4LLAA

Crystal structure of d3d4 domain of the lilrb2 molecule
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
198
structure length
198
Chain Sequence
b'SKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukocyte immunoglobulin-like receptor subfamily B member 2
publication title Crystal structures of the two membrane-proximal Ig-like domains (D3D4) of LILRB1/B2: alternative models for their involvement in peptide-HLA binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 198
sequence length 198
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llaA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llaA01
2NTFA 2XKNB 5KVMC 3BSZH 3TO4C 3MREA 2CLZA 1CTNA 3PWNB 3QXDB 4M8VA 3Q1SH 4NQSA 1HHJB 4Y19E 1AP2A 1W72A 2E7HA 1RZGB 5F7NC 1CFTA 3D3VA 3EJYC 4XNMB 4OIAA 1MCEA 3D69A 5IESH 4GOSA 4O2EA 2A77H 4U0RC 4C59B 1FAIH 2FBJH 3TH3T 3GEWB 4KK6C 1LILA 4WW2C 3W9EA 1ZSDA 2VLRA 2PN5A 1JF1A 5IHLB 4F80A 1UWXH 4HHAA 2D03H 3QR2A 4Z78B 1MLBA 5AZ2H 2BJML 3U4BH 3U4BL 4F9PA 2R0KH 3M45A 5CHNA 3QPQD 3V4VL 2IEPA 3I02A 3TT3H 5H37G 4JO2L 1FVEA 1DANT 3NOIA 3E6HA 1UZ6F 1J1OL 4HF5L 4M7JH 1AIFB 2A6IA 4JG0H 4P5MB 3VXRD 3K0WA 3IDIA 4N9GA 2NY1B 4MJ4A 3UBXA 1IQWL 3OKLB 3S35H 4PFEA 1D5ZA 3ZKQD 1UB6B 4OCWH 2BY1A 4EN3D 1DBBH 1NUDA 2V5YA 3IYLW 4PGBA 3S5LA 1NCDL 1DVFD 1SM3L 4MCYB 5DJ0B 4FZ8L 3UTZB 5INDA 1KPRA 1MCPH 2OS7A 4X9HA 4GAGL 4X99A 3T0BA 3VWKB 3WJLA 2UWEE 3M17A 4ODVL 3MGTB 3NFPB 4X5XA 3RX5A 3VFTA 4AYFA 4Q74A 4WHTA 1WJ3A 1ZHKB 1DN0A 2DTSA 1OAQH 5EZOH 3IVKB 5DWUL 1KN4L 1W72L 5SX4I 2GTWB 1KF9B 3V2AR 1YUHB 2I9LB 3TBYA 4RAVB 5SX5K 5FGRA 2EIZA 1GC1L 1RZFH 2ZSWB 5C08A 5I8OH 1BREA 4LLDA 1KJ2B 4MHHG 4QCIB 3SJVB 1WIPA 4MA8L 1F4YL 5DUML 1WCBA 1AY1H 4NKMB 1RK0A 3MUZ1 2Z8SA 3OJ2C 5C8JB 1ZHBB 5BS0A 4G6FD 5ECJE 3HZMB 1J11A 2EKSA 1QZ1A 3NH7H 1EHAA 3QI9A 5KVGL 3MODH 5KSAA 4LARH 2I25N 4LGPB 3FFCA 4JREB 3G6AA 1XIWB 2EEAA 3ES6B 2ZKHH 2P7TA 1JTTA 1UEMA 1C5DB 4PJCB 2V2TB 3ARED 3FN0H 5KOMC 4IOIB 1EAPB 5BV7B 1PD6A 2R1YB 3CDFA 3BPOC 5DVMA 5KAQG 3MLRH 3QQ9C 4I0PC 1TZHA 4U1SB 2ATKA 2Z9TA 3HUJE 1FGVH 4X9BA 4HWNA 1MHCB 3ARDC 4YZFF 5FEBA 1XGRB 3M8OL 5MEND 4XAKD 4BUGA 2JTDA 2I24N 3H3BC 3W2DH 3WUWB 2G2RB 3LN9A 4HGWA 3PL6B 5DLML 4IDJH 4LCWD 1W0WB 5CMAA 5C6TL 1WISA 4Y4KA 5FFLA 2GJ6D 2VDMH 1KJMA 2R0ZH 3RVTC 3TM6A 4YFDB 4X5LA 4NGHH 4L4TA 3QDJB 2ITDA 4KHTL 2AABH 4DTGL 3NIFE 4LPCA 3A67H 3BPNC 3EJZD 4JRXA 4S1RL 5ESQA 2VXQH 4J1UB 3DV6A 4XCEA 2BHYA 3V4PL 3OR6B 4K71C 1CDHA 1DBJH 2R0WH 3T0VA 1LO4H 4P5KB 2V2WB 3EDEA 4TUJA 3CFEA 3W5NA 5EOQH 3ULUC 5I1KH 4FRWA 4PJDF 1V7NL 2OP4L 4LCCA 4ONOA 3FQTA 2IPTL 2YKLL 1KB5H 1DSFL 2E7MA 2FGZA 5TDOA 5DJ2B 2NW2B 4PRHE 4U3HA 3WNPA 3U79A 3PABA 3OR7A 3L7EA 5ESVB 4LK4A 3CMOH 3F7YB 4P9HL 3DTXB 4Y2DA 3CPLA 1GPOH 1GPOL 4OF6A 4H0HB 4HT1L 3WN5A 1FFPA 1IKNA 1CF8L 4JY6B 1BLNA 4XP4H 1HIMH 4PRNB 3MRPB 2MOVA 5C6PB 3B2VL 1OAYH 4DCQA 2NW3A 2HKFH 3KPRE 4L8DB 3QDME 1MEXH 1MEXL 4TOYL 5DQJA 4NHUB 5IMKB 2YA0A 1M1SA 3MV8B 5C0AB 4HUKB 5JPMB 5E2JA 1CGWA 3NA4A 3V6ZA 1KIRA 5BS0D 1AGBB 2V7HA 4KJYB 2G9HA 3FHQA 3KVQA 1FFNA 4OZHA 4EEEA 2AGJH 3QI9D 4JDZA 4WDIA 1LEGA 4WHYG 1LNUA 4ZG1A 1RK1A 3CSYB 5DVLA 2ESVA 5KSAD 1T5WB 4LVNC 4EIZC 2RIKA 1HSAA 1D6VH 2DQFA 3GI8L 3ZTJG 4XWOD 1DUYB 2EYTA 5IVZA 5C70A 5KG9A 1ZHNB 5CP3H 1UCBH 1T0NA 4WRLA 2DQEL 4GAFB 4YDVB 2AKRA 4UQ2A 3O6FA 2NCMA 2BCKB 4URTB 5JIIA 1CFQB 1G7IB 1KLFA 3N06B 3QAZC 5F9OH 5HDLA 1JUFA 1AR2A 2Y23A 1TVBA 1PQZA 4NQCA 1U95A 2BSED 5HHPB 1MI5A 1A0QH 5ITBL 4RMRA 4YXLH 5FM4A 5IJVA 3RU8L 1UH4A 1I7RA 3VW3H 3QSKB 4UQ3B 5K9OA 1AO7B 3SDCB 1R5WB 1W0VA 2YUZA 3O81A 3QB7C 1S3KL 3P9MB 4LSUH 5TE7L 4PD4K 3JV6B 3EZ8A 4YE4L 4KMTL 4MHHI 2YD3A 3C5SA 4G6AD 3UDWA 4HUVA 1RJZA 5GGRB 1VADB 1YNTB 4LFHG 5BW7C 2BRRL 2DIAA 3UYPA 5ERWB 3D5OF 2W65B 1RIUH 4NN5B 4FFYH 1GGUA 5IV2A 1CFVH 1G7MB 3HAEB 1T2JA 2WWMD 1TNNA 4JRXD 1OCWH 1NCWH 1D5IL 1IAIL 4R4FH 2BVPA 1P5UA 2QADC 3F12A 4ENEC 2DAVA 3FQRB 3ZT6A 1QRNE 2EDOA 5I75B 1JHKH 5FUZH 1OWWA 1P4LA 5EBWB 4LHJB 3QQ3A 1BIHA 3RAJL 3VWJB 3B9EA 4HXAH 1J0HA 4K94C 2EDTA 2OI9B 3QH3A 1AGEB 4RRPG 2O5ZH 2O5ZL 3DLQR 3RWJA 3EOAA 1D7FA 2CLVA 5JLZB 3BHBA 1LQSR 4JFYB 4M03A 3VD5A 3S97C 4D94A 1S7SB 5JHLH 1HHGA 2EH8H 5CLWA 1F2XK 4CN6A 1LWRA 5LQBL 3VE0A 3W82A 1DBMH 3NCCB 2R1XB 4FQ1H 5IM7B 5T1LD 4Z7UF 1HEZA 3WIFB 3FO2A 4DN3H 4K55A 2N4IA 2OQJA 3TBSB 3DX8B 1S7UB 4PJHA 3MYJB 1W8OA 3PJSA 3V8OA 4WVRA 4JFPB 3NPSB 5IB3B 2I27N 3STLB 2NX5B 32C2B 1QSFA 4LKXA 1GZQB 3FT4B 4LMQE 2E7LC 3TIEA 5HVFB 3GMMA 2FD6L 4U6HB 3WFBH 3T3ME 5IWLC 4TN9A 4KH2A 1RZJL 3MLVH 3V0VB 5DMYA 3CU1A 2A6JA 2YPVL 4HK3N 3D0VB 2VZUA 2DL2A 4I3RH 1CXLA 5EUKB 4RAHA 4EXKA 1OB1B 2CJUH 3GBNL 4YBQD 5KSVB 2XTJE 3BDYH 2VZTA 1FLRL 3WIHA 4OV5A 3HKFA 1UB5A 1G6RB 1MVUB 3LEXB 4KQ3L 2HN7A 3BO8A 2VDOH 1CLOH 4D0DA 4QHNA 3RNKB 1CXFA 4O5LH 5JNYA 5D1XC 4ODUA 4NQCD 3RZWA 2FL5A 1JHTB 2E7CA 1I1FB 3ABZA 4KDVA 5HJ3B 3MJ9A 1YN7B 4NNXB 1K8IA 4PJBB 1A7NL 1U92B 1I1AB 4M7ZB 4WI8A 3E2HB 2WINA 3P9LA 1INEL 2IAMA 3PHOA 2ICEA 1KG0B 2DIJA 2KQMA 3PWPB 1VGKB 4PRPE 2XNAA 2Y9RT 3L3DA 4JM4H 1PG7W 5AAMA 2VC2H 8FABA 1OSPL 1R5IA 5FM5M 5DJYB 2V9RA 