4LLAA

Crystal structure of d3d4 domain of the lilrb2 molecule
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
198
structure length
198
Chain Sequence
SKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukocyte immunoglobulin-like receptor subfamily B member 2
publication title Crystal structures of the two membrane-proximal Ig-like domains (D3D4) of LILRB1/B2: alternative models for their involvement in peptide-HLA binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 198
sequence length 198
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llaA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llaA01
4ZQKA 5EO0B 1OLZA 1NEZA 2FL5B 5JR1L 5F9OH 3LS4L 1XF2B 5H8DA 3D87B 3ILPB 2VLRE 3IXTB 4I0PA 4YHLL 2X4TA 5GGUB 5F7FA 3KPPB 3CK0L 3DGCR 3HI6H 3B4NA 3HMWH 4Z7UE 4RISH 1NAMA 5D1QB 1U8PA 3ARQA 1QBMH 1G7IB 3RBSA 2JJSA 3TO4D 3V4UH 4O9HL 4KGLA 3GHBL 3GMMB 2V2WB 4WO4A 4F7EA 1KCVL 3N1FC 3JV5A 4JVPA 1MFCH 3VCLA 1YNTB 4DZBA 1XMWA 4U1JB 3PQYE 2QQKH 4U6XA 5BVPL 5ESQA 2YUVA 5D1ZB 1W8OA 5D1XB 4URTB 5F7LB 4Y2OA 3CC5B 5GRJH 3BUYA 3VW3L 1X3DA 4Y4FA 1HEZA 4WI8A 3SN6N 4ZXBB 4OIAA 2C4XA 5HHXL 3MCKB 2WM0A 4C54A 5JTWA 3MV9A 4YC2C 3TO2B 3KHQA 1EMTL 3EOAA 1ZS8B 4P5TC 3UTZA 1IMHC 1QFWL 5FF6B 1RMFH 4X6CF 1YN6B 1FORL 1FYTA 2QSCH 5I2IB 1B6DA 3L5IA 1OOAA 1U8QB 4OF8A 3ULVH 2H3NA 4YE4L 4O02H 4D9QD 9CGTA 1H8NA 2HT4C 4AL8L 5DJ8B 3IU3A 1ZLUH 2H9GA 1P6FA 1PG7H 3O41B 5C08B 1YY8B 3LSOA 1LD9A 4GRLC 1IL1B 4FFWC 4YDKH 1F02I 4LQ1A 4LL9A 2F19L 5EFIA 2CDFB 4LSUL 3CAFA 3O6ML 1J5OH 2IMNA 3IS1X 1NQBA 5JIIA 3CFDB 4O2EB 4L9LB 3F6IA 1MY7A 1I1AA 1FJ1B 3AROA 3MV9E 3O3DB 1A9BB 3MC0A 2GUOB 5D2NE 4EDWL 3BN9D 1QYGH 2R1YB 4QHNB 5IROA 3GSNA 3PDDA 3BJLA 5EUOF 5I8EB 4N8VB 5GZOC 4OQ1A 2ADIB 3NIGF 4AYFA 1MLCB 4YZFE 2XZAL 2APBA 2FEDD 3TH3T 2DQDH 5T1LA 2DTSA 3PHOA 5I76B 4Z95H 3PWLA 2VH5L 4D9LL 4R0LC 3TCXA 4WHTA 1MI5A 4EBQH 1N2RA 4GH7B 5EC1B 3ALXA 3NCJH 5CIPB 2ARJB 1RUPL 1DLFH 3PG2A 3HC0B 3VFOA 4WI4A 3RVVC 5KS9B 3OJVC 1LO0H 3H9HB 4NHUA 1B6UA 1KJVB 4QNPE 4R97C 3FB8A 3W39A 1UACH 4YWGH 4LKXA 3P0VH 5IMOB 4JKPH 1YECH 5IVOA 3I6KB 5HGDB 3KPNA 1G7PA 4NRXB 5DJ6A 4K3DL 2CUMA 2ILLA 1D5BA 2OZ4H 3FZUC 1QR4A 1A9EB 1QEWB 1U8JA 5IVXB 1CXIA 3OWEA 1E27B 1FL6B 3WNKA 4NKMB 3O6LL 1EDQA 2JKXA 3OF6A 5E2VH 5B38G 1IKFL 1AY1L 4JRXD 1N4XH 4GG6A 3D2UB 5D72L 1EPFA 4CUCA 5L2KE 1MI5E 2VC2H 5KOMC 2UWEA 4NKOA 3DIFA 1WWWX 4OV5A 4WFGD 5DJDB 5DUBA 4U6VL 4I5BB 2JK5B 3GMPB 4FQ1H 4H0IA 1FPTL 2WBJD 5HVHC 5MERA 3HC4H 3BXNA 4FQIL 4AMKH 4EOWH 3GJFA 4LPCA 2I9LA 2NY2D 2V2TB 1RK1B 2W9LA 3OB0K 4JFPB 3AM8C 2E3VA 3BDYH 3QZWA 5F7KC 3BQUD 1S3KH 4G8GA 3MOAL 3GB7B 5I9QB 2DQHH 5C0JA 2XN9B 2X4TB 4WEUD 3VFGL 4Y5VA 1W0VA 4JGMA 4JLRA 3QDJB 1B4JL 2R9HD 4GG6E 5FUZL 1U8PB 4AM0A 1D5XA 5CINL 5DQDH 1Q38A 4UQ2B 2UWEE 3WIHL 2VKXA 2AJ3B 2W07A 3VD9A 1NFIA 4U0QB 5HTSA 3TV3L 5ESQB 3C6LA 3GSXB 1Z3GH 3OMZA 4KTDL 5TDOB 2DQEH 3DMMA 4ZAKC 1PYWA 2VR5A 4XP4L 2OTUB 3O3EA 2VZVA 1ED3B 4DTGH 2YD1A 3LPWA 3TC9A 2EXWC 4G8EA 2FX7H 2DRUA 3MNVA 2BDNL 4XWGH 5CWSB 1JN6A 1WCBA 1WGOA 1AR1D 4G3YH 4OGAD 1MCFA 3VXMD 4WFEE 4G8GE 3UTZB 2A73B 4WW2F 1QLRB 1MPAL 4KUZL 4BUGA 2XQBH 5CD5D 4ZFZA 3ZTNL 1IAIL 1AJ7H 3N1GC 3N85L 4WW1A 3DSFL 4ODBD 4QRRB 3TT3H 1CR9H 4S0TD 1GIGH 5IEHB 4TSCL 4XCFH 3LSOB 3IGAA 2CKBB 4Q0XH 2PXYC 1LD9B 2N7BA 3LPFA 1IGCH 2HKHH 5L88H 2XTJE 5CJOL 3VFTA 3BSZL 3QUXD 5DURD 2GJZB 4JFDD 1WZ1L 3LQZA 1QPXA 5J6GB 1QFOA 3B9AA 1FNEA 2V5TA 4I2XB 5EUKA 4EVNA 4HC1A 3RZCC 8FABB 3B9EA 4K23H 3MLVH 4I8DA 3T3MF 4EN3D 3JV6B 4FA8A 4E41D 1R5IB 3LRHA 3FTGB 3IU4H 1HKLL 2H2PD 2YD9A 3WV0A 3C5ZC 4PP1C 1ETZA 3GSNB 3B2UD 1N0XL 4GKSA 1CFNB 3FRUB 4GSDH 5CZXC 1GAFL 1OAZH 2YKLL 2YZ8A 3PHOB 4NO0B 1S9YB 4WHTB 3NCMA 3MJ8A 3MRFB 4CNIB 2IGFH 5C0BD 4DVRL 3G5VA 3RU8H 1MLBA 1N5AA 3BKJL 4ODXB 5JHDB 4YC2B 1LP9B 4LLMB 5JQHC 2X4QA 4R4BB 4I9WE 4HG4J 3ARZA 4P5TB 1REIA 3MLPA 4PJDB 1T0PB 4QTIH 1LK2A 2JB6B 3ZTJG 3CXHK 1G7PB 3W0WB 2BNUA 2X4OB 3GNMH 4LPWA 1L0XA 3ZYJA 1I4FA 1QLFA 3FFCE 1NUDA 2ZZUT 1CDGA 1OAQL 1CS6A 1WBYA 5H37H 5FO7B 4O58H 2CK2A 1BJ8A 4GRLB 3VWKD 4MJ2A 4RFNC 5IT2H 12E8L 3U7WL 2VQ1B 3EDFA 3MXVL 4KY1H 3GKZA 2ICWB 4POYA 1CDIA 2RB8A 3SGEH 5TGBA 3ZKSD 3I6LE 1Q0XL 2VDML 5DUBB 2AS5M 1NCTA 4HK3J 4R2GD 2EEDA 3QG7L 3UTOA 5EPMA 5K9KB 1AD0B 1MIEH 4PREA 3T09A 3BKCL 3RVTD 3J7HA 3UTPE 3RKDC 3BKMH 1FL3A 4UINH 5BRZE 4NOBA 3K3QA 4NNXB 3TEUA 5BCAA 1O7VA 3BP4B 3QUKB 5KG9A 5CP7B 2DQFA 5JQ6H 5DJYA 2D4FA 1DANU 1A4KA 2YK1L 2BXZA 4NQED 4QTHA 2JTDA 3HPJA 3ZT6A 4Q9RL 4PRPD 1XF4A 4AM0B 1OSPH 4MD5A 4R97B 5DK2A 4U6HA 5E2WL 3H42L 3QQ3A 3GJFK 5CKAA 4PJBB 2LU4A 1NFIB 3QI9D 4XP6L 4KPHL 2IANE 1DSFH 4U1GC 4PV9A 4EXPX 6FABL 1B0WA 1T66C 2HTLD 1F3RB 2AQ3A 1IVLA 1TZGL 4UIMA 4HWZB 4S1DC 1XZ0A 5EWIL 4JHWL 3RPKA 3FN0L 4LLYB 5BO1H 5DD0L 3GRWL 1JN6B 4OAWA 2O26U 5BOPA 3NH7H 4YUEL 3RNQA 1ZWIA 1Y18A 2IH3B 1FNAA 5B38A 1P7KB 2C1PA 3WUWG 1J18A 1DQMH 2V6HA 4X6DB 2CDEA 3TO4C 5CGMA 1F2QA 3RGVC 4CMHB 1QSFA 3MRDB 4X4YA 4TQEL 3SE9H 1MHCA 5HVHB 4TTDD 3CJJA 3MBEA 4XC3L 1BX2A 1VA9A 4ZFGL 5TDNA 4OKVB 3FO1A 5SWSA 1Q0YL 3QCTL 4OLWH 1DBJH 3ARDA 1EJOL 5DC0A 3L3JA 