4LLAA

Crystal structure of d3d4 domain of the lilrb2 molecule
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
198
structure length
198
Chain Sequence
SKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the two membrane-proximal Ig-like domains (D3D4) of LILRB1/B2: alternative models for their involvement in peptide-HLA binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Leukocyte immunoglobulin-like receptor subfamily B member 2
total genus 38
structure length 198
sequence length 198
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llaA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llaA01
5ADPL 4JJHA 2WQRA 2DQHL 4GG6B 5JORB 5TQ0H 1UM4H 1QYGH 1CLOL 1HE7A 4O4YL 3NZ8B 1WCBA 4KVCL 3T2NL 1N64L 3B2UD 5IV2B 2G60H 4DGVH 3G6JE 2QQLL 3PWPD 2VABA 3OR7B 1KGCE 2CKBA 2P8MB 1H8SA 4YHKL 5FYJD 3U0WL 1O7SA 5JMOC 3QHFH 4IDJL 3LS4L 3U7YL 43C9A 4ZFZB 4HPOL 3TIEB 5M94B 4M62H 5IGXL 3MRBB 3HNSL 5JA9A 4ZUUB 1INQA 5DSCB 3B5GA 3R4DA 2C3WA 2R1WA 4YAQB 4P4KC 3HE7D 4OAWA 4NKQB 4RMUA 1NGQL 4UDUA 2BSED 3BFOA 1KB9J 4G9FE 1S7TA 2KDGA 1A6WH 2NW2B 1SJVA 1BVKB 1JPFB 5D1QA 1GGBL 1LP9A 2WWKT 1HILB 3QNXA 4PJXE 2DICA 3OMZA 4FQHB 4X7TA 5CILH 1YPZA 3VXUB 1MLCA 2AJYH 2CMRH 2E6PA 2H3NB 1N3NA 4OF0A 5CEZL 1OTUD 5GISH 4GW4B 2EICA 1HHGB 3ZYOA 2YWZA 2GITB 2VSDA 1MH5A 4FQPA 4JPIB 3C08L 1F6FB 4KK5D 5L6YH 1K8IB 1JN6A 1OPGH 4MAYC 1NEUA 3MV11 1J8HE 3MODL 4WVRA 4D0CA 4LHUA 4HFUL 3MQIA 3QDJE 3WJLA 5I71B 2A38A 1FFOA 2NY5L 4RMRA 5F8RC 1I8KB 3W2DL 2R1XB 2DQHH 4KUZH 1B3JA 3S97C 1QYGL 1Q9KA 4HLZG 2ERJB 4AH2B 1OP3H 1V05A 4APQD 5IG7A 3O2DH 1GGUA 3SE4A 2IH3A 1U8JB 2RBLA 3C2AL 2QQLH 4MYWB 1A6UH 1FFPB 3ARGA 3O3EB 1FIGL 5DZOA 2XXCB 4QRRA 1W0WB 3RFZC 2Z31A 5D7IA 3H9HB 4J4PD 2DQDL 4KKLD 4NQSB 4Y4FB 5IT2L 2V5RA 5E03A 1ZLWH 4MJ5B 4YGAB 3IT8D 5FDYA 3O2WL 2D9CA 4HPOH 1T80A 3GK8H 3AREB 1YMMB 1JNNH 2YS4A 3BH8B 3U9UA 4F3FB 2P8PA 1A21A 1CD9B 2V17L 4PJ9B 2R8SL 3GFUA 2ATPA 4Z7OE 1MRDH 4FXLA 5KBNC 1KCSL 5EU6D 1Q9LB 4Y0GA 5I15H 3EOBB 3MCLH 3JTSB 4OCSL 5DK3A 4PJFB 1TDQA 5B39A 1ZHKB 4NSKA 3BQUB 1BAFL 4ISVB 1HXYB 1N59A 1PVHA 3OAZK 2C3VB 5DJ0B 2R1YA 4LSSL 3HRPA 5FUCE 3O4OB 5D7SH 1EEUA 4K23L 2X09A 3X12A 2W0KA 2I60L 4K3GA 3PL6A 4NJ9L 5GRUH 4L5FL 3HUJF 2ORBL 1A7PL 3EO1B 1NDMB 5SWSE 1PQZA 2YA1A 2BVOA 3DI3B 1ZSDB 1Q9WA 4ZTOL 5D5ME 1Y6KR 5T3ZL 5D8JH 3GRWH 4YH6A 4K3EH 4KGLA 5AUMB 3MUGB 1YEKH 2J88H 2NY3C 2F53D 1IQDB 3D5OF 1CFTA 4X6FA 3O0RL 2XFXA 2H26A 3U2SA 5JQ6L 1A9EA 4CVUA 4UT7L 3MRRB 5KS9E 3UTTE 2BSRB 2DJ4A 5FAAA 4JFDB 5JZ7D 4K71B 2AXJA 4HSQA 4LL9A 2OX5A 1N8ZB 3LQZA 3HI1A 2XZCH 2GTZA 1MLBA 3FCTA 5D7JC 2AXHA 3MNWA 4PG2A 5DJZB 1F5WA 1B0WA 4HKJB 3RNKA 1IGMH 3MRHA 1XZ0B 2P24B 3ZKSD 4HEPG 3GSUA 3LKQB 2C5DC 1S9VA 3EOYG 1TFHA 1KXTB 4TNWK 3CD4A 2F8OA 1CD1A 2FX8L 2Q7YA 2PN5A 4JHWL 4J8RB 5J3HD 4B7IA 1C12A 4Y2DD 3GB7B 1L9MA 1NCTA 4IOIA 4AEIL 4F7CA 1AGBA 1TZHA 1AD0B 4NHUA 1G84A 4Z8FL 3KYOA 3B3IA 1MCWM 5ANME 3KPMA 1AIFB 2AJVL 2FEDD 4WFFE 3KG5A 4AQ1B 5T33L 4OCXH 1T2JA 5T1KD 4YHPB 3MR9A 3J8F7 3QNYB 1H9VA 3QI9A 4LVOB 2YRPA 4U6VH 2FWOB 3ZKXC 4OZIF 4EOWL 3PQYE 2AABL 3FAXA 1JPTH 4RWHA 5JIHA 4XNXH 5CEXB 1RHFA 2X42A 2FX9L 5C6TL 4BH8B 5DDHA 3S5LA 3IJYA 3CPLA 2R2HB 1QBMH 1CQKA 3EIFA 2EDHA 3JTTA 1H5BC 4QF1B 1MIEL 1GRWA 5ETUA 3HI1B 4P2RD 5EBGA 3ARBD 5CS7A 2DMBA 5IB3B 1SEQL 5KS9B 4QRUA 2EDBA 1B2WL 5I1GL 3S37X 5LKNA 3GUTA 3HAEA 2NY5C 1X6LA 5T3ZH 1FNEB 1U3YA 3QXAB 4LEXH 4KWUA 4DUXA 3IFNH 5JW3L 1J1XH 1OF2A 3QCTH 4XAWL 1F4XH 2YUVA 2ZCHL 1BQHG 4XPGH 3EHBD 1KT2A 1JGDA 1CN4A 4U2ZA 2A9NH 4TRPL 3VXTA 1PEZA 1P7QB 5SWSB 3I6GB 2C1OA 3LAFA 5JPMA 2GSGB 3D1MC 3RWGA 2K7PA 3O9WA 3T0VA 4WW2F 4QHLB 1LQSR 4MZ3A 3ZHLA 3B4NA 2HFEB 4P49A 1HHJB 2DIJA 2Y36H 4AK1A 2G2RA 3O6KH 4MMZC 4KROD 1U41A 3UYRH 4YHNB 3QUZA 5HHOB 4XNUL 4Y1AD 4NM8H 1A1NA 3FFCA 2C3VA 4WI6A 1SYVB 2HVJB 4YFEA 1W72H 5D96C 2NY0C 4IRSD 4PR5B 4LCUB 5KOVC 3RX8A 3QG6B 5D7KD 3RJDA 1TCRA 3E2HB 4E41E 1EEYB 4PGDA 2MCG1 2DQJL 3DV6A 1OD9A 1PKQA 2EDDA 4P3CH 1AHWA 2YA0A 2WM0A 4LSPH 1G7LB 2C4FT 2X4QB 4NC1E 1NC2A 3RHWK 3CDGB 4U1LB 3VG9B 1PAMA 2VLKB 5C0EA 4XBEL 4MXWH 5FUZL 2DLFH 5B21A 1UJ3B 2Q3AA 3MRNB 5IMLB 3RBGA 3U4BL 1CTOA 4P5TB 1GZPA 1YEGH 2VDKL 2HJFA 2VC2H 3CDCA 1L6ZA 1INDL 3H9YA 1OAQH 5DEGA 4HKZA 4LCIL 1J12A 1IC5L 3NPSB 4YXHH 4KQ4H 3PWLA 1WBXA 2ZUQC 3I2CL 4DK3A 2RB8A 3SKOB 1YPZF 1JYXA 4N8CH 3SDAA 4U31A 1S7RB 3GMMB 1M1SA 3VG9C 3ROLB 1BM3L 4Y5XB 5BRZD 1OSZB 5CLTA 5DHXB 4WIQA 4KMTL 4D94A 4R2GB 4QHKI 4XC3L 1CFQA 3DGGB 2XRAH 3LOWA 3VD3A 5CSZB 3DO7A 4JRYD 5DUPL 2EKSA 2MQ3A 5E4EB 3IJSB 1RZGB 2LE9A 4HWZB 4G43B 3WFEL 3M17B 5IUSA 2P47B 4PR5A 4KZDH 1M6OB 2WNGA 5CEZE 2LV4A 1BFSA 2LABA 3SQBA 2BERA 3HN3A 3NCJH 4FP8H 3KLAA 5IHZB 4XPGL 5MEQA 5I1KL 4XMPL 1SYVA 5ESAB 1T21A 4KVCH 3T2NH 1XGRA 3RTQB 4K7FA 1WCQA 4DGIH 4ONGH 4KI5D 5K9QG 4LK4A 1CR9L 1QFOA 2CIKB 1NEZG 3TA3C 5GGRY 3I02A 3DVFA 2CH8A 3SGDI 5CEYB 3SDDC 3R06A 3TWCL 2OL3H 3GIZL 3HZMB 3UTTA 1TVHA 2Y36L 2EDKA 5FOBA 1UWEL 4JM2F 5CZVH 3IETA 4LSVH 3FTGB 1MRCL 1KIRB 5L9DL 3ULUF 4G8GE 4JO1L 1AGFA 3VFWA 4L4VD 4Z7UB 1CLZH 2JB5L 4IIQB 1HN1A 2DB8A 2R2EA 1YNKL 5A2FA 