5BRZE 4MA7H 5DTFA 3OSKA 3C5ZD 4CBPA 3UAJC 3NABH 2QJDA 3NABL 4UZGA 1VFAB 1NEUA 4KK5C 3RTQB 4MDJA 4NPYB 4ELME 2P5ED 4HH9A 4MS8C 5DDHA 1PY9A 2PYEB 4JJ5B 1NDMB 5DMIH 4R7DA 4ZUWB 2DWEB 3HMWL 1ED3B 3ILQD 4HUWB 4NSKA 1BVZA 3NFSL 4MJIA 4WWKA 5EZLA 2CR3A 4FQXD 5B4MD 3JUZA 1Y6KR 1EHNA 4NOFA 3X12A 4JPIB 4L29B 3WIHL 2IALA 1YEDA 4NKQB 3QNYB 1NH6A 3KLSA 2F54D 3FB7A 5A2JH 1EGJA 1ZOXA 1NLBL 1N2RA 1KEML 5BXFA 2ADIB 1J88A 4GW5A 2Z93B 2OMNA 5DC9B 5KVDH 4NO5B 4AMKH 5ID0A 1NFDE 1M7IB 4Q0XH 3DMMB 1KXTB 3RIAF 3RUGB 4Q9CA 2MPAH 2MPAL 3GUTB 3BESR 4M7KL 5F1SA 1Z5LA 4I3SH 4XNQB 4P57A 3QIBC 2ERJC 3MJ9L 4X6DA 1AXTL 2C1PA 2RHEA 4ETQB 5EU6E 3FT2B 4MNQA 1KULA 1NBYB 1FLTX 4NJAH 4Y5XA 3QNZB 5KJRH 3HPJA 2V9TA 4XCCL 1SBSL 4G43A 1GGCH 1J05B 2W9DH 1MY7A 4K3DH 3GO1H 2ZPKH 5EIQA 4DVRH 4ESKA 2AJ3B 4JHBA 3TN0C 1I3UA 5EC2B 4PTUA 5GRUH 1LO2H 3PF2A 1U8IA 2GCYB 2DBLH 5CUSH 5CUSL 5TF0A 2DWDA 5F70A 2O5XH 1R3LB 4ODXB 2FIKB 1TTUA 3V52H 4Z0BH 4EUPA 3OAUH 3OAUL 5CWSA 3F58H 1XCTA 5FYJL 5D2NC 1QQDB 3ZKXC 4MWFB 4NT6B 2I9TB 2LABA 3FRPA 3P0VL 3JWNC 3O3BA 4OI7A 2D0FA 1JGVH 3RVUC 4AEHH 1U8JA 1QFUL 3VXRB 5E24E 4OM0L 5AD0A 1E4KC 3LEVH 3LKPB 5FOBB 3KPQA 3ZZ1A 2EIBA 1XCQB 2CKBB 1U91B 1HI6B 2GFBB 1EGJL 1NUNB 4U1HA 4EN3B 5I8CA 4WEUD 1Q1JH 1KJ2H 4I48A 5C09D 2EDLA 1DVFB 4YPGB 4RX4A 3V5DA 1GXEA 3T8XA 1U6AL 5C0JA 2NR6C 3A6BH 4KAQH 3VH8A 3RBGA 3ZE0E 1VFUA 3KPMB 1RUKH 3BZ4A 5B39A 4J8RB 4NKDA 1DLFH 2OK0L 3JV4A 2NNAA 5I1CH 1S9KC 4MDIB 3OKYA 4ODSL 4XGZA 2DI7A 4LASH 3OJVC 4JRYE 2HFEA 2NY2C 4YDJA 4Z7NF 4Y8AA 1I7UA 4WWKD 1GZPA 1VA9A 2SEBB 3FKUS 5FK9A 1QR4A 5FO9A 3SDDA 1MJJB 4MJ6B 3DGGA 3QUYA 5F7KC 3UTTE 1JZ3A 5HYJA 5BV7H 4X4YB 3CVIL 3PV6A 5A3IC 2CDFA 4GKZB 1UM4L 1I85C 1A6ZA 3GJEA 5IVXB 5L2JA 4RWYL 4U1MA 3P4OA 4M6NH 4NN7C 1NANI 1ZA3A 1I8MA 2LVEA 2VDRL 2UZXB 1BEYL 4M9PA 2FDBP 3RVXD 1UT9A 4IHOB 2XQYG 1P5VA 5D9SA 4M62L 3QQ4A 3IDXL 1S9WA 2A6DA 3PHSA 4P46B 2YBRB 1HKLH 4MNQD 3AREB 1A7BA 2Y6SD 2YPLA 4ZUTB 4ODTL 1QBLH 3FMGH 1J1PL 2LE9A 3FMGL 3H42L 1WC7A 3MTRA 4KJQD 4LGRB 4XPFH 2DD8L 2LTQB 3BZEA 4DZ8A 1OW0C 3MGOA 2PUQT 4TVSa 4U6VL 1RVFL 3D69B 1LD9B 3KPSE 1HK6A 3MNWB 1PX3A 4OCNC 2ADJA 5FV2A 5MENB 2E27L 5SWSE 1MHHB 4I18B 1CLCA 3BH8B 2JB6A 4G7VL 4PJXB 5TQ2H 4BSVB 4NZUH 3VXMD 4LCWB 4OLXH 1WITA 3U0WH 1FL5A 4PY8J 2GJ6B 4ZYKA 4G6ML 5FYKH 5C2BH 5C2BL 2Y07H 2F8VA 4QY8A 5CHNB 4E41A 1ZEAL 2E8ZA 5CILL 1QSZA 5I8KH 4MAUH 3ULVH 1K2DB 4NZDA 3E6HB 1ZLVK 3BN9D 2BHZA 4JO3L 4KJWC 4HKJB 3KXFE 5IBUB 3IDIB 1RZIA 1NUFA 1YEEL 3UBXB 1MCKA 3KPOA 4R2GC 3VD9A 4ISVB 3GRWA 4PJ9C 2EZ0C 3ZKSD 4X7DC 5HXMA 1YC7A 4PJIA 4NC2B 2DQCL 3QXTA 5DD3L 4L1DA 1ZHLB 5INDB 4RQQA 3S4SA 2D7PA 4O9HL 1ONQA 4KHXH 4UTBL 1R24B 3O9WC 3M17B 3VA6A 3CXHK 4IMLB 1CG9A 1N6QH 3VXQA 4WHTB 1MNUL 5IK3B 5CFHA 4XC3L 5HVHB 4M1CC 3HNSL 2DQHH 1C16B 3NACL 5E2TH 4MQSB 3T1FB 2O5YH 5EU5B 1R5VA 5DQDL 2DMCA 5F97E 4CU7A 4UNVA 5F96H 1I8KB 1TVDA 3SDDD 1BVLA 2UY6A 4P2QE 5SWZD 4GMSL 3QUYD 1A3LH 5HYJD 1NC2A 4NYLA 2X4RA 3C6LC 3MC0A 4ZUVB 1MI5E 1KB9J 1ZT7A 5D6DA 3KWWA 4P59H 1P4BL 2Z31A 1WAAF 4G6JH 3GFUA 2FEDD 2EKSB 3GK8H 3MRCA 3FQWA 4HFWB 3O41A 3SKOB 5I76B 5GS1C 4PJEE 4OTXL 1BWWA 3LMJL 1OQXA 2GHWB 4HWUA 1MY5A 4TSBL 1X5YA 1H5BC 4MXWL 5ANMB 2QKIA 5DS8A 4OF3A 2Z92B 4HJJL 4OKVA 2CIKB 3DOSA 3G6AB 3DXAE 4FMFA 4X80H 4X80L 4NRZA 5E8PB 4G8GE 4FQLH 3LAFA 3LPFA 4CJ0A 3MCKB 5D4QA 4PP1C 3U6RA 4WGVB 1UWGL 2G75A 2MNUA 2ZJSH 5CEZH 3FB8A 2YPLD 3FB6A 4PG2C 1A22B 1KJ3H 2NY1C 3CFJB 5C2UB 2V2XA 3HAEH 2ICES 3I50H 5F6IC 4HIXL 3GRWL 2DI8A 3A6CL 5EZJA 3QDGB 5ABDE 4WFGE 1ZVHA 5KS9B 1S78D 4MNHB 2ATKB 5E8DH 2X4OA 1JYNA 4EQ2A 5C3TA 1MJ8L 4Z76A 3RIFK 3VXSB 2WBJC 1F2QA 1RJCA 5KW9L 4JR9H 2NY3C 4D0BB 3O4LD 1ACYL 4S11A 1E4WL 3MNVB 5CMAB 1LO3H 4J4PA 5I17B 1KJMB 4HKXB 3S3JA 4F58L 5JPNA 2WQRA 2MKWA 3UO1H 1Z9OA 5D5MF 3QRFM 1YEKH 4PG9A 5DGQA 3VFOA 5BJTB 1YC8A 4G8IB 4C56A 1BVKB 4OZGE 1AQKH 4LMQI 2HKHL 4FTVB 1N0XH 4DQOL 4JRWA 3G08B 4X8JA 4MNGA 1CLYH 3G6JB 4TUJB 3KYKL 3U82B 3DUSB 1BQHA 1C7TA 4ZTPH 4OUUA 1MCHA 1O0VA 1UXSA 3FRUB 5EWIH 2D31A 1W2KT 1G7JA 3VJ6B 1MAJA 3FQTB 1X6LA 5T1KD 3NFNA 3WXWH 2C7UA 1FIGL 3OR7B 2BDNL 1JPTL 1YJDH 2C4XA 4LGSB 4UT9L 3P4NB 3VXTB 5IVNA 3H9ZA 3N9GH 5K9JL 1I9RL 3O3EA 2ZNXA 4KKNA 5FO7A 3SDXA 3BZDA 5T1LB 3WN5B 5ADOH 4KV5F 1Q9LA 2VH5H 3MO1A 4RFNB 2AXJA 1FFPB 3BIBX 4KI5C 5HHMD 1JMZA 1IM3A 5E1AA 2EE2A 2BVOA 4DN4L 1DEEB 4LIQH 1TFHA 2H1PH 1XF3B 1OP5H 1KBGH 1JE6A 1T0MA 2FWOB 2WP3T 3G5ZA 4DCQB 3CCHB 1BMGA 3P40A 1JYWA 3DURA 1A4JA 3PDOA 3GSVA 5JDSB 1WK0A 1NC2D 1YECL 2PKDA 3HZKB 1KIRB 2EC9U 4ZFOA 2VIRB 2G9HB 4OZHB 3FN3A 5E2UL 1D9KA 4JDZB 4PS4H 4LSTL 4ONHA 3UZEA 3HFMH 1DR9A 4JKMA 2BY3A 3PGCB 3IFPB 1FO0H 1FO0L 5IVZB 3WMSA 5KG9B 3OB0H 1IGYB 1CXIA 2GYSA 4UQ2B 1DQQA 1QFWM 4AH2A 5HYIA 5DYOA 4GG6B 2JJTC 2XT1B 2J6EA 4QTIL 4OGXL 5F9WC 1RJLB 2C1OB 3MFFA 3EIFA 4QYOA 1TVBB 4RGMB 1PQZB 3UC0L 5HD8C 3TLRA 4Y7MA 5D1QC 1IM9D 4XVUD 1CGUA 5IJVB 3O2DA 5E0QA 43C9A 1FZKB 1ORQB 3EYSL 5GS0H 1CR9H 5FYJE 2VKXA 1RUAH 4KPHH 2XQYK 4LPVA 2AJZA 1IZKA 1J0ZA 1KPUA 4X6CA 5EU7E 5KSBE 5CCKH 4KTDL 4MAYA 3G6DH 1I8LC 5TE4H 2H9GB 4HUVB 5AYUH 4BH8A 5FKPA 3D2UA 1FL3B 2JJVA 