1ZLVH 2HT3D 1I8IB 3K80A 1TJGL 1CDBA 1SHMA 4CVUA 1RVFH 1X44A 5FA4B 3LQZB 1A1OA 3FB6A 1K6QH 3B83A 4L9DA 5EUKB 5HHME 1LEIB 1EGJA 3U83A 4G43A 5F7UA 3UJJL 1LWRA 5E9DD 4NRZA 3GI8H 2QQQA 5T1MA 4QRTA 1OTTD 5KTEL 1WIOA 3T2NL 2E6QA 1KNOA 3VXTA 5IESL 4EXKA 4FQ2L 1G9MH 1QSFE 2F5AH 4YHML 2G5BB 3AXLA 1UQSA 1KF9B 5FOJA 4HUXB 4QOKB 4ZAKB 4N5ED 4UUJA 3GDBA 4P9HH 1YMHA 2BNQA 3VJ6B 4C4KO 3G6AA 2I25N 1F2XK 3U0PB 2FJGA 1U8IA 3DHJA 5T33H 3X3FH 1FVEA 3DURB 1A8JH 3HS0B 3G5VB 5EBWA 1ZT4B 1MLBB 1G9NL 4OFYD 2I5YH 4JHAH 5DT1L 4R26L 4ALAL 2A9NH 2NY0D 4ZUUB 3S36H 5CBEA 1F45A 5BS0E 3NZHL 2HKFL 2ICEA 4PR5A 4IRZH 1G6VK 1I4FB 1QSEE 1ES0A 3JWOL 1U3HD 1RZ7L 4AZ8A 3P4MB 2EEAA 3EGSA 1RAMA 4RAUA 2YMXL 2PXYB 1BD2B 1T22B 1XFPA 5EBLA 1XGUB 1UCTA 2V9TA 4XNQB 5I66B 2P45B 2BNQE 5JW5B 3GHEH 1UG9A 4E0RB 2XY1A 1TETH 3S37L 3U36B 3RZCB 5IGXH 4BYHA 1H3XA 1KIQA 4NC2B 1SYVA 4OT1H 5EB9A 1BGXL 4DK6A 3IAPA 3OKEA 4RA0C 3C5ZB 1OVZA 2NMSA 3VXSA 1FVDA 1H15A 3PWPE 3WNPA 1HXMB 3FQTB 3MA7A 1CN4A 2FYYA 5HGAA 1ZOXA 3LN5B 2NPLX 1FC2D 5IK3A 2X42A 5D5ME 5KG9B 5DJYB 4Y5XC 1RQ5A 1SJVA 1KPVA 5DHXB 4HBQA 3KYOB 3C8KB 1XF4B 4U6HB 3QQ3B 2BMKA 3GUTB 3O6FD 4JN2A 2DIBA 2DJ4A 2ZPKL 4M9PA 4U1KA 2WBJC 3MRPA 1EEYB 1R3KB 1ZTXH 1Q72L 1UCBH 5IB1A 1RY7B 2NY2C 5IQ7H 2D0FA 4X5XA 4XBEL 5JUEH 3VXSE 1CD1A 4M6MH 1DN0A 5FYKE 3BQUC 3ZSSA 4OZGE 1LMKA 4RFNB 2PTUA 5I1HH 4FXKA 5JOPE 1ZXQA 4QXGH 3MV8B 2G2RA 4WTZG 2DLEA 2DQTH 3MJ9H 4OUOA 2UUDK 2R9HC 4Q7DA 2C1PB 3V5KA 2RHEA 5I0ZA 5M7QA 3SDDA 3HE7D 3ZE2E 5L6YL 5FM5M 1BHGA 4ZMAT 3I50H 3FQUB 3ECBB 1FCCA 3VG0L 2P24A 3OAUH 4UV4H 3S5LB 5E00B 4GFTB 3L3JB 3SGEI 4LHUG 4N0CD 4GKZA 5DMKB 4IDLA 4P2QE 1A1OB 3VG9C 1JTTA 5JXED 4KRPD 4XMKH 4AJ0A 3TN0A 5M94B 1CL7H 4PJHA 1AR1C 4OGAC 4JRXA 3SE3C 1JWMB 5B3JE 5AD0B 4LVEA 4PFEA 3RWIA 4DKAA 3V52H 1L4IA 3VRLF 5J13C 3RWHA 5IMMB 3VXTB 5CD5C 3AC0A 3X17A 4MNGB 5EU3B 3ILQD 4P4KA 2BJML 4U1GB 2GQHA 4O4YL 5IB3B 3PWNB 4NN7C 1P2CB 4ODWB 1KC5L 2BVYA 1U8IB 3ISWA 1A6ZA 2Y7QA 1XF1A 1KB9K 1J1XL 1B2WL 4HW6A 5GIRB 5F7HA 4CW1A 1KJMA 3DVNB 1BM3H 5GRXG 4JKKA 2VL4A 4HWEL 3C60A 4G6KH 1MCLA 2AEIT 4EN3C 4PJHE 1Q8MA 1VPOL 3TO4B 1BVKB 2H2PC 1JV5A 3RGVB 5DMGD 4KWUA 2R56L 1JHKL 4ORGB 4R96B 1KBGH 3B2UC 3OSKA 1R3HA 4LQFL 5FO8A 4L5FL 4WU7A 3TWCL 2WWMC 4FTVA 4MAYD 4LCYA 4OCWH 3UEZA 4QXUH 1I8LA 4YDIL 5DK0A 1GSMA 3A6OA 1PX4A 4JJHA 1XR9A 4LLVB 4LSPH 3S98A 1BMGA 4GXVH 4HKJB 4JN1H 3DBXB 2GW5A 4KVCL 1NCAH 4JB9L 4LCUB 3NCCB 3Q3GA 1R6VA 4KVNH 1KIQB 5GS2H 1NCWH 3OKEB 4HWUA 2VDRL 1TFHA 2D7TL 3P9MB 4LPVA 4FNLH 1T2QL 4BFBD 1UYWH 1H15B 3P4LA 2PKDA 1I1RA 1O5DT 2Z4QA 3FT4A 3IDJB 4PUBH 4RAVB 1RUAH 3CDCA 2XNAB 4OD2A 3R06B 3VWKC 4NQXB 2HJFB 4FTVE 1GVIA 2AK4A 2DBLL 1BZ7B 1HIML 3JV4B 5DEZA 3T77B 4Y5YC 3QUXA 4G80B 4YHZL 5FKPA 3EYUL 5ADOL 1OW0C 4DUWA 3K46A 2AGJH 3HUJF 3WXWH 4R2GC 1T21A 4LDEB 4EN3A 2ZUWA 2B2XL 3U30C 2H45A 5MP6H 4M61A 3MRPB 4NNYB 3LEXA 3BRFA 4IRSD 2A6JB 4U4BA 4YHNA 5ICXB 3RVTC 3TVMD 1GGUA 1Z0NA 4N90E 4ZD3L 5F1KC 3QHFL 3VFWA 1OTUD 2XQYG 4XCYB 2FX8H 4XPFL 3SJVD 1R0AH 4Q97A 1X7QA 2W65B 4OB5L 2FH6A 1MNUH 2DM4A 1NAML 2AK4E 1HDMA 4HUUB 3BIAX 3RWCA 1BIIA 4M48L 4H1LH 5DHYA 5IFJB 3LIZL 2ZUUA 1TZHA 4U1HA 5HHPA 3QI9C 1HI6A 4G9DA 2A77H 2XZQL 3MJ6A 3L3HA 5FCSH 5MEQB 4HIIA 3CX5K 3C2AH 1ZVSB 4Q9QH 4KMTH 2HTLC 1NH6A 1MFDL 3S96A 1S7QA 1XGRB 4K8RD 5DEGB 5ESAA 4PD4K 4IIQC 4Y5XB 2CLVB 1BOGB 4GKOA 4JRXB 2F8XC 3BT2L 1FVCA 1OGAD 1I9JH 3MJ7A 5IHLB 2EICA 5HDBF 4HGMA 2NCMA 4LIQH 2XA8H 1F58H 4TOYH 2C3WA 4JM4L 3TZVD 3OAZK 3WLWD 3RWHB 1MCNA 1MCDA 4IJ3C 3SO5A 4NC1E 2AW2A 1IAIM 1K4CB 2WBJB 4TTDC 1AXTL 5HYQB 4MSWA 1KB5B 4RFEA 1X4XA 4H26A 3B5HA 2NY2B 4BH8B 3RP1A 5C0FB 1YYLH 4XPBL 1XGTA 5DVLA 3CSBA 3BUTA 4XP5L 1BBJB 1S78D 3TIDA 4HAGA 2ZSVB 3BQUB 5DQ9A 4K7PH 1NDMB 5CUSH 2YA2A 4HS6A 3FB7A 1I7TA 1RJLA 2MCPL 4XRCA 1T6VN 3V5DA 4NJAH 2FZ3B 5F9DC 3SDAD 3LCYA 4PRPA 3MYZA 1R24B 4WTZA 5JNYA 4CU8A 2UYLB 1EEUA 4J3UA 5DJAB 1R3HB 1OTTC 5F96H 1B0GA 3EDJA 4QHMA 1S9XA 4IHOB 4ODTL 2E9WA 1MREL 3M17B 4KK9D 2Q20A 4N5EC 4ZUVA 5ILTH 3FO2A 5E2UL 3QP3A 5I1KL 5JOFB 4X80L 5A1AA 3G6DL 3TF7C 3VXNB 4Y4KA 4PLNC 5FIEA 1FV1A 1EA9C 2IPKA 4LHUA 5I15H 1MIMH 2ATKA 3VXMB 1DZBA 2BP3A 1NCBH 2CRZA 2XYCA 1CTNA 3HI1A 4WI9A 1UM5H 3IS0X 3P9WB 1A0QL 2WZPD 3QXDB 4OZFB 5J13B 3AAZB 4G6JL 3PE9A 1U3HC 3N0PB 4RMRA 3REVA 1HHIA 1EZVX 1UXWA 2BVQA 3NFPA 4Y4HD 3T4AA 3WBDA 1CL7I 3SBWA 3JBG7 2AV1A 3TNNA 1MCWM 2KDGA 5BMFH 4LKCB 4NN7B 4JCLA 5GGVH 2Q3ZA 3HHRB 3QUXB 5DURB 4QXTB 4JFDB 3PV6A 4HS3A 1DL7H 2BVEA 1M7IB 1FFOB 1ZA3A 3O3BA 1F8TH 2VAJA 4OIIH 4LEXH 4PB0L 3T65B 3S3JA 3WIIH 4EN3B 1NMBH 4FQQB 5IHUH 3MLSL 4X6BA 4E41B 5DC4B 5BV7H 3V7AG 4L4JA 2IJ0C 4YHNB 4HGWA 4S1RH 5C07D 3BVNA 4R8WH 2R0LH 3KHOA 5GHWL 2RFXA 3SGKA 5K9QI 1M6OA 1I3VA 2NY7L 4YX2L 5DTFB 3F62A 4JPKH 5CILL 1NLBH 3MLYL 5GSRB 5F6HI 4WNQB 4XAKE 2R8SL 1FLRH 2YRZA 5C0BB 3RWCB 4OFYA 4M62L 1TZHB 3PGCA 3O6FC 1A14L 4OGXL 3CVHA 1JJUA 3NTCL 3WFEL 4M02A 1ZVYA 1LDPL 1RIHH 2NW2B 5L0QC 5IFHL 2DMCA 4WGWB 3EO0A 5JR1H 3HCVA 1KG0B 1QBAA 2F8OA 5DVKA 3S96B 4BZ2L 5ANMA 1LO5B 5D7IB 5I1EL 4Z0XA 4YHLH 2P49B 1C5DB 1T2JA 4PRID 4U6YB 3CK0H 5IFAL 3VWKB 3ES6A 