5DHVH 1RULL 2DQJH 3L3DA 4W6WB 1ZEAH 2CR3A 2VZ1A 2QV2A 4F57H 4MD4B 3GUTB 1BBJB 1U95B 1U8QB 3ZE0F 4KJPD 2WUBL 1WZKA 3ILPA 5IFAL 4NNYB 4YK4C 3LS4H 4XPHH 4PRPE 3P11H 2C7UB 3PDOA 2I25N 4P2OB 1NGQH 4G80A 5DYOA 3EUUA 5DDHB 1NLBH 4PGEB 3VDAA 1EMTH 1CXHA 1GGBH 1A14H 5I1AB 1ITCA 4CW1B 1KXVC 1U8JA 3H7BA 4BSWA 3NFNA 2P5EB 4PV9B 1FFNB 3OTTA 4KV5E 3TP4A 2QKIB 3F12A 3CLFL 2JK5A 3U7WH 4NN5C 5KSVA 3JWDC 4YXKH 1AHWC 1EAPB 2R1XA 2XOTA 1U93A 5K33A 4MHHI 4QRQA 1ED3B 5J9PB 2BVYA 5T3XH 3O4LE 1BD2A 3I3EA 3CFDA 4JG0L 5GRVL 3GIVB 3BPNC 4PJDB 1IAII 4NFDA 5FDWA 2UWEE 5DEZA 1T1ZB 3F8UB 5LG1A 5HDLA 1YN7B 1ZK9A 5HYEA 4DCQB 2RAMA 4J2XA 3LIZH 3C5ZA 5EUKA 1NEZA 5IFJA 4IDJH 1MFAH 3UAJC 2XIDA 1Q94B 3VFOA 1FLRH 2HT2C 3MREB 1J11A 1NFDB 1T7VA 1JWSB 4HK0B 2VLMD 3KPQA 3ABZA 2VXUL 4PRHD 4ZUVA 3K8MA 3BN3B 3OF6D 4LP5A 1C5CH 2A77H 1YY8B 5IB1A 1EEZA 3KLAB 5HYIA 3PHOB 5HDBE 5T3ZE 1R5VA 1WIPA 4HFUH 3QZWG 1J0IA 5FOJA 4X98B 3UJTH 4DKFH 4PJBA 1BJ1J 4ZPTB 3RVXC 1FDLL 3M1BA 2R23B 3IJHB 4FMFA 4JO1H 2OK0L 2XFXB 3ZTJG 3RWEA 3QUMA 1CLZL 3KR3L 4M7ZB 2P44B 4IMLB 3QO1A 2CJUH 4U1SA 1A6WL 5SX5K 1N6QL 4GKSA 4ZMAT 1Q9WB 3VE0B 5MENA 2HJLB 3O6ML 3H3BC 4YEFA 5CKGA 4WEUD 4M1CD 3T2OA 4DEPC 4XPHL 5IT2H 4HH9B 1RUPL 2C3HA 4PTUB 4EBQH 2H6PA 2NY2B 3OXSB 2W92A 4UTBH 4XVUC 2MCPH 4YDLB 2DWEA 3JWNC 1UXSA 2EH7H 1YEJL 4PJ8B 4NQDB 5L2KD 3RY4A 2DYPD 3CFEB 5E08H 3BYYA 3V6OE 3MCLL 2KH2B 3DVNA 3G5ZB 4C56A 1OAKL 1M4KA 2VUYA 4JQVC 3D6GA 3LN4B 1I7UA 5FYKL 2CLRA 3PV6B 2RHEA 4X6DF 2CKNA 4AIOA 4NDMA 12E8H 3DXAB 4TSAL 1YNLH 4OFKA 3UDWC 3GJEB 4KJWC 2J4WH 1IAIL 2I60H 1IGYB 5K9OA 4JGUA 3U9PH 3LS5H 4PGZA 3RHWF 4EXPX 3CVHH 4WO4A 3HE7B 4WFHE 1VKXA 3MUZ1 4FQXD 5D8JL 3QUKA 4N5UA 3O9WB 2H45A 3KLDA 3QYCA 1IGTA 2X7LB 1RV6X 5KVDL 3GSXA 5BXFA 4XXDB 3RUGE 2FWOA 5D7JD 4PJAE 1MFNA 3UTZA 3ELAT 4Y89A 4JG1L 2F74B 1OTUC 2AEWA 1EPFA 5C0NC 1XGQA 3ARGC 1YDPA 1IM9A 4ELMF 1KIQA 5GSRA 2Q1EA 1F4YL 4E5XB 1FSKB 5SWQB 2XA8L 3BIKA 1LDPL 4QOKB 1YEIL 4XPFH 1R3IH 1PZ5A 1RK1A 1ADQH 4YZFE 4MAYD 3V6FA 2A6JB 3IF1A 2XKNB 2UYLA 5CZXD 2NY3D 3EDDA 3L5XH 3GRWA 3QIWB 3GSQA 3P4NB 1AKJB 3LB6D 3WJLC 1NGWB 1JGVL 2A6KB 3ZDYF 3EGSA 3VMPA 2BNRB 4MCZB 3EYOB 3PWNB 3ZL4L 4Z7WE 3HC4H 1MFBL 2HFEA 3MRCA 2ZSWA 2ICEB 1M7DA 4Z95H 1SJEB 3V52L 4AY0A 4OFPA 3V6FB 2ARWA 4K94L 1CE6A 2UYLB 5IEHB 2Y5TB 3EJZD 4OBSA 1N4XL 4NGHL 4N0RA 3IVKA 2OP4L 4BFGA 1U8KA 4X8XA 1YMHB 3FT2A 2DOCA 4TPRH 5DTFB 3T0WA 3FO1B 5H35A 4YHLL 5JOFA 1SEQH 3JWOH 2GY5A 4HS8H 1JGUL 35C8H 1U3HC 2IANB 2FBJL 2ED8A 1LEIA 1QO3B 1ZAGA 1CXIA 1Y6NR 2MOVA 4XCCL 3WL9B 4C55A 2J5LC 3IYLW 3ILQD 4TSBL 3IAPA 3NCCB 3QCTL 1DQLL 3OKMB 3PL6B 3EFFB 5BS0E 4QXUH 3QQ9D 1AC6A 3UC0L 3FT3A 2FIKA 4OT1H 5DJ6A 1VA9A 1DVFB 4KHXL 1GIGL 2JB6A 4JCMA 2G5BA 4X4ME 3VD4A 2AEQH 3MBXH 3WUWG 1R0AH 5F6IC 5LCVL 3KPRB 1TQCC 3P9MB 4WEBH 5A3ID 4PYHA 3PV6A 5GSVB 1CGUA 3QRGL 3SBWA 1QFUL 1F4WH 1CIDA 2X4SA 5IB5A 5T5NG 4GRWF 2DYPB 4XPBL 1UZ6E 4OI9A 4LARH 4Z8FH 3R8QA 3NA4A 3B9KC 4IBLT 1QBBA 4KI1A 3ARXA 4WTWA 3RZCA 1MY5A 3RJQB 1KELH 2H6PB 3SDXB 4OQ1A 3ZYZA 4LQFL 3TV3H 1MQKL 3HNTH 4HBCL 4MJ5A 4YX2H 3WNMA 2H8PA 3GSRA 5I9QB 5HI4D 3RTQA 2X89A 5FYLH 5J56B 4RA3A 4F9PA 5F7MC 5HHPA 1YMME 1EFQA 1JNLH 2AGJH 1G7QB 2VXVL 5DRXA 3HC4L 2EIZB 4Q6IB 5IVXF 4ZFOB 1ZGLM 1J88A 4BK4A 5IW3A 3RY5A 1AO7A 1CIUA 2FR4B 4M43H 4ONHB 4F15C 4K94C 2BSRA 3QQ4A 1GJIA 3BSZL 4Z0BL 1KYOJ 2B2XL 3MV9D 3RWCA 4JKLA 3VWJC 3MJ7B 4KK6C 1K8DB 3RWDA 1XIWD 5J3HC 3PNWA 4X6FB 5KTEH 5GS1B 1P53A 4NO3B 2WMPA 3D39A 1GHFL 5BVJA 4X4XB 3TNNA 3BPOB 2P48B 4GAFB 1BWWA 2VDKH 5C0GA 1E0OB 4OCWH 5IMOB 2Z4QB 4HV8B 3DMMB 3S37H 1L7TH 3L3KA 3LV3B 4L3EE 4NM4L 4LCIH 3MRMB 4V1DD 1OLLA 1WK0A 2JJWA 4JFYA 4XMKH 3HB3D 2OQJA 4NYLA 3OJDB 3FQWB 1UEYA 2E7LA 5JTWA 1HHHB 3C8HA 3QJHA 3HI5H 3P77B 2LQRA 1R3KA 2ZCKH 4GW1A 1UADC 4P57A 2A6JA 1HILA 4TVPE 2NXZC 1NAML 1O5DT 2AEQL 3MBXL 3SKMB 2W60A 4K3HA 1SJXA 2NXYD 3L6FA 4OUUB 5DA4A 5IB2A 2I9TA 1KJ2L 1AFVH 3JV0A 3GJFK 1TVDA 1UB5B 1GGIL 5KS9A 3O6FD 4AM0A 5D71L 2BY3A 3BW9A 3C9NA 4GMTH 4DZBA 5HGBB 3F12B 3NCMA 4ZXBD 3MJ6A 4F33A 2JB5H 5INDB 3KPRE 3D18A 4NT6B 1YNKH 3ARBB 4E41B 1ACYH 1D5XA 4KTDH 4LCWD 1SVZA 1ZKAA 2WK2A 2W9LA 1UWGH 2YC1A 1EV2E 2YPLD 3MNWB 4HMDA 4RZCB 3VXUA 5J57B 1FZJB 1KJ2B 3LMJH 4XAKD 5J13C 4OLWL 4FZ8L 4FQIH 5IEKB 4U1JB 4J7RA 1NGYA 1JGEA 3N50A 4KI5C 1SMAA 2QBWA 2V2WA 2FO4A 3KYOB 1A14L 3BH9A 5GJSH 1FNEA 3QXAA 1LGVA 2VL4A 4A6YH 4ZO6A 4WFGE 1IT9L 4OGZA 3WXVL 4JO4H 4R4FL 3U7WL 4RQQB 3W5NA 2V2XB 2J8UF 3W0WA 4Z7VA 3QEQD 3C87A 2AJSL 1H5BB 3B5HA 4JPIA 4QTIH 1R3KB 4M1DH 4UIKH 1JZ7A 1QLFB 4P2RE 2C4XA 1S3KH 5FYJH 3TZVD 3SE8L 4F58H 5DC4B 1RJLB 5C9JB 1WSST 2NY6C 2Z8SA 4FZEL 1SM3H 3I75A 3MACL 1OCWL 3O2DL 5C0JA 1K4DA 2GQHA 2IPTL 2KUTA 2A6KA 2JJSA 2WBJC 4KK8D 3GDBA 3K4ZA 4POZD 3N9GH 3CLFH 3T09A 3QUYD 4H5SB 5D6DC 4XH2B 2CLVB 3BQUD 3CGTA 3QI9B 1KOAA 3H42H 1M7IA 2A2QT 4JQXA 1LMKA 3S6CA 4XZUA 4K7PX 1MJ8H 5GGRB 4G43A 2CSPA 1HSAB 1KG0B 4DN3H 1G0YR 4MA1B 2XY2A 2GAZA 3P9WB 4X5WB 1PBYA 4DVRL 1KN4L 2ITCB 4Y5XA 4JO3H 1EUTA 5EU4B 4XAKE 5MERA 2FX7H 3WYRA 1KB5A 3VGEA 3RPIA 4TTGA 5ESVA 3QR2A 4PJCB 4ODSL 4RAVA 4ZG1A 4NFCA 4CMHB 3CX2A 