4LLOA

Structure of the eag domain-cnbhd complex of the mouse eag1 channel
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
173
structure length
173
Chain Sequence
GAMGTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEATLAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structural mechanism of KCNH-channel regulation by the eag domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium voltage-gated channel subfamily H member 1
total genus 49
structure length 173
sequence length 173
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lloA00
1I5ZA 1QXRA 3L2HA 3CLPA 5I0TA 4I3PA 4AQ2A 5AVPA 5KHKA 2PTMA 1OFNA 4J1XA 5KHGA 3TNQA 3H3UA 3ES4A 2O1QA 2ET1A 4QGMA 4EWEA 2XGXA 2GC0A 3C3VA 4R8HA 4ZU7A 3WW4A 2E9QA 4E2GA 1JUHA 1ZREA 2FQPA 5KHJA 4H7LA 4MX3A 1HW5A 2VQAA 5JSRA 2GC2A 3I59A 4ORFA 1ZZ6A 3LWCA 4PIYA 4R52A 2IXCA 2PAMA 4LLOA 2XLAA 1J58A 2PA7A 1EP0A 3S7IA 4HLTA 2IXIA 1DGRA 4CYDA 3R6SA 3ETQA 5KBFA 2IXHA 4XF9A 2OYZA 4PIXA 1CGPA 2GC1A 1UIKA 3E5QA 2CGPA 5C8WA 4EV0A 3MZHA 3EHKA 3KMHA 4ONUA 2N7GA 2UY9A 5T3NA 3H8UA 1ZRCA 2HJIA 1CAUA 3GBFA 3I54A 4XF0A 3ES1A 1UPIA 4E2QA 3HT2A 3KCCA 1XRUA 3ROUA 1DGWA 3QACA 1O3QA 5F1RA 1RUOA 4AVAA 1ZZ9A 5LRSA 2D40A 4XF1A 4HMZA 5CADA 3M70A 1Q5OA 3E5XA 4HBNA 1NE4A 2Y0OA 1WA4A 2H6BA 3BALA 4FAGA 4DINB 1RUNA 4Q0UA 4X6QB 1L3JA 2CAVA 3H50A 3RPQA 2XL9A 1ZX5A 3LA2A 2O8QA 4MV2A 4I01A 4LA2A 3E6BA 4BIFA 3DN7A 4IEYA 5FPZA 1NXMA 4I0BA 3FJSA 2DCTA 2KXLA 4KWJA 5BUVA 4XFIA 5CU1A 3SMHA 1CAVA 1Y3TA 2EAAA 4QGNA 3BCWA 3ACLA 1X82A 3E97A 3BPZA 1ZRDA 1YLLA 1O5LA 3S0MA 3LAGA 2XKPA 4QM8A 2QVSB 3OF1A 3SCFA 2IC1A 2WFPA 3IWZA 1J59A 5J3UA 1DZTA 3CF6E 4XFFA 3G7DA 1NYWA 1RTVA 2Q30A 3FWEA 3MDPA 2B9UA 4Q29A 3PNAA 2BEOA 2BNMA 5J48A 3B02A 3IDCB 4AXOA 4K8FA 3UKVA 2V09A 1Q43A 2UY8A 1CAXA 4IEQA 3UKNA 2IXKA 1WGPA 1SFNA 2D5FA 3CJXA 4O9EA 4IEVA 2D5HA 3IBMA 4LA3A 3M3IA 2MHFA 4OFGA 4KWKA 3EJKA 1O4TA 1ZZ8A 4EWDA 5EZWA 5JCTA 4P9GA 2PHDA 3LA7A 3OTFA 2CAUA 1PM7A 2UYBA 3CEWA 3H1MA 3NJZA 1EY2A 3SCHA 3WW1A 2Z69A 5FPXA 3PVBB 3SHRA 4ZU5A 4TLFA 4IEWA 1X7NA 2GC3A 1NE6A 3GYDA 2VPVA 4HVRA 4YARA 