1YY9D 1D9KA 4OCYL 4PJIA 4O9HH 2E7MA 2WLZA 3DV4B 3GHBH 4Y5YB 4Z0BL 3QIUA 1KCVH 1I7UA 4XNZC 2X4RB 3MJGX 3CCHA 4XXDB 1Z9OA 5BVPH 3FJTA 4R4ND 2PW2B 2GIYA 3BDXA 4HKBA 2OK0L 4R2GB 4ZSOB 3HE7C 3WL9A 3U30B 4M1GL 4M6OL 3WHE1 1DBAL 3VW3H 3BPOC 4NP4L 4KTEH 1PEZA 5HHXH 1Q94A 2YEZB 3LB6D 5E8DL 3FB5A 3TIDB 1EMTH 4N0CC 5DQ9B 5ANME 5JXEC 4KRPC 1Q9WB 4NN6C 1T4KA 1FORH 1INQB 1XR8A 2ARJQ 1TIUA 5E56A 1RJLB 1QA9B 3VE0A 4NQEB 1H0DB 4XRCB 4PJFA 2GY5A 1MHEA 3AU1B 3BH8A 4PJAA 4YE4H 3V5DB 1A6UH 4PJIE 4U7KA 5H37G 2B8OT 4PRPB 5E95B 3RAJL 2DTML 4AL8H 2MHAA 4N0RA 2HWZH 1YEDA 3D39A 3SHSA 1MQ8A 1KLGA 3QI9B 3FL7A 3U4EB 2DQJL 4HXBL 5BQ7A 4ONFL 1U8LB 4CN6A 2F19H 1MRCH 2FGZA 4LSUH 4Y16D 4ZUVB 3MODL 3MUGB 3UTTD 1G6RA 1JL8A 2VDLL 4UTBL 5DRXB 1HH9A 2Z91B 2DICA 5CCKH 5LAXB 5E8OB 4IIQB 2ESVA 4YPJA 3SKNB 4EDWH 4NNPL 3QO1A 2ATKB 4YHPA 3DVFA 2BY1A 4DQOL 2P4AB 1KCLA 3FQXB 1E6OH 1T7WA 1O0VA 4EIGB 4ERSL 2XZAH 4PJAE 3ULVE 4IJ3B 1JZ4A 1UA6L 1HHIB 1UXWB 2WIIA 3NPSC 3A0OA 1KT2A 2BVQB 2VH5H 3MFGB 2HFEA 1U8NA 3D39E 4D9RD 2XG5A 3KPOA 4MAYC 1RUPH 5GRYA 3EJZD 5GGQL 5BZDB 3T0BA 4KFZC 2OR9L 3KXFD 1HHJA 2I26N 4LPYA 2BHZA 2K3TA 3KLHD 4MQTB 2ESVE 3ARFA 3QFDB 4MNQA 3UZEA 4YHIA 4K3DH 2CGRL 1Y6MR 2OZ4A 5E9DB 4X6BB 5IWLC 1WT5C 1MFBH 3T4YB 3SY0B 5C92A 2HVJA 2MSPA 1K5NB 4S2SA 1OM3H 2HFTA 1QR1A 4Y7MA 3O6LH 1S5IL 3CDGA 1FNSL 3MRGB 3HE6D 4XCNB 3V8OA 1KACB 5D72H 3MR9B 1JF1B 2EDKA 4QF1B 4HPOL 1OPGL 4MJIB 2J8UB 4NZDA 3O3AA 2RIKA 2BCKA 2HA1A 3FT2A 1E4WL 4KK8D 5DRWA 4L3ED 3U9UA 1S7SB 5GZND 4HZLA 4FQIH 4PGZA 5F7NC 3PWJB 2X05A 3STLA 5CEYB 4GJTB 5C8JB 4OBRA 1F4WL 4MNQE 3D85D 2VDKL 5KOVC 2PETA 4IRSC 1BJ1J 4FQXA 3GSOA 3SE8H 5HDQL 1U3HB 1FFPA 2VLJD 1C16A 3EO0B 1OY3B 4APQD 3MOAH 4R9HA 4OSUL 1MCQA 1T2XA 3WFHA 3VFGH 3MZTA 1P9MC 4CU6A 1KUMA 4GQPH 3CXHJ 4XXCC 3L1OL 4HFWB 4WFHE 5DFWH 3HZMB 5HYJE 5EU7E 3WIHH 3F5WB 1R3JB 2VXUL 3QNZB 1IC7L 4X83A 3TV3H 1AGFB 5I8CB 1WIUA 3JTSA 4HKBB 4KTDH 4J23A 1UM6H 3WL9B 5L2JB 3D1MC 3LMJH 1U8KA 5KVEL 5KVGL 4JG1L 1QRND 2YZ1A 1IFHL 3QCVL 3EIFA 5J8OA 4RA3A 1V7MH 3JWDH 4LEOB 4P5MB 1IGIL 3STBA 3KG5A 4QRUA 1EEZA 4K8RC 2F58H 3F6LA 4F9LA 1MF2L 5MENA 1FIEA 3EFFA 4GRWB 1F11B 2GSIA 5A40E 1MPAH 2C4FT 3BH8B 4Z7VF 3VFPB 2WW8A 3ZTNH 5GS3A 1IAIH 4YHOL 2BHUA 3DSFH 3TZVC 3WLWC 1P7HL 3UPRA 4F58L 3GBLA 3O6FB 2VITA 4HJJL 2AJYL 3OBAA 5BQ7B 1EAJA 3TIEA 3PL6C 5ENWB 5L0QB 1G1YA 2PTVA 3B9KD 2B1AL 2OSLA 1WZ1H 3MRIA 3TVMA 5DHVB 1S78C 4MXQC 5IB4B 2XQYK 3EYFA 1FAKT 3V7AE 1NCUA 3VFNA 3H0TB 3B2VL 2PNDA 4M5ZH 5GJTL 3W0WE 1IEBB 3SOBH 4OF3A 1A6TB 5MENE 4F80A 1ZLUK 4EKXA 5DO2D 3FCTB 3MV7A 4XNZB 2X4UB 1N0XH 2JB5L 3SDAC 4CDHA 4CMMA 3IRPX 7CGTA 2VXVL 1I7RA 2YKLH 4JFOB 3HE7B 2EE2A 3UROR 5EIVA 4M93C 4RQQB 1SBSL 3BPOB 2HFEB 1U8NB 1XAUA 1ZHBB 2P5EA 4JREC 5TF0A 2W1NA 3KPOB 3UJIL 4KK9C 5C86A 4XGZA 4DVRH 1FCGA 1U2CA 3BKJH 3HAEH 3JZ7A 1X6LA 1MJJA 1X5YA 4Z7QF 1E28B 4KQ4L 35C8H 4KRPB 1G7JA 4NN6B 1WEJL 2VDQL 4F7CA 4YHIB 4Y0GA 3D0LA 2EDYA 3LN4A 1ONQB 3NPZB 1HYRC 5BZWB 1YPZA 3MGOA 2VISA 4RMUA 3MV7E 4HBCL 3WIFB 1OAQH 4JGUA 1S7RB 2LQRA 3PIQA 1P1ZA 1L9MA 1G7HA 4JKMA 5KSVB 5FYKL 3MRRA 12E8H 4WEBL 4NQUA 3RWEA 1RFDL 3VFUB 4CJ1A 1F4AA 2Z0BA 1DLHA 1OGTA 3MXVH 2LTQC 4DAGH 4YBHA 3PGDA 4DUXA 1WICA 43C9B 2P5EE 4JZOB 2Y5EA 5KSBF 1JPFB 1Q9KA 5HDLA 1Q0XH 2VDMH 3SEPA 1JPGB 1I3UA 3FT2B 5MHSD 4DN4L 1HINH 1TTFA 1IC1A 1ROWA 2C1OB 2YSSA 3U9UB 1X4ZA 4HJGA 1MVUB 4OFKA 4H8WC 2X44D 2DQCL 1TXKA 3Q0HA 4CADB 3O45B 3SDAA 3MNZB 4ZDHB 4JCMA 1YPZE 4KUCF 1FL5A 3PABB 1ND0B 1P4LB 3NPSB 2X1XR 4KXZH 2QJDA 1LQSR 3TH2T 2E9JA 2R0KL 5FDWA 5JW4N 2YK1H 4MAYB 4NSKA 3Q5OA 2CJUL 4LGSB 1JVKA 3GK8H 2P8LA 4JFEA 3ET9F 1BF8A 4Q9RH 3H2WA 2Q76A 5IP4A 1VADA 4PJ8A 4IMLB 5E2WH 3H42H 4M43L 3QR2A 3BP6A 4Q74A 4LVNC 1C1EL 5DYOA 4PJ9A 4XP6H 4KPHH 2K1MA 1T3FA 5DS8B 3AMKA 2QSQA 4X7DC 3HC3L 1TZGH 1G7MA 4HUWB 3EZ8A 4Z76A 4BKLB 5DUPH 4JHWH 3O11A 1YMMA 3P0YL 3IDIA 3FN0H 3BESR 5F9AC 5I1JL 5FHAL 3GRWH 2L7UA 4X6CA 4Y4HA 3FO0L 4YUEH 3ROOA 3UO1L 2R2HB 2VR4A 3VXOB 1RIVH 5T3ZE 5CAYB 1I9EA 5ITFA 5DZOA 4A6YL 4JFEE 4WHDA 2NX5D 3AFLA 3X11A 1ZT7A 3FQWA 1JGLL 4HWBA 4HK0A 4ZFGH 1IGTB 4DZ8A 1Q0YH 5A2FA 5EU4B 5FO9A 4GKNB 4IRSB 1EJOH 2O61B 5JW4Q 1YEIH 2P8PA 3ROLB 1PLGL 2VWEE 2R23A 3TVMB 3D69A 1ZV5A 1YMME 1J0ZA 2D03H 3WNOA 1D6EA 4X6CE 5EUOA 1YEJL 3SJVB 2I9TB 1P4BL 4JG0L 4P2CG 4HMCA 4NFCA 3T2NH 5JORA 3SDXE 3BZ4A 4NQDD 4FQ2H 4GAYA 4YHMH 3K2UL 3HFML 4WY7L 1GC1H 4XP1H 4YZFF 5LGHL 1L7TL 3ARGA 3MGAA 1ZGLB 4YDLC 2PW1B 4XGZB 4Y16C 2FBJH 1B3JA 5DT1H 2AQ1A 5DDHB 3HG1A 1MJJB 1UWGH 3KAAA 4R26H 4ALAH 3DX9B 1MOEA 1YN7A 1NGYB 4PRIA 4OI7A 3NZHH 1YEHL 1G7JB 1A6PA 4JDZB 2DN7A 3OKDA 1OGAB 1TCMA 2B39A 1EIBA 1QUNA 2AI0L 5F9WC 3NIGE 3JWOH 1QVOB 2UZYB 2VISB 3TZVB 2ZUXA 2ADJA 2EDNA 2H32H 4PV8B 2YMXH 1P1ZB 1G7HB 5HBBA 4Q2ZB 1A3LL 1AD9B 2B4CC 3PL6B 3RWEB 2K9UA 1CG9A 1OGTB 4H1LG 2VL5A 1SJEA 4U49A 3EJZC 3QG6A 32C2B 2GY7B 1BFVH 4K9EC 2W9DL 3S37H 1KTRL 2AJXL 2NXZD 1NBQA 4F7PA 2VAAB 1HQRB 1UB6B 2PTTB 3KLHC 3HG1E 1BGXH 4R4FL 1M1SA 3GSQB 3GMRB 3L5WB 3S34L 3U6RB 4KTYA 5ACLA 4W68A 3SDAB 1DQJB 4JO1L 4K3EL 2HLAB 3ALPA 5E1AA 3V6ZA 1FL5B 1H5BA 3DX7A 4M93B 1EEQA 