3DARA 1NGPH 3EJJX 3H2WA 3FQRA 3KYKH 4RMQA 3CXHJ 2ZJSL 1NBVH 4AEEA 2A73A 1N59B 2OJEA 3D2UB 4FFYH 3M45A 4MXQC 1MWAL 4FQ2H 4R4BB 2GK0A 4P3WA 3DYMA 1LEKB 4LKCB 3G04B 3UJJL 4HJ0D 4K71C 4MA8L 2EE6A 2NXZD 5SX5H 3SPVB 3SE9H 3D0LA 4PJIF 4PRBB 4PJBF 2GUOA 4ZS6C 4RFOL 1HIML 4X6EA 3DV4B 3VDBA 3WFBL 1IZKA 1T6WA 1ND0A 3QIWD 3MUGA 1SYSB 1A3RH 5LJYH 2I9LB 3WN5C 4ZS6D 5J1AA 1NMCC 1D9KA 3VWKB 4X7DC 2XNAA 2EXYD 4NWTH 3BKCH 4H5SA 1E6JL 2VOTA 1FL6B 2AJSH 1CGYA 1HCFX 4M1DL 4LHJB 4Y7MA 3QEUA 4ZXBB 1WQVT 5D2NC 4WWKD 3IXTA 4UTBL 2UY7A 4MJID 5IVXB 5IP4A 4HIIB 2Q7NA 4NUGL 3WFHB 2GJ6D 3O6LH 2VYRE 4NZTH 2QJDA 1ZV5A 4M6OH 1G6RH 2AV1A 1MVFA 1JV5B 1OAYL 1NMAH 3UTPE 3UPRA 4TVPL 2YSSB 3T1WA 4LSUH 5B3JE 4PD4J 2ADIB 2D31A 5HHVH 2VDNL 4OM0H 2DM4A 1MSPA 4H0IA 3IVKB 1KTRL 4JFHE 3O8XA 2NLJA 3IDUA 5BV7B 3MRGA 4NCC2 1X5HA 4GLRI 4Y5VA 5DJXB 4ESKA 1NGYB 1EO8L 2VDML 2CJUL 2F15A 4LVHC 4ODTH 1KN4H 1SBSL 1K5NB 4BKLB 1QSFE 1U8PB 1CE1L 2W9DL 1MI5B 3JUZA 4G8IA 4G6AD 3VGBA 4GRWE 3TNMA 4YEEA 4KHTH 3LRSB 3OAYK 5L2JA 1RVFL 3EFDH 3QXTA 3VGGA 3WKNA 2VDOH 5DO2C 1IGFH 2GFBA 1BX2A 4MGXA 4WV1B 4MNQA 5E00A 1T21B 1BF2A 1DVFD 4U6TA 3SGKC 2BRRL 5ISZB 3HPLB 4YHML 1FVDA 1QHPA 4JDVA 5D9SB 5DHYA 1KB5H 3MRQA 3UMTA 3NFSL 3MLWL 5IHLB 2W59A 4JM2D 1GGCL 4QHMA 2VABB 3OKKA 4U6YB 4WV1C 4WWID 5DRZB 3MV7A 3RGVA 1JHKH 5CILL 3DRQB 5I74B 1QTYT 1BQLH 3T4YA 4F7CB 3LZFL 4Y4HC 1WFUA 1AD0A 3MXVL 5TDNA 4C4KO 5E08L 1G9MH 3QIUA 2R1WB 4MJ6B 5J0BA 4WRLA 1FFNA 4LAQL 4NRYB 3QXUA 2B5IC 5C2UB 3VXPA 1F4XL 2WINB 1MCKA 3CMOH 4MD0B 4TPRL 5C0DA 5I19H 1J5OH 4C57C 3MMEB 2WWMD 4PGEA 1RD6A 4NWTL 3N1MC 2DM3A 1DBAL 5K93A 1EDQA 3F7YA 4HF5L 4ZNEE 1NCCL 2GTZB 4HS6B 1YZZA 3A67H 4LPVA 5BJTB 5JLZA 4NQEB 3ALWA 1I3GH 5IMOA 2GTWA 5EBWB 1B0GB 3BMVA 1BBJA 1U95A 4MLSA 4GQPH 1KENL 4NP4L 4PGCA 5F7WC 5IQ7H 3LEVL 3EOTL 2EDQA 4CADA 3O45B 4I2XE 4NKDB 2X5PA 5F6HJ 1E4KC 4M7LT 1IQDA 4WI7A 2FSEB 1U6AH 2BX5A 1FNFA 4HG4J 2CRYA 1OAUH 4NC0B 1FE8H 4RRPA 3FL7A 4FTVD 5FHAH 5DZLA 1R3IL 5J06A 2IAND 4TSBH 1KIPA 1B6DA 1WBYB 3MLTB 5B3JF 5HD8C 1IEHA 1F45A 1X5YA 1JRHH 2PO6C 3UC0H 1ZLWK 4Q9RH 2IBBA 4B53A 5T3XE 4B50A 4JR9L 1L0QA 1UGNA 3GMLB 4KKBD 3RUGF 2HLFC 5E24E 3W5MA 4I9WD 1YYLL 3OKNB 3MRIA 4PB0H 2X05A 3FT4A 4MXVF 1MCHA 3AGVA 2CK0H 3VWJA 2I9LA 4MWFA 1UT9A 4IMKC 2B1AL 2DMKA 3OB8A 4Q9CA 1JNHA 4J4PC 4YIQB 3V4VH 4QCIB 1J1PH 1BAFH 2D7PA 3X14A 1IL1B 1QNZH 1FO0L 3PGFH 4X6CE 4Z76A 3SPVA 4LSRH 1GGCH 1FG9C 2PYEA 5BMFL 1DUYB 2MNUA 1C16A 1JHKL 5F1OB 1T04B 4M6ML 4PGCB 5BW7A 3SGKA 3GSNA 4U1JA 3C8KA 1MF2L 1JGUH 4S2SB 1YJDL 1V5JA 4JM2C 2MPAH 4RAUB 4K8RD 1ES0A 3HE6D 4OFYA 4KAQH 1F4HA 1DQDH 4FQQB 2AXGB 3Q6FA 5CD5D 2AJZB 3PWUA 4LPXA 1JZ8A 5HI5D 2ILLA 4S1QL 4ZODA 1AGDB 3QBTB 4HGWB 1NGZA 4MNGE 4ELMB 1EIBA 4HK3J 1A6TB 3NA9L 4MVBC 5L88L 3BAEL 4UT6L 5DJAB 1OM3L 3NTCH 4APQC 1G7PB 2NZ9C 1FV1A 2OL3L 4XXCA 3SJVB 1FFOB 4MB5A 4TYUA 4EVNA 4NN7C 4OCLC 2UZXB 4JY4A 2OI9B 2LU3A 4NNPH 1MRCH 3OAUH 4LHUB 5IROC 5DQDL 1D3CA 4JFEE 4I1NB 5I8KL 4ZSOB 3GMQB 3T65B 5MP6L 4JREB 1TJGH 2P5EA 4I8DA 4JANB 3B83A 3LVEA 4I3RH 1I3VA 1UH3A 3ARSA 4TQEH 4EI5B 2FHCA 4UI2A 2Q86A 5L2JB 3W39A 5C0BD 1UQSA 3VXRE 1H3PL 5CHNA 1NDGB 5EO1B 4DKDC 4DTGL 1JF6A 1RZKC 1N2RA 3DROA 4GXVL 2CIIA 4RAUA 4HIJB 2YD1A 3MA9H 4GBXC 4NPYA 4U0QB 5D2LA 5I8OL 5EWIL 4PV8A 2IALA 3G6DL 3DTXB 3GSNB 4JDZA 1TJIH 1CLYH 1I1AC 4JPKL 1KC5H 2AABH 4FQ1H 5GGSY 3OKYA 1MCWW 4Z7UA 5I6XB 2AK1H 1HSBA 3V4VL 2P5WB 4NQXB 4P5TC 2H32H 3PHSA 7FABH 2CDGB 1T2QH 2KL6A 2A6DB 3KYAA 4MS8C 3GMPA 3D48R 5E7FA 3MLXH 1NDMA 1RZ7L 3MBED 4PLKC 3JUYA 5HBBA 3S5LB 5TDOA 5J1TC 1ONQB 3VFTB 1KJMA 3VMOA 2APBA 4JANA 1A1OB 1JPGA 4WUKH 5CSGA 4NDMB 2UUDK 4UOW1 1NAKH 1NCNA 5ID1B 2X1PA 1QLEL 4FNLL 1S7WB 4NN7B 1TENA 4DJMA 1X5ZA 4PJIB 5DRWB 3STLB 4U1MA 2BOCA 1E6OH 4ZFFB 4I9WE 4XB7A 4R4FH 4PRBA 4YR6B 4E9LA 1YQVL 3ARPA 3SEPA 1OTSD 4BZ2L 4JFQB 1LEKA 3DMMC 1H8OA 3ETBF 3PGDA 3SDYH 1QACA 3S36X 2WIMA 4PD4K 4R7NB 4MSWB 1B0RA 5TQ0L 4M6NL 4L8CB 4L9LC 3WLBB 2CUHA 1SM3L 3MACH 5D72L 1EX0A 1O7VA 4DGVL 5C86A 1RZJH 4L9DA 4HFWA 2W0FA 4I3RL 4PJCF 2JF1A 2P4AB 3SO5A 2IQAA 3V5DB 2XTJD 5ESVB 4Z7VF 3NOIA 1C5DB 2XWJA 3TBWB 1YN6B 3QHFL 3P40A 1TNMA 1CFVH 3NABL 2XTJC 2VZ3A 3BN9C 4LPUA 5KSUA 5IJVB 1NUGA 3OR6B 5C0FA 4XT1C 1PLGH 3D39B 4HGMA 3MFFA 1Z2KA 3LSOB 4NWUH 5F6IB 3GI9H 3P73A 3I50H 5FIEA 2E6QA 1YUHA 4O2FB 3O45A 3QG6A 3D9AH 3D69A 1E4WL 1A4KA 1UH2A 3BKJH 4ONFH 3LD8C 1XF4B 2OJZL 4JZNB 4S1SL 1X9QA 2ZPKH 3AU1B 5JR1H 1OAKH 1FC2D 1KNOB 2D7NA 1UKTA 3VCLA 1FYHB 3L3OB 3QUMH 5FYJL 3K1DA 4JRYB 4CVZA 4M8QA 4GW4A 1T1XB 5BZWB 1CF8L 3SDCC 2QTEA 4QRRE 1OPGL 4EI5D 1PFCA 3FMGL 1W72A 5I1HH 1U8LB 3B9VA 5FYKU 4DOHB 1AGEB 1KJVB 2IADB 1XFPA 4LRIA 3N1QC 5C0CD 3QXVA 4UDTA 5KAQF 1PY9A 3MV7E 1F3JA 2CXKA 5AZ2H 4AMKL 2UVFA 4L4TA 2FEEI 4JM2B 5E2TL 3STBA 4D9QE 5I1JL 5FFLA 4RMWA 3E0GA 1LK2B 5E70A 1LO0L 2R2CA 2IFFH 1EFXD 1K6QL 1HH9B 5DQ9A 3TFKC 3VGAB 1CR9H 3QIBC 4WW2C 1FYTD 1W2KT 2QR0B 3KPRA 4G6AC 3C5ZD 1K2DA 2AP2A 1J8HA 3UX9B 5BJTA 5HHME 1OY3B 1URLA 1YECL 1AD9B 1DQQA 1W0WA 4MHHG 3G9VA 1NAMB 4PJAB 1FFPA 3ARGB 5DYOB 5C07E 1FZOB 3HMXL 1I9RL 3OKLB 5MI0B 5I73B 5AWNH 1SY6L 