1V7MH 3C5ZB 2KUTA 4MB4A 4KROC 5DI8B 4WENB 4YHOH 2HH0L 3DBXA 3SJVE 4ZS7L 3S8WA 4OCYL 2IBZX 3OGCA 2EIEA 1N5YH 2P5EB 5C0NC 4L8CB 3NAAL 4ZPTA 1JWSA 5MP6L 1S7XA 1UWXK 1BF8A 4X6DE 4WW2F 2X42A 3QUKA 2HWZH 4ZFOL 2PW2A 2VLMD 2VXTH 2VXTL 4FQXB 2XPGB 4NO0D 4W6YB 5E9DA 2XICA 5HDBE 3F5WB 3WJJA 5DZNA 4ZUSB 1LHZA 3J7HA 3WXVH 2F58L 1HHGB 4PJCE 2OJZL 2F54B 2UYLB 1I9JH 1BZ9B 5IB2A 1EMTL 1IAOB 2Z8VC 1AD9A 4KGJA 1IJ9A 4XBGA 3FCTB 4QHLA 5M95B 1HHHA 2LU4A 1MFAH 2J6EL 2F9BT 3SDYL 3TV3L 4Y4HD 2X70B 5FO8A 5JXED 1K8DA 1QYGL 1CL7H 4Z7QF 2VQTA 4NWTL 3ARGC 5LVEA 5HVGB 5F1OB 4MA3B 3O2DL 3TIEB 3GMMB 3NIGF 3X14A 4WY7H 1ZXQA 5I74B 2EDRA 4ODWA 4P99A 3L5WB 1J7VR 3HZYB 1F5WA 3OKKA 4UMGA 4AM0B 4IOFC 1HYSD 4P23C 1RHFA 4DEPB 2H3NB 4S1QH 1FH5H 2VABB 2MJWA 4LLVA 3MZGB 1PVHA 5I0ZA 1G1YA 3K2UH 3GHBH 3V7AG 4OLVH 1UB5B 1UG9A 2D7QA 2CKBH 4ZQKA 4XXCC 4DKFL 3QXAA 1TENA 1CICA 4D0DB 4G8EA 5CGMA 2AJSL 1TQBB 3U36B 1BWMA 4R96A 4LPXA 25C8H 4KUZH 1WAAA 5A2FA 1WSST 4XHJC 3VRLF 3LKQA 5L6YH 1KCRL 4XPHH 2ITCA 2AW2A 5FYKE 3RHWK 3KNBB 3KYMB 1K8IB 4RGNB 4I9WD 3KLHC 1A4KB 3KYNA 3ULVE 4XMKL 2IFFH 5B8CC 4NM4H 1URLA 3W9DA 3O0RL 2ICEB 2B4CL 3PHOB 5K9QG 3I75B 1MREL 4XPAH 4X0KB 5I71B 1KTLA 3L3DB 3VA2C 3B9DA 4DVBA 3IFNL 5MHSD 3IFLL 3CIQA 4D9QD 4TVPL 4Q97A 5GGSB 5C09B 4HJ0C 3SKNA 3IKKA 12E8L 4DK6A 3UJJH 3FN9A 5IFAH 4OGZA 5DFVD 2PXYD 1NGWB 5C0AE 2VDNH 3ZDXE 3WV0A 3NMEA 5CS7A 4N5UA 1U41A 1MVFA 5GISH 1QLEL 1U8NB 4LVHC 2QTEA 5J3HC 3ZSSA 4LL9A 5EZIH 3PWLA 2RAMA 2FB4H 4TYUA 2QSCL 3T65A 2V5MA 2FEEI 2IFGA 4WWKB 2HYMA 5EZLB 3RQ3A 1RMFL 5CJ5A 1HNGA 4K7FA 1YNLL 5CZVH 1KCKA 5E9DD 4CW1A 3Q48A 1NBVL 1J5OL 3QFDA 1KGCE 1YEDB 2ZCLL 4M6OL 1BQUA 3OKMA 3QCTL 1ZGLM 4TVPD 4WHCA 3IDUA 4XI5D 5C71A 1N0LA 5ID0B 3OX8A 3P4LA 4RA0C 4UU9B 1J86A 2CR6A 5GGVY 5BVPH 3GB7A 1C7SA 4P57B 4DKAA 2CGRL 1AO7E 4NUGL 3ULUF 4NNYB 5I1JL 43CAA 4YC2C 4E41E 5IT2H 2DJSA 3E2HC 1P84J 3CVHH 3CVHL 2BNUA 3LHPH 4U1LA 2IG2L 3VFVB 2CK0H 4Y5XB 1IBGH 2EDKA 3BEVA 4G43B 3LQAH 3CZJA 1IGTA 5I2IB 3H0TA 4LKCA 4L9LC 1YPZF 3H7BA 1YA5A 4LEOA 4MCZA 2A9NH 4PTUB 1U8KA 2DQDH 1U8IB 5EUOF 1OAUL 5IROC 3BAEH 3BAEL 4PTTA 3RWEB 3RTQC 1SEQL 3VXMB 1CD9B 3HB3C 5L7XH 3I84A 5DUPL 3HE7A 1C12B 4JDVA 2DLGA 4F9LA 1G9NC 5CWSB 1A14L 4GXVH 5D2LA 1XCTB 2IAND 3QEGL 1WZMA 3MRHB 4MQ7A 1T04B 2BOBB 1AHWA 3O3BB 3F62A 3TO2A 4HKBA 1EEUA 4YUEH 2R2EB 3P77A 3N85H 1V5JA 5C07D 2YMXL 3MACH 5IJKA 5FYKU 1LP9A 4IRZL 5GRJL 3IDMA 4BJLA 4I48B 3LD8B 1YEHH 3GSUB 1RZ8A 3T8XB 4HGMA 3I6KB 3DMMC 2FYYB 3NA9H 4YDKL 5JZ7D 4PJFE 1MFBH 2XWBB 5FV1L 1MRCL 3BW9B 3BZ4B 3OZ9H 3B9KA 2R1WB 4D8PA 3GKWH 3W81A 1IKFH 4NKDB 5CEXB 2HVJA 1K5NB 5JUEH 4XTRD 5ELIA 1NMAH 6FABL 4ETYA 1Q8MA 2OTUB 4F7MA 1KCUH 4JKLA 5EO0B 4P4KC 2VLKD 1GZPB 4BSWA 1Q94B 3PGFH 3TNMB 2CXKA 1BJ1J 4PJ7A 4LIQE 5FO9B 2EE3A 3SDDB 3KJ4C 2X4PB 2AEQL 5SWZB 3DGGB 5HYJB 2LAAA 1JPSL 2FHFA 2W9EH 4NIKB 2HT2D 3WS3A 2CDFB 2C3HA 1FVCB 4R0LA 2XV6B 4J2XA 1QLRB 2OXHA 3VXUE 1KCVL 4NO3A 4U1MB 1RU9H 1RU9L 5EA0H 2XN9A 1ZA3B 1G0XA 4FXGA 5HYSA 1QFOA 1NCUA 5K9QI 3WUWG 4HAFA 3QPQC 2I60H 4GS7B 2NY4D 3D25A 5D9SB 5EO1B 1FL6B 3DIFA 5ADPL 1DQMH 2VLJA 3PWJB 4M5YH 4M5YL 3GMNB 1S9WB 4D9LL 2R29H 4JY4A 4KMQA 5B38G 2YPLB 5GXBB 2B1HH 1U2HA 5FB8A 3O6LH 3KR3L 1WC7B 1YMMA 3MRGA 4UDUB 1PSKL 4EXPX 1L9NA 3RWHA 3RI5F 3C5JA 3SOBH 4HLZH 2FLRT 3MNZB 1U3HD 2NYYD 1EA9C 5GGUB 4BFIB 1U58A 3REVA 1YYLL 1CFBA 1YEIL 4RDQG 4BKLA 5GHWH 5BZWB 1KLUA 2FH6A 2PYEE 3O4LB 2YZ8A 5LXGL 1FL5B 3OGOE 4ZYKB 5DJXA 4XRCB 3C8HA 2DM3A 2MHAA 4Y16D 4XB8A 3ME0A 4XT1C 4QY8B 1INDL 1QSED 3B3IA 2F5BH 3AS0A 3P11H 3ZL4L 4DJMA 1NGQH 4O00A 3ZTNH 3ZTNL 3MLUH 5C7XH 3M1BA 4Z9KB 4R4ND 2ZG1A 4F57H 1RZIB 4IS6A 3VGDA 2W0KA 5GRYA 2H41A 1TJIL 1QVOA 3GIVB 4JN1H 3GSWA 2XYCA 3CU7A 2RCSL 1F6FB 2JB5L 2VDQH 2WUCL 4M4RA 1MJUH 4KXZI 2NXZC 5F89A 1DBAH 1OSZB 3CUPA 1F90H 5T1KB 2DDQH 1FYHB 3DSFL 1MRFH 1CGXA 4NWUH 4P2RA 2ED8A 2CLRA 4HIEA 3OHXA 3UPRA 4EI5A 1ONQB 1AD0B 5LWYL 3ZHDA 3L3OB 3B9KD 5ACZB 3DX9A 1FGNL 1YN6B 3DVIA 3LKNB 3MX0A 2IMNA 4OCRL 5HHMB 3U7YL 3MXWH 3PIQB 3KJ6L 1A7PL 5D93C 3TGXA 5FYLD 3BT2L 1R5VB 4N90E 2EDBA 1IVLA 1GC1C 4B0MM 4LLAA 5CJQH 2GT9A 3BPLB 4IMKA 1BOGA 1WT5A 2VR5A 4M93B 4HIIA 5DEZA 2DQIH 5HYFA 4QOKA 1TCRA 1NC2B 5I1IH 4NYLB 4OD3H 2X4RB 4NKIH 1A3RL 1KTKE 3CFBA 3MLTA 4J23A 5L9DL 1FBIH 5C9JB 4B50A 1ROWA 2FX8L 4WUUA 3T4YA 3EJYD 3GNMH 4GMTL 3DJ9A 3AS1A 1NEZB 1KNOB 4QRSA 1MCCA 1FC2D 4XX1E 4F9PC 4JZJB 4V1DA 1EJOL 3ZDZE 1AJ7H 3EFDH 1FFOA 3BEWA 4UT6H 5DS8B 3R1GH 5I1LA 2JJUA 2ZUQC 4N1CA 4HX1A 2J8UF 3TEUA 3LRGA 3U7WH 3EJZC 2FX7L 3NN8B 4HV8A 4YX2L 1XMWA 4FABL 3HMXA 2G75B 5E2WL 4JQIH 4JQIL 3DARA 3FB8B 3FB6B 3HAEG 4JFFD 4OZIF 1GRWA 4KVCH 4Q9QH 3MXVL 2B0SH 1IILE 3MRQB 3A0OA 5D7LA 5INCA 3GMPA 4CMMA 3Q6FA 2X4OB 1IAKA 5H2BA 1NAKH 1NAKL 5DXWA 1IM9B 2VJXA 5K33A 2QQLL 3AAZB 2BNQA 4P9ML 3QHZH 1KTDA 1VENA 3BKJL 2K7QA 2PO6A 2B1AH 2B1AL 3S37H 1IGCH 1IGCL 4XC1H 1H3PL 3VGAB 1IFHH 3WJLC 4W6XB 5FHBL 4JN2B 3CX2A 2VXUL 3MRNA 2QQNL 1UVQA 4U1IA 2WZPD 3PGDA 4MSWB 1F3DH 3DROA 4Z7VA 4MQTB 5JPNB 3AM8A 4K3EH 3CFKA 5DD6A 4OIIH 2VN7A 3I9GL 5J89A 3NZHL 2KQNA 4XB7A 1G7QA 3TT1L 2Q7YB 3PQYD 2W92A 