1RHFA 5LG1A 5L9DL 1KB9J 3ZDZE 1FG2A 1KXTB 1IAMA 5FDWB 1CGSL 4JREB 3HE6C 2E6JA 2PR4L 5IMKA 3MUJA 5B39G 1R5VA 1BLNB 3G6JB 2WK2A 4QHUB 3BGAA 4V1DD 3UTTA 4DKDC 3OR7B 4GG6F 1VADB 2X6MA 3RJDA 4HV8A 3BP6B 4JO4L 4UV7L 1LNUA 4ISVB 2ZPKH 4KK8C 2VDNL 3QT2A 1IGML 1YQ2A 3QNXA 1EUTA 4MCYA 1Q72H 4LNRA 1MJ7L 5HY9B 1WFTA 3IRZA 3GGWB 5IB5B 4BK4A 1D5ZA 2HVKB 5IW1B 5SV3A 4DN3L 2VERN 3VD7A 3O11B 5IBUB 4NKQB 3PP3H 1N26A 5E8EA 4APQC 4ELKA 2ITDB 3WJJC 2X1OA 5EG6C 4OZHB 4CL7A 2LTQB 1HILA 4WW2A 3ROOB 2R2CA 3RGHA 5E6ID 3MJ9A 3QEQD 4NQCA 1EERB 5CHNA 3FQNA 1KJ2B 1NFDB 2PO6D 1AHWC 3TA3D 1MJ8L 2ERJC 1CXEA 3T3PF 2LU7A 4HK0B 5E94B 5EOCH 1XIWA 5KVDL 4DZ8B 3VG0H 2PYEA 2O5XH 1ZHLA 2CH8A 2W0PA 3STZA 5C07B 3WD5L 2EIZB 1F4HA 1HQ4A 4JM2F 5EOTA 3CFKA 5CLWA 3L7FA 4XT1C 4CAGA 3U46A 3T0XA 4PP2B 5E6YA 2YA1A 5IB2B 3V6FB 3KNBA 1U58A 5EUOB 4TNVF 3MRHB 3MOBH 5CFHA 3P4NB 2Q7YA 4U1MB 3CFEB 5CJQL 3MROB 4NQCE 4KI5D 4ZPVB 5C1MB 5F3BB 4LVNB 3MO1B 1RD6A 3ARPA 3E6FA 3W5NA 1FH5L 1HN1A 2EC8A 3BZ4B 3OV6A 4XZUB 1V5JA 4JFHD 5JA8B 3R1GL 4NBZB 3WJLA 2BJMH 3I3EA 4O4YH 5CMAB 3IFNL 3FOMA 3HZKB 2GTWB 1JGEA 4UTAL 3I02B 2OYPA 1S7WB 1QOKA 2PYEE 3THML 1L6ZA 3WSQL 3B9KC 1B2WH 1DQQA 1X5AA 1DP0A 3T3ME 1UKQA 2J6EA 1YN7B 4PRIB 1QLEL 1SJHA 3OGCA 2CDGA 4KKNA 4LNVA 5GSVA 3P2TA 5LQBH 1S8DB 2R56H 1V8HA 1AHWA 3CX5J 4LQFH 4L5FH 3GEWB 5ERWA 1XCQA 5CGTA 4P57B 2IG2L 4UAOC 5IIEB 4MQSB 1HH6A 2NW3B 3OKOB 4PD4J 5D2LB 1MFNA 4QHLB 4YDIH 2O93L 2QTEA 1XGQA 5D7KE 4AH2B 4KDTC 3B3IB 2APWA 2NQCA 4XNXL 4KJYA 5ACZA 3D0VA 4KVCH 2BVTA 1QG3A 3Q6GL 3PHQA 3OKMA 4D3CL 5F1NA 1DBKL 1Y6NR 1B0RB 2VDRH 3SKOA 2D7TH 1R3LB 1T2QH 3RTQC 1DFBL 2AJSH 2GI7A 1KCRL 2P5WD 3GM8A 3H6JA 1NC4D 4W4OA 5JO5A 2Z8RA 5C0DB 4YDLB 2D7NA 2DBLH 5IMKB 1HIMH 3V95A 4Y16B 3B9KA 4XTRD 1OSZB 3OG4B 5IW6A 3UTTB 1NPUA 1EUUA 4OGZA 3GSUB 1N64H 1EFXA 4DGIL 2B2XH 4L3CA 3BZFB 4HHAA 4K2UL 3U7YL 4OD1L 4MJ5B 3QIWD 4QRPA 4AIZB 5F9WB 1MQKH 3CVHL 3EOYG 3QUMB 1EHLL 4ZD3H 2JLLA 4FQCL 3QHFH 1M05B 4LRNL 4LLUA 1QFUL 4MLSA 1RUQL 3MRLA 2GT9A 5F9OL 1X5FA 4XPFH 1AC6A 2PF6A 1VFMA 4KDTA 3DYMA 4NC0B 3HI6L 3HMWL 1YJDL 2F15A 3KXFB 4KKCD 4M48H 3FO9A 4H1LA 1MCWW 3LIZH 4UMGA 4I3RH 1CXKA 4JZJC 5IBLD 4MB5A 1IZJA 4XVJL 2M1KA 3IFPA 4Y1AE 3O9WD 1Q9LA 4DCQA 2XZQH 1KYOJ 1WUNT 4MD4B 2EC9T 3L3DA 5KZCD 1WLHA 4Y19E 2IQ9H 3IKCB 3LKQA 2P46B 5CZVH 4QRPE 2V7HA 3QFJD 1ZHLB 3AREA 3MACL 4AEHH 1HQ4B 3HPLB 3CIQA 5EOTB 5HJ3A 3VFRB 3CFKB 3KDMA 5TH2A 3DUSA 3GSRB 4IMKC 2R0WH 4UNTA 5CEXA 3PDGA 3ARBD 3HE6B 1RZGB 3QEHB 3RUGB 5FYKU 3BT2H 5F7EL 4KC3B 3KYNA 3MREA 1RMFL 4XBPB 1MCIA 1AQDB 4JM4H 1NJ9A 2GJJA 2ZUTA 1F3DJ 2CLRB 3ULVL 4IEFB 2BSRB 4XNMB 4L3EB 1PEWA 1AXTH 1BBDH 1PG7L 3EJJX 4XAWH 2KL6A 2IFGA 2OL3H 3D85B 3MYJB 3IB4A 4YDKL 4XP5H 4BSWA 3UXFA 4D2NA 4WUUA 1ADQL 4TRPL 3MUY1 1OQXA 1IM3A 2VLJB 1GZPA 1J5OL 4WUKL 4APQB 1G6RL 4FQHB 5LGJA 2WLYA 1FZKB 5KSAD 4BZYA 3UP1A 3C6SB 3ULUF 1A3QA 2MCPH 2WSKA 4B41A 1SYSB 3RY6A 1QKZL 5ABDE 2G75B 3NGBC 5C2BL 4JZJA 1AHWB 4LIQE 2ERJB 4MCZB 3WMSA 2DWEB 2ZWLT 1TNMA 3RVXD 5JIKA 2KZWA 2EC9U 2XV6B 5LCVH 1U95B 4NWTL 5E2UH 4NUJA 2GFBB 5I1KH 1XGQB 1CK0L 1QRNB 3G6DH 5LWYH 4YXHL 4NBYB 4GAGH 3IKKA 5D4QA 1A7RL 1LO0L 3FN9A 4IMKA 4WUUE 2YPVL 3JUYA 1F4XL 2A83A 5CGYD 3T0EE 5F1NB 3PV7A 2KH2B 2IC2A 4LLDB 1U0QA 1JHTA 1A0QH 3L9RB 3VXRA 2OZ4L 4MB3A 4G6JH 1TTGA 4L4TB 2X5PA 3EHBC 4RGND 3G08A 1JZ3A 5E2VL 1OT1A 1BZ9B 1SBBA 3BO8A 4PB9L 5D5MF 1N4XL 3UTSE 4Y89A 3MX0A 3B9KB 2RJMA 4WI2A 4OLXL 5F97E 4KI1A 1AGBA 1WQVT 5HPMA 4J8RA 3NMEA 2HG5A 2NXZC 4FS0A 4C57C 3BKYL 4J3XA 3MLSH 5I1LB 4GRMB 5I71C 4EOWL 3GJFH 5A16B 4AEIL 4DGVL 4YIQA 4KKAD 3VXRE 3BP7A 3X12A 4ESKA 3LKSB 5GHWH 4UAOB 4UU9A 3RBGA 4GMSL 1S7TB 5T1DL 4RWYH 4KK6D 3MRLB 2NY7H 2VLME 3HNTL 4OZGF 2DQHL 3BWAB 3MLYH 1FNGA 3O2DH 5H2BB 4X5WB 1Z9MA 4NQSA 3P77B 1WFOA 4ZOEA 4M62H 2LU3A 4NZTH 5JLZA 3FFDB 4XMPL 2F53D 3WFEH 3NTCH 4HDIB 4DCQB 3ZE2F 1T04A 2R1WA 1A7NL 1Z3GL 2OP4L 3RTQB 3UDWA 2ZUSA 3V0VB 5F3HB 4OFDA 5HPOA 2NNAA 1I1YB 3OB8A 5I1EH 4DTGL 1TITA 3D3VD 1C5BL 2FX7L 1J11A 3DETD 4QGTA 4XWGL 4JY4A 4G3YL 3W81A 4F7MA 1K8DA 3NZ8A 2DMKA 2ATPB 2HT2D 2J8HA 1H3PH 4RMVA 3CU7A 2EKSB 3KYNB 3MREB 5E6IC 4Z0BH 3TPUB 1KIPB 4MQ7A 3ZSTA 3L5XL 4D94A 1NJ9B 2A74A 5DD1H 3GMQA 2D7PA 2PO6C 2OK0H 4LLQB 2QHLA 4JFYB 4M6OH 5CJ5A 4UOJA 1J0IA 4D0DB 4NP4H 1YEGL 1CFSA 1GIGL 3TBVA 4XCFL 4X7EC 5AZEL 1PX3A 1IGFL 1TTUA 2HKHL 5E8DH 1IEAA 5L88L 4JFXB 5BOZG 2BNRB 5IG7A 3QIBD 5GGRA 1KN2L 1GZPB 4LU5L 1HK6A 5F1IB 5F1OB 5T1KB 2C3VA 3AS0A 3LQAH 4JRYE 5C0AE 3VI4F 3QJHA 4IRJA 4LCWA 4P5KB 3T1FA 3VRLE 4PRNA 1IAKB 2YRPA 3Q5TA 1E4XH 1RK0A 4V1DA 4HCRA 3ZYZA 1BFTA 4JZJB 4KDWA 3LVEA 3SKMA 4KI5C 1AFVL 1GHFL 4WV1A 2DQJH 1KTDA 1T1YA 4HXBH 4ONFH 4FXGB 1U93B 4JJ5A 4PGBA 4WCYL 3WHXA 4K94C 2QQNL 3MODH 3ZDXF 3KLAB 1JWSB 5FM4A 2VDLH 4UTBH 4N68A 1A6AB 3QXUA 3DRTB 5I1IL 1TVHB 1A22B 3GMLA 3BD3A 1FBIL 3P11H 5C9JA 4XCEA 1JZ6A 2A6DB 4NNPH 5DD6A 1BREA 2GCYA 4ZO6A 4CDGC 2IQAA 4DQOH 3IJHB 4QTIL 3IJSB 3UBXG 4LCWE 5F7DA 1JHTB 3E1F1 3EFDH 5GJSL 3KPRD 4XHQA 4ZYKB 3GNML 3PWVB 3GIVA 3TA3A 1UA6H 2AJZA 2NX5B 4HKZA 2AKRB 1D6VL 1MWAH 2IALA 4MX7A 4X8JA 3G08B 4PGJA 4ZOBA 