3FN0L 2Q8BL 4D0BB 1MFBH 1CZ8H 1MUJA 1KCSH 4YC2B 4GAYB 3C60D 2AQ3A 2IPUG 4NRXB 4Z95L 5DMKA 5C9KA 3EOAB 1ZLSH 5H2BB 5FO7A 3VW3L 4OD1H 4KFZC 2HFGH 3IU4L 4LCCA 4PREA 2NTFA 4B0MM 3PJSA 1P6FA 4OZGE 4UDTB 1S9XB 4PIRF 3WS6A 1C5BL 4U6XB 5H37H 1JGLL 4GW1B 8FABB 3FO2B 1ZANH 3H3KA 5D1ZC 3KYNB 1U58A 4WUUB 2YA2A 5I8EB 3DUUA 4D9QD 4NKOA 2YHGA 2A9MH 3QIWC 3TVMD 1KCUL 4LBEB 3L3OA 3DVGA 5IBTH 2RQ8A 4MQ7A 5DT1L 2A74B 2Q76B 1OSPH 4PJIE 5TF1H 1EXUB 5C0GB 3VXUE 5IHZA 2FD6L 5I76A 5L2KA 1J5OL 1YEFH 5CIPA 4LRNH 3ARZA 3U0PB 2JJTA 2ENYA 2ZNXA 4Y4FC 3V6ZA 3TH3T 3IU3A 4AJ0A 4BQ8A 5IB4B 4H8WL 1FORH 3WS3B 4H20H 3LHPL 4GSDH 4M4PA 5E1AA 1RZGA 2NY1B 5DFTA 1UZ8A 4YHIA 2WANA 3IB4A 1RQ5A 3SGDH 2A0LC 4OLEA 3SKNA 1E4XI 4ZPTA 2PETA 3DGGA 3PXHA 5F88A 1JTOA 1KXQE 5JO5A 4JAMA 3DRTB 2Y9RT 1WZ1H 2ZUUA 1JHLL 1OGAD 3WFCL 1U92B 1TNNA 4QYOA 5HYJE 4G6JL 4NRZB 4Q2ZB 3D2UD 1WF5A 4JDTL 2VAAA 2L0DA 4ZS7L 1TPXB 4HF5H 3VFOB 4IJ3C 2N56A 2W0FB 3SDCA 5CUSL 3SDXF 4X9BA 3BGMB 4I4WB 3F62A 4AEIH 4XVSH 3JV5A 4P2QA 2F5BL 3UZVB 3P4OB 4ZUWB 3PUCA 1ZGLP 4UAOB 5C6WH 2QLVB 3WEXB 3L3HA 4GRWB 2GAZB 4RAHA 1MFEH 4OF5A 4R26L 4PB0L 4PJ8A 5JORA 3CK0L 4XTRC 3FO9B 4M43L 1U93B 3STLA 3T0EA 2IG2L 3O41B 1YMMA 4PJ5A 3HZYA 4Z0BH 2ZUYA 1WT5C 4Y5YA 1A3LL 2DQCL 4RBPH 3INUH 4AIZB 4R4BA 2HFGL 3IU4H 2VQUA 1BREA 2CUMA 2BOBA 3DUSB 5DUMH 2JE8A 5E8DH 3X13B 3S4SG 3PGFL 3KJ4B 1D7FA 4QRSA 4D9RE 1IAKA 3QUXC 1EHLH 4MA3A 2EH7L 2HA1A 4M7KL 4OKDA 2HLAA 1NBZA 4PPTA 2VAJA 1NFDE 2EZ0D 4QTHB 1H3GA 2GCYB 3BISA 4IM8A 3WL9A 4WTXA 3TA3A 5EH1A 4GUPB 1BHGA 1RURL 1NUNB 5DMGD 2VWEE 2P5WD 1DQDL 3DUHA 2BNQB 1T3FA 4TSCH 4W4NA 2V9QA 3FB5A 4NP4H 4HPYL 4IHOA 5E2UH 2IAMB 1ZT1A 2W38A 4Y19A 4EN3A 4S1DD 1LO5B 3PABB 4GG6E 1HHKA 3QNZA 3FN9A 3IU3B 1ODAA 3HG1E 3LN5B 5B8CA 5IW6B 4J3WA 5L88H 1LO4L 3T3MF 2BC4A 3U6RA 5IB3A 4QRRD 3OKOA 1EERB 5C09D 4NPYB 5GIRB 2EE2A 1GXEA 4U7SA 1WAAE 2GFBB 2VH5L 4HK0A 4TOYL 4LQ1A 5ISZD 3CXDH 1DEEA 5EO9A 1DBMH 4HUWA 4K2UH 4M9OA 2ZCHH 3ZYJA 3SDAC 4ELKB 4S1QH 3RQ3A 4LSQL 3VI4E 5L0QB 5KVFH 4N8VB 4G8FB 1JP5A 5FV1L 2WSKA 3WNLA 5CCKH 1MCIA 4OFDA 5B22A 3FRPA 3NA9H 3GBML 4KXZI 1TTFA 2VB5A 4ONOA 4LLMB 4OM1L 2C1PB 2DQIL 4NQVB 4F8QA 4PLOB 1HYSC 4NO0B 3A6OA 2J3SA 1WITA 4HIEA 2HRLA 2JJTC 1TMCB 5SV4A 1KIQB 4HWUA 2WLYA 5DQDH 5GZNC 5EZIH 1JUFB 1W72L 4FQIL 2YUZA 2XICA 3OR6A 2PYFA 3K7UA 4G8GD 4LKCA 2BNQE 1UCBH 3IAQA 1L0YA 3E6FA 3S88L 3O9WD 5DMJB 1QSFA 3I2CH 4BUHA 3QI9C 1MIMH 3OPZH 1WIOA 3THML 1K5NA 4B41A 4BH7B 4X6DB 4BKLA 2GJ6E 4EQ3A 3DSFL 5C0AB 1HOCA 3ROOB 1KTDB 4MNQE 3L3IB 3ZZ1A 3WE6B 1IC7L 4GLRH 4R7NA 2VERN 1MHEB 5KS9F 5D1XD 4IRJC 3RWIA 1RZ8A 4JHAH 5T1LD 1NC2B 5F6HI 5C0RH 1RUQL 1DSFH 1A9EB 2ZG3A 3NCJL 4Y16A 2EIBA 1N6UA 5I30L 1EHNA 1S7WA 4ZAKC 4LIQL 5LAXB 3QT2A 2LAAA 4MVBD 3DBXA 2WBJD 4LF3B 4N0UB 1S9YB 3OSKA 2ICWJ 4U2YA 3QDHA 3R06B 4N8VG 1E6OL 5TGBA 4BZ1L 3QDME 2D2OA 1CL7I 4WNQB 5D7IE 5DJ8B 5DRNB 1OTSC 2RFXA 3WFEH 1EHAA 3OWEA 4ODBD 4YHZL 3FT3B 1DBBL 4OF3A 5A2KH 5ESAA 2MHAB 2RGSA 1FGNL 3GSRB 4WU5A 4P46B 1H3PH 5DJ2A 5B38A 4NBYB 2IMMA 4MD5A 2BY1A 1NC4A 3RX5A 4M4RA 2QADC 1BD2E 3A6BL 4R7DB 4DGIL 2MWCA 4XPAL 1FYTB 1X7QB 2A1WH 5GGUB 5SWZD 3GIZH 1QRKA 3RWCB 1XR9B 5D5MA 3V6ZB 1WEJH 1JGEB 3NPSC 2X4SB 1R5IA 4L3EB 1MHEA 2VXQH 4OGAC 5TE7H 4LCCC 3I9GH 3SCMB 4NN6C 3BUYA 2Z93A 1AR1C 5DD6B 1MCOH 1A5FH 3MREA 3G5VB 3QDJD 3ARBA 4JO2H 3E8UH 1RK0B 4CAGA 4MDJB 4N1CA 4K3DL 1CFVL 3ZYIA 1QRNE 4EIZC 1UFUA 4PJDF 4HLJA 4NRYA 2PO6A 4HUUB 1UXWB 4IRJB 5DMIH 2HT4D 4GRLA 4QT5A 1ZOXA 4PJDA 5IHBA 1DBKH 1MAML 2ZUXA 1KACB 3AY4A 3K74B 3QEGH 1GC1L 3QEQB 4I3GA 3FOLB 3TZVC 1X4ZA 1A6VH 4FFWC 3EDEA 5IB5B 3MGOA 5CMAB 2NY4B 1OAYH 4IOIB 1NMAL 5HHQB 1TTUA 1VEPA 1U8OA 1FIGH 3MNVB 1MUJB 3WHXA 3CU7A 5ITFB 1YQVH 1JJUA 2QKIA 4LASL 4XRCA 4AMKH 5IKCA 3LQMA 2DJUA 4Z7WA 2GHWB 3IFLL 1I7TA 4UNVA 4LLDA 4NC1C 3VRLF 3GHBH 2R4SH 2VN4A 3LKQA 4R96B 3U36A 4PJFF 1TJHH 4X6DE 3QUYA 1YEHL 1N5AA 5F1IA 1I1AB 1MRFL 2BHYA 4ERSH 2H3NA 4XVTH 3DMMA 1U8PA 2DM7A 3QFJB 4RWYL 1RVFH 2AJ3B 3TBYA 1X4XA 3QWQB 5EU5A 4GAGL 4IDLA 4AZ8A 1MCPH 2NLJB 4LPYA 4N0UE 4RCAA 2J8UB 1FLRL 2OM5A 3MRGB 1NC2D 5DJXA 4HH8A 5C0AD 3BIKB 4LLVA 5E1HB 3BN9D 4X83A 1HQRB 3VXOB 5A2JH 4C4KT 3IETB 1ZVHA 1HXMA 1QRND 4PRHB 5FO9A 4TUJB 1KIRA 3RGVC 5JXAL 2OI9C 1AO7B 1OGAB 3CUPA 3KPTA 1DVFC 1LVEA 4WY7H 4HZLA 2F54D 1G9ML 3QJHB 3NFPB 5T3XD 3ZKXB 2MKWA 1TQCB 4C83A 1QUNA 4NQUA 4FMKA 2H2PD 5MEOA 5E5MB 3GSVA 5HGAB 1J05B 2J88L 4GO6B 2YD5A 2X1XR 4BFIB 3TO2B 2X40A 3LY6A 5CBAA 4MJIE 4UT7H 5MENB 2QSTA 2AJUH 2ZOKA 5EZJB 4LLAA 1AKJD 2VR4A 2JTDA 4KQ3H 2ICWB 5GS2D 3AS1A 1NCWH 5IB2B 2XA3A 3ZTNL 1I1CA 4XP1L 1MREH 3T0EE 3QQ4B 1S8DA 5E6ID 1RUML 5K59E 1YNTB 1ORQA 2NTSP 4P59L 1EK3A 1FZMA 5IMKB 1K6QH 1NCBH 4I0CC 2XN9A 3QH3B 4N0CC 1XEDA 1BF8A 1ZANL 1FL5A 5EBWA 3U0WH 5KZCB 5LBSH 1FVEB 2AV7B 3SDAB 4ZUSA 4LKXB 4ENED 2FLRT 2HWZL 2APFA 5E99H 1VPOH 1EO5A 4NOFA 1DL7L 4P9ML 4O9HH 3B9DA 2UY6A 3ZDXE 1X5XA 5E8PA 1FNGB 1EVUA 3HMXH 4S10A 2EECA 3QH3A 5BZDA 3MODH 1WFNA 2VRAA 4J3UA 4X4XA 1RZIA 2HTLC 2EH8L 3KXFD 3G5XA 1IEAA 4XXCC 5DJDA 5ESQA 2XYCA 4U6VL 4KUZL 5FKAA 4WENB 4GBXD 1XCQA 4GOSA 1M7IB 4IJ3B 2F5BH 