2VXVH 4OJFL 4AENA 4H88H 1N4XL 1UH3A 1DZBA 5F1NB 3G9AB 2F74B 3G5XA 1CIDA 4PY7B 5LGJB 3TCLB 4NO2A 5SWQA 5A2LH 2Q3ZA 3I3DA 3QWQB 1A7OH 1BGXH 1CE1L 5IVXE 3OTTA 1BJ1H 2WSKA 4UV7L 3LH2L 4RMUA 2VXSH 1KCSL 1UXSB 1IEHA 3ZKMC 4ZTOL 3UMTA 3IB4A 3ULSA 2WP3O 3QI9C 1FRGH 3DUHA 3NFNB 5M94B 4RFOH 5KSAC 4PR5B 1TQCB 4P9HC 4NO0B 3L5HA 4X7SH 1FNEA 3BP5A 3VG9C 4XWOC 5F72S 2C4FT 2D7TH 2R56L 2X4SB 5FO7B 3V5HA 1R3KA 1N8ZB 4MD4A 4NC0B 1YQVH 3HMXL 3K4DA 2H6PA 3MO1B 4G6KH 5JXAL 5AUMA 4AEFA 1OD7A 5DK2B 1ES0B 2BVOB 1SEBB 3CK0H 1FYTD 3U4EA 2FRGP 4P2YA 4Y4HB 2H26B 2WUBH 3G5ZB 2X9WA 4XCNA 1CVSC 1PG7H 1T5XA 1YMHB 3JWDL 2VWEE 4TSAH 1HNFA 1EPFA 5MENE 4WTZG 4FQCL 5J8OA 1S5IL 2MCG1 5ITFA 1HH6B 5HGBA 1JNLL 1N7MH 4PJXE 3WHXA 5I18L 1HDMB 1RURL 3REWA 1UQSA 1XH3A 3MRJB 3QPXH 4I0PD 4UAOC 2GJ6E 5L0QB 1E28A 2J2ZA 1I8IA 2A9MH 4Y4KC 3ARDD 3HNVL 3RWIA 4YHKL 3ARVA 1D5BA 4ZS6D 1A9BA 1N6VA 2WWMC 4X9GA 3BIAX 4PRAA 1YEGL 1IC7H 3TZVA 3WSQH 3FQUA 3BMVA 5JW5B 3RVTD 4UNTA 1IT9H 2CO6B 4OIBA 2IPUK 1Z9LA 4FQQB 4YDLB 4L3ED 3JWOL 3SE8H 3MFFB 4HUUA 4QYOB 4LCCC 2IMMA 5IGXH 1YY8B 4G42A 3H9SD 4LDEB 1V3KA 43C9B 3I6LD 1NL0H 5T5NF 3C09C 1CFSA 1UWEH 2FNBA 4EOWL 2Y7QB 3ULUD 5F21B 4Y2DC 4N5ED 1NPUA 1QBAA 3NCEB 5E4EB 2FX9L 3GI9H 3WN5C 5BO1L 7FABL 3TF7C 1S7RA 2CDEB 1KPVB 3LVEA 4RFNC 4HWEL 3AUVA 1ZVSA 1ZLSH 1OAKL 2MFNA 4ERSL 1JRHL 2WIIB 4I13B 4ZSOB 5HDQL 2PXYB 3OGCB 1R6VA 2CUMA 1D6EA 4U7MA 5D70H 1XGUA 1JWSB 3H2WA 1S7WA 4QHMB 1QKZL 1UM5L 5I66B 4EDXB 5J11C 3K4ZA 1CDBA 1FQ9C 5HHVH 4C83A 1ZMYA 4OFKA 1WQVT 2DBJA 4F33A 2MQ3A 3QRGL 3GKZA 1EHLH 1EX0A 1IGIL 2F53A 5E9DB 1QLFA 1OLLA 2J5LC 3S36H 4R90L 3GBLA 3RDTA 3QYCA 4I2XA 3FZUC 3ESUF 1OD9A 1JFQH 4CVZA 1ZS8B 4MMXC 3O6FC 1AD9B 2R4SH 3B6SA 4LLWA 2ZUYA 4FP8H 4QHLB 3QDGE 1C5BL 3RNQB 2V7NA 3GGWB 3WKML 3O3DB 4GSDH 4PGDB 2QSTA 2BSTA 1K8DB 4TULL 4RMVA 1RIHH 1RIHL 5F71A 4UB0L 1W0YT 2FJGA 3VXSE 3HC3H 2HT3C 3MLSH 2DJ4A 5HYQB 1FG2A 3TBTA 4XX1G 4ODWB 4N8PA 1RZJC 4P3CH 5DHYA 3EO0A 3UTQB 2NY5H 4CGTA 5C1MB 2R23B 3UDWC 3WO3B 3CFDB 1JN6A 5FAAA 4TUKL 5E08L 4YWGL 2APTA 5IMMB 2BSSA 5EOCJ 2OL3B 2Y36H 1ZT1A 4YGVA 3H9YA 3TZVD 4YHML 4FTVE 3R06A 4PYHA 3MJ7B 3IDGA 2PR4L 1F13A 2O61B 3HI6H 5C0BA 1BECA 3L3KA 2HRPL 3S88L 1T4KA 3G6JE 4G8EB 4WI3A 4Z7OE 1MAML 2NY0C 5T1DL 1A1MB 1F4AA 4H1LA 1KT2B 3NGBB 3LKQB 1VSCA 3ILPB 4XP6H 3ILQC 4HCRH 4Y5YB 2IANB 2QADD 1GOFA 4P2OA 4ENED 1CDCA 3O3UN 4RNRB 1SY6H 4QNPF 3BVNB 1QP1A 1T1YA 2J8UA 2AJVL 4LCUB 4JCMA 2RGSA 4JKPL 5GGVH 4BZ2H 5FM5O 5C07B 1L7TL 5I15H 1DUZB 3N1FC 2EDHA 2R69H 1B0RB 5C0FA 1JI2A 3B4NA 4JKWA 2J8OA 1T7YA 1CT8A 1I9EA 3QULA 1SMAA 2A73A 5F7DA 1TDQA 5I1EH 1NJ9B 1BD2E 1WUNT 5I1EL 4JHAH 3CLFH 5JHDE 1D5XB 3BWAA 2XN9E 1FCGA 1SJHB 3H8NA 4PJGA 5F8QC 3P30L 2QHRL 3CH1B 4PY8I 4R97C 2X40A 3BISA 4A6YA 3L1OH 3U83A 4MLIA 2YD4A 1LO0L 1RUML 2VLJE 1A7QL 5J13B 3VFUB 3MLZL 1FJ1B 7CGTA 3GMRA 2VDKH 4PD4J 4ZFFA 5D71H 3T65B 4OM1L 2RB8A 1ULVA 4YFLI 2VLKB 2V17L 3T0DA 4KZDH 1L7IL 3BH9B 2YEZB 5D5MB 1QO3A 1I9IH 1YMME 2ZWLT 3BYTA 3TBWB 2DMBA 4HPOL 2XACC 1Z0MA 3IU4L 3QFDB 4KTYA 1RFDH 1OT1A 4LLMA 3NCJL 3UROR 2JJSA 4IRSA 2DOCA 4WU7B 2EH7L 4AL8L 3RJDA 4LAQL 3DI2B 5D7IF 4GG6E 2EICA 5DO2C 2OTWA 3SGEH 1X4YA 1TQBC 3RVWD 4C54A 3EOYG 2HVKB 4YEFA 1Q72L 1PZ5A 2NY4B 3MZTA 5CJBA 1LE9A 3GB7B 3BJLA 2NZIA 3T08A 4PLKD 5EFIA 5TE6L 4FNLL 5DGRA 4I77H 2IAMC 3GSNB 5DR5H 1MHPL 4MJ5B 5I71C 1IGTB 3V0WL 1OGAD 1QHOA 4YLQT 5A2KH 1VACB 5IBUG 5EU3B 2CO7B 4QRTA 1U3HB 4LKCB 1MFNA 1OP5K 3ARQA 3NTCL 4LEOB 4AEIH 4AEIL 1NSNH 4KI5F 5FGBA 2P5EE 2VE6A 2W60B 2R0LH 2BRQA 4RGOL 3BWUC 3CLEH 3L3JA 2D4FA 3QEUB 2GSGA 1GIGH 4F15B 4P2RE 5FECA 1A6AB 3P0YH 1T0PB 5JQ6L 4JFOB 3UAJD 4A6YL 4OLZL 2H45A 3STBA 3ALPA 5J6HB 4Y16B 5BOPA 2XA8H 1XGYH 4P48A 1QSEB 15C8H 4DKEL 3WNNA 2YOCA 2AK1L 1IAIM 4WWKC 5DC4B 3MROA 1KXQE 4KY1H 5EBMB 5JIKA 4WTXA 3O11A 3WIIH 4HMCA 4OD1L 4UILL 1UZ6E 1BFOA 5EBLA 2F54E 1CL7I 2HFTA 3OB0K 3GSXA 2UZIL 2VITA 3WFCL 2ZCKL 1E6OL 3RZCA 3N1MC 5A43C 1DQJB 3IAPA 4F7PA 3IDMB 4TPRH 2Y5TB 1FG9C 1UJ3A 1WFOA 5IG7B 4ONFL 5HHQA 4HIHA 5JOFB 4HULB 4JHWH 1QR1A 1IGJB 3B9KB 4Y8DC 4U3CA 3MUGB 1Q9KB 5TFSH 2HVJB 1KFAL 3MRRA 2Y6SC 4OSUH 3DV4B 4F7MB 5HBBA 4Y5XC 4AEEA 4KJQC 4S2SA 1WV7T 1PFCA 1LO5A 4PV8A 3QIBD 4U05A 2IPKB 4KU1A 2FR4B 4NBXB 5ID1A 4HK0B 2KH2B 4AT6A 1F58L 4R26L 3D85A 3E8UL 2Q6WA 3BKYL 4XVSL 3HR6A 4C57C 1BIIA 4M7LH 5KANG 3OKNA 1N5AA 3QG7H 4R0LB 2F19L 4PJAA 5EOCH 5J1SC 1DE4A 2BNQE 3TNNA 4JLRB 4U0RB 3TN0D 1H3UA 3H6JA 4WW2B 3GBML 1KC5L 2R8SL 4YHLL 1J8HA 3MV01 4RGNE 4JZNB 2Q8BH 2IGFH 3W0WA 4PGEA 3F65A 3PE9A 2CDGB 4HLJA 3IXTA 1G9MH 3QFJA 3QEHB 1HZHH 3RJQB 4OV6F 4JFFB 5ESAA 2BMKB 1FIEA 1V05A 4HLZG 1VCAA 3RWHB 4U2ZA 2XY2A 3MRMA 1ZLWH 4D9RD 5I30H 3SHSA 4S1SH 4M48H 5GGTH 3KPLA 4IRJA 2ICWB 1RUQL 3BRDA 4H8WL 5F7EH 3LN5A 2BK8A 1OARH 4O4YH 1AE6H 1HWGB 1TETL 1U8PB 4YXKH 4YXKL 5DJXB 5B21A 3MBEA 1OPGH 5DRWA 4DGVL 1E4XL 2EDEA 2FGWH 3HI5H 4XCFH 3TWCH 4BQ6A 4ZXBA 5F1IB 5BZDA 3PQYB 2XQBL 5CKGA 3SDDC 3QUYC 1FNAA 1F4XH 2MCPH 1H0DB 1T6WA 4IS6B 1QVOB 2VAAB 4LPTA 5HSFA 1A1NA 4XMPL 4YNYA 1QA9A 3T2NH 4L9DA 3HNTH 4PJDE 1X4XA 1A7RH 5E7BA 2EYSA 2BOCA 3CXDL 2ILLA 