUYB 2A9MH 2AK4E 2CLVA 4KMQA 5DJ0B 3F8UB 2FBOJ 3BDBA 3KYKL 4Q9BA 4KI5F 4K3EL 3P2TA 3RWCA 5GS2H 1CE1H 4MD5A 1OSZA 5ENWB 1OTUC 1T3FA 2DOCA 1BF2A 4LMQE 1UC6A 3TVMC 4LLUA 5FGCB 4L3EE 2XTJD 4WHYH 5B38G 2W9DL 1U3HC 3RJDA 4M8QB 1F4WL 3QPXH 3QNYB 2J6EH 1YZZA 4B7IA 3NFSL 2GTWA 4LCWB 5I0DA 3BRDA 3CFIC 5E9DA 4P2QB 1WITA 2RBLA 3DUUA 1UB5B 3UPRB 4MA8L 3VXPB 3NIFF 2VDMH 4FQXA 4HGWA 4RX4A 1IL1A 5EU6A 1BM3H 4ZQKB 1KB9K 2CLRA 5E5UB 1CT8A 1KCSL 5IFAL 3I6KA 1N7ML 3VFVB 4G9DB 2HLFC 4LNVA 3QIUC 4XMPH 3U0TB 1JGUL 3NIDE 5FA4A 5BZDA 5D71H 2XPGA 4RMRA 3AS0A 3QUXD 5DQ9B 1INEL 3QRGH 5F9DC 2W07A 2A83B 5TQ2H 4M02A 4JO1H 3FN0L 4NRZA 5AYUH 3CMOL 1DLFH 1UM4H 1ZT1A 1T5WB 4RGNC 4OZHF 3BP7A 5EPMB 5AUMB 1K8DB 1MREH 3EYUL 4NOBA 2X4OB 3I3EA 3LDBB 4PY7B 4MNQE 4XP9L 4MVBC 5L8JB 4TPRL 1NLBH 3MRPB 35C8H 3BHBB 2XKUA 1H3WM 3RGVD 5KVMC 2BOCB 1P4BH 2VDKL 5DJAB 5DRWB 3CVIL 2NZ9D 2W0PA 1CK0H 2YOCA 3MOAL 3QG6B 2O5ZL 3HZYA 2HFFA 3EYVB 5JOFA 1FL6B 1LO5B 4Q9QH 4ODXA 5BQ7B 4AYFA 4X4XB 1H3XA 5I66B 4K23L 1V5JA 4PTTB 2CSPA 1XIWC 1S7WA 3H9SB 1HI6A 1CL7H 3FO0H 3CFKB 4NQCD 1G7MB 2VZ3A 5D6DA 5HHNB 4KTDL 2C4XA 3B9VA 1NAMH 5IOPB 1VADB 3S4SB 4FRWA 2B0SH 2K9UA 3A6OA 1MRFL 4TQEL 4XC1L 3L7FA 4G8EA 4CRPA 4BZ1H 1J7VR 4YUEH 1D5BB 3UYOD 1ZKAA 4UV4H 4TSBL 3CDFA 3SJVA 3ULVD 4JO4H 1MIMH 4PJCF 1DEEB 3TO4A 1H3GA 4JKLA 4OM0H 3CFJA 1BFOA 3O3UN 4K7PY 2PTTB 2BNRB 5A16B 3KYMB 1I8MB 5IW1A 1K2DA 3MGTB 4PRDB 1LK3L 3S88H 1FNSL 1QNZH 5EO0B 3C6SA 3KHOA 2Q20A 4JFOB 4OBRA 1ZLWH 1EMTL 3CX5J 3QQ9C 4WGVB 5FHBH 2ZUWA 3FT4A 1FNGB 5HYEA 2BNQA 5J0BA 5D9SA 1I8KA 3MYJA 4WW2F 3V8CA 1Q9LA 5IJVB 2VLJD 4B50A 1RVFL 7FABH 3D85B 2VYRE 5T3ZH 5EFIB 1OLLA 3ULUF 1W72B 3DBXA 2BVPA 