4OLUL 4GMSL 1JF5A 4Z7UE 1T0NA 1L6XA 3BT2H 4Z0XB 3EDJA 1RJZB 1WAAA 3FT4B 2JK5B 4H25B 4N0CD 4NUJA 5DR5H 1H8NA 3EFFA 1D5MB 2QHRH 2BRQA 4MA8H 4KK9C 3KPSD 2DL2A 1RJLA 3O2WH 5D4QA 3SE3C 3PQYD 4XVSL 4TNVF 4Z7VB 4PS4L 3T4AB 1QEWA 4TUJA 1P9MA 2A6IA 4G6ML 4ZO7A 1OQOA 5IBLC 4D8PB 2D7TH 4OZHF 2XPGA 3GO1L 3HAEG 4HZAA 4G6KL 4Z7UF 3TN0C 4YDLC 5J9PA 1CU4H 4NQCB 1MVUB 1C1EH 3CSBA 3STZB 4IS6A 2CK2A 2ZG2A 1N0LA 5D2LE 3PHQA 1F11B 1JI2A 2ZSVA 3QPXL 2AXFB 3PDDA 2CIIB 2CLZA 3MJ9H 2DLEA 3MRDA 2JB6B 2L7JA 1IFHL 3ZE1E 4JQIH 5DVLA 4Q9QL 3DETD 4OB5L 1QRNB 4Y4HB 4JDTH 3CZJA 5F71A 1QSFB 2BMKB 5ALBL 1JYNA 3OF6A 4WI4A 4PRPD 3MZGB 5LCVH 1X44A 4UOW0 3BKYL 3SDXE 3AAZB 4I18C 5IBUG 3IDGB 4YDVB 3PGCA 4DAGL 4XCFL 1KPVA 3GIVA 1CCZA 3MR9B 4ODTL 5DTFA 2JLLA 4OUOA 4M7ZC 4WHTA 4WW1B 5GRJH 3DX9A 3RA7H 1G7HA 5GGVL 3SJVA 3TC9A 4X6EB 4U6YA 1K4CB 5E2VH 5CSZA 1TZHB 2Z35A 4HUKB 4CU7A 3VXME 2Y5TA 4L4TB 4JPKH 4PBXA 4LQFH 4UT9L 4JPVH 5A1AA 4R97C 4BFBD 1WZLA 4G8FA 5FK9B 4WFGD 2FJFB 2GSIA 4Y88A 3GSUB 3HC0B 4HC1H 5LWYL 5HVWA 3UXFA 4NBXB 1J0JA 4P2OA 3QUXD 4R0LB 2VLJA 5C6PB 4PLJD 3NCEB 4HV8A 1FVEA 2AV7A 5F93C 1MEXH 3QSKB 2K1MA 5FCUH 2IQ9H 4Z7QE 4YGVB 5KVEH 4HJ0C 5BVJB 3WSQH 3K4AA 1EUUA 5F88B 1QQDA 3KJ6L 3X3FL 5H94A 4JVPA 1Q8MA 3CFEA 4PJXF 1G7LA 2CKBL 3DO7B 1X7QA 3GO1H 3CFJA 4PP1D 1T5XB 3KXFB 1S7UB 2ED9A 4EOWH 3OJ2C 1INQB 1OB1B 1KV3A 2NY7H 4QHNA 3S88H 2H9GA 4MD5B 4ODWA 4I2XA 3L3JA 3FZUC 1UKQA 1D6VL 4U0RB 5M95B 1QG3A 2WWMC 5ADOL 4JY5L 4TULL 1M7XA 2HLAB 3HI5L 2VH5H 5HHPB 2VLKD 3FQNA 2EDJA 3MJ9L 4YJZL 4Y4KC 3QEHA 2HMID 2X89D 2E7LC 3V9FA 5IFJB 5I1IL 4DVBB 1CGSL 1KTLA 1ZLVH 1T0NB 4EEEA 5GRWA 4PJFA 2XWBA 3IDXL 1KJ2H 3IDNA 2EKJA 5ABDE 2Z8VC 5C0EB 3TEUA 3LQAC 1KTKE 2BXZA 1A6AB 1E4JA 5FYLD 1J1XL 2WUBH 1PDKA 4FA8A 4Q9BA 1VESA 1EVTC 4PJ5E 5D71H 3WEXA 3VRJB 3HC3L 4QRQB 4ZFFA 5LGJB 3RWFB 5TF0A 4OF6A 4TRPH 3EYSH 4L1HA 5GRJL 4P5KA 2QSCL 2NR6D 4GKZA 2CUIA 3E3QC 5E2WH 3QIUC 1AQKL 1YEDB 3BVNB 1VFOA 5C07B 3PGCB 2Y1VA 4F7TA 3SKOA 3I50L 4RZCA 3JTTB 2EIEA 3TCLB 1QLRB 3BPCB 2V7HB 1OTTC 2VMFA 4Z9KB 4V1DA 3ULVD 3IFOA 1GPOL 2YD3A 5C6TH 5T3ZD 1I8LA 4MD0A 4R96A 4ZUSB 3U36B 2OTPA 2VXQL 2YUXA 3O3DB 4NN6B 1TZIB 5IK3A 3V5HB 1QR4A 4MLIA 1N0XL 4HZLB 3LKPB 4UILH 5J4MA 2AXFA 2X70A 1XF2B 4KTDL 1K4CA 3V6OA 4P4KA 1I1FA 4JRXA 5FA4B 2IBZY 3TBSA 3UO1H 5C0RL 1QFHA 1GCFA 3KJ6H 1OAXL 1II4E 3VFWB 4LLUB 2VN7A 3DX6B 4XP9L 5CJ8A 1CXLA 1MAJA 4NNXA 5TPWL 1A1NB 3FFCB 3RVWC 5ECJE 3ZSTA 2EE3A 4U6HB 3QEGL 2IFFL 5I16B 1INDH 1OAQL 1MCRA 4MDJA 4U1IB 2X1WL 3NCYS 5DC9B 1JWUA 2NXZB 1T20B 2V5TA 3C6LC 3MOAH 3LKRB 5IOPB 3EGSB 2BNRA 1IKNA 2AJXL 5DJZA 2VZSA 5C92A 3WIHL 5EUOB 3FQXB 1BPVA 2CR6A 3ET9F 4DQOH 3ARVA 1N64H 5DUPH 5GSRB 3R1GL 5IW6A 2V9TA 4WI2A 1IAMA 1AIFA 1FJ1A 4G9DB 3DX9B 4JO3L 5TJWK 3WHE1 3RZCD 3MLRH 1MHHA 5KAQG 1VGKA 2F74A 1ZHLB 2BNQA 3N1FC 3V2AR 3BWAB 3IKKA 1DZBA 3GB7A 1MCPL 1EJOH 4X5XB 1XR8B 4DTGH 2B39A 2APWA 3VW3H 3V5HA 3X11B 4JKWA 2NW3A 4HKXA 4EBQL 1XF3B 1AGDA 4HGWA 4LHQB 3S3JA 3EO1A 4J23A 3H9SD 5A43C 1SMOA 4KJYB 4Q6IC 3BZDA 3FFDA 4Q74A 2NY1D 3BD3A 3DNKA 1KC5L 3TWCH 1JGLH 1NL0H 4HDIA 2V7HA 1IGCH 3UJJH 2D9QB 3VFRA 4KZEH 4AYFA 1FCGA 3CLEH 2AK4D 5JW4N 3LQZB 3ZE0E 3T1FB 2E9WA 4N8CL 3P4LA 3WNPA 3BRDA 3QULB 4ORGA 2EO9A 5IBTL 3D39D 1C16B 4X6BA 2PKDA 1ZT4A 2PW2A 3OKDA 2GK2A 4QWWC 4NQDA 5ESQB 1XGUA 4H0HB 3HPJA 4ZTPH 2BHUA 4ZUTA 3GM8A 2HKHL 3E2HC 3QHZH 3U9UB 1HWHB 4OZHB 4DVBA 4M03A 4UTAL 3F7VB 1MJUL 1T0MA 1WBXB 2D03L 2AQ2A 4HXBL 2FGWL 1JI1A 3SKJH 1NCUA 4JQXC 3VFTA 5GGSB 2PR4H 4NO2A 3O11A 1MCNA 1BEYL 4JG1H 1Z0MA 1G6RL 1YEHH 1KFAH 3PXJA 3TBVB 4I48B 5TE4H 1MCSA 2DQDH 4Y4KB 5I2IB 1RZKH 3QUMB 4RX4A 3QO1B 5JO5B 1DFBH 1EFXA 4OFIA 2VXSH 4CVXA 3T3ME 1FYTA 4I0KA 5C0IA 3MFFB 1RZFL 1SEBB 3DVIA 5E1AB 5F3BB 5KSAA 1QQDB 3LKOA 4XVJL 3CCHA 5AZEL 3ZKND 4YBHA 1RULH 1WC7A 3SQOH 1J86A 2CDFB 2APXA 5I76B 3MLUL 5L2KB 1T1YA 5EUOA 3L3IA 1RIVL 5GGTA 2MHAA 1UM5L 4PG9A 32C2B 1Q72L 2FBOJ 4JN1H 1VPOL 4UB0H 4NKOB 4KKBC 4M1CC 5F1IB 3WBDA 1A3LH 5CHNB 3SE3A 4GMSH 2IJ0C 1NFDF 4ZOCA 5D7LA 3NFSH 3TH2T 3F7VA 4YO0A 1AH1A 3NIFE 3RKPA 1SBBA 4GW5A 2GJ6A 3U6RB 3AS0A 2VQTA 4L5FH 5D1QD 4LVOC 2ZPKL 1FDLH 1HQRA 5I18H 1L7IL 5ALCH 4JEGB 2FBJH 3BH9B 4BA8A 4PJ9C 4UDUB 3UYPA 3T4YB 1EEYA 4NRXA 5FA4A 3QEQA 2XQBH 1NCWL 4ODVH 1JPSH 4TSCL 3JV6B 3I3DA 3BH8A 4F3FA 5EO0A 1SVCP 4LOUC 4G5ZL 5E56A 1IM3A 2MFNA 3EHBC 4F9PC 1I8LC 2PO6B 3HUJA 4JFOB 4K23H 4O02H 4KHXH 1ZHNB 3QDAA 4Y8DC 1U8HB 3S36L 4NQSA 1LWRA 4JFED 2BXYA 4YDIH 1VB9A 2F58H 4HKBA 4PJFE 4E41A 3OKMA 4Z7QF 5AYQA 4HS3A 4PJGE 1KULA 1DQQB 4M7JH 1R3JA 3GMRA 3TCLA 3QUXB 4LAQH 4X6CA 1BIIB 4HUNB 1JZ3A 4MNQD 1BZ9A 3E6HB 1MY7A 3CFBB 5F1NA 2J8UE 5IG7B 1CXFA 2BOBB 2VXUH 3DUSA 4Q9QH 4GG8B 4ZFGL 4IS6B 2WUCL 4QXGL 5BS0D 1DBAH 1J10A 2QQNL 5DVOA 3FT2B 4UAOC 3BKYH 1UWXH 4JY6B 3JWOC 4R97B 3TN0D 1LK2A 2VQ1A 2FX8H 4PJEA 5JQHC 3ARGD 5EBLB 5IIEB 2VDRL 3MXWH 5FYKH 1G6RA 1KLUA 1OOAA 1CT8A 4V1DE 4YX2L 3ZSSA 2BNRE 3MCKA 3CZFA 3P9LB 4XVJH 3GMNA 1M7DB 2H41A 1UKSA 5AWNL 1A3QA 1NDGA 1GOFA 1RFDL 3LPWA 3IDMB 4PTUA 3VG0L 1YYLH 4OQTA 4GH7B 3B43A 3VH8G 1NBZB 2VE6B 4F7PB 1BZQK 4L3CB 1Z9LA 1MQ8A 