1O7VA 4YXHH 1XR9B 2PYFB 3E1F1 5A3ID 4N8CL 3C60A 4WCYH 4HIEB 1DBKH 4QRRA 3HUJF 5CD3A 1M6OB 3I6GB 1QSVA 4P4RB 3DX9B 3VFMA 1CFNA 3B5GA 4LCIH 3SQOH 4M43L 4IOSD 1N64H 1JI1A 4LLUA 1S7TA 4BM7A 4GH7B 1T89A 3T0AA 1WBZA 1JPFB 1FYTB 1DQDH 1DQDL 4CAGA 4BFGA 3MV7E 1S78C 2GT9B 2P5WA 4HIIB 3D85D 1MF2L 4JHZA 4G5ZH 3TBVB 1C1EL 4JFDA 5IHZA 3BGAA 4NQEE 3QIWA 3BPOB 3T0EA 1F11A 2L7UA 3VXME 4I0PB 4Q2ZA 1F3JA 1UKSA 1FPTL 2HJFA 3RGVA 1DANU 4BFBD 3QCUH 2GUOA 4M61B 3ARDB 4X7FC 4E0RA 1T1WA 2OR9L 5DJ6A 1TZIA 4Z77B 4ORGA 5JW3H 1NKOA 1J8HD 3R8BB 4HX1B 3VRIA 4TTGA 2HTKC 3IAQA 3K8LA 4HV8B 4CKVX 1MWAB 3I2CL 4F37K 1BBDH 3TC9A 1Z3GH 2YK1L 3PWVB 3QCVH 4L3EB 1XZ0A 3ZE2F 3BGMB 5BCAA 5CBAA 3MOBH 1NKRA 3BPNB 5ICXB 2YD5A 1H15A 1JNNH 4U49A 3IGAA 5DD1L 4JDTH 4JDTL 3AY4A 1JK8A 3WL9B 4X6FA 1IAKB 4KJWD 4K71B 3H9SB 5JR1H 2BX5A 2QLVB 2BVEA 3C08L 1CGVA 2QSQA 3VFGH 2EZ0D 3KS0H 4H0GA 2APFA 3MRNB 4NJ9H 4U1IB 1EFXA 1XF5B 5C0CA 1D3CA 4FZEH 4PJBF 3MCG1 3V6FB 5KANI 2ED7A 5IW6B 3O9WD 1X5LA 5CIPB 3BQUA 4NDMB 3MV9D 2DLIA 1YPZB 4M93C 3G5XB 1CD8A 2EDDA 5IEKA 3MRLB 1X5AA 4UNUA 5EUOB 4U4BA 4KRNA 4WFHD 5JW4R 2Z35B 4DGYH 4XP1L 4YFLF 5DMKB 4UTAH 2J4WH 1RHHB 1FNSH 1HCFX 2Z31C 5D6DC 1XAUA 5TPWH 5TPWL 2Q76A 1UYWL 4LNRA 1GGIL 3GDBA 1NCCH 3WD5L 1FSKB 2X1PA 4E5XA 4K3JL 1XF2A 1NCAH 5K9KB 3UTSA 3EYVA 1ZGLA 2IQ9H 3DSNA 2AJYH 1PZUB 1EEYB 1JWMB 3AS2A 1H3GA 3V5HB 5LCVH 4XPBL 1X5FA 4JPWL 5GSVA 1A21A 5DJCB 4MD0A 4CJ1A 5JIPA 2H6PB 2OBGA 3T77B 4Z7UE 1ETZA 5GSRA 4GKSB 4LVNB 1YNKL 5GZNC 2OL3H 5KSUA 5SV4A 3WNMA 3IDJB 1F4WH 3DRTA 3DETC 5GGQH 4Y19A 2GI7A 1AXSB 1T20B 4M1GL 3CX5K 4PP1D 2O93L 3INUH 3X13B 4JFDD 4OF0A 5HHOE 3QAZB 3QIWD 1JZ4A 1ZTXH 4YHZL 4YK4C 5DD0L 3T2QA 4HS3A 3RUGF 3IF1A 4UIKL 4K07A 4IM8A 1I8IB 2J12B 4J4PC 3CXHJ 3VDAA 4Q9RH 5TGBA 4N0YL 3UTPD 4FXKA 4PRDB 3BP7B 4LCYB 5IB1A 4AY0A 2AK4A 5I1GL 1A9BB 2WBJD 2NY3D 1TZGL 3RWCA 3D9AL 1ND0B 4F3FB 4Y1AD 4L4VD 2D4DA 3TZVB 1U8OA 3ZHLA 1WBYA 1NLDH 2Q8AL 2Y4SA 4X4XA 1AKJA 1P4IH 3HR5A 4NCDA 5IBTL 2ICWJ 3ZO0A 4NM8H 5J9PB 2VL4A 3QJFA 5D1ZA 4LOUC 4O02L 5GJTL 3O2WH 3MJ8A 2QADB 3FONB 1UA6L 3VXPA 1T03L 1XR8B 4ZOBA 1L0QA 1F6AA 1G9EA 1OTUD 4PRID 4X6BA 5IFJA 4U1NA 1UZ8A 5HI3C 3QUMB 3LS4L 2GIYA 3BUYA 4XH2B 3V0AC 3L3HA 5CGYC 4LVOC 1VFOA 4RRPA 2UWEA 1M71A 4JFED 5T3ZH 1IMHC 3SE4A 2OSLB 3OJMB 5E8NA 5CJOL 3V5KA 3WFEL 1CLZH 4K9EL 2CK2A 3IETA 4HKZA 1NGPL 3ESVF 3HZVB 5CINH 5ALCH 2MWCA 3BQUD 4LSPH 2UUDH 1B2WL 2F5AH 2AXFA 4NC1E 2HJLA 4KI5D 2IQAA 2ZP0T 3WFHA 1YEFL 1JZ6A 5J1AA 3MLYH 2JK5A 1HKFA 3S34H 4RFEB 2GAZB 5L0QC 4ZDHB 3O8XA 1VPOL 1D9KC 1XGQB 3GIZH 2I07A 3FOLA 3LY6A 1AQDA 1EZVY 3EO9L 1NGYA 4HC1A 3LN4B 1QBML 3GSNH 2C26A 5EC1B 4JPVH 5D72L 1A6TB 3HN3A 5I19L 4KMLB 1PY4A 1UM6L 3MRDB 1YEJH 1RIVH 1RIVL 3BKMH 3TIDA 1A1OA 3B6SB 3QWRD 1A6VH 3BN3B 3IFOA 5D6CA 3VXNA 3MR9A 3MLWL 4HH8A 4Z8FH 3DHMA 4Y19D 3GJFA 3CNKA 5MEQA 3DVGA 1U8QB 2R9HD 3TH2T 2APWA 2FJGB 3AXLA 3IDNA 5GRWA 3TPUB 5F9JA 4P2CG 5ETUA 4DFHA 5DMGD 1A6WH 5LGKA 3EO0B 3GSQA 4OCSH 4MAYC 1UKTA 2ZUSA 1K6QH 4XP9L 5E4EC 5D1QD 5I1HH 4OB5L 4FFZH 4OLUH 3ORJA 4OLUL 1W8NA 1OGAB 4XPGL 4UBDC 5J56B 4DZBB 2YN5A 4JM2A 1K4DB 2QSVA 4PJ8A 4N0UB 3SGJA 3MRIB 1BBJA 1MIML 3KLAA 3MBXL 4F37F 3OPZL 3R06B 3UYRH 5DFVC 5BMFH 4XVJL 2PXYC 3HS0B 3GM8A 2PCPA 3S96A 1EO8H 1T2QL 1BZ7B 4KROD 3K8MA 3KYOB 1X4ZA 3QUXA 3DNKA 4KQ4H 2YRPA 4AQOA 3ARZA 5C0ND 1QEWA 2P24A 1SMOA 4FQHB 3QHFH 2J8UB 4NCC1 2B4CC 1JGUL 4PRHA 4YIQB 3WJJC 4HC1L 4QXTA 1IL1A 4W4NA 2FJFB 3Q5YA 5IBLC 3OWEA 1U8HB 5FYLH 1T1XA 4FQ2L 5GPRA 2I5YL 3KPNB 2AV1A 1CIUA 5HY9A 3MRKB 5IB4B 4OZIB 1BFTA 2A73B 3LS5H 3Q5TA 5F93C 4R8WL 5TH2B 1GSMA 3OB8A 3QEQD 4XCYA 3VFWA 1JGLL 1I3RB 4LBEB 4YHNA 3X17A 3ZHKA 2DICA 4A6YB 3KPRA 1KJVA 4G3YH 1HINL 3F7QA 1SBBA 1VERA 1RZKL 4D3CL 4ODHL 3QIBB 3ARGD 3NPZB 4Z7NE 1EXUA 3VG0L 3C8KB 3D6GA 5LG1A 5TF1L 3LZFL 3FT3A 3VDCA 2XFXA 4P23D 3EZJB 4XMLL 3O2VL 5LAXB 4KKCD 1CICC 3EJJX 2VYRE 1N26A 2OTWB 4N0CC 2G5BA 4NBZB 1Z6JT 3D39E 4XP5H 4NHCH 3TN0B 1OAXH 4PUBH 2FATH 4H0IA 3VRJA 1FZMB 4KVNL 3SDAD 3ARUA 1H3XA 2VKWA 4TRPL 4OCLC 5E8OA 1GGBL 5IHUH 2PW1B 3OKOB 2EC8A 4LSRL 1MIEL 3ZE0F 4QGYA 3B43A 4DUXA 5L2KD 1INQA 4XHJD 3SN6N 2RFXA 2Q20A 2CQVA 5I16B 4B7LA 2YC1A 4KDWA 5F1KC 4GRLA 4D9QE 5D2NB 5DD5L 3ZKXB 2GW5A 5JMRA 3KLHD 4PB0H 1EO7A 3UPCA 3T4AB 5C0GB 4JM2D 4YDIH 4ZSOE 4PJ8D 4GLRH 2ZCHH 5JZ7C 3HLAB 3IU3A 3L6FB 1K4CB 3C9NB 5TDPB 4G9DA 2EDQA 4QXGH 1M05B 2XZAH 4HEPG 4U1JA 2GSGB 4PIRF 3GMQB 3X3FH 5FECB 4OQTA 5C9KA 4N0FB 3VMPA 4YFEA 3O45A 5FUOH 2YUWA 3C2AH 3C2AL 1HQ4A 1S9VB 1QRNA 1Y18A 1NFIA 1WWAX 5DEFB 1U93A 3MV11 1HSBB 1HH9B 3QUXD 5LGHH 2ADFH 3KDMB 3PWUA 4UDTB 3O11B 1S5HB 4LSQH 5J3HD 4H26A 5AZEH 4PP2A 5E2VL 4L4JA 3LKOA 4R7NA 4Y89A 4UI2A 1EEZA 3H9HA 1E0OB 2JKXA 4K8RL 4QT5B 1RULL 2L7JA 5D8JH 3R4DA 2A6KB 4MXQC 5IW3A 3MUHL 3RL1A 4JJHA 4M6ML 4JFQA 1IQDA 3BPCA 5KVEH 4HIHB 3NVQA 4MXVF 1NEZG 5I6XC 1B0GB 1HHIA 2F8OA 4J12A 2PTUA 5CZXC 5IQ7L 3SKJH 2A1WH 4BH7A 4F7CB 3QDMD 1PLGH 3HE6A 4ZD3H 4GAJH 4GAJL 5IR1A 4OAWB 1GH7A 3LV3B 4NQDD 2APXA 5IF0A 2JJWA 4J3SA 1LO5B 4PV8B 1LEKA 1RUPH 4WV1A 4OLWH 3LRSB 3GMLB 4AIZA 3B2UC 2UY7A 3J8F7 2XRAH 1HILA 