2AJUL 2XKNB 4ZFGH 3QO1A 1T03L 4LL9A 4BZYA 4JM2F 4M4PA 3EJYD 1FQ9C 4QHNA 3JV6B 4X0KB 3O3EA 5CP7B 4LLDB 3AB0C 4WWKB 3MX0A 5D93C 4ZUWA 1WCQA 4EI5A 3HZVB 4LLWB 2ZOLA 1WVZA 3EYQC 3P4NB 4JQXC 4BZ2H 4M43H 3IRPX 1XT5A 1CDIA 5B39B 5IBLD 4J3TA 4XCCL 1NCAL 4J7RA 1YPZE 2GTZA 3MNZB 3F7PC 4OD2B 2QQNL 4ALAL 1J0IA 3V0WH 4LU5L 4R9HA 3IJHA 1EVUA 2V9RA 5J6HA 4FXKA 4AM0B 1I1AD 1EEZA 1I9RH 1BEYH 4YO0B 1HHJA 5GIRA 2YXMA 4OSUL 1DANT 1HEZA 1AR2A 4P5KB 4Q6YA 5A2LH 5HD8C 1SVZA 2ZSVA 1FPTL 1RSFA 2GSGB 4NCDA 4KK8D 4P9ML 3E1F1 4ZUTA 3O11A 1INQB 4Y4HA 1JFQL 2EEDA 1G6RH 3P73A 2AJVL 4Q0XL 1G7PB 1PSKH 1IC4H 4H1LA 1K8IA 1M71A 3VXMA 4G7YL 4RMWA 2CUMA 1YJDC 4CW1B 1WZ1L 1MRDL 5C8JB 3C9NB 1TMCB 2V5TA 4I3RH 3IFPB 2IANE 4MX7B 2YA0A 2HRPH 2CDEB 5HGGS 4FZEL 1VPOL 4H88L 2FX9L 1T2XA 2X70A 2GJ6D 3CVHB 5C07A 3ILPA 4UNTA 1R5IB 4X6FB 4XCFL 2ID5A 3SDDB 3QXAB 4F7CB 5AYQA 2HT3D 1S8DA 5BRZE 2HP4A 5K33A 1BJMA 4YDIH 2NXYB 4Z6AT 4D0CA 1MFNA 5C08E 3HE7B 3RZWA 1QO3B 3IS0X 3R06B 4KMTH 4OKVA 4ZO7A 3I2CH 1JPST 3TBWA 3OKMB 1YQ2A 1TZHA 2MCG1 4O9HH 5FO7A 5I1GH 4F57H 2F53B 3MPCA 5C6TL 3O6LL 3WFHA 3QCTL 3B3IA 4OCNC 4N0YH 2E6JA 5JHDE 4N9GB 2HVJB 2VL5B 2ERJC 3FQTB 3RWDB 3FFCD 3ARGB 4MHHG 4Q2ZB 3RDTD 1XCTB 5HGAB 1YA5A 3WLBA 3OKDB 3MRJA 5E8DH 4HDIA 4JFQB 2EYSA 4KUCF 2R9HC 4NZRL 1PAMA 1OGTA 5I1JH 5D72L 5JPMA 3R1GH 1OAZH 1NL0L 2EDXA 3PDGA 3VFRA 4OF3A 1A64A 2E8ZA 2V5RA 1P4IH 1VGKA 4ELKB 3KG5A 3FOMA 5EIIB 5GGRY 4FQHB 1LK2A 4OF5A 2X89A 4L3ED 3M1BA 3SE3A 1JF5A 4AMKL 2P5EE 3D5OF 1CIDA 4P4KB 3QDME 4JFHE 4ZS7H 4FFVD 3DROA 4X4ZA 2E7CA 4OZFG 2BSRA 2VKXA 5KG9A 4YQXL 4ZOCA 2HKFL 3B2UD 4BFEA 4WDIA 3W9DB 3EYOB 3JUZA 4JRYE 1JK8A 1GGTA 4BM7A 4F9PC 4ZFFB 