1UG9A 4XPTH 3Q6GH 1P4BL 5DD1L 4OD1L 4MB4A 4DAGH 4XCFH 2JJUA 1PZ5B 1RK1B 4DEPB 3VI4F 1I7RB 4LF3A 2R2BB 2CKBB 2P8MA 3ARTA 5LWYH 1E28A 4OZIB 2AJVH 2BP3A 3P73B 1K8DA 3RWDB 5KZCD 4CN4A 3RKDC 2GY7B 1IKFH 4XCYB 1BLNA 4KJQD 2Z91A 4XP4L 1T89A 5BZDB 4Q58C 5E95B 5JHDA 4JZOB 3VXRA 3B9KA 5IR1A 2LVCA 5DT1H 1C5DA 1AI1L 1ZA6B 1AY1L 5CJQH 3B9AA 5TF1L 4B7LA 3HE7A 4WTZG 2AEIT 1W8OA 2HT4C 3DHJA 3OGCA 1ZVYA 4PRIE 1IFHH 4LRNL 1JWSA 1M05B 2R0ZH 1Y18B 1QLRA 3BPCA 3GBNL 3G9AB 5FUOH 4QRSB 5KVGH 2OTWA 3CNKA 4XX1E 5DXWA 4ZQKA 3IKCB 3MUHL 1BZ7B 5KVEL 5CWSB 3VXPB 1YN7A 3Q5OA 5LGHH 1FNAA 3GMOA 5L7XL 4JM4L 2H2SC 4KKCC 3WSQL 3QZWA 3RY6A 2J6EA 4YR6A 2R4RH 3FOMB 2DQEL 2H26B 4YHLH 4UQ3B 3TJHC 2DYPA 3RVXD 1FN4A 2F5AH 3B6SA 3VGDA 2W65A 5GGVH 2X4NB 4YXLH 4MNGA 4ZS7H 2NY7L 3EOAA 5GRVK 1EH9A 5JNYA 1F4YH 1X5IA 1OQXA 5FUCC 4I18A 1ACYL 5KSVB 3TVMB 4LCUA 5CBAB 1JTPA 3GSWA 3UTOA 3ESVF 2Y4SA 5CP7B 3LH2H 3DVGB 3X3GL 1A2YB 3OAUL 4HX1B 1MWAA 1NMCB 5FEBA 1H3WM 4WUUA 1CGSH 4YHYB 3G6DH 2GSGA 4J3VA 3BEWB 2VC2L 2BSSA 4JQVA 5D70L 2YR3A 3CUPB 3ES6A 1QR1A 1QSVA 4P2OC 3EDKA 1A5FL 1KBGH 3BWAA 4NQXA 4GKNB 2X2YA 1EZVX 4WHDA 5E8DL 3PJSB 5I1LA 1XH3B 2WIIA 4LGSB 5EU3B 3WS3A 1IVLA 3X3FH 2EC9U 2R0KH 1KLGA 2EDLA 3MA9L 1F2XK 4LIQE 2ESVA 2V2TA 1DBKL 1S9WA 4LPCA 2A83B 3BX7C 2XRAL 3TN0B 4M1GL 1MJJA 3MV8D 3TV3L 4XP4H 3U0TA 1ACZA 2BY2A 2NY6D 3OAYH 3S4SB 3MA7A 1UQSB 2XACC 1OVZA 3RDTA 3T8XB 4NN5B 4HJJL 4HPYH 1D5BA 1P69B 4Q7DA 3HTLX 2R0ZL 1T1WA 1WISA 4H1LA 5CP7A 1CDCA 3GHBL 4JZJC 3Q0HA 3WHXB 4TTDD 4M62L 4Z0XA 5IGXH 3L5HA 4Q97A 3C5SA 2F54B 3OR7A 3M8OH 1HKFA 3QRGH 4P0DA 1JBJA 5DQ9B 5LGHL 2JCCA 1SJHA 4D0DA 3BZEA 4H0GA 3VXMB 4HWZA 2VKWA 1I7ZA 4N0FB 4WCYL 3D85D 2GUOB 4QHMB 3ARBC 2I9TB 4GAGH 2KQMA 2X4OB 1BOGA 3RRQA 3WD5L 2PTTB 3AB0C 2EO1A 3UPAA 5AAMA 3IDGA 1UXWA 4IRJA 2WBJB 3IRPX 4HHAB 3S37L 3MRBA 3GMMA 4PRDB 4FFYL 1NKRA 2BVQA 3ARDB 5HI5C 4JJ5B 5E6YA 2DN7A 3EO9L 3BP4A 4ELKA 5FA3B 2YPKB 5K9JL 1UVQB 3SDCB 4OF8A 3UTSE 3GJEA 1MI5A 4HKJA 3RNKB 5L2KE 2APVA 2Z93B 3TYFB 5A40E 3DYOA 3SDDB 3SO3B 2XY1A 3CH1A 3PHQB 1B0RB 1UCTA 5MHSE 15C8H 2DKUA 4JFDA 1LHZA 5IR1B 2V2TB 1RZJL 3VJ6B 3LN5A 1H15A 3L95A 3G5ZA 5EU6E 5BV7L 3OHXB 1N26A 3U4AA 4NQCE 1J7VR 3ZHKA 5HGHB 5TFSL 2XWBB 4P23C 2NY5H 5F9DC 1JMZA 1OAXH 3QCUL 1DLFL 6CGTA 4NWUL 3DSFH 3ZTNH 1VERA 3TBVA 3TO4B 1NLBL 1QFWM 4UNUA 2ATKA 4L1DA 4BFIA 4HX1A 2PW1B 5EOCH 3KPNA 4CKVX 1AXIB 4R9HA 2Y23A 4ODXB 4M3KB 2G2RB 1XGRB 4M6OL 3MRJA 4JPWH 3TO4C 3T3PE 3QDJB 3WFZA 1LNUA 5EC2B 3WLBA 4RGMB 4NSKB 4QHNB 2WZPD 3RI5K 5CINL 2XKSA 4CGTA 1AP2B 5DEFB 5EORH 4K3JL 5EZLB 2VLLB 5T3XL 4S1DC 2H2PC 1ZWIB 1C7TA 5CZXC 3EOBA 1NAMH 4A6YL 1IGJB 3UJIH 3VXSA 3DX8A 1C5CL 4XC1L 3S34L 5E9DB 4HAFA 4X7CC 3VXUD 4LEOA 1P7HL 4RNRB 2Q8AL 4LVNC 2PXYB 2VITA 2A73B 3TYFA 3UEZA 2E5EA 1CK0H 3RWJA 3KR3H 2Q87A 1I9RH 2BFVL 3VU2A 4ETYA 3KS0J 4HKZB 1BEYH 4XPAH 1A7BA 2IBZX 4PB9L 8FABA 2GJZB 5F7FA 1BVLA 5CSBA 4N9GA 1W0VB 3R8BB 1RU9L 2D7QA 4F80A 4YDJB 3TZVA 4WWKB 1I7ZB 1ZLUH 4U49A 4NCDA 4Y4HD 5FYJU 2OZ4A 1A7RL 5FO7B 4K3EL 4GRLC 3VGFA 1MCQA 3RAJH 5KG9A 3DRQA 3U79A 5E9DE 4NO0A 2I07B 3WO3B 2D7TL 2FJHA 1FBIH 4Z7NE 1FGVH 2F54A 1QBLL 3I6KB 1JPGB 2HKHH 4M7LH 4LLQB 4ODSH 1RUAH 4S11A 1NCCH 4PJ7A 1LE5A 2ZG1A 1MH5B 2D03H 4F7EA 1R24B 4XNZC 5EU6B 4GRMB 4JFXB 4HXAH 1S78C 3LEVH 1MNUH 4LCWA 5DD0H 2PR4L 3RWGB 3QPQC 2V7NA 4FXKA 1MFDL 1DQML 4FTVE 5CBEA 1S7TB 3STZA 1L7IH 4MX7A 1BVKA 1JPFA 1HIMH 2R29H 4LGPB 4QXTB 3HHRB 4OD3H 2VR9A 2ADIA 4O58H 5HHNA 1LK3L 1KCVH 5IHUL 4M61A 3GNMH 2R4SL 4BQ6A 3SDAD 1NBYA 3H9SB 2EDEA 1XMWA 4XP5L 2IWGA 5FHBH 3MUJA 1IILE 3NAAL 2VZTA 5DSCA 3K8LA 3LKPA 4CBPA 5BOPA 4JZJB 1ZSDA 5CUSH 5E4IA 2EZ0C 3W2DH 4UNTA 1AC0A 2GCYA 1D5MA 1WT5A 1PX4A 4Y5YC 4N1EA 3AB0B 3DJ9A 4HUVB 3K46A 1G1YA 4FQQA 4JB9L 3VH8B 4BQBA 3HMWH 4NUJB 3V4PL 1INEL 1KCRH 4WU7A 5JW5A 1S7VB 4FABH 2ICES 2CGRH 1QBML 3BQUA 2FJHB 3PWJA 1MFEL 3T0EB 3DLQR 1F58H 5CMAA 4I18B 5LAXA 4PJ5B 1GC1C 3TBTA 4ZUTB 5E6ZA 1LP9F 3C60C 5E5RB 1MEXL 3ZE2E 2M2DA 5F7UA 2FSEA 1B2WH 5I18L 4N5EC 4WWKA 4Z76B 3KDMA 2D0HA 2NYYC 3UTSA 5C0FB 4U1MB 2IMNA 4PY7A 2GJJA 4CADB 4KAQL 5IM7B 3GMOB 2P8PB 3UCRA 4I4WA 5KSBF 5ID1A 4S1RL 4RGOL 3T1FA 3H6JA 2H32B 5FGBA 4OD2B 5C08A 4O02L 2OJEB 3D2UA 4BH7A 2N7BA 1PG7X 4QOKD 3LRGA 1RUAL 1EBPA 3KS0H 4FTVB 5C3TA 2NY3B 1TLKA 5C8JA 5F9JB 1AO7E 5E6IB 4YDKH 4JJ5A 4DOHE 2LTQC 3O2DA 3QDGB 4ALAL 3QB7C 3ZO0A 1YC7A 4A6YA 3S9DB 1F42A 4JGMA 4ZYKA 1BQLL 4TVPH 5KN5A 3MXVH 4X5WA 4OQTH 4JN2B 4XVUD 3P0YL 2BVTA 4UINH 5JA8B 2R29L 3OL2A 3C5SB 1Q38A 5CIPB 4ETQB 1AI1H 3FQXA 1DBML 5E8NA 2FH6A 5E2UL 3QAZC 3OKNA 5E8OB 4XH2A 3HRZB 1CYGA 4ZFOL 2O26U 5LVEA 4XBPA 5D7JA 4C83B 1JZ2A 3QIUD 5EULV 1F90H 3T8XA 1K85A 3IS0X 5DJ0A 4J3TA 4HUWB 5IF0A 5HY9B 5ENWB 4PJ7B 1H5BA 3C60A 4PUBH 1F4WL 4PRDA 1YPZB 3U0TB 1BWMA 2BVPB 3QDMD 1UEMA 2WLZA 4MAUH 4EIGB 3DGCR 5BV7C 3BHBA 2PTTA 3PWVA 4ZOBA 4XMLL 5I75C 3QEQE 2NYYD 3BDYL 5HHNB 2CGRL 3CFDB 4P3DA 3RWHA 4KROB 3NVQA 3TBTB 4KRLB 3VXMA 3OAZH 5EC1B 4KC3B 3QA3B 1CL7L 4HWBA 3NH7L 4D0BA 4RGNE 5D2NB 1T3FB 4OLXL 4YHYC 1DLHA 4EDWL 4NO5B 5GQBA 2E3VA 4X6DA 4Q9RL 1A47A 1R3JB 2EIDA 5DMYA 