3DUUA 2NYYC 1MWAH 4AT6B 1R3IL 3P3YA 3D85B 3EOBB 1QHPA 3PHQB 5AWNL 5IUSA 4K2UH 2EC9T 2Q86A 1BIIB 5I0DA 1KXVC 5DVKA 1KELL 3EUUA 3LKRA 3TJEH 3JTTB 4F15C 1AGCA 1MCDA 4ALAL 3HE7C 3EYOA 4OQTL 3L3GB 3OKEB 4F9LC 4PB9L 5F44A 2ZOKB 2IANE 5DHVA 1FV1A 5E95B 4KC3B 4QHUA 4J6RL 4G7YL 3ULUH 4NRYA 5C0CE 5F9DC 1AHWC 1CK0H 3O6MH 4HUNB 4U1GC 5DC0A 3HB3D 5IIEB 3DYOA 2XZQH 2JELH 4JFXB 1MRDH 5T33L 4R4NC 4G9FB 4GG8A 4OT1L 5D7JA 4GUPB 3GMOB 1LDSA 1T7VA 3R8QA 3V4UH 5F3BA 5IJKC 4GRLD 3IJHA 1JF5A 3GSRB 4UV4L 4F7TA 4WFFD 4IIQA 1GHFH 5CIPH 4KRPC 4NFBA 3ARPA 4PRPA 4Z95H 4LLQB 5BW7A 4L8BB 2D0HA 3TYFA 3BYYA 4JQXA 3LOWA 4KK8D 4E42B 4EBQL 5HHXL 5BRZA 2BFVL 2BY2A 2G60L 3B9KC 4PJ9B 2ARJQ 3U0TB 1P1ZA 4YQXH 3RRQA 4ELMA 5DVOA 1CBVH 4KGLA 4RISL 5DRWB 3LQZA 4WO4A 2VZOA 2VLKE 2E9IA 3SGEI 1KOAA 1DQLH 2BNRE 2P8LA 4NZRH 3BSZL 3O9WB 5T3ZE 1OT2A 2FO1A 5BZDB 5FF6B 3Q1SL 3HC0A 3MV9B 1MCOH 4NZJA 4Z7WA 3MMEA 2VL5A 2VZSA 3OF6D 3C87A 3BGFC 1RJYA 2Z91B 4Y2OA 3V6OE 4P4KD 2X1WL 4R0LC 2WBKA 3AFLA 1PYWB 1WBXB 3RWFB 4QF1B 3F8UB 5IESL 4CVXB 1MHEB 2A77L 1FAIL 2FBJL 2Q3AA 3C6LB 1H3VA 2HLAA 1NFDA 1NBQA 5F3HB 4X7TA 2D03L 3FO1A 4YHIA 2AK4E 3VFPB 1CCZA 4A2LA 5GS1B 2FHBA 5E6IA 5HGHA 3V7MA 5AZ2L 3HE6D 2VDPH 1H5BB 4LLUB 4KV5E 2R0KL 4QXUH 1KIQA 1WBZB 3VFSB 1T3FA 5EU6A 3W39B 3TT3L 1AC6A 4J3XA 5C0DA 5F88A 4M7JL 4JG0L 4QRPD 5IQ9B 3P4MB 3ZYZA 4QRQA 4JFDB 2XTJD 3S35L 3HCVA 4PJHF 3DWTA 3KPPA 1F11B 4MX7B 5F6IB 4OCWL 4V2BA 5FUCE 2YPKA 1DBBL 4Z0XA 1F3JB 1KYOK 2AXGA 1II4E 2GUOB 3IXAA 3QA3A 2JCCE 4E0RB 1QSEE 1T1WB 4UIMB 1AGDB 1MCPL 4HDIA 2WBJB 3FAWA 2NY3B 3VRIB 3CH8A 4Y1AB 4L4VB 4EVNA 3QUMH 4F2MB 5KTEH 5B22A 4K94H 5TJWK 5ICZA 1SJEB 1G84A 5D7JD 4QKXB 3G04B 4S1DC 2A83B 1ZA6A 1OAQL 5EZOL 4PREA 3RX8A 3UZVB 5D7IB 3TVMD 3DX7B 4H20H 4OFVA 4FXLA 3X11B 3ROOB 4JG1H 3WE6A 3RPKA 4LRNH 1RZFL 5I8OL 2DIBA 4DKDC 3EBAA 1CDGA 5EPMB 5A1AA 4X6FB 5EO9A 1V3JA 3DVNA 4WUKH 5CSZA 1A2YA 3L3IB 4ELKB 1AY1L 1DN2A 3LB6D 1HXMA 3VFNB 2VNCA 4OZFB 4EI5C 3O6KH 4PRIB 4TTDC 4XAWH 1G7LA 1C5CH 5FKAA 1KB5A 1HXYB 2NXZD 3NH7L 1G6VK 1U3ZA 3VI3F 1N59A 1HOCA 2X4NA 5FHAH 3GSOB 1I3VA 1JPGB 3QDHA 1FNGA 2CIIA 4CNIB 1FAKT 3MODL 4HWBH 2OYPA 4LARL 3HG1A 4MD5B 3TPKA 2BSRB 5FYLE 4JFEB 4LVEA 1ORSA 2ZKHL 1LE5A 3VXOA 4IMKC 1WT5C 4JRYA 4KZEH 2NY7H 1NAMH 1MCNA 4R3SA 3IJYA 3UZQA 3FN0L 4LHUG 5E8EB 5CD5C 5JORA 2FIRT 3QG6A 3QNXB 3UTTA 3MLRL 5MEPB 3D3VD 2Q76B 4FQIH 2X4UB 4N9OB 3RWGB 2IH3B 1FGVL 4M5ZH 4LNRB 5JA8B 3B9AA 3BP4A 4B7IA 2VLRD 4ZS6C 1SYSB 2PETA 3KG5A 4X98A 1ZGLB 3MRBB 4YHPA 3W2DL 1E27B 5MEOA 3IAGC 4IDJL 2P44B 5DJ8A 2W0PA 4JFFE 2YS4A 2VDML 2R0ZL 3QHTC 4U6TA 5E6ID 3ECBA 4JFZH 1U8LA 4NGHL 1ETZB 1KLGB 3VFRA 3PNWA 4AK1A 2QR0A 1IEAB 5J7CC 3BZFA 2AABL 2IWGA 3A67L 3DRTB 3FQNA 5CP3A 5T5FH 5DRXA 3BDBA 4KKAC 3ZT7A 2VXQL 4ZFGH 3JWDC 4P5TA 5ILTH 3E6FA 1DBJL 3LSOB 2R0WL 4Z7QE 1LO4L 2NY6C 3KPSA 5F9WB 4YR6B 4RIRB 3NIGE 1FZOB 5EOQL 5I1KL 2PO6C 3LIZH 2GK0B 4HS3B 3VGGA 4N5EC 2MTPA 4LF3A 2MQCA 1VFBA 1I7TB 5D1QB 4BK4A 1KB5L 5SWSA 3BIKB 2WW8A 3WDJA 3AM8C 5GGRY 4X6DF 3CMOL 1CD1A 2PTTB 4P3DB 1DFBH 3PQYE 5FA4A 3RWCB 3RL2B 5EH1A 1CXKA 3BXNA 3L5XH 3QIUA 4D0CA 1U8OB 2BC4A 1WBYB 2P8MA 4LHQB 3T1WA 4CADA 5DUBB 3MCLH 2HFGH 1Q0YH 3QUZA 1NFKA 4XP4L 1HIML 5SV3A 3JWOC 4DWHA 1TITA 3KXFA 3QJFB 3F6IA 4KROB 2AI0H 3RY4A 4MQXC 3UJTH 3ARFA 1OAYL 3CMGA 5C08D 3VRLE 3RIAK 2HKFL 5CEYA 3MJ8B 2XG5A 3HRZA 1IGMH 3VXPB 4JPKH 1FSKC 5DA0B 2ORBH 3G5YA 1JV5A 2HG5A 2D7NA 1CZ8H 2AV7B 4GW4A 5EU4A 2X10A 4X6BB 5IFJB 2IBZY 4U1NB 1UZ8B 3ZKMD 5ENWA 4XZUA 2AGJL 4POYA 3V6BR 3ET9F 5HGAA 3T3PF 3TA3A 1JNJA 4XBPA 1QNZH 2X7LB 1FYTE 3IKCB 3FFCD 1D6VL 4U6YB 1ZLWK 1JGDB 3QEQB 3V5KB 1T2XA 2WM0A 3GHEH 4JZOA 1UCBL 2AQ3A 1LK2B 4AZ8A 4HIJA 2FEEL 2H8PB 4OLYH 3M07A 4ZO6A 5F9OL 4P2QA 4ZFZB 2JK5B 4OGYH 4PGCB 4U33A 3OG4B 5F7YC 2XWTA 3QO1A 1NQBA 3D0LA 3I3EA 1A0QL 4YXLL 3ARGB 4U1KA 5KBNC 4HSQA 3VW3L 2B2XH 3MA9H 3MOAH 4GRWF 3CZFA 3FOLB 4IBLT 4RMQA 1AQDB 4PJEA 5T3XH 2H32B 5F6HI 1J0YA 3RP1A 1JGEA 4LSUL 1MH5B 3V9FA 3U9UB 3TZVC 4P23B 5E94B 4Y4KD 5FA3A 1A9EA 2VQ1B 4O51B 4L3EE 2FZ3B 4APQA 2YSSA 3DXAA 3STZA 4G8GA 4Y4FA 1RIUL 4L4TD 3QWOB 4FFYL 1CFVL 3IFOB 4NUJA 3F7VA 5HGDA 3QJHB 4LQFH 2BVTA 1OCWL 1NCWL 3H9SE 3GJFB 1JHLH 4R4FL 5DJZA 2W07A 3SDAB 1L6XA 4XNXH 3UX9B 3IDNB 3AXLB 4LSSH 1JHKL 5FUZL 1C8PA 3ULUE 2VSDA 2DTMH 5LBSH 3HUJB 5L2KB 4JANB 1MCBA 2N56A 5H35A 3EW3B 4HXAL 5IB5A 1JNHA 3T2OA 4LU5H 2M1KA 1UACH 1UACL 1A6UH 3S7GA 4HS6B 4L1HA 2VRAA 3VI4F 2BXZA 2Y5EA 4NQXB 4JM2B 5B8CB 2W1NA 3EDJA 1G7PA 1XFPA 4PJ8B 2LV4A 4Y2DD 4XNYH 2EH8L 5JHLL 1YPZE 4DGIH 5GZOC 1BBJB 3SCMA 3MJGX 1AR1D 1DBML 2IH1A 3E3QC 4OFIA 4FQ1L 4JO1H 3NBNA 3QBTB 4DN3L 1T21A 2A0LC 3P73A 4NN6B 4GRMB 4OZGA 3RA7H 3WLBB 4ZAKA 2FSEA 3KXFD 4G8FB 2F15A 1QG3A 1U42A 3Q0HA 4X83A 2ZOLB 4QRUB 3QUXB 4EZMA 4JGMA 4PV9A 1TIUA 4LVHB 3WFBL 1XGPA 4UT7H 3MLVL 4OD2A 1IL1B 4UUJA 5JQHC 3RDTC 5GIRB 2IC2A 4I3RL 3QXDA 2CJUL 2ESVD 3BDYL 1MCSA 4YBHA 3RVWC 1HHJA 3EDKA 4XPTH 1CGSH 4XPTL 1DDHB 5E00B 2DQJH 5HI5D 2AVGA 1RZ7H 3FZUD 2VDOL 3U9PH 1CLOL 1WTGT 3O6FD 4O5LL 1FZJB 3DECA 4LPYA 4PLKC 2W59A 1KJVB 1L9MA 4PJIF 3QDMB 3MYZA 3L7FB 4JCLA 