1JWSA 1QYGL 3MCLL 1NCBH 1ZT4A 3RP1A 4WI4A 4KRNA 1H3TA 3LZFL 2P5WA 1YEDB 4YHYB 3QIWD 3CGTA 2XA8H 4I0CC 1U8MB 3U6RB 1HNFA 4UDUB 3C6LC 1BBDL 2WZPD 4RFNC 3EJJX 3FOLB 3I6GB 3PABA 1UJ3C 3T0VA 1M7IA 2CQVA 3U7YH 3VFMB 1M05B 2KZ1B 3ARQA 3HRZA 2Z4QA 1AGBA 2IALB 1BIIB 3OJDB 5CKAA 1QKZH 3HTLX 2FEEL 4H26B 2J8UE 1T04B 2VXUL 3GMQA 2VE6B 5E6IC 3QPQC 2DL2A 3SE4A 3BPLB 3RWGB 3U4AA 1UXSB 3FQUB 4WWID 4LPUA 3TF7C 1AD9B 1BQSA 1DQDL 4QEGA 1QSFE 3KYNB 5CJ5A 5JXED 2IANB 1OF2A 5ESQA 3CLEH 5DMIH 1MCWM 5I17B 2FD6L 1U8PA 3CAFA 5DUPH 1HSAA 1ZHNA 3LOWA 1Z6JT 5F7HA 5C7XH 3PL6A 5JQHC 4AH2A 4KV5F 5GS0L 4NQEB 5BRZB 1NGPH 1L6XA 1S5HB 2HFTA 1W0VA 2DIJA 4IMKC 1IEBA 1B4JL 2IF7A 3U0PA 4HV8B 1W8OA 2A6IA 1RZIA 2Y07L 5F96L 1LP9A 2D7QA 3D39A 3MA9H 1EBPA 1OW0C 1OTTC 5F72S 4FFYH 4NZTH 4CN1A 1N5YL 3AREC 1NQBA 2NY2B 3RL1A 2IH1B 1P7HL 1ZV5A 3G6AA 3O6FB 5K9JH 2DYPB 4X5XA 3HR6A 4OLZH 5CEXA 3NN8B 3WNMA 4RA0C 4APQB 1FG2A 2OR9L 3FL7A 5JHDB 1FGNL 1RJLB 1EHAA 2DTML 3C5JB 1A14L 3BDXA 2Q86A 1ZVSA 4FQLH 3BT2H 4JFDE 4HWZA 4PJBE 2EH8H 3MC0A 1NEUA 3VXRE 4Y2DA 4QRPE 4OUUB 3L1OH 4J12A 4IJ3C 5BS0B 5LGKA 1FFNA 1P6AB 2IQAA 2JJWA 1Y6KR 5TDPA 3SKOA 4U1HA 3LPFA 1MH5A 3EZ8A 3BVNB 1HH9B 1H5BB 4A2MA 1N0XH 3H7BA 4PJAA 3VXNB 2YPKB 5HDQH 4UUJB 3ISWA 3T0EE 3BSZL 4Y16A 4Z7UA 1M7DB 4U6TA 3DVGB 4MJID 3U4EB 1OAUL 5FAAA 2DWDA 2VUYA 1DTUA 3DYPA 4OV5B 4YAQB 2CMRL 1JGVL 2HH0L 4OCLC 4EEEA 4PJXA 5B8CA 4PJEA 4LEXL 3RKPA 4DUVA 3CUPA 1DVFB 2HVKB 5ITBH 1U58A 5JR1L 2GCYB 2MQCA 3WIIH 1JNHA 3FTGA 4HLJA 4I0PD 2AEQL 3PJSB 5CZXC 5TF1L 3KPLB 1FRGH 3BX7C 3X3GH 4YHKH 3K2UL 3FQWB 1CLOL 3S35H 4M48H 5GJSL 2WP3O 3DX7A 3RZCC 4CMHC 2AV1A 2RFXB 2I07B 4M1GH 1MJ7L 2YK1L 4YPGB 4IIQA 