4YPGB 4MJIE 1XF3B 5JPNB 4YFLF 3BO8B 3D18A 3RJQB 2FLRT 2OR9H 2X4PB 4RX4A 1EHXA 4KY1L 3KJ6H 2VMFA 4MS8D 1ZK9A 3HUJA 3CMOL 3WFCH 1VFBA 5IF0B 3DV6B 3RY4A 2CGRH 4EJ1C 3GJEA 3WUZA 4Z7NF 1N6UA 4OBSA 4PJ7F 2RR3A 3NGBB 5CEZD 3DXAD 1MIEL 4YIQB 5F7YC 5JW3L 3F7YB 1IKNC 1S5IH 2GSGB 4NQDB 1FNSH 1SVCP 4UU9B 3KS0H 5FK9B 1XH3A 4BELD 4HPOH 5H35A 3BH9A 2WAHA 5EZJB 5JQ6L 2Z8SA 4OZIB 2CPCA 5T3ZL 3G04A 2VDOH 3WNMA 1KGCD 4L8CA 4XTRC 4BSVB 2EDHA 4NQSB 1E4WH 1N6VA 1ZSDA 3OJMB 1OSPL 2Y6SD 5DZNA 1AGDB 3LRGA 1V3MA 2IMMA 4ACPA 1UEYA 2UUDH 2Z31A 3T0AA 2F54D 2R1WB 2AV7B 1T89C 3QIWC 3GKWL 1WVZA 1E6JL 4M3JA 4J4PD 2B0SL 2E27L 4YBLC 4L29A 4OSUH 3QDGA 3QEGH 4HD9A 2VABA 1OT2A 1R5WA 3MRCA 2R2EA 5BO1L 1HHKA 1JUFB 4MQXD 4JY4B 3FAXA 3NZ8B 3FOLA 1YUHB 4P3DA 5FEBA 5KANI 5JPMA 1J0KA 4PJXB 3I6GB 3D9AL 3WIHA 3NCYS 4JANB 1DTUA 4MQ7B 4GW4A 2VXUH 4JQVC 4KKCC 4X9HA 4ZFFB 2NXZB 4OD3H 5IBLC 3SPVA 2XFXA 3SE9L 3O9WC 3L3OB 4YNYA 4K3HA 2XWJB 4HWBL 1W2KT 4TVPH 3TBVB 4YAQB 5I71B 3QA3A 4YJZL 4LAQH 4OLWL 1IEAB 3WEXA 3I3BA 2QR0B 4JFFA 5GGRB 3RFZC 3ULUH 2P5WA 4RFOL 1JF6A 4KHTL 1BVZA 1MF2H 1LE9A 1NC4A 3QDGE 1K6QL 1V7NL 3ARBC 5TF1H 1B4RA 4F7TB 1P4IL 1I3GL 5HHOE 3T1FB 5HDBE 2AXGB 3OKLA 2EDOA 4PGDA 2H41A 4YHOH 3GI8L 4F58H 1ZHKB 4Z7WF 5J57B 2VLRD 4PTTA 5C0IB 5ESVA 1QRKA 1JNLH 2AJYH 4ZS6D 1KTDB 1NSNL 3CZFB 3W9DB 3QIWA 4JJ5B 3TPKA 2GKIA 3QWRA 3BDBA 4KROD 1AI1L 3BYYA 5D93C 5FYJE 3W9EB 2E7LA 3RI5F 4N1HB 3DUUA 3X3FL 3AS2A 4KQ3H 2YPLA 3PQYD 3GMLB 1JNJA 4UQ3A 2Z92B 3MUHL 5GJTH 4JFFE 5KSAC 1JFQL 2DL2A 1CGUA 2IQAB 5E6IB 3T2QA 4ZFOL 3QEQB 1UVQB 3L3KB 2JB5H 4GS7C 5F7DB 1VACA 4IRZL 2PO6B 2VXVH 5IKCA 3GSWA 4NRYA 3GMOB 4PG9A 4PJCE 5GRWA 3RVXC 4X8JB 3KYAA 4I0PD 4C56A 5C6WH 3UJIH 1OAUL 1T1XA 3WS3A 3Q48A 1BQHG 3H9SA 5ALCH 5TDPA 4E42A 1HHHB 3GHEL 4WO4D 4HULB 3HUJB 2AVGA 3HNVH 3O4LB 4O2FA 1QHOA 3G5ZA 1MHPL 3VRIA 2RCSL 2PCPA 5CSGA 1WEJH 4HEPG 2YPLE 3T2PA 2VDQH 1TPXC 5CGYC 3BW9B 5M95B 2JIXA 1T5WB 3SGJC 5MEOA 4Y4FD 5SWQB 1CT8B 3DTXA 4HBCH 3V6OC 3L3GA 3QEUA 1RJYA 3CPLA 3VH8B 5FYKH 3MV9D 4ZS7H 7FABH 4WEBH 4RGNC 1RFDH 3D5OF 5GGSY 3BH9B 1Z5LA 4O51A 4C56E 5EO1A 3G04B 1NGWA 1ACZA 1E4XI 3WKNA 4K3GA 1CLYH 3H9SE 4DN4H 1ZSDB 2A6KA 1CLOL 4NT6B 1BVLB 3UTQB 3KPLB 1LVEA 2DWDA 3DNKA 3OTTA 3TP4A 2FD6L 3U48A 4WJ5A 1ZTXL 1UCBL 4YHKH 3ARXA 3ZTJH 5EU6A 1S7XB 4KKAC 2R0KH 3GZKA 5JDJA 1I1AD 2XZZA 3FQRA 1AO7B 2YXMA 4M6ML 5EIIB 4B50A 3RNKA 5DJZB 1HHKB 4KK6C 1GGCL 3D48R 3NIDE 3ZLQC 4HIEA 5FGRA 4P46A 4QY8A 4PY8J 3P73A 4HIHB 4L4VA 1BFOA 5DJCA 2Q8BH 2XA3A 3HZYA 4MJ4A 5FM8A 3HC3H 3ZL4L 5L2KD 4XMLH 2W0LA 1MI5D 4R7NA 4UBDC 3V6OA 2VLKA 5GRZA 4G8IB 2ED9A 3P0YH 2IH1A 3OAUL 5I1JH 1A1NA 1G9NC 3GRWA 3EYVA 3ZE1E 5EU6E 2DI9A 4I18A 5IJKC 1LE9B 5INDA 2XPGA 4GMTL 3RZWA 4PYHA 2G60L 4XMKL 1ZT1A 1CL7L 3FRPG 1WC7A 5I17A 3TT1H 2EYTB 4NUGL 3U2SB 4Z78A 2HT2C 4A6YH 4ZNCD 4KHXL 3DX6A 4WIQA 4Y8DC 3SDCA 1JGLH 5HGBA 1A1MB 3QULA 4WHCA 1PZ5B 4L4VE 3OF6D 4PJGB 3HB3D 5C6PB 3OX8A 3QIWB 1A6WL 3U4AA 1G7QA 3E3QE 1PLGH 3W82A 5KS9F 3UC0H 2VLKE 1UM4L 4U1LA 4YBLB 1QD0A 1K3ZA 1VCAA 3DX8B 3QIBC 4UQ3B 3Q5YA 2DLHA 2FRGP 3F12B 1AGCA 2J6EL 2D3VA 4JG0H 2JJTC 1FN4B 3L3IA 1AIFA 2OMNA 4NHCL 2XKSA 4LLWB 5IVXF 1MUJB 5J0BA 1PKOA 1CFTA 3QJFA 3K2UH 3HFMH 4WY7H 4GW1B 3O9WB 2F53A 2WINA 4JFQB 4G8GD 4WFED 1L7TH 1XCTB 2HFGH 1C08B 2XRAH 4LCIL 4YGVA 3WS3B 1LEKA 5KZCB 5E0QA 3BOVA 3HAEB 3QFJB 3IDGA 4LSPL 2B5IC 2EYSB 3D3VA 4GXVL 1YEHH 2PUQT 2AEPL 3VRIB 4LF3A 3ARBB 2WANA 3C6LD 2D0HA 1IM9D 5MEPB 5GS1C 3NN8A 2ADGA 2XTJD 1A3RH 2BSSB 1GZQB 5I74C 3NFNA 2OTWA 5D7SL 1IQDB 3DTXB 3X14B 2CSPA 1UGNA 2H32A 2X9YA 3BN3B 4QHKI 1RJYB 3CPLB 2SEBA 1X9QA 2X70B 4P2RE 2FHCA 2MKWA 4MYWB 1RUAL 5SX5K 1F3DH 1J05A 3RIFF 3IDMB 4PJ5A 5D93B 3R8BB 1A6VL 4X4XA 2W9DH 2AJXH 2BOCA 5IMLB 1NDGB 4MS8C 5SWZA 1CXFA 3E8UL 5DR5L 4R4FH 4HKXA 3MFFA 5KSAB 4Y2DA 5B3NA 2JJTA 3S4SG 3WXWL 4JQXA 4PY7A 1VFAA 2VDPL 4JO1H 4WJ5B 2HN7A 3P3YA 5BVJB 3IETA 4I48B 4I9WD 1W0WB 3QUYA 3DROB 4OZHE 1Z0MA 2DKUA 2F9BT 3FN3A 1CGSH 3FQRB 2PR4H 3RNKB 3FT3B 4B7LA 1W0YT 2GJ6A 2FHFA 3LKRB 4PRDA 2LFGA 4Q6IA 4QY8B 3O2WL 2BSTA 5DSCA 1RZFL 4PJ5E 3REWA 2EDXA 3FFCD 2J1KA 4HSQA 1BQHA 4JO4H 4CRPA 1QO3A 2WQ8A 3LS5L 3PNWB 1BFOB 1IGMH 2Y6SC 5SWZE 1TPXB 2CD0A 3HZYB 1NCDL 2CLZA 2DI8A 2NLJB 1MJ7H 2COQA 4JPIA 1FSKC 2A77L 2R29L 1NFKA 4R7NB 4DN3H 2YBRA 3JVGC 5TPWL 2HYMA 3I6LD 3VFVB 3EYOB 4MD0A 1AGEA 3RWFB 4KMTL 5HHQA 4WDIA 4HXAH 4RGNB 4KV5E 3MRQB 4GW5A 2VYRE 2FR4A 5FCUL 4LGRB 3ZKND 4M00A 2XPGB 1IT9L 4Z7VA 3OG6B 2ZUQC 4MQXC 3VD5A 3UTPD 1D3CA 2GJ6E 4X4ME 3U9PL 4TULH 1I9JL 2V7NA 4Y8AA 5JW4R 3OKNB 5BRZD 1MJ8H 1OCWL 4U33A 4LIQL 1MSPA 3QQ4B 3ZHLA 4D0CA 3WHE0 3QULB 5KVDH 3CH1A 3LKPA 2OMBA 3IJYB 3SCMA 3D25B 2K7QA 2B20A 2FIKB 1WIPA 4R3SA 1G7QB 4XBGA 3WD5H 1EZVY 1LP9F 1MHHB 1YYLL 2NY6D 1I9IH 2GITB 4U1LB 3EBAA 5I16A 1T83C 5FGSA 2ENSA 4ZO9A 5EBGA 5DJXB 1DQDL 4PJDF 3HRZA 2R2BA 3ARYA 2J7LA 1AP2A 4L8SC 5KANG 2OS7A 2IAND 4K7PL 4RNRA 2MPAH 4U7SA 4ZUTA 3QB7C 5CUSL 1A64A 5HVWA 5J06A 2BVPA 3BPNC 5CJQH 4Z7VE 4NM8L 3IDUA 2I60L 5C7XL 4HS8L 2FSEA 4IOIB 4NJAL 4HF5H 1FH5H 3R1GH 5EDXA 2D4DA 2OI9B 3MMEA 4OFVA 3ULSB 2F53B 2WINB 