2FLBT 4M3KB 1R0AH 4NQDB 4BZ1H 1MI5D 3G5VB 4Z78A 4MYWB 5GS3A 1QFWH 1EXUB 5I1DB 1KV3A 1MFDH 2HT3D 4YC2B 5KN5B 3BUTA 4ZPVB 1AGFB 1VHPA 3FT3B 4O58H 3MUJA 4OFPA 1MQ8A 1ZAGA 1VGEH 3SE9H 4OKDA 4JAMB 3WDHA 2XFXB 3U30C 4K7PY 4JM4L 2VC2L 1AIFA 4P5MA 2M8XA 4L9LB 1J18A 4MA7L 1IEBB 1OL0A 3THMH 4R4BB 3OKLA 1X5HA 1HQRB 1UB6A 3LDBC 1J1XH 2OZ4H 4KRLB 4HK3J 4P2OC 5E8OB 4O2FA 3CDGB 4WFGD 4MCYA 2NY0D 2WV3A 5DJ0A 2QQQA 3UTZA 1H8NA 2KPNA 5DMIL 4RMWA 2RFXB 2YC1B 3VWKA 4GRLB 2AEPH 4Z7WE 4GKNB 2A74B 3NFPA 5IKCB 1SHMA 5KSBA 4XBEH 35C8H 3Q3GA 5J12C 5E5MB 4EQ3A 5TQ0H 1ZHKA 1IGFH 4PBWD 3ARSA 5TQ0L 3PP4H 3RPIA 2W0FB 2DL9A 2DQGH 3U7AA 2GTWA 2CMRH 4Q9BA 3IJSB 1YUHA 4G9DB 4RAVA 4N8VB 2X05A 2ZSWA 1KJ2A 4QCIA 3I3BA 5KVDL 1YZZA 3SJVA 4M8QB 1F42A 3EFFB 4AMKL 1MFCH 4Q0XL 4ZAKD 2XTLA 1Y18B 4JO4H 1DL7H 5FCUH 1KTRL 3K4AA 3VMOA 5C8JA 1U8MB 4I3SL 3HHRB 3HZMA 1YQ2A 1QSFD 3H3KA 1HHKB 2DQTH 2ID5A 2FH8A 1B88A 4H26B 3SBWA 4KXZH 4PP2B 2J88H 4NJAL 5TDNA 3EOTH 4BSJA 5IW1B 2JJSC 4IRSC 5KJRL 1EEZB 1XIWA 3ES6A 1P7QA 1GGCL 4P4KB 2W9DL 1Y0LB 3BOVA 4K3DL 3GO1L 3C8DA 4JVUA 1BFVH 1C5DA 2ZPKL 4PJCA 4DVRL 4K3GA 3KJ4B 4ZO9A 4ZUUA 2EECA 1MFEH 1MFEL 2R1YA 2V5SA 3W11D 1K3ZA 5GRUL 3FOMB 1IQDB 1LO2L 1FDLH 5DZLA 5E6YA 1F8TH 2DBLL 2WMPA 2COQA 1J8KA 5AEAA 2DLFH 2X4TB 5DO2D 2O5XL 3CFCH 4TSCH 1MHCA 5DF0A 4OI8A 3OXSB 4BH7B 1R3JB 3V52L 3UJIH 1OGTB 3HE6B 3JZ7A 4Z0BL 3F58L 2AJUH 2GJZB 4ZODA 4RBPH 3WUWA 5IF0B 1OGAE 2G2RA 3PL6A 5DRZB 1W0WA 4FS0A 3N1PC 1JGVL 4AEHL 3SDXF 4QRPB 2L0DA 2IAMD 3LEVL 3QDJA 5B38A 2UUDK 4HXBH 2ZSVA 5FGBC 2XTJB 4J1UA 3KGRA 3SO3C 4HJGB 3LKRB 1E6JH 2Z4QA 3OR6A 4NQVB 1Q1JL 4TQEH 1KJ2L 2DQUH 4P5KA 1VKXB 4GXUN 4HMDA 2V2WA 1ZGLP 3L95B 3A6BL 4KAQL 5DHVB 1MCWW 1OP9A 2YD1A 5IMLA 4QHUB 4OZFH 1RUKL 2P46B 3DRQB 3HG1E 1T6VN 1XGTB 1S9YB 1DLFL 3OG6B 5DJ2A 2NW2A 5I1CL 3CSGA 1S9XB 4GG8B 5D7JB 4LASL 5ESVA 1GAFH 1OY3B 3DO7B 4KDTA 3U2SB 3P2TA 3DTXA 5FYJD 3TVMB 4OZIE 3RZCC 1GOGA 2VDLH 4MJID 1X5JA 4IIQB 2E7BA 1G7HA 1XF4A 1UJ3C 4GAYB 4JY6A 3U1SH 3WNKA 1PJ9A 4PRNA 3MRPA 5BV7L 4KUCF 3BD3A 1OLZA 2KBGA 2GJJA 5ISZE 4H8WC 4G6FB 3OQ3B 4M00A 4NNPH 3SJVD 1P1ZB 2NXZB 4M6NL 1I1YB 4PJ5E 3TYGH 4NHUA 5IMKA 5C0AA 4ELMB 4J3TA 5JPMA 3LQZB 5CSGA 2X4QB 4YEEA 5K59E 2NTFB 4XNZB 1NMCC 4X6CF 3MREB 2CLZB 2DN7A 3BE1H 1HKLL 4HS8H 3CSYA 4NQSB 2ICWI 1QBLL 4HEME 1AP2B 4XPFL 1W72B 1EERB 1RJYB 5D93B 4AG4H 1DUYA 1P7QD 1ZHNA 4JB9H 3B5HA 1ZANH 1CFTB 2AJXH 3D3VB 4OCXH 4O2EB 4YDVA 4FOMA 1CXEA 2BCKA 5EOTA 1CFQA 1G7IA 3W9EB 1ZSDB 2VLRB 4I3GA 1JF1B 1AFVH 1NFDB 4HHAB 3IS0X 2R4RH 2R4RL 5TQ2L 5HHPA 4NZUL 4OLXL 5T3XE 4GLRI 3U0WL 5C0RH 1MLBB 3FO0H 5E6IB 4UQ3A 1SQ2N 1AO7A 5FYKL 3SDCA 2Y07L 5D2NE 2C3WA 3HTLX 3ARWA 3I02B 3P9MA 2ZUQB 4ZO8A 3LRHA 5I8KL 4MAUL 3ULVL 3JV6A 1KEGH 2GKIA 1FVEB 4D9RE 1FE8H 5GGRA 5C0EA 1VADA 2A6IB 5IFHH 4I0CC 5ERWA 4N9GB 2W65A 4K23H 3HAEA 4QRQB 1D5ZB 4IRJC 3KPPB 1FVDA 4HUXA 2HLFC 4GQ9H 4YJZL 4PGBB 3S5LB 4RX4D 3IXAB 2E8YA 5EBWA 4UINH 1QOKA 3MBEC 3NCYP 1KPRB 3VWJA 4X99B 4KHXL 2X89A 4ZXBC 4HPYH 3KHQA 4X5XB 3VFTB 1AGEA 1N6QL 1TJHH 1DQTA 5DVNA 5AG9A 1BQSA 4BQCA 1DN0B 2DQHL 5JLZA 4JFYA 5E2TL 1S7SA 4J3VA 1NCBH 2O5YL 4M02A 5GRXG 1MQKH 1ODAA 3TBYB 5F96L 2R1XA 5IM7A 2EIZB 1LVEA 1IC4H 1IC4L 2CH8A 5C08B 4LLDB 4XNUH 1A3LL 1NGXA 4XNUL 2L4OA 1A2YB 1EO5A 5E1HB 1S7UA 1WCBB 3MYJA 3TBSA 3C60C 1RK0B 3RY6C 5IB3A 4P59L 4G6JL 5BS0B 2OM5A 4N68A 3GK8L 32C2A 2XZCH 1KB5B 1GZQA 1MELA 3FT4A 4PJFA 1BM3H 1LK3H 1WZ1H 2YUVA 4WHDA 1HOCB 3QI9B 4OCMC 2CIIB 4GO6B 3Q5OA 5KSAB 3EYUH 4ZNCD 1T89C 2VZ1A 3FFCB 2H32H 3V0VA 3VG9B 3D0VA 1LE5B 1TJGH 1A5FH 1TJGL 2P7TB 4FQLL 4LEXH 4U0QB 4LSDA 5EUKA 1PKQE 5CEZL 2ZJSL 5KSVA 3V7AE 4DW2H 1KJ3L 4YHYC 1BAFH 3EYFA 1VDGA 3K1DA 3QIWC 3I50L 1MVUA 3T0EC 2AERT 3QQNA 1TZHB 5E8DL 3RGVC 3RNKA 4WEBH 2Y25A 2VO5A 3VXUA 2P43B 4WTZA 2QQKH 1JWUA 1GCFA 4JR9L 4UAOB 4HGWB 1JHTA 1I1FA 4G9FE 5HJ3A 1OM3H 2D7OA 1LO3L 1YN7A 4NNXA 4Y4KB 3ALXA 1I1AA 4DUVA 1AO7D 1U8LB 3UO1L 1YEKL 3PNWB 4E41D 3VD3A 2QR0B 4L4TB 2E3VA 2ITDB 2Q1EA 3BZFB 1FO0A 1KG0A 2DKUA 4TNVK 5ESQB 4JRXB 1JPST 1VGKA 2HTKD 5ALBH 4XCEB 3DV6B 3AY4C 1MUJA 1AQKL 2YR3A 1N0XL 1ERNA 5DJYA 1PKOA 5AG8A 2JLLA 1KENH 1CLYL 2QV2A 3CFEB 3NCBB 1VFAA 1OTUC 4ZTPL 4LCCB 5EWIL 4LF3B 3VU2A 5TDOB 2FECI 4EIGB 1U3JA 3WXWL 1I3GH 2PYEA 1KN2H 3PABB 1WIOA 4JJ5A 1NDMA 3L7EB 4HQQH 5HPOA 2HMID 3C09B 1YJDL 3VWJD 2EDFA 4JY5H 3B83A 4ZNEE 1ED3A 5FA4B 4HD9A 4PBVC 3N9GL 4HUWA 1YY9C 3MV9E 4Y2DB 3BXNB 4D0CB 3CPLB 1Q0XH 3BQUC 4HBCH 4HBCL 3RVVD 4WFHE 5ADOL 2IBGA 4POZD 2VH5L 4LSVH 3RGHA 4JPIA 1BLNB 4L29A 5E99H 4W4OA 3JTSA 3QNYA 4LIQL 2E5EA 4FQJH 1OAZH 2H1PL 1G6RH 1G6RL 1KBGL 5DT1H 1ZT4A 2YN3A 2NW3B 2ADIA 4B5EA 2Z93A 5DQJB 4NO5A 4RA3A 1CU4H 2ZUWA 1M7IA 3X3GH 4QNPE 3V6ZB 1AI1H 2Z31D 3GUTA 2AQ1A 5J11B 2V7HB 3WFZA 4XNQA 3OAYH 1FFNB 5D2LF 1OTSC 4PS4L 4WDIB 1LEGB 5FDYA 1LNUB 4ETQA 1RK1B 2ESVB 4XBPB 5ICYA 1NBYA 2W38A 1HSAB 2DQFB 3HFML 3H7LA 5EORH 1NMBH 3ARBA 4K9EC 3QNZA 2J5LB 2EYTB 2GQHA 4JZOB 5KVFH 1J05A 3ALWA 1T0NB 3WO4C 1CQYA 2R9HC 2AKRB 1LP9F 4HIJB 3O6FB 1H8OA 5CJXA 5CKAA 3WFDH 2XXMB 5GZND 1JUFB 5DMGC 2GCYA 3DETD 4HFUH 3UTPE 4NQCB 1U95B 3TFKC 