4D9LH 4ZYKA 3ARWA 4OCSL 5EWIH 5JPNB 1OLZA 4HUUA 3GRWH 2I5YH 1NFIB 2K7PA 3V5DB 1T4KA 5M94B 3GSVA 4KHTH 1FHGA 1G7HB 1GVIA 1P53A 2J88L 1KPVB 4PBVC 1UYWL 3FRPG 1QSFB 4XWOC 2WQRA 1Z9MA 2N7BA 5I1EL 4OLYL 1HYSC 1A9EB 5FB8A 1P2CA 4TULH 3SDAA 3V6FB 1JP5A 3SGKC 4JEGB 2P47B 5SV3A 4WHYG 5F1OB 5F7KC 3SDXE 2JKXA 5D1ZC 1FORL 1C1EL 3L95A 4QHLA 1S7QA 1MCPL 5T3ZE 5DRXB 4MNGB 1NCWH 1ZTXL 2AQ3A 1GL4B 2NQCA 4LLYB 4ZO6A 3WIFB 3KJ4C 5C08D 3PGFH 4FQXD 2AJ3A 5EUOF 2YKLL 5DC4B 1UWXK 4BQ6A 4NWUL 3B9KA 5I1AB 3QDHA 2NW2B 2A9ML 4GRLA 1IZKA 1RUPH 3LN5B 1J12A 5IQ9B 5HDBE 4JFFE 2ZKHH 4LOUD 3QDGA 3UBXG 1I3UA 3BFOA 4H1LG 4YX2L 4HS8H 1ORQA 3MNWB 1CE1L 1PKQA 2BY0A 5DFTA 2YPLB 1AIFB 1U8LB 3IGAB 3SPVB 5CILH 1K4DB 1PGRB 1EAPA 4HUXB 4PGBA 4AENA 4JFDB 3I75B 2M8XA 4PJBB 3X13B 2NW3B 4YGVB 1YECH 5I2IA 3LRHA 4LQ1A 3BRFA 4ZUVA 4GW4B 3QPXL 1JPFA 4JDZB 2J6EL 3CFBA 4YDJA 5FK9B 3TC9A 4L4TA 4XAKE 2YR3A 4EDXB 4QRTA 1I9JH 3IFNH 3MLZH 1P7QD 3C09B 3QUKA 3BN9D 2VDML 1G9EA 3FT2B 1XGPA 4S1SH 4HG4J 1BM3L 3VH8G 3PWUB 4G6JH 3MV9D 3EOAA 1NGXA 3C08L 4XMPL 1B2WH 5IW3A 3O4OB 2B1HH 5D71L 4Q7DA 1FFOB 4MB4A 5M7QA 2FEDC 2P8LA 3GK8H 3P77B 4EN3A 3QRGL 1HDMA 2Z8SA 3VWKC 1ND0B 1X7QA 2Y5TA 4M6ML 1HWHB 3QEUA 3RX5A 5AYUL 1DLFL 1UM4L 4HMDA 1NAMB 1AE6H 3E6HB 3O8XA 1MREL 3DRTB 3L3DB 3HC0A 5IV2A 8FABB 2XG4A 3E8UL 3TO4D 3L9RB 5TH2B 3M17B 3MV8D 4CNIB 1NLBL 2VXTH 3K8KA 35C8L 3HCVB 3S3JA 4CVXA 4OQTA 1P4BL 4GRWB 1AO7D 5IBUB 1XGUB 5JW4M 2HTKC 1CK0L 3O9WA 4Z7VB 1SEQH 5DVOA 2GITB 4E41E 5HSFA 1T83C 3NA9H 3P9LA 2W9EH 2WBKA 1BAFL 1MJUH 4FQCH 2OJEB 4S0SD 1RU9H 3BZFA 1CL7L 4JANB 3FO0L 5CSBA 3CSYB 1AJ7H 2VDLH 3FZUD 1ZHKA 4WFHD 1U41A 1NAML 2BNQD 2NY6B 4L8DB 1GZQB 