3IFNH 5JDSB 4LVHC 4NO5B 1RZJL 4ZS6C 1CIUA 4UTAH 3KJ4C 3L95A 2AAVA 3THMH 5ILTL 3WSQH 2VQTA 4KROC 3F7VA 3C9NB 4J4PA 3IDGB 3T8XB 4C83A 3D3VB 1FZMB 4N8CL 1U8MB 1QLEH 5H94A 2WP3T 1S9WB 1MIML 4MXWL 4X6FA 2Y72A 2Q87A 4UILL 3N06B 2RAMA 1ORQA 1J1PH 3FRPA 1AXSB 1I3RA 4BZ1L 5IVNA 2IG2H 2X1PA 5HHMD 3U1SH 4OUUA 1JK8B 5FUCC 5F72S 2H8PB 1EH9A 1KJ3L 4QO1A 5KSBA 4PLOB 4XNUL 4I0PC 4XNXH 2VN7A 4NCC1 4Z7QE 1T83A 4DOHE 5I18L 4DVBA 1ZVHA 4PJBF 3Q6GH 1QSFD 3QIBB 3R4DA 4WO4C 1J87A 1OARL 2BY0A 3HR5A 4D3CH 2ZKHH 1DBKH 1JWUA 1DL7L 2YD2A 3MBED 4E5XB 1FGNH 5DRNA 2P7TB 3WIIL 1RU9H 3ARWA 5BV7L 3KWWA 5FDYA 4Y4FC 3LKNA 4R90H 5DQJB 3OL2A 1XGPA 1NC2B 5EU5A 4R8WL 5ADPL 2R0LL 1JRHI 5BS0D 1RJZB 2M8XA 3TYFA 1CDJA 3GMNA 4ZNEA 4BA8A 1PSKL 3CSYA 4QRSA 4LSDA 2AJVL 2NYYD 5KSBE 1OB1A 4OTXL 1QSED 4X6DF 2BSTB 5DSCB 4NOFA 4MAUL 2B5IB 3AY4A 3WCYA 1WBZB 4XVTL 3EDKA 3VXPA 2E7HA 3VXQA 4DGIH 1A4JB 2DKMA 4YFLI 3H3PH 5KAQF 4K2UH 3U7YH 3C8HA 5GS1B 3CVHH 4U1SB 2BNQD 4FFYH 3P30L 2BRQA 3BGMA 4NQVA 5I74B 4Z77A 1BQLL 3KPRB 5DGQA 5CSBA 4CVZB 2JCCB 5CD3A 4MD0B 1UFUA 2Q6WA 5HHQB 4WDIB 5C09E 1RUQH 1VFUA 1I1AC 2XWBA 3PDOA 4GW5B 1EX0A 2FDBP 5F6HJ 4KJPD 4BJLA 5BJTA 4ZNEE 1AQKL 2XXMB 4QRQA 1YJDH 1KIRA 5KSUB 1Y0LA 4ELMB 1TQCC 3PWPD 4MVBD 5IROC 5CJXA 5GISH 3U79A 1GGBH 1KN4L 5FUOL 4XVJH 4P3CL 3BD5A 1E4KC 2GAZB 2NTFA 5CIPH 4QWWD 3J8F7 4NYLA 4EQ3A 5F7MC 3PP3K 1UT9A 1RHHB 25C8L 3S4SA 3DXAB 4R3SB 3MACH 5F9JB 4KTEL 2YPKB 2Z93A 3BISA 4WWKA 1RZIB 5D2NA 4U1IB 3RWGB 2HRLA 4GBXD 4RIRB 2D9CA 5F7EH 4UDTB 3S35H 5E5MB 4S1QH 3FONA 4NO2A 3VXSD 3I75A 3QQNA 3OR6A 3FAWA 2R1XA 2WBKA 1A6UL 1T0MB 2CMRL 3IDXL 5FYKD 1EVUA 4HCRL 3S88L 1KLUA 3SDXF 2HWZL 2O5ZH 4JY6A 5JOPD 1FSKB 2FO4A 2OL3A 1T6WA 3HB3C 1YNLH 2F54B 1X5ZA 1EO5A 4G6FD 5HHNA 5BXFB 3KLSA 3ORJA 3ZE0F 1MRCL 1ADQH 1KPRA 3PJSA 4TRPH 1AE6L 3F7VB 4WUKH 3U0TA 1G6RH 2N1KA 1CQYA 5CCKL 2E5EA 1ZA6B 3L7EA 3IF1B 4MWFB 1OAXH 5DVNA 1UEMA 3CLFH 2ZUQB 2DB8A 3LRSA 1QKZH 4L4TE 3R0MA 4N0FA 5C2BH 1ORQB 1KTLA 1E6OL 1NKOA 4H0HB 4P2QD 4NIKB 1G84A 1E4KA 4HUMB 1KLFA 2F5BL 3MCLH 2IWGA 1NGZA 4K7FA 4NWTH 1W72L 3KYMA 5L2KA 5I8KH 1CK0H 3MRKA 5FECA 4RRPA 2KQNA 4YXHH 4Y5VC 3QDME 3UCRA 1P6AB 3V79C 1A7RH 3MRJA 2YPVH 1JI2A 1F4XH 4L8SB 3SDDD 2E6PA 5JMOC 3BE1L 4GOSA 3BPNB 3C6LC 2LE9A 2HJLA 1L0QA 3DMMC 2B1HL 2XTJC 4XPHH 1I7ZA 5K9OB 3CH8A 1MFBL 1OQOA 4G8FA 4EUPB 1XGPB 2NY5L 1OM3L 4MMZC 2VLRB 4LVHB 5DWUL 4PB9H 1MJUL 4N0YH 4Z7UB 3TN0D 3ZDZF 3OJDB 3KJ4B 4QRSB 2AQ2A 4X99A 3MNWA 4LBEA 3QRGL 4KROB 4OLXH 2AEWA 1L7IL 1JMZA 5D7LA 4X98B 3PQYB 1VGKB 2CKBH 3VXPB 4CMHC 4FQJL 3BZEA 3VXQB 3BKYH 3RL1A 1ULVA 3U82B 1IAOA 5C0CA 4M3KB 5I1AB 4P4KD 3KPSA 1UB5B 1T0NB 4NBXB 4AEIH 2NZIA 3CFJA 4DGVH 3Q6FA 4NQVB 4LHJB 4Z77B 4AT6B 1CICD 5E7FA 3SE8L 1IGYA 2Q6WB 1NGQH 4GMSH 4X0KA 4ZQKB 5T1DH 3DLQR 1NEZB 3EO1A 2IBGA 1MCSA 3HNTH 5DD3L 4I0PB 5J11C 3VMPA 3C60D 3O2DA 4BQ8A 1NBVH 1NAMB 1Y0LB 2EDRA 1MCOL 2EEBA 1JGDA 4X6EA 1KIUA 1NAKL 4ETQA 4WO4B 4F7EB 5D7LE 4XMPH 3VXUA 3VA6A 3VCLB 2CXKA 2W91A 4DZBB 1LGVA 4U6XB 3IAGC 3F8UB 1A7NH 2OP4H 4ODUA 4FTVD 1IM9A 1UM6L 5C0CE 1DDHA 2V9RA 4JM2A 4Z7OF 2BNRE 3BUYB 3H7LA 3KPSE 4Y4FB 1HEZB 3LMJL 5FYJL 4LSRL 3A67H 3CLEL 1C5BH 3TNMA 3QDHA 3MV9B 1V7ML 4NPYA 3JWDL 3EOAB 3H3BC 1OP9A 5FGBA 2E8ZA 2FLBT 1WAAF 2NR6D 4JAMA 3ZKNC 2F58L 5IQ9A 1X5HA 3EOTH 1T5XA 1FYTB 4I4WA 3L5XH 1CI5A 5EBMA 4N90D 2DAVA 3I75B 1MAMH 2HJKA 4PRHE 2H3NB 5HYSG 2BZDA 3T3PE 3IU3B 1S7UA 3I3DA 4IS6A 2H9GB 1YEGH 3VXUE 2FIRT 1SEBA 1DBBL 1SY6L 5AZEH 2FO4B 1IGFH 4IDJL 4ZPTA 43CAA 5DZLA 2AK4D 2P42B 2VZOA 4MA1C 5EFIB 1KPRB 1B88A 1KN2H 4LU5H 1G1CA 2NY6C 3WNNA 1I1AB 1OAKL 1PG7X 4ODSL 1I8MA 4ZTOL 4M5ZL 5GS0D 2L4OA 1TQCB 5JIHA 3SOBL 2D31A 4HZAA 4HH8A 4D0BA 3FFCA 1KTLB 1AFVH 1GHFH 4Q6YA 3K7UA 3QBTB 5T1LB 1NGZB 3RDTA 3MQIA 4WCYH 3PWLB 5L2KB 2QQNH 1MI5B 1N2RB 3MRKB 5FA3A 2HAZA 3NBNA 4TPRH 4P3WA 5I1IH 3VFOB 1FBIH 5DMIL 4NHUB 4HK3N 3DRQA 3FB8B 3BIKA 3W39B 4OI9A 4HQQL 4LKXB 1TENA 2CO7B 35C8L 3UZQA 1IARB 3KPNB 2WWKT 1OD7A 2YUWA 5DJ6B 5GJSH 1D5BB 5BRZA 4AG4L 2LV4A 1D6VH 1MWAA 2VXQL 2X7LA 1U8JB 4PBVC 1JPSL 3IXAA 4MNHA 2BSED 4MA7L 2QEJA 5F88A 5FGCE 5IM7A 2EZ0D 2V5RA 1T1ZA 4GG6B 4LSVH 4DAGL 4Q58C 5A2IH 3CMOH 2W0FA 2UWEB 4NKOB 3DIFB 1ZHNA 4OV5B 1DJSA 1CDYA 1QP1A 3IDNA 2IANA 1X6NA 1HINL 2DJSA 5MERB 1LEGA 3MBEC 2AK1H 3BXNB 4EDXA 3GJFB 2I9LB 3OXRA 3CFJB 3BRDA 1JZ7A 4EZMA 4U3XA 4LAJH 5DEFA 5JW3H 1HNGA 3ARDC 5AAWA 3QZWB 4KK5D 3I85A 2DD8L 1IGYB 2ORBL 2YD3A 4X0KB 4G8GB 2N4IA 4LFHG 5HI4D 1I8KA 1JGUH 3U4BH 5C0JB 5T3ZH 2KQMA 2YUXA 2NZ9D 1A7PL 4Y5VB 1W0VB 4JLRB 2NYYC 3GK8L 4C55A 3KPQA 4N0UE 4RMTA 2C9AA 1HOCA 1INDL 1D5XB 3TBSA 4X4ZA 4ZUWA 4GAJL 4LSSL 3RWJA 1RSFA 4YR6A 5HI5D 5ICYA 4QYOA 3C6LB 4OCMC 2Z35A 2FECL 3DMMB 2XTJB 3DVGA 1PYWB 3M1BA 3GKWH 2FATH 1E6JH 3O3EB 2P43B 2B0SH 2E27H 5TE6H 5DUPL 4Y4KD 4G8EB 1QTYT 3MGTA 4BFIA 3MNVB 1S7VA 1INEH 4LHUD 1WCBB 3HZVA 2NY3D 1SMAA 4YFEA 1WBXA 4JFZL 4KJPC 1GL4B 5IQ9B 1RIVL 3D9AH 4I4WB 3UPAA 3Q2CA 1YYMH 2A6IA 3C5JA 4ZFZB 1DVFA 3RPIA 2E9IA 4LVOC 4WW1B 1S7UB 4H5SA 4HWBH 3VFMA 5FB8A 4QWWC 2EE9A 3IGAB 4XAKD 1TNNA 4TNVK 3OAYH 43CAB 3OZ9L 4LOUD 2VO5A 3VFTB 