1YFYA 4F7ZA 1SEFA 1O3RA 2K9ZA 1ZRRA 4Z07A 2FMYA 2XKOA 3E6DA 4QGLA 5CVRA 4QX5A 5JR7B 4MGZE 1YUDA 3CO2A 5FQ0A 3RZZA 2XHKA 4I09A 4J1WA 1ZNPA 4I0AA 4MH0E 1YFXA 1FT9A 1J3QA 5C6CA 1NZCA 4WBBA 5JAXA 1GQGA 2BGCA 4YRDA 4X6RB 2GH2A 1X8EA 3OCPA 3N4MA 3I59B 4IEOA 3H9AA 3U10A 1G6NA 4RD7A 2H6CA 1PMIA 2BNNA 1QXJA 2MPFA 3D0JA 1RL3A 2HKXA 3BB6A 5I0UA 3BU7A 4ZU4A 4LTAA 4YYOA 5K8SA 1EYBA 4BYYA 1ZZCA 1QWRA 2OA2A 2ETEA 4BH9A 2I45A 2IXLA 3NVCA 4QM9A 4MGYE 4KWLA 1Q3EA 5BY5A 4EROA 3DKWA 5LEJA 5FDBA 1WLTA 2P17A 3NW4A 5JSOA 1O3SA 4LUMA 4QMAA 1YFUA 4BHPA 4KU8A 3ELNA 4IEPA 5FLIA 1UCXA 4NVPA 1O5UA 4AVCA 4HVOA 5E1RA 1XE8A 4UBHA 1VJ2A 4HSLA 4IEXA 4JTNA 1ZZBA 1CX4A 1ZVFA 2GU9A 5HI0A 4Q0VA 3UKTA 4D7SA 3E6CC 4JVAA 1QY4A 4KL1A 2ET7A 1X8MA 2EA7A 5JSPA 4OLLA 2OZJA 4I02A 3SXWA 2D93A 5J7MA 1I6XA 4MUVA 3DV8A 4XFHA 3CL1A 4GULA 4I2OA 2K0GA 4FT8A 1LB2A 3FHIB 3IDBB 3PLQA 4XFGA 2C0ZA 4PIZA 3D0SA 2GZWA 4L2NA 3RYRA 4YSFA 1GQHA 4MGKE 3ST7A 3WW3A 4IETA 5FLHA 1FXZA 4PJYA 3RDIA 1H1IA 3QOPA 1OMIA 1V70A 2BYVE 4LUKA 3USSA 4LULA 2B8MA 4XF4A 3ZDSA 3I7DA 4N9IA 2PAEA 5E16A 5I8TA 3U0ZA 2Z2SB 4IESA 4WZCA 4F8AA 1OD5A 3EBRA 2Q4SA 5LRRA 4MZUA 1O3TA 3RNSA 2ATFA 4IEUA 4FAHA 2QJVA 2XLFA 1H1MA 4A2UA 1IPJA 4Q0QA 3FE5A 4Q0PA 2PHLA 1YHFA 3RYKA 1EPZA 1DZRA 4EWAA 4Q0SA 3H3ZA 2CV6A 4N9HA 5D1IA 4HVQA 3KGLA 5I8SA 4XF3A 3HIFA 1VP6A 3H7YA 3KGZA 2VECA 3OGJA 4D7TA 2XL7A 3DL3A 2UYAA 4L11A 2EVXA 2OZ6A 2MNGA 4UXAA 2ZCWA 5I0RA 3NKTA 3JZVA 5BPXA 4XETA 2F4PA 3D82A 5BV6A 1LRHA 5FLJA 3IIAA 1Y9QA 5I91A 5FQ0B 1CAWB 4Z82A 1J3RA 4HZFA 3WW2A 3VHRA 1U12A 1ZRFA 3EO6A 3OD0A 1YFWA 2QCSB 4HN1A 1CAWA 4E2SA 4KU7A 1VR3A 2ZKLA 1CAVB 1TQ5A 3RYPA 2PFWA 4HN0A 3S7EA 5FCCA 5BXXA 1CAUB 4B29A 4META 1XE7A 1IPKA 1UD1A 4XFBA 3KSCA 1J1LA 4AQ6A 4XFCA 2PYTA 2PAKA 3EQEA 4IERA 3NSTA 5EFUA 2OPKA 3FFQA 3HT1A 1UIJA 3TNPB 3LOIA 3NL1A 1O7FA 3O14A 3FX3A 4JV4A 1LR5A 2WC2A 1RC6A 2QNKA 5I93A 3H7JA 3MPBA 3FZ3A 2BNOA 1CAXB 4QXKA 3H1WA 4HSJA 4YNIA 2XLGA 2QDRA 3MYXA 4MGIE 2B5HA 4XFAA 1FI2A 5KHHA 1UW8A 4O9GA 4WVZA 4AVBA 2H0VA 2Q0AA 4LEJA 5LEKA 1J3PA 4UBGA 1OI6A 3H1YA 1RGSA 3U11A 3LA3A 2PQQA 2Q1ZB 4XEZA 3SCGA 3E5UA 1SQ4A 5I0SA 4IEZA 2GAUA 1LKNA 1YWKA 5KHIA 3HQXA 4JTOA 4FBFA 5I8YA 2IXJA 1ZZ7A 3LZZA