4RIRB 4BKLB 3OPZH 1WFOA 4PIRF 4NUJA 4DKFH 2WINA 1ZT7B 4K9EH 1S9VA 2IPKB 2EDWA 4YUEL 3QFJB 5E2TH 4UV4L 5I8EA 3BMWA 4G6KH 3QCUH 1OCWH 4JO4L 1LMKA 1MIML 4R4FH 2I9LB 4JLRB 4U1LA 4OM0L 1EEYB 2XTJC 4EI6A 4X7DC 2PO6C 4FP8H 3HUJA 4MA3A 1H8NA 1A1OB 4XNMA 2E9WA 3DV4B 3DV6B 5MEPA 1GGYA 4HMCA 1N8ZA 4QCIA 4EI5D 3ULSA 2QQKH 5EBWA 1MHHA 3PDDA 4X7CC 1T1ZB 5K9KA 1DUYA 5TDNB 4R97B 5ISZE 5DC9B 3S88L 1UJTA 1QNZL 4UILH 5DJ0A 3QAZB 2WUCL 4ZOEA 4NKDB 1Z0MA 1OQOA 1EJOH 2WWKT 3OMZA 5ENWA 5FHBL 2DM3A 2A73B 5F6HI 4DEPB 2EDHA 2D7PA 2HT4D 1U8NB 1NKOA 7FABL 3I3DA 2JCCB 3QUXC 1KJMA 2F9BT 4M6NH 4K3HA 4M8QA 2JJVA 3SOBH 3QNYA 12E8H 4LSDA 4OCRH 4I3GA 5IHZB 3VXRD 1D5IL 3OB0K 4HF5H 4LCWA 1TPXC 5A3ID 3QUYB 2PXYB 3E6FB 4P2QA 4Y8DC 2VMFA 3GB7B 1UB5A 3UPRA 1J5OL 4JO2H 3VXPA 5FGBA 2E27H 1RJZB 4WI6A 1JHKH 3KDMB 4G8GE 4ORZC 3G6JB 4U1JB 2NZ9C 4ZQKA 3OB8A 1Z0NA 1I7ZB 4TUKH 4LNRB 5C07D 4M43L 4G9DA 3T0ED 3VFVA 1EGJA 5IHBA 3U0TA 2UZXB 3ZKXC 5DA4A 3LHPH 3SGJC 5DQ9A 2OJZH 3V0WL 4MJ4A 5AAMA 2A83A 5IHUL 1I9RL 1BEYL 2A74B 5K9QG 5C09D 5T1LB 1T5WA 2X10A 1LE9B 3BZDA 5EPMA 5AUMA 1K8DA 5E00B 2X4OA 5HPMB 4PY7A 1BECA 2ICWJ 3MRPA 2D0FA 1G6RL 3BHBA 5DD0H 1PSKL 2BOCA 5DJAA 5DRWA 3ULVC 1KG0B 3QG6A 3OKOB 3NCCB 4NOFA 2EC9U 3EYVA 3PXHA 3DO7B 4X4ME 3BKMH 4I3RL 1X5KA 5SWZE 1MLCB 4WTZG 1LO5A 5BQ7A 1IGFH 2HRPL 1SBSH 4X4XA 5I66A 3WO4B 1XEDA 2YEZB 4HUKB 4KK9D 5A2KH 4PTTA 3MV7E 5MENB 1IAKB 3H9SA 3CFKA 5J12B 1G7MA 4DVRH 5HHNA 3SGEI 1V3LA 5IOPA 4F15C 1VADA 3S4SA 1H9VA 4U3XA 4YDIL 2W0FB 4AIZB 1F00I 1D5BA 3I85A 1J0YA 1KB9J 3IDMB 2E7LA 5EC1B 2MOVA 4OIBA 3V2AR 1PBYA 3VGGA 2VZOA 1ZS8B 4KMTL 1HCVA 1DEEA 1BZ7B 4O9HL 5I1GL 1MLBB 5KVGH 2F15A 1ONQB 5ILTH 