5C2UB 3L6FA 1YEIL 3BP5A 4RFOH 4KHTH 3AGVA 5BS0A 1IC4L 1FNEB 4WI3A 1D5MA 4EVNB 1N8ZA 1V7NH 5J11B 2D03L 4TUKH 1P4IH 2EDLA 1I3GH 2KUTA 2F74A 4P23A 3G5XA 1QSEA 2ZOLA 2QKIA 4DFIA 1ETZB 5EORH 4D0BB 3FFCB 1HXYA 1GXEA 3K8LA 1P5VA 4ONGL 4GKSB 2HTKD 1CBVH 1NSNH 2D7OA 4AENA 1GC1L 4XP1L 5E5RB 4JHZA 1BIHA 1AI1H 4TVPE 3MJ8B 5AUMA 3O4LE 2VZSA 2FBJL 1N5AB 2X4QB 1UWGL 5CP3H 3ULUE 3TBWA 1JFQH 2LVEA 1LK2B 3K1DA 4IOSD 5AYQA 3BN9C 2O5YL 2YRLA 3PWPA 3KR3L 2BNUB 5BRZB 3O8XD 2NXYD 4S10A 1OLLA 1H3GA 4QCIA 1QLFB 4X7CC 3R0NA 2X7LB 4GXUM 4L8DA 4MDIA 4OGYL 5D5MA 5TE7L 5HYSA 1UKSA 2FEDC 4KKLD 1WBYB 1EAPA 1OAUH 3DYOA 3RX5A 1CIDA 1MY5A 1T1ZB 2JJUA 2FWOA 1D9KD 4MA1B 3TCLA 5C6TL 5ISZA 2J2ZA 3QIUD 4MA8H 2NY6B 4ONHA 3QXTA 1MHPH 1PG7W 5TGBB 1BFVL 1JHLL 2RCSH 4WEMB 3RX7A 3TJEL 2ICWI 4F57H 4GBXA 1FE8L 2IANB 5F21B 3SDDC 3Q1SH 1LEGB 5EPMB 5KVMC 1N59A 4GG8A 5DXWA 2C5DC 4FFZL 1ZLWH 4PREB 1A21A 4Q9CA 1HNFA 1AO7E 4S1SL 5D7IF 1FL3B 4F33A 4OZGA 2GTZA 3WNLA 1JNHA 4NDMA 2YN3A 1F97A 4ZODA 5DJ2A 1UZ6E 2DQFB 4LRIA 4J3VA 1A4KB 1TVBA 3TN0C 4CVXA 1U6AL 1N3NA 1LO2H 4QTHB 4H88H 3ULVD 4RGMC 3HPJB 1FZOA 1VDGA 1K2DA 1HOCB 5ISZE 4MD5B 1CLOH 4PY8I 4TSBL 5DK2B 4LMQI 1P84K 3D39D 4CN1A 1I1FA 2HH0L 1U8OA 4YR6B 2ITCA 2IBBA 2CRMA 4DFHA 3TGXA 2FD6H 5GGTA 4P4KC 4PV9B 2A2QT 4M8QA 4P2QA 4UIMB 1XZ0B 1CICC 2VLLA 5HHMB 3S97C 2ESVD 3INUL 4JVWA 4OAWB 1GGCH 5HHVL 5A43C 3RNQB 1ZWIB 3C60C 1Y18B 3LDBC 2E8YA 5B38B 1S9KC 1J8KA 2CDEB 4YDVA 4X4YB 4P2OA 1QSFB 2A6IB 5C0EA 3DI2B 2FCBA 1MHCB 2GK2A 3ZL4H 3MBEB 4H5SB 1DQLL 1BX2B 3PWUA 3VFMB 3QAZC 5EOCL 5TDNB 3FO1B 5SWSB 3HN3A 4RCAA 2O5XL 1I8LC 1VHPA 2HLFD 3ARDB 3BWUC 1K9TA 4GMTH 5BS0B 3FB6B 1CE6A 4PRBA 2G60H 4K07A 4G43B 3ARFD 4G7YL 4MNQD 4NGHH 4NUGH 2NR6C 2F74B 3OGOE 4A6YA 4KHXH 4YH6A 4CVWA 5DI8A 4YEEA 5F71A 1QSEB 3MOBL 4NRZB 5T1MB 2J88H 4QRTB 3TYGL 5ACMA 2XKNA 4L8BA 1KNOB 3CUPA 2DBJA 2FJHA 3AXLB 1UQSB 5DFVD 1A6WH 4UUJB 1YMHB 2H1PL 2BNQB 3JWNC 4WFHD 3TM6A 3G6AB 2OR8A 5HYJD 5JZ7D 1UM4H 2FJGB 1CF8L 1OF2A 1WK0A 1CICA 3BEVA 3GSVA 5ID0A 1FVEB 5EBWB 3QUXC 3VI4E 4M8VA 2J6EH 5CBEB 1VKXA 1TJHL 3QWQB 1FZJA 5GS0C 1HSAA 4NHCH 2ICEB 4PR5B 4LHQB 3PWPB 1WFNA 3WFDL 1NBYA 5LQBL 1YDPA 4FQXD 1ES0B 1ORSA 1ZLSL 3WUWA 1KULA 1PKQA 5D7JA 4G9FA 4LVOB 3EGSB 3RIAF 1ACYL 3S36X 5T5NF 4LCIH 4RAUB 2ZOKA 2OQJA 3ZDXE 3V5HA 5EBLB 1CGWA 5KW9L 3ZT5A 1YNKL 4PJEE 2CR6A 2DKSA 2ZG1A 1A47A 2AEPH 4NKDA 4PJ7A 4O5LL 5HSFA 5J56B 1SYVB 4D8PA 3QPXH 4GG8B 3ZHDA 1F42A 1JNNL 3MRNA 5D7SH 3LHPL 3VXSB 2CIIA 1FVDB 4LASL 4JY5L 2X4SA 3LEVL 1J88A 1FO0A 4N8VG 3MA7B 1UXSA 5HGAB 2FYYB 1SQ2N 3W0WD 4OZGB 15C8L 1JNHB 2AJSL 1PBYA 1PKQE 1JZ5A 4G9FE 5IK3B 3V7MA 1CD8A 5MEND 2VE6A 1JPST 1A6VH 1TVBB 1KPVB 4G6FB 4UDUA 3WN5C 1N3NB 1U3JA 4LSQH 2PYFA 3BI9X 3E8UH 5DR5H 2IAMA 1NUGA 1N64L 1D5IL 2BMKB 4JN2B 4Z7NE 1S9VA 1I1FB 3MXWL 5DVMA 3VWJA 3CU1A 4BFGA 4ZG1A 4PJ7E 2H6PA 4U1KB 4HPYL 5GXBB 2VDPH 1EBPA 1U41A 4S11A 5IB1B 1J8HA 1MQKL 2EDDA 2VXTL 2FB4H 4M8QB 3V9FA 4X5XB 3TBYA 2L0DA 1DE4A 3OKKA 3JTTA 4KK5C 1CD1B 1DN0B 3ZMRA 1UENA 3K1KC 4GRWF 4U2ZA 3A6CL 4TUOA 5HI4C 1MCBA 4P4RA 4FXKB 3O2WH 1RZFH 3C5SA 1H3UA 1MRDH 2NZ9C 2G2RB 2DL9A 2Q86A 2R4SL 4RGOL 3MLRH 3MV7D 4UNVA 2UY6A 1EXUA 3P40A 3V5KB 2C7UA 3LS5H 5D9SA 3MV11 4I3RL 2C3GA 4TTGA 3SDDB 1NCDH 4C59B 3SKUD 4OLYH 2KKQA 5D6CA 3HA0A 4K3JL 2R29H 2MFNA 5HI5C 2P5ED 3OKYA 1VEOA 5TPWH 2A0LD 2P24B 1U92A 2IQ9L 5CZVL 1J8HE 1BOYA 1VERA 4GKZB 4AEHL 4Y4KC 5FCUH 1IT9H 3N50A 1C5CL 4PRBB 2EO9A 2R0WL 2XACC 1Y6KR 3TN0B 1FHGA 2NY3C 4PJHB 4OZFH 3QHZH 3WN5A 2YS4A 3U9PH 5B4MD 3MLZH 5D8JL 3LKOA 3RWIB 4RGMB 4Z7WA 1OCWH 1IQWL 2OJZL 3E6HA 4NFDA 3B8YA 2FO1A 4JPWH 3CUPB 2R4RL 2XKUA 5AYUL 2FJHB 4P4KB 1BBDL 4UT6L 3SBWC 3WE6A 3BPLC 4XAWL 4NJ9L 2OL3L 3LEYH 2YD8A 4ONOA 1OF2B 1CICB 4PS4L 1FFQA 2HT3C 2FEEI 5ID0B 4YO0A 1A6ZB 1DQDH 2Y7QB 2CUIA 4CW1B 1KJMB 4PTUA 2I27N 1H3VA 3C60B 4NM8H 1G0YR 2I60H 3LDBB 3VI3F 4IOFD 5C7XH 4HS8H 4KDVA 1HSAB 4TYUA 1JV5B 2VZTA 4Z7WE 2WUCL 1DBML 4I3GA 5C0GA 2DYPA 3WUWB 5FO8B 1TVDA 4WU7B 1RZJH 2HTKC 1T03L 5LJYH 4PJCF 5T3ZD 3QAZB 3EUUA 5LCVL 4FTVB 3EYSL 4ZO7A 3SGKC 4LCYB 4HLJA 2OBGA 2JJWA 4JFED 1T7VA 5DK0B 4EI5A 1XR9B 4PJ8D 1KPUA 5LWYL 4N8CH 2YD6A 4GAGL 4WENB 3G5YA 4EI6A 4PJ9D 4KZEL 4MXWH 3Q3GB 2NY0C 3X13A 4UILH 4JRWA 5CSZA 5EO0A 2FL5A 1XF2A 4BZ1H 3ILPA 3O2VH 3IXTA 1FRGL 1FLTX 4WHYH 5GGUA 1YQVL 1YMMD 1VGEH 2Z4QB 3BFOA 3FT4B 5EA0L 3VGAC 3O8XC 2NXYC 3PUCA 5D1QA 5FM5O 1G7IA 1KYOK 4WFFE 1KJ3H 3GMMA 2V2WA 4XNUH 1KOAA 4KKLC 4OD2B 5FFLA 1XT5A 4P59L 5CJ8A 1YNTA 4U1JA 1CLZH 2AK4B 5D70H 1D9KC 5I18H 5D1XA 2PYFB 5D1ZA 2PXYD 4LPUA 4HUNB 1OARH 5FKPB 3QIUC 3CC5A 5EOCJ 4EQ2A 2YOCA 3HI5H 2NY4D 4ZXBA 1GGTA 4FMFA 5L7XH 1T21B 2H6PB 2YC1A 3MCKA 4M61B 3TO2A 1MCJA 3LEXB 5IW3A 1EHNA 1ZS8A 2XWTA 4W4NA 5FF6A 3A6BL 1YN6A 5ADPH 1JCKA 5T3XE 2CO6B 4XPAH 4O2CA 3OKKB 1U8QA 2DMBA 1PSKH 3VFWB 4RWYL 1P5UA 1R3IH 2R0ZL 2AJVH 4UT7H 4HX1A 5E8PA 5DJ8A 1AKJD 4OTXH 3QUZD 2A38A 1X7QB 3C5SB 3NIDF 4MAUH 4OLVL 3O2DL 2KPNA 2Q86B 2VUYA 5C08A 4XVTH 1YY8A 3ULVC 1HDMB 1BIIB 2C7UB 5DHYB 1IL1A 5D9SB 4JR9L 2QHRH 1L0YA 3ARVA 3SE4C 2CDFA 4NZTL 4U1HB 4X9IA 5HHPB 1HI6B 4G9DB 