chains in the Genus database with same CATH superfamily
1I5ZA 2ARCA 5A33B 3W20A 3MHZA 4I3PA 1ENRA 3L9JT 4MSVA 2PTMA 1TMF2 1H8VA 2CWSA 4KH9A 1UXXX 3NNFA 4QU1A 1ZA7A 3HNYM 1W6MA 2ZGUA 3H3UA 3ES4A 3AVSA 4EZHA 3CBNA 1S0EA 5BNNA 1O6UA 4XJ9A 3K48A 2GC0A 2XJTA 5DUUA 3WNOA 2HWD1 3RQ0A 3A0NA 1PX4A 3JUUA 2HYKA 4GWJA 2E9QA 3AKRA 4Q4W2 3JQWA 2FQPA 3DCQA 1PNFA 4GD4A 4QX1A 2VOTA 4MX3A 1I1EA 5FY7A 5DZGA 5JUVA 1FOD1 3Q8FA 1GWKA 2PLV3 2WN3A 1UF2C 2BFUS 2ZHLA 1HRV2 3FMGA 3MIEA 4PIYA 5GALA 4NIIA 3RSJA 3J9SA 2IXCA 2PAMA 3S7IA 4B7KA 1J58A 2WYFA 5A70A 3DF0A 1OA4A 4QPGB 4Q4Y3 2VZVA 5FZHA 1POV1 4FFIA 2A3XA 4CYDA 1QOOA 1WD3A 3A23A 5J09A 4Q5OA 3I3MA 1RUE2 4XVHA 4BB3A 3R6SA 2J1SA 3DPRB 4FSJA 2H0BA 4DY3A 4CVUA 1L7LA 1QJEA 3ZPOA 4AHXA 3ZFFA 2W91A 4FO9A 5A33A 1PO22 1XBFA 1COV1 2OYZA 4EN8B 1BBT1 1GICA 2A7AA 4ZXKA 3SITA 2D98A 4KBBA 1UIKA 3ZYFA 2WZR1 2A6ZA 4W65A 1KXGA 4JGZA 2CGPA 1GQPA 2QQPA 4EV0A 4DRVA 3O1UA 1NUKA 3MLJA 4FPLA 5GLZA 5A1LA 2NZ9A 5T5PA 4QD2A 2W46A 5JMOA 1JYVA 3MW3A 1K12A 2XQRA 4M4RA 2AREA 2DU1A 3ZXJA 1H1AA 2OUJA 4P5YA 3UL2A 5GLWA 1VBC3 2ZGPA 4YW5A 1VE0A 5C5UA 3KT4A 3H8UA 1ZRCA 3S57A 2NP0A 1HN1A 2BWAA 4CDUB 1OT5A 2YB7A 3GBFA 3CKHA 4D6RA 4MLOA 3ES1A 2Q8CA 3BI3A 4QPYA 3POGA 1ULDA 4HL0A 4NRQA 4FPJA 5K0UC 1QU0A 1ST8A 3I2IA 4IDZA 3K3OA 3DYMA 3WF3A 1ZZ9A 3AM2A 4WM8C 1MS0A 3ZFGB 2ZGRA 4UW5A 1LCLA 1Q8PA 1QJY3 4N90A 4WM8A 1OXCA 2WQ4A 3R4DB 1W8ZA 5DUXA 1D4VB 1NE4A 2W08A 4OCTA 3AZWA 2KD7A 4LOTA 4CCJA 1WA4A 3BALA 4FAGA 2BP6A 3SH4A 4XC9A 2XDVA 3FLTA 1GZTA 4OULA 4X6QB 4W8JA 1OD3A 2DTWA 4Q1RA 3RPQA 1FMD1 1PZ8A 3AZVA 5FYVA 2WO7A 4A6OA 4Y1VA 4LA2A 3VD7A 3ZPYA 4UYBA 3T4VA 4NWVA 1IPSA 2R16A 1JOJA 3DXUA 5HCBA 3ZXGA 2A6WA 3BPSA 3M3QA 2WSUA 4I0BA 1CR7A 3SLIA 3ME2A 4YVSB 3VDBA 2CY6A 3KT1A 3HN3A 4O7XA 1W2UA 4QQOA 5FOJB 5C3SA 3WD5A 3N7KA 5FMDA 4B8EA 3ON7A 3K51A 1STMA 4QX3A 3ZXDA 1CZSA 3I8TA 3FC0A 3GGLA 1QJU2 1YQ8A 2PHFA 4YG3A 2ILMA 3TBDA 4CDQA 2QQOA 2DDUA 2B9VA 5FZOA 2FDFA 4MXWB 1PVXA 1LOFC 4PDWC 4AI0A 3DKQA 