4MNQB 5E00B 2R2HA 3QUXA 4XP6H 4BQ9A 4FP8L 4S1RH 3W39B 4MQTB 4YPGA 2AVGA 3TIEA 4Z7WF 3B8SA 4F7EB 4HKBB 4MAYB 2V5SA 3DYPA 4LNRB 3CH8A 3IFOB 4L8BB 5KJRL 5IW1B 4OCWL 4ZDHA 5J7CC 3L5IA 4M5YL 3LB6C 1CU4L 1HI6A 4UV7L 5E6IC 2DJSA 1C1EL 2IANA 1XGPA 3H3PH 2FX9H 2Y07L 2YPLE 3ILPB 1DSFL 3PP4L 3H7LA 1B9ZA 4JM4H 4K9EH 3FRUA 4LSRL 3CAFA 4H88L 4F2MA 3EOTH 4PJDE 1U8KB 4MQSB 5IMMB 4RFEB 2P1YA 4PRPB 4X4YB 3KPLA 2EEDA 4JDZB 1Q1JL 4PJHF 3TT1H 2XPGB 2GT9B 2W9EL 2YN3A 5C0AE 3BHBB 2OTUB 2FYYA 2NX5A 2X4UB 2YD7A 1P4IL 3TJEH 4G8GA 5C0CE 2R56L 5JW3H 3C60B 3GSOA 1TVHB 1DBBH 3H8NA 5FOBB 4WCYH 1A7QL 3VMNA 4YC2C 3F7RA 4GMTL 3FQWA 4B5EA 1S7QA 2D0FA 3OXRB 3VCLB 1PLGL 1MLBB 3FCTB 2DWDA 4PRAB 3QDGD 3O81A 4D3CL 4BZ1H 3L1OH 1VEMA 3GSNH 5HGDA 4KJPC 3KNBA 1NSNH 4Y5VB 2Y25A 2A1WL 5BRZE 1Q9OA 4U1SB 4PJ8D 1N6VA 4JN2A 4KZEL 2NY2D 3G08B 4OZGF 4JRXB 2OJZH 1A4JA 1J1OH 3HLAB 3LMJL 4OAWB 2J2ZA 2PXYD 1V3MA 4HC1L 4FQXA 1NUDA 4L8DB 1QOKA 3LSOA 3VDCA 5JXEA 5DWUL 1HQ4A 4HUMB 1I9EA 2M1KA 3RTQD 4UU9B 5CEZD 2XZZA 2R69L 3N1GC 3PG2A 1LE9B 3KNBB 5IB1B 4WW2B 3ROLA 5C07D 3OX8A 1FZKB 1H3TA 2RIKA 1U0QA 5I1HL 3E8UL 1HINL 1WEJL 3TA3D 1TZGH 4Q0XH 2F19H 4LGRB 4LSTH 3ARFB 1T4KB 4O5LL 3RIFK 4HBQA 2MSPA 5DVKA 5C0DB 1XIWC 4F58L 3SKJL 4POYA 5EIVA 2XT1B 3FONB 3FRPG 4WI9A 1Z9SA 1XGYL 3QG7L 4M6AA 2NNAB 1ZA3B 4POUB 4X4ZA 2Z91B 3WXVH 1L9NA 2NZ9D 4L9LB 3B2VL 1A6AA 1CICB 3OKDB 1EO7A 4WHTB 7FABL 2PYED 4PGDB 1FH5H 1BM3H 2XWTB 2CDEA 5E8EB 3UPCA 5F1SA 3K2MC 4MCYA 1FG2B 2OK0H 1KPVB 1XGPB 5CD5C 2VZVA 1V7ML 2G60L 3NFNB 4PV9A 4OLZH 1P4IH 1Y18A 2J8OA 3FQNB 3SQOL 4WHCA 1QSEB 2O5ZL 3FQUB 3QXDB 4NZJA 3RUGB 4HWNA 1IMHC 43CAA 4WW2A 4YUEL 3CZFB 3P9LA 5IVNA 4X80L 2PO6D 1DLHB 4PBWD 4AEFA 3O6FA 3V0WH 3MBEA 4D3CH 2ARJA 5TDNB 1LEGB 4O51B 5HVGB 5D1ZA 1KG0A 4IOFC 4Y1AB 4PB9H 4R4NC 4DGYH 4I5BB 3RPKA 1CGXA 2B20A 2FB4L 4XB8A 5CJBA 3KPSE 4R6UA 4RWYH 4NQVA 2Q8AH 1JWMA 3BIBX 2ICWI 1S7XA 3SE9L 4I13B 1TXKA 3TFKD 4FG6C 1SJEA 1EGJH 3KYKL 4MS8D 5MEPB 5F72S 3BRFA 1OAZL 3K2UL 2E7MA 3L5WB 1MWAB 1RZ7H 5I8EA 3RDTB 4NYLB 3WV0A 5F7DA 1YNLL 2KQNA 3V0AC 3CIQA 2KPNA 3T3PF 5J6GB 2AJUL 5I0ZA 1IQWH 3EYUL 1TZGL 4Q0XL 3IAGC 4PP2B 3W0WB 5ERWB 4NHCH 3VWKA 2AK4B 2XKNA 4ZSOA 5GISL 2JIXD 1XF4A 4JZNA 1NCAH 3GMQA 4OTXL 5DQJB 4U1HA 1KLGB 1SHMA 1QFWI 4E5XA 2BCKA 5GS1C 2OXGA 5CFHA 4F15B 1JHLH 4MA7L 3WFCH 1IARB 2DIAA 3Q3GA 4QLRA 5LQBL 1P4LA 3KPSB 1KPUB 3LQAH 3UJIL 4ZFGH 1E4KA 1KN2L 1MFDH 1DE4A 3QIBA 1MELA 4GRLB 4QT5B 5KSAC 2AEPL 1T1WB 2BSSB 1D5ZB 2FECI 1NGZB 1CD1B 1WTGT 5IWLA 4ZFOA 2VLRA 2VXTH 3O3DA 4W4OA 1D5BB 4I77H 2VZOA 4O58L 1ZVSA 3SDDD 2GYSA 2KZ1B 4LLYA 3EBAA 5F9OL 3QWRA 1JGVH 2P5WE 3HE6C 3WCYA 3EYQC 1Q0XH 4FRWA 2XNAB 4QNPE 2G75A 2X9WA 3WIFA 3ARQA 5HHVL 3BVNA 4GQ9L 5ICXB 2VDOL 3B9KB 5LGKA 3ULVL 4U4BA 3O3AA 2ITDA 3MV9B 3D3VD 5LGJA 3KPPA 1CICA 2FEDC 1FYTE 3Q1SL 5IESL 1S8DB 3MRRA 4YHMH 5DUML 3S35X 3P30H 3TYGH 5I0DA 3VFMA 4P9HC 4V2BA 4F37K 4M3JA 2EDTA 3QXWA 2GK0B 4F9LA 1FGVL 5TQ2H 1G0XA 5HY9A 4JFFA 4P48A 3QDJA 4HIXL 5AEAA 3OJMB 3MGAA 5T1LB 2MJWA 3FQRB 3MCG1 4JB9H 3ECBA 2BRRH 3BZ4A 1UACL 3GI8H 1N6QH 2HAZA 5F7HA 5DJ8A 1DQLH 1ZA6A 5I19L 1IGIL 4QGYA 4ZTPL 4YFDB 2FLBT 4L8SC 4NZRL 1UENA 2ZCLH 3SDXA 5J11C 1P7QA 4CJ1A 1NGXB 2YKLH 2UVEA 1YUHB 4O2FA 1KT2B 2ADJB 4UTAH 5HGHA 3KXFA 5AZ2L 2VLME 5KW9H 3MRLA 1EFXB 5GS0L 1H0DA 2CO7B 4PS4H 2PCPB 4PJBB 4KDTA 2R4RL 3V7MA 1BJ1H 4ORGB 2I27N 5ID0B 2IALB 1GGYA 1T5WB 4P5TD 1YY8A 2Y06H 3HE7C 1M71A 3UTTD 1RJYA 4ZQKB 4FQJL 5EFIB 3VFRB 2VLJB 3HZVA 5T5NF 1I3GL 4DFHA 1K3ZA 1J8KA 1V7NH 3JSSA 1OSPL 4LLDB 4EI5A 1JRHL 2FJFA 2WQ8A 3W0WD 5GRXG 4K9EC 5JW4R 3TPUB 4G3YL 3TH4T 1FO0A 3IF1B 4WFFD 4R4ND 3BW9B 3C9NB 1T66C 4U1LA 5DD5H 4AH2A 4NFBA 1NLDH 4ZO9A 3QWOA 1X3DA 4F2MB 3FOLA 4XNXL 5EN2A 3WIIH 4AG4L 5HYSB 1WZ1L 4P9HL 1UWXK 5DJAA 3KPRD 1FO0B 4P57B 1CXKA 2JJVA 2YC1B 3O4OC 4JR9H 1C5BH 3U46B 4HIHA 5E94B 1QVOB 1A6PA 2MMXA 4KKLC 1CFNB 2O93L 1HEZA 4XPFL 1PKOA 4M1GH 2HT3C 1I4FA 5J6HB 3CFIC 2W0LA 1A6ZB 3BPLC 4D9LL 1QSZA 1DEEB 3JWDH 5EO9B 2GIYA 1OGAA 3S4SA 1AKJA 5AD0B 3WLWC 3IGAA 4ODVL 4DZBB 2HJKA 4XP6L 5CGYC 1S9WB 4RQQA 3V4UH 1UB6B 4L29A 1EEQA 1GVIA 3HS0A 2V5MA 1YEFL 4MNHA 2ESVB 3FO1A 3CCHB 5H35B 5SX4I 5FF6A 4NZRH 4R26H 3N0PB 3MRKB 2NR6C 5CJ5A 3SDCD 4M5YH 3LKSA 3P4MB 2EYRA 3B9KD 2J8UA 5EU3A 5FCUL 5I1GH 5D1ZB 3EZJB 1AGFB 3P3YA 4L4VB 2IADA 1JNHB 1YJDC 3BWUC 5D2LB 4G8EB 4QY8A 1N4XH 5AUMA 2OR9H 4OGYH 3H0TA 1W72B 1VFAB 1X4YA 3S35H 4ORZC 2EIZA 1EHLL 3BKMH 3GKZA 4G6JH 5HPMA 4Y1AE 3L3GA 5DLMH 5I8KH 3G5YA 1G7IA 1RPQA 3BZFB 3EYOA 4PRNA 2OR7A 4KY1H 4APQA 4BSVB 1NGWA 2GW5A 1FNHA 3DXAD 1D6VH 3H3PL 2HT2D 4JFFB 4F8TA 2NY1C 2OL3B 3HA0A 5IJKA 1G9NH 2J6EH 1GZQA 3OB0K 4K9EL 4LFHG 4MJ4A 5FYJE 1WAAF 4XBEH 4NQTA 3L7FA 1NPUA 2EKSB 4OT1L 3RVVC 4CRPA 3I9GL 3VRJA 5HD8D 4KRNA 3D25A 3ISWA 4MJIA 3RX7A 3E1F1 1H15B 4TUOA 1UXSB 5FKPA 5IVXE 3LKNB 5EZOH 3T0DA 3C6LD 3L9RB 4JO2L 1J1OL 3OQ3B 4Z18A 1KEMH 1I75A 1OARL 5HHOD 5SWZE 1I8IA 4OLVH 4V1DB 4PGJA 4GXVH 5DMIL 5DWUH 3OGCB 3P0GB 5CCKL 2YPKA 4PG9B 1CLOH 4OGAD 1M71B 4DCQA 5H8DA 5A2LH 1TJIL 1CLYL 1GC1H 1FL5B 2W91A 4LP4A 5ID0A 2J7LA 2YN5A 4E0RA 2DQTH 3MJGX 