3P30H 5BW7A 5DD5L 3ARGD 3QSKB 2FH8A 3L3HB 4QLRA 1BQLH 4HIIB 3CVIL 1TLKA 3B9VA 1CDHA 3IYLW 3O3DA 1A9BA 1BPVA 3O8XA 2GUOA 5IHZA 3HG1D 2R1YA 4QHNA 1S7QB 3QZWG 5I8EA 4N8VA 5ESAB 3ZE1F 3F7QA 4OJFL 1AQKH 4HMEA 1MLCA 4YHYC 4FQPA 5HXMA 2ZUVA 3WN5B 1FVCB 2OJEA 1TDQA 1H3PL 3DJ9A 3MJ7B 5I76A 1KN4H 5FUOH 2C3HA 4P3CH 5C08E 5EC1A 5CIPA 5DD1L 2ARJA 4LGPB 3HC0A 2BK8A 5KS9A 4CKVX 3H9HA 25C8H 1KJVA 4MSWB 4RFEB 4LK4A 4V2BA 4H26B 3WE6B 2EDJA 4UB0H 5IMOA 3I6KA 1XGTB 5HGDA 5L8KB 2HLFC 4NRXA 3MLXL 3F58L 2ZCHH 4HS6B 3LQAL 3FB7B 1QEWA 1I7TB 2PN5A 5IVXA 3ARFC 1E27A 1FL6A 3MV01 4NKMA 4POZD 4C58B 1E4XL 2CMRH 3IDXH 4HCRH 5JNYB 4BQ9A 3S88H 3RI5K 3SE4A 2ZCKL 1NMCC 1B0GB 4K7PX 1TCRA 4QHMB 1CDCA 1S9XB 3O81A 5L8LB 5DFVC 5DJDA 3ILQC 5KAQG 4I5BA 1FAIL 2JK5A 5KS9E 3GMPA 1ADQA 1AE6H 3FO2B 3V2AR 4HUKB 5JZ7C 5EU7C 4HUVA 4UNUA 4Y4KB 4HT1L 2C26A 2V2TA 1RK1A 4PPTA 2ICCA 1FV1B 3K74B 3P11L 2IPKB 4JFPA 4LHUB 1MCPH 2NY3B 4PYGA 4S1DD 5CKGA 3C2SA 4C4KT 5CSZB 4P9MH 4RAHA 5IVXE 3HI1B 4PG2A 3GB7A 2XN9A 3EFDL 4NQTA 5IV2A 5DMGC 4FQXC 2F5BH 3ARTA 3QDJA 3REVB 5C0ND 1W72H 1MCCA 1MWAL 3NFPB 3T4AB 2IBZX 3RGVD 4FRWA 2AV1B 2EH8L 3BPLB 4UQ2A 3TNNB 4TN9A 3G6JF 2AJ3A 4NQCD 1RZKL 1YEEH 1CVRA 3GSXA 2EKJA 5TDOA 3KJ6L 3PV6B 1WFUA 1ZEAH 4HS3B 1GPOH 4QGYA 3WFCL 4UZGA 2X2YA 2OTUA 3BE1H 1ED3A 1PJ9A 1ZA3B 3O3BB 3TBTA 1XIWD 4X7SH 1EBAA 1K8IA 5JOEA 4Z6AT 2YC1B 2B1HH 2PYED 2NTSP 4CJ0A 5CWSA 2VXSH 3VU2A 5FUCE 3GI9H 1A2YA 2NY5H 4HGWB 2XWTB 4AK1A 3BVNB 4GRWH 2XN9E 1KEML 5DWUH 2A73A 4O2CB 3MBXL 4OZHF 5DFTA 1MJUH 5E1HB 1QLRA 3QDJE 3ZDYE 2RFXB 4OCXL 1M6OB 3QRGH 4F9LC 1T7YA 4HX1B 5E8PB 5HYJA 1CGYA 1L7IH 4QRRA 2VDOL 3BPCA 1NFDF 5IEHA 2CKBA 3MLWH 4FQJH 3CXDL 2NY0B 1I85A 4M6NL 3PGCB 2DIAA 2GJZA 5D7KD 3CVHB 4UT9L 4A2MA 1CE1L 5DHVH 5J6GA 4I2XA 4AY0A 8FABA 3LN9A 3VGAB 3O8XB 2NXYB 3JV6A 1KXVC 3TVMC 3B8SA 5IHZB 1R5IA 3HCVB 3FTGA 4L3AA 1KCUH 5ANMB 5DD3H 4Z0XB 3QEGL 4OCRH 1FYTE 1OTUC 1VEMA 4KV5F 3ES6B 1CFNA 3FRUA 1MCOH 2IADA 1D9KB 4PJIB 1NAKH 2OJEB 5TQ2L 3QIUB 4NO0A 1S9YA 4QRRE 1I7UB 5ELIA 4KRLB 3CCHB 4Z8FH 3MRFA 4CNIA 4OD3L 3S6CA 4ODXA 5JHDA 1LP9A 1F00I 1CTOA 3MPCA 4LLMA 3U0WL 5GRUH 4UIKL 2Q7NA 4R4BA 4TVPL 5FYJH 4LSRH 4P5TA 3SDYH 4I2XE 2A0LC 4PJDA 3NFSL 2JB6A 4LAQL 3CLEH 1Q94B 3GIZL 4YFDB 3DO7A 3FB5B 3W0WA 4UOW0 2X4OA 2LAGB 3ULUL 2Q8AL 5GS2D 2DQIH 1CVSC 2H26A 3LQMA 1T4KB 3AMLA 5TF1L 1XR8B 3QO0A 3VE0B 5HGGS 5FO7A 4PJFB 4MXVE 1HZHL 1MHEB 4PJAB 4U3CA 5B4MC 5C9KA 4GRLA 1JE6A 2VQ1A 1ITCA 2MHAB 3UJTH 5I8OH 1YEDB 2ICWA 3D39B 4K94L 1DBBH 1KLGB 1SY6H 1TCRB 1UZ8A 2FX9L 5D2LF 1JNLL 4LPXA 2QLVB 4IDJH 1NGXA 1LE5A 5JHDE 4V2CB 1LP9E 4LARL 3H8NA 1G6RB 4W81A 5K9KA 3S5LG 4HUVB 4Y1AD 4PJDE 2XXCB 1AD0A 1HH9B 1OAKH 4KQ3L 4ODSH 4ZTOH 1EFXD 2ESVB 3SKJL 4YHYB 3QXAA 3QO1B 4YHPB 4Y19D 4NNXA 4QRPD 2YXFA 3BP4A 3QUKA 3P4OA 1WTGT 4IOFC 5CP7A 3VGDA 4R0LA 4AQ1B 2ADFL 5IV2B 4OM1H 2VRAA 1TJIL 2E7CA 2WIIB 1KT2B 1WSST 1VSCA 4XC1L 2QL1A 4PJBA 5AEAA 4BUHA 5DMIH 1HHJB 3V6BR 5ALCL 5SX5H 3WO4C 4PJ8C 1NGPH 1QNZL 4HQQH 4F37F 3HNVL 3DO3A 4PJ9C 4HWZA 5I19L 3ARFB 4MNQB 3TBTB 2C4FU 3T04D 1K8IB 4LLYA 3RIFK 3K8MA 4AG4H 5HVGB 2K7PA 3I9GL 2VWEC 2VXQH 3ARED 1A2YB 2HVJB 1JPSH 4S2SB 1NMCB 4MA7H 1QR1B 2IH3A 2YD4A 3OHXA 4LMQE 1P7KA 1VB9A 3CDGB 5DRZA 3BX7C 4X6DA 4ZS7L 1J10A 4Y4HC 7FABL 4KMQA 3MRDA 5E7BA 3HNSL 4KZDH 5HYJB 3BPCB 4PJBE 3O3AB 4OKVA 4WI5A 2BCKB 1CLYL 5F6IC 4OCSL 5TE4H 4KU1A 5DRWB 3AM8A 5E03A 1I8IA 2NY4C 3DI3B 4HZLB 1WJ3A 4J12A 3STLB 5FA4A 1Z6JT 3MLUH 1LEIA 5GGTL 4HGKC 2AJUL 4FQXB 1UJ3C 5AAMA 3GSOB 4WUUD 4YHKL 2DD8H 1FFPB 2ORBH 1C16B 1PFCA 2YD7A 3T0ED 3RUGF 3WFHB 1A7PH 5HYIA 5JXAH 4X6DE 3U7AA 2IADB 2GHWB 2WWMD 5LBSL 2G5BA 3QUZC 4N9OB 5FHBL 1INDH 4HUXA 4M7LL 4QOKA 4ZAKA 5JHLH 1NANH 1U2HA 4GAJH 4MHHI 1JTPA 4LSSH 3VJ6A 1DANT 3U0PA 2Y1VA 1G9MC 4JGJA 3JTSB 3HS0A 3DURA 2Q8BL 1ZT4A 4LP4A 3UTSD 1UWXK 2VSDA 4FP8L 4P9HC 4XMLL 3ARGC 4G6ML 4ZUUA 1U8KB 4K8RH 4LPTA 4R7DA 1EJ6A 3CD4A 1V3KA 3DO7B 3BRGC 3C09C 4QRUB 1FP5A 1EEZB 4JFZH 4GT7A 3RX8A 5MENB 1WCQA 2H26B 3EFFB 3P4MA 4FZ8L 3N9GL 1YY9C 2BRRL 2GSIB 3QO0B 3TT1L 4OQTL 2C3XA 3SDXA 3VXRD 2PXYA 1BD2A 3P9LA 1T22A 4M9OA 4M7JH 3S9DB 4QOKE 1XGUA 4JPVL 4I0CC 4XCCL 4XNQA 5I66A 3UPRB 4R4NC 2ZSWA 5JW5A 2VLMD 4ODHH 5J4MA 3LH2H 2VITB 3CSPA 4YDJA 1UZ8B 2VZ3A 1ZANL 4E0RA 3M8OL 1NGXB 3TIEB 3U36A 1LE5B 3OZ9H 3RZCA 4EIZC 1UJ3A 1FFNA 2OSLB 3UC0L 4WGVB 3MRIB 3LB6C 1IC4H 4XNYH 3C5ZA 2BFVL 1U3YA 3EYFB 3VFNB 3ZKMD 1P84J 1JRHL 1HXMA 1BWMA 3FQTA 3QXAB 2OXGA 1AKJA 3AS3A 4OF6A 1F90L 3QUZA 2EDTA 3LN5A 4J3TA 3MV7B 3P4OB 4POZC 3KS0J 4R0LB 4ONGH 4I77H 4CMMB 4XHJD 1BD2E 4H20L 1I7RB 5TFSL 1H5BC 3KYOA 3C8KA 1MFEL 2Y06L 5FYLE 3ZE0E 2HFGL 2P5EB 2XRAL 3QXVA 5DUML 3GUTA 1F13A 3VDAA 1K3IA 1UADC 1U3ZA 1EEYA 1R3KA 4P49A 3M07A 5CP3A 1CU4H 3UYRL 1SMOA 4ZUSA 4ZFOA 5C71A 5I30H 2O5YH 4F7CB 2N56A 2R69L 3KR3H 3D0LB 3LN4B 4TNWF 1YPZB 1RZ8A 4M7KL 3MGOB 4W6XB 1A3RL 4HMDA 5TE7H 4OGYH 5KVFH 1U42A 3MV8A 4L1HA 4DJMA 4JRYD 3OHXB 3PIQB 4HIXL 4TUJA 5C0AD 1FO0L 2OTPA 4XH2A 5DRZB 3MRRB 5C0NC 3NA4A 1KJ2H 2E9BA 1DLHB 1RUML 4WW2C 5C6TH 3L5JA 2QQLH 3PGDB 3T0DA 4M1CD 3FQUA 3LOWA 4ZTPL 4H8WH 3DSNA