5TDOB 2XN9E 2PTTA 3UTSE 5T3ZD 1OPGH 3IT8D 5DD3L 1FLTX 4N0YL 2BNRA 3HMXH 5A16A 3KYMA 2C1OB 1T1WB 2E3VA 3ZHKA 5TE7H 5DR5H 3MGTA 4PRDA 1U93B 3EJYC 5I71B 2LFGA 2YD5A 3EGSB 1TENA 3E3QC 4X7SH 5EO0A 4X4YB 5IP4A 5J3HD 4JFOA 1LILA 5DJ6B 1BQHA 1MHCB 4JKPH 2DKSA 4OCYH 4CN6A 5E8EB 1F2XK 1GC1L 4EQ2A 5E24E 2DQFB 1FNGA 5I1JL 5IBLC 3BP5B 5IJVA 3BUYB 4XXDB 3RFZC 4JHAH 1VKXA 1VSCA 3D85A 1P4IL 4OQ1A 5EFIA 4ONGL 2VWEE 3HI5L 3SE8H 1W72A 3VMPA 4POYA 4YBLC 4ZS7L 5D7IE 4OUOA 2XKNA 2F8OA 3T3ME 4KK8C 3U48A 3JV6A 4X0KA 4ZO8A 3RU8H 4AEHH 4UT6H 5CP7A 4LLDA 4WWKA 2F5AH 4NM4H 4Y4FB 4OZ4B 3TEUA 1MHPH 1VFBB 1NCBL 3HZVA 4LLWA 4P0DA 3NBNA 1I8LC 3P4NA 3MRNB 2XA8L 4K71C 3QWQB 1HHIB 5B39A 1A21A 6FABH 3PL6D 3MNZA 4OD2A 5CZKA 4ISVB 3QWOB 4C4KO 4C59B 3PGDB 3RA7H 4AM0A 2YUXA 4YO0A 3U7YL 2VUOA 2YD8A 4P5KA 3BD4A 2GSGA 2HT3C 3L7EB 1MCLA 1R3IH 3D2UB 1INQA 4MNQA 5D7SH 5C0GA 1RMFH 1G7PA 3RPKA 1T1XB 1F4YH 4WFEE 2APBA 1A1NB 5IF0B 3MLTB 4NNPH 3LD8B 2L0DA 4WUUB 1DQLL 2IJ0C 1JGEB 4U1SB 1FN4B 4CW1A 1LO3H 1MCFA 5C8JA 1FIEA 4HSQA 3C9NA 4MMZC 1NCTA 1KCUH 3WUZA 3IFPA 3RAJL 4MX7A 3MLWH 1G0DA 3LEXB 5IMMB 1ZGLB 4XXCC 2CDEA 3CLEL 3QP3A 5DMIL 3VGHA 3K81A 4E41D 4HH9B 5DUPL 3B8YA 3CVHA 5MP6H 4W6YB 5HDLA 4P2OD 5KS9F 1R5IA 4X6FA 5C7XL 3FO9B 3SDDA 3QXAA 4JN2B 4UT9L 4F7CA 4KROD 4Z77B 3KNBB 3RDTC 1NGPL 2I25N 4QXTB 3HE7A 1QO3A 5DHVB 5CJXA 4BJLA 1ORSB 3R06A 4FFYL 4NZTL 4R6UA 3OKMA 2MFNA 5DJCB 1LVEA 2IAMD 3PWLB 1RIHH 5K9JL 3K3QA 2F53A 2WUBH 4OLZL 4FTVE 5D2LE 4QOKB 1N64L 3VG0H 5IJKC 1WUNT 4N9GA 5KJRH 3CX2A 2HVJA 2VL5A 4Y5XB 3FQTA 3RWDA 1LD9B 5GRVL 3ARGA 4Q2ZA 4WV1C 2AJYH 1XCTA 5HGAA 2QSVA 4FQLL 1U8KB 3BT2L 3OKDA 4JFQA 1I4FB 1OGAE 2EH8L 3AS2A 3MJGX