4CN1A 4EI6B 1AXSB 4IEFB 2NXYC 1ZHLA 5GGUA 2BZDA 3QAZB 4N0FA 1MHHB 4H88H 4G9FB 1ED3A 3S7GA 4CDGC 2Y5EA 4JRWA 4UIMA 2R2BA 1AP2A 3D0VA 3MLXL 5DEFA 4XC3H 5FGCB 5DQJA 5JUEL 4FQCL 1K8IA 2BVOB 3JXAA 4X8JA 4P46A 3HPLA 4JVWA 2B4CC 4L8SA 4KK8C 2F19L 4LSTL 1VCAA 3FFDB 4K7PY 4XCEB 4LSVL 2BMKA 3LKRA 2DQEH 3AFLA 5HPMB 5EOQH 5IJKC 3BJ91 2BSTB 4O2CA 4R2GD 1N5YL 3MRDB 5JPMB 4G8EA 4QY8B 4XWOC 1BFOA 3WNOA 3RWEB 5J12C 1T7ZA 4EUPG 2P5WA 4Z7NF 4KK6D 4JGJA 5EIIB 1U8NB 3P4MA 4OFVA 1G6RB 1KLUB 3NGBB 5JXAH 3KPLB 1UWEH 3WXWH 1FRGL 1FH5L 3NCYP 3BUTA 1BOYA 4IRJD 1UM6L 5L9DH 5I8CA 1UB6A 4L29B 1FAIH 2AAVA 1IZJA 2DLHA 5DC0A 5LXGH 5D72H 1EMTL 1N7ML 1NUFA 4Z5RA 3EYVB 5HTSA 3AM8C 5C09A 1TTGA 3P0VL 1OP3K 1OGTB 5J13B 3IXTB 5JHLL 3QUYB 1Z3GH 2Q86B 4KJYA 1IC1A 5JIPA 3QI9D 2VWEC 1D9KC 1V3JA 3B9EA 2DTML 4KK9D 5JR1L 4O5LH 3RTQC 1U8MA 2F54E 2P8LA 3G6JB 2HN7B 4XP1H 2WBWB 3O6FC 4JG0H 5IWLC 1JFQL 4Y5YB 2NY6B 1XGYH 2K3TA 3RL2B 1I7UB 3CVHA 2XTJB 4Z6AT 5JDJA 5J11B 4NQED 3JV6A 4WI3A 2YEZA 5I1EL 5HVHB 4NQCA 2QSVA 1G7HB 3IJSA 4OUUA 5JIIA 2FH8A 1IQWL 3B2VH 1KEGL 3AMKA 1OHQA 1GGTA 3CXHK 4W6XB 3TT3H 1OSZA 3OG4B 1C8PA 4XI5C 3ARRA 5DGQA 4FG6D 4M5ZH 5J6GA 1KCVL 1B4JH 3LN9A 3PE9A 1WICA 3EJZC 3AMLA 1U3ZA 3C09B 1V7MH 3FHQA 1AXTH 2OTWB 3UTQB 3VFNB 3ZTJH 3D85B 3ZE1F 4HCRL 5DEGB 1MRDL 2I5YL 3DX7B 4FQHA 3L3KB 2VAAB 2FCBA 3OX8B 1MFAL 1YYML 3MRNA 5DVMA 1R5IB 5FKPB 4CMHC 3RVVD 3LKOB 3PP3H 4FZEH 4MA7H 4OFYD 4CUCA 3IFPA 4PRHE 4ZPVB 2RCSL 4IIQA 1VFUA 3KWWB 5GHWH 4CJ0A 1YEEL 2E9BA 5D96B 5EIIA 1KN2H 4YHKH 5F89A 5K9JH 3PV7A 4GQ9H 3WN5A 3UJTL 2QL1A 2UV3A 1GAFH 4ZOAA 4RGNC 5ACZA 4WEMB 1DFBL 2JCCF 1CVSC 2HVJA 2ZNWA 1XF1A 3TO2A 3T2QA 1EGJL 4DN3L 5KANG 3TYGL 2DWDB 1QSEA 1H3XA 3IDJA 4GXUN 5EG6C 5BV7H 2VDPH 1MCOL 1I1YB 3BMWA 3BEVB 3HC0A 5JQ6H 3VD5A 4I2XB 2BVEA 3MNZB 4ZAKB 3A67L 4NHCL 1KCUH 3V95A 3Q1SH 3ULSB 4W6YB 4RX4D 5IESH 5C1MB 5GS3A 1MCLA 5EBLA 1HHIB 4YQXL 5IIEA 3QPXH 4HMEA 4PJ7F 4G5ZH 4LVNB 2VQ1B 2OXHA 4QRPB 2VO5A 5D6CA 4UBDD 2X4RB 5I1EH 4EI5C 1U6AL 4ZUVB 4NZUH 5EPMB 3S3PA 3QFJA 3BDXA 3BGAA 3P0YH 1BIIA 3N85H 3W0WE 2KKQA 2VXTL 3QHTC 5DHVB 4JFZH 4XNYH 4K3JH 3GI8L 5C0CA 5HSFA 1MCCA 3FJTA 5F7NC 4PJCA 4G80B 3NACL 1J0ZA 2E7BA 5TH2B 4F7MB 1D5IL 1MRFH 1QZ1A 4HIHB 1E27A 4KRPC 4CMMB 4ERSL 3BD5A 5ICYA 4OZFG 3U9PL 3HR5B 3QNYA 4EKXA 4PP1C 3MNVA 3HG1A 4HMCA 1YYMH 4CL7A 3RZWA 4UT9H 2C4FU 1KPUA 4WW1A 3L5XL 5EA0H 3W9EA 1JK8A 4UZGA 1OP9A 5I17B 1U36A 4YHOL 1GZQB 4Q6YA 3PWVB 2BK8A 4AT6A 1P1ZA 4FQJH 4OIBA 4Y2OA 4OGXL 2BVPA 3ZDZE 1DQTA 5TE6H 1KB9K 2VIRB 5I6XC 1A6ZA 1HHHA 6FABL 4JFEA 1V7NL 3HFMH 5GJTH 3K81A 5ACLA 1U58B 2DKMA 3C5ZB 2ARJQ 5D7JB 1PJ9A 2GSIB 1R24A 2VDMH 1JWUB 3K80A 3O3BB 1JNNL 2IBGA 3TCXA 3RAJL 1T03L 3OZ9L 1LO3H 1T1ZA 2XN9D 4AT6B 4U6HA 5GIRA 3WNNA 5DK0A 3HCVB 1IBGH 3EFDL 4QEGA 4XRCB 3VXOA 4X0KB 3CK0H 3JWOL 3TNNB 4HS8L 2EYRB 4KTYA 1PEWA 2IG2H 4BM7A 4J1UB 4X9FA 4UV7H 2OS7A 2V9RA 4P5MB 4GAJH 3O6FB 2E8YA 4YQXH 2UWEB 4GG8A 1LEGA 3IDIB 1VEOA 2FR4A 5HVHC 3UDWA 2B4CL 2Z9TA 4XHJC 5GGQL 1JZ5A 4YNYB 5IW1A 3LZFH 5FCSH 1A7PH 1R0AL 4U3CA 4W4OC 5JW4M 5K9QI 3NBNA 3WJJC 2HWZH 2EC8A 3C6SA 1ZGLB 2PTVA 4KJWD 5F1KC 5E99L 5DD6A 2LVEA 4P2YA 2HJFB 4L3ED 5IHUH 3O41A 5C70A 1GH7A 1EBAA 5BVPL 3D0VB 5KVFL 3KYMB 1H3VA 1P9MC 3GBNH 5FUOL 3ULVC 1VSCA 5E2WL 3SBWC 1NLDL 4OM1H 2DQGL 1WTLA 1CG9A 4KUCF 2GKIA 3GGWB 1CDIA 1G9NL 1KENH 1ZT7A 4YO0B 4P2QB 2BSTA 5EC2A 4DKAA 3OV6A 2ADGA 3VXQB 4A2MA 4OGXH 4R8WH 1A1MB 4WHYG 1U3JA 2DQFA 3MO1B 4YZFF 2O5YL 5GJTL 2DQUL 1UJ3A 2XZAL 4YNYA 1HINH 1RIUH 5A16B 5EU4A 5SWSD 5GGVY 4Z77B 1HQ4B 1ORQB 4IMLA 4KZDL 3MLVL 3M17A 4KTEL 1GHFH 1YMMD 4K55A 5FO9B 3BQUC 3IDIA 1NBYB 3ULUL 3MBEC 4PLKD 4XMPH 3T0XA 4AEHH 5CAYB 1U2CA 1UZ8B 4YHIB 2D7MA 3VFUA 2Z31D 3ZT6A 4J3SA 4DUWA 3RZCC 5HGGS 5T1DL 5D2NE 2NXYB 5JXEC 4R7DA 1R3HB 4CVWA 2AI0L 4ODUB 4X6CF 3LDBB 5C09E 1X5FA 1KEML 1PQZB 3PIQA 4LCYA 4OZHE 4CNIB 2IQAB 4HWBH 5L8KB 4OB5H 3PWNA 1MF2H 3DUUB 1T83A 4ISVA 4QNPF 1CI5A 3MCKB 3RNQA 3OKOB 4F57L 3GGWA 1S9XA 2PYFB 1FGNH 3UTSB 1BD2B 2J6EL 3LDBC 3REVA 2ZCKL 3LKSB 4FN0A 4PREB 1TVBB 1XT5A 1MOEA 4TVPD 4ZNCD 4KU1A 2B5IB 3S96A 1U3HA 1EAPA 5EOTA 3MBEB 4GAYA 3P9MA 5F9WC 4HT1L 4NKIL 3F7QA 2DD8L 3MV01 5ERWA 4YHZH 4M93C 1DVFA 3WXWL 4KKCD 2FIRT 5HGAA 1FRGH 3C6SB 1HDMA 4BSVA 4N8VA 4HUVA 4M48H 4H26A 1FLTX 2HFFB 1CFNA 1DDHB 1OTTD 4HKXB 3QJFB 5C09B 2M8XA 3RGVD 3QUML 3HUJE 4KROC 5HI4C 3H0TB 3JZ7A 1LEIB 1HH6B 4FQXC 3SCMA 4KKNA 3QIBB 1DBJH 2X6MA 2P7TA 3FMGH 2LTQB 3UBXG 5DI8A 1F11A 2ZSVB 3ARWA 5T1KB 2BJMH 4C56E 3LN4A 4EDWH 3ZT7A 3QHZL 3RWFA 2H2SD 4MXWL 3DX8B 5JHDD 1PZUB 3QNZB 4QTIL 3LIZL 3JV4A 3ULUC 3AROA 4I5BA 3I84A 3L3HB 1NCAL 4I0PB 3FTGA 1ZA3A 4HXBH 4QRUB 4FQLH 1AQKH 2A6IB 2VLLA 1JFQH 4GKNA 4YAQA 4P2QD 1K9TA 1T22A 3WDIA 3WFHA 3FFCE 1U8LA 4YXHL 3CFCL 5IFHL 5BS0B 4R90H 3QQ3A 4NOBA 1ZTXH 1HHGA 1HEZB 4K3DH 3FQUA 3H42L 1YECH 4M8VA 2RFXB 2Z4QA 4P2OD 1G0DA 1IAOA 5EOQL 3IFLH 3AY4C 5IKCB 4O4YH 5GZND 4OSUL 1MAMH 2ID5A 1S9YA 4AL8L 2YBRB 5ACZB 3SGEI 4DVRH 3RIFF 2Y7QB 1XCQB 1LO2L 3IDXH 3TBSB 3MX0A 4G9FA 4OZGB 3KGRA 3FO9A 2R56H 4CVXB 3NIDE 4BSJA 3ULVH 1FNLA 1WBZB 2E27H 3TZVB 1Q72H