1MI5B 3ZKNC 4EKXA 4DUWA 3AMKA 4U1KB 4KJPD 1I7RB 4ODXA 2FIKA 5GS0L 1CR9L 3VXUD 5K9OB 1RUAL 4KPHL 3S9DB 1BJMA 1FORL 1FORH 3CZFB 5IVOA 4Y1AE 1W0VB 4L4VE 2LAGB 3I85A 1G9NH 1G9NL 1BFSA 3QXVA 1WTLA 5CCKL 5CLTA 1JGEB 4YPJA 1QQDA 3G6DL 3T0WA 4J4PD 4MWFA 4NT6A 3C5SB 2LVCA 5TE4L 5J57B 3RKDD 1A9EB 1RJZB 5AYUL 1B4JH 1I1AD 1BP3B 1BQLH 3BMWA 5D7IE 3HC4H 4PJ7F 1V7ML 5IV2B 3LKPA 5FOBA 5D1ZC 5E56A 4C56D 1XCQA 4YHOL 1U91A 4DAGH 2GFBA 2BVPB 5D7SH 4EN3A 3F12B 1N5YL 4Y5VA 3ZT5A 4NZTH 4KTEH 4YPGA 1DVFA 1P4LB 4PRIE 2NY0B 3QQ3B 5JW4N 1MPAH 3KPMA 3SY0A 4LOUD 2QBWA 1ADQH 2HWZL 3QH3B 3RWJB 4JFEE 2PYED 4MDIA 4EDWH 4Z5RA 3EOAB 2JF1A 2CLVB 4TNWF 1JJUA 1WEJH 3BHBB 5GGSY 3SE4C 5F9AC 3WXVL 3KPTA 5HI3D 1MJ7H 4L5FH 3VE0B 4MZ3A 1I9JL 5IEHA 3CX5J 4KI5E 1DCLA 1HEZB 5CGYD 3FO2B 1MJJA 4NQUA 1IC5H 2KL6A 2OQJB 4PJHB 5J06A 3PJSB 2P48B 1MFAL 4ZAKB 2HAZA 4YO0A 5T5NG 4K7PH 4K7PL 1EDQA 3O8XC 2YUXA 5IVXA 5FXCH 1CL7L 4HAGA 1QSFB 4M1DH 4LKXB 5MI0C 4UOJA 4R97B 1JZ5A 4C55A 2DLEA 4WY7L 4XVTH 4DFIA 1XGPB 3H3PH 5JO5A 2LU3A 2A6JB 3ZYJA 4OFYA 1D9KD 1X5GA 4KKCC 4S1QL 1FH5L 4M4PA 3QDJE 4P46A 2YBRA 3RI5K 3AREA 3K2UL 4OV5B 3GHBL 4ZUTA 4ODBD 1EUUA 3ARBD 1O5DT 4OLVL 2CKBL 2HN7B 3BO8B 3SDAC 2WANA 2KZ1B 4N90D 4KUCD 1LD9A 4QHNB 1P53A 3MNWA 1H8SA 5FGCB 5JNYB 1WZKA 25C8L 4KUZL 5MENA 5DHVH 5L6YL 4BQ8A 1CWVA 1RZKC 4ODUB 4XPHL 1MHHA 4I18A 3BH8A 2FL5B 3K3QA 2D9QB 4JGUA 4PJXA 4BSVA 4LCWA 3EDDA 3ZMRA 1CDIA 2GJ6A 4BA8A 3CVHA 2BJMH 2IFFL 2WINB 2AEWA 4JM2C 3P9LB 4NM4L 4PJ8C 5CP7A 3V4VH 2IAMB 4MAYD 3SGJC 4HW6A 3DX6A 4XPAL 5J4MA 1K2DA 2XNAB 4JO2H 3PG2A 3D2UD 1J1OH 3IRPX 4HF5H 4UBDD 4HKJA 8FABB 4NN6C 1R5IB 1B90A 4TNVF 4HUMB 5DTFB 1IQWH 3UJJL 5IFAL 1CVRA 4ISVA 4MDJB 3MV8E 3QUXC 2VDNL 3AVEA 4HH9B 1IRAY 4O2FB 1NCDH 5GISL 1SM3H 5DDHB 4FZ8H 3MJ6A 4HZLA 1ZHLA 3BD4A 4R7DB 5EZIL 2HJKA 4OI9A 2PTVA 4GAGH 1JIBA 2FB4L 2I26N 1R24A 4NSKB 4ODVH 4MJIB 3QXUA 5KSBB 4IMLA 2F8XC 3Q3GB 1L0YA 3QEQE 5IK3A 5CZVL 3X12B 1EBPA 3FB5A 3AB0C 2IALB 3ZE1F 1C16A 3RPIB 5EIIA 1OHQA 3T1FA 5DWUH 1KN4H 1W72H 5EU5A 5IBLD 3FB7B 4MJ2A 1N2RB 4RCAA 2UVFA 1I8KA 1GC1H 5BXFB 4GW5B 5HGGS 4MA8H 1F4YH 5DUMH 1ZLUK 4ZUVA 5GRVK 1Z5LB 5BVPL 1P2CA 2C5DC 4HFWA 5FIEA 3SKOA 4X6DB 5I76A 2C1PB 5IT2L 5KVGH 4MNQB 1A47A 5ANMA 2FJHA 4RSVA 3LHPL 4Z7VF 5TDNB 2Z92A 2CK0L 1IBGL 3HPJB 2CIKA 5CEZE 4K8RC 1P7QB 4OFYD 5GJSH 3LQAL 5GJSL 2Z8WC 5E8PA 2YD7A 2YD2A 3MCKA 3B8SA 4P46D 1M4KA 1BX2A 4ZUUB 1RAMA 2A9NL 3CFJA 4Q7DA 2DQDL 5JOEA 3QDGA 5KS9A 2DWDB 4MNHA 1MCJA 1CICD 2XY1A 5L2KE 4N0CD 5L7XL 2EDNA 4L8SA 3M8OH 4EUPB 3VXSA 4U2YA 5FOJA 4GXVL 4GRLC 4D0BA 5DLMH 3MNVA 5C6TH 5I17A 3PDDA 5AYQA 4HKXA 4CL7A 1U8JB 4YUEL 2VSCA 1WLHA 5AD0B 4WFEE 3N85L 5GRZA 1NDGA 4KHTH 5B38B 4KK8C 5BJTA 3KPQB 3MACL 2ZSVB 4G8IA 4DTGH 4S1RH 3U46A 1WWBX 4U1HB 1BVKA 3V4PH 5I8CB 3WUZA 2Z4QB 3BRGC 1EVUA 2FHCA 4FTVA 1E4XI 1IAMA 1YEHL 3V5DB 3G08A 5IP4A 3NA9L 5C0JB 4OZFG 3G6JA 2NX5E 3VH8B 3DUSA 5IMLB 1MFBL 1F3DJ 1V7NH 2OP4H 1BF2A 3FRUA 3OZ9L 5B39B 3S35X 3GKWL 3VJ6A 1IKFL 2IPTH 2YKLH 1DSFH 4GRWB 3JV4B 2NNAB 5JUEL 4XGZB 1NMAL 4Q6IA 5JW4Q 1KCUL 4P9HH 4WI2A 4AIXA 3P4NA 4YDJB 2HFEB 3VXTA 5I8EA 1DLHA 5I9QB 1I7UB 3ZE2E 4AJ0A 4HT1H 3PGFL 5T1LA 5FK9B 1WVZA 1A02N 3AS3A 1G7HB 1XF4B 2IPUG 1CF8H 1P69B 3QUYB 1DEEA 1QFWI 4KK9D 3PV6B 1SJVA 2W9EL 4LRIA 2ZUVA 1XF3A 4HZAA 2GY5A 3BKCH 1A6ZB 1BD2A 2FWOA 3B2VH 3BKCL 3GJEB 3CCHA 5L2JB 5JHDA 4X9IA 3P4OB 5JDSA 4MXQD 5EA0L 4TOYH 1I8MB 2GITA 3HE6C 1P6AB 4NQDE 4CMHC 1NCNA 5AAWA 1ITBB 1JYXA 3HZKA 2I60L 1JVKA 4FN0A 4PJBE 2VIRA 3QQ4B 4GT7A 4WV1C 5IMOA 5J6GA 1DQML 2A6DB 5CZXD 2R29L 2YD6A 1Q38A 4ONGH 4ONGL 3PWPE 4GBXA 2B1HL 1CGTA 3O6LL 2B7DT 3GI8H 4B53A 2LQRA 3PGCA 2XTJC 3IFPA 1UENA 3BZEB 1ZVYA 4DZ8B 1IGYA 3MGOB 3SOBL 2XXCB 3B2UD 2DQEH 5D7KE 1F6LL 4GG6A 1VFMA 5EOTB 2ADJB 1RJLA 2A38A 2C1OA 5GHWL 2Z0BA 3OAZK 4FHBD 3QDGD 2C3XA 2JB6B 4CU6A 4MA1C 2VZVA 5ITBH 3HE7D 3RU8H 1FZKA 1ORQA 3MFGB 5D7JC 2WIMA 5HHNA 1UXWA 3DYMA 3VXSD 4U6XA 4E41B 4WFFE 1S3KH 3TVMC 5TE7H 1QACA 2F5BL 2RJMA 3P11L 4KMTH 4IIQC 4YE4H 3U0PA 1IE5A 1NGQL 2H9GA 2HA1A 3MLUL 5C0EB 5C7XL 1FL3A 4F57L 2BRRH 3C5ZA 4JQXC 3LB6C 3ARXA 4JN1L 3SGKA 3KPOB 5DI8A 2XWJA 1D5IH 1TNMA 1IAIH 1FVDB 2VDQL 4X4ZA 4HUXB 1AXIB 3JUYA 1MJUL 4KRPD 4FTVD 5HI4D 1DBAL 2P5EA 1QTYT 4PJIB 5FGSA 3RUGE 4L8CA 1F90L 2VQUA 2DDQL 1MRFL 4NWUL 4X9FA 4WO4C 2EXYC 4RQQB 3RAJH 4Z6AT 3S4SB 5FDWA 4CDGC 1QD0A 4XNZC 4XHQA 5HTSA 2EYRA 4FQXA 1CG9B 2XPGA 3VXQB 3FTGA 1X6NA 3F5WA 3MXWL 4ZUSA 5EDXA 3EO1A 5LQBH 4L3CA 2F54A 1VESA 2UYLA 3PDGA 5CJQL 1BZ9A 1FNFA 1R3HA 5E6ZA 1IAOA 1BVLB 2DQIL 1NGXB 5I1IL 3FCTA 2C9AA 2GY7B 4OD3L 4NKIL 2EDWA 5DFWH 1EZVX 1ZT7B 3KWWB 3F7PC 1BD2D 1FBIL 2Z31B 2X70A 2C3VA 4WI5A 3GNML 3MRCB 3FQWB 5JHDD 3O41B 2HT4C 4PJFB 2XN9D 2IADA 4MA3A 5E6IC 2FD6H 1IZJA 4J3UA 1AJ7L 2QKIB 3EFDL 2P1YA 3L5WA 4UT6L 3R1GL 3HZYA 4I8DA 4FG6C 4AM0A 1RZJH 4OKVB 4LP5A 2OCFD 2VLJD 2YPVH 3NZ8A 4JFHD 3U7WL 1EUTA 3VXRE 4NRZB 2H3NA 2V6HA 4QRPE 2VABA 4BQ9A 3U6RB 4WU5A 3TJHC 3GBNH 1FLRH 4GBXD 3MLPA 2VR4A 3EYFB 4KVCL 1YMMD 1G0YR 2V2XB 4Q9QL 4LNVA 2B0SL 4KQ3H 5EZJB 4PLJC 2NZ9C 3ARRA 4PJGF 2D2OA 3U36A 1XEDA 2QHLA 3VXUB<