5JOXA 1YIFA 1X82A 5FWEA 3BPZA 5LY2A 3H8OA 2WFF1 1ENSA 2E32A 3HR9A 5JXJA 2VD7A 3B93A 5CKQA 4B4PA 2ZMKA 1WUVA 1KD7A 3LAGA 2EF6A 4C0HA 1SFYA 3VDDA 4QM8A 1EV13 4EQVA 4XBQA 2ZGQA 3TAYA 3ACIA 2WFPA 1J59A 1JBCA 2CU5A 5FTTC 4K40A 4JHZA 1RUC2 4NR1A 5DXDA 5J98B 5L73A 4EE2A 1MZ6A 3OEAA 5J3UA 4DEQA 5FK7A 2YHJA 1NYWA 5JZGC 1RTVA 2HWE2 4Q4X3 1W6NA 1UU5A 2B9UA 5DAPA 4Q29A 2BNMA 1RVF3 1EAH2 3J8F1 2ZHNA 3UKVA 1PMHX 1NY72 1S0JA 3BU0A 3EYPA 3UKNA 3DXTA 2IXKA 3CJIC 1A8MA 4DUVA 4DXRA 4O9EA 4SLIA 4LA3A 3M3IA 4P00B 1VBA1 1LTEA 2WYSA 2MHFA 4AI8A 2HWF3 2QZ3A 2XBO3 4K3UA 3BTZA 5JMCA 2QTWB 2FD8A 4XJWA 1WA6X 1VMJA 4L0PA 1ZZ8A 2X53S 1MZ5A 5EZWA 3UNPA 3QH6A 3QCWA 4P9GA 5GLTA 2PHDA 2R1BA 1COV2 3NMBA 4BQYA 2CAUA 2LUWA 2ORZA 4JKKA 5EIYB 5L7OB 2ID4A 2RS51 3VD5A 1UU4A 3WW1A 3H42B 4LBQA 1XYPA 1UYPA 5H9RA 3O5SA 1LGCA 5FYMA 3ZFEA 2ZX4A 1ENQA 4AFMA 1VB4A 3GYDA 4HVRA 4M4PA 2BBVA 2ZMLA 3Q8CA 4W6YA 4CDXA 5D8AC 1F31A 2GMMA 2HEVF 5F3IA 1AL0G 5LK5A 1BEV2 2D97A 3HQRA 3WG4A 3TEYA 1DGWX 1H0BA 4Q2FA 5CVRA 2I2SA 3SEEA 2WS93 4TXWA 1HN0A 3IM0A 5D8AB 1AR61 3AZYA 4RN5A 3CQOA 4TZDA 4XAAA 5A6QA 1AR71 1ZNPA 3WP4A 4I0AA 3DGTA 2X8KA 2DFBA 1NZCA 4RR3A 4WBBA 5FP8A 2BBAA 2JG9A 5GZFA 1BEV1 3RMXA 5JXHA 3BUCA 3VZMA 2AEYA 1FV3A 3OY8A 1GQGA 3PHMA 3J7NA 1PO13 3UYJA 1R1A3 1KEXA 2J1EA 2WAOA 1RUD2 2C9AA 1RUH2 1AR72 4CDWC 4DMIA 1D4M3 1NCQB 2OKXA 2DBIA 4DQAA 3N4MA 2B46X 2JDPA 2C9KA 1D0HA 3G6JB 4UOJA 5FZLA 1QIQA 1XYOA 5ANQA 5F3GA 1G6NA 1SLTA 4BQWA 3MGUA 5FP3A 4LHLA 1AYN1 2GP3A 2YU1A 2BNNA 4V1PA 2RDQA 1RL3A 5F2WA 4CCMA 5F37A 4O65A 1WLCA 4BXFA 3BU7A 3Q8AA 4LTAA 1JZ7A 2NPIA 1EYBA 5JOYA 2GNBA 1H4GA 2ETEA 3T0DA 2GMEA 1NX9A 4RHV2 4BH9A 4H2AA 3LB9A 5DAWA 3ZO0B 4X8NA 1R1ZA 5F5QA 5IW0A 1W3XA 2WT2A 2YZ4A 3NVCA 5J36A 3O0XA 5KXEA 3VV1A 1Y4WA 1DDLA 3NV3A 2WFF2 3P3NA 1IHMA 1YYNA 4GJYA 5LW9A 3KQ4B 4IGPA 1MEC2 5K0UA 4GB33 2P17A 1RUE3 1IS6A 1GWLA 1KFXL 4CCDA 1WMDA 4IGOA 3VBFC 2VR4A 2RS31 4URAA 2XPJA 1BK1A 3K2OA 2ZZJA 3KVBA 2PHXA 1H9PA 4LUMA 4YW3A 1YFUA 2ZOEB 2L9LA 1OQ1A 5FYUA 1CJDA 2JKBA 2JDAA 5E1RA 1XE8A 4N53B 5FY0A 2A6VA 2DUOA 1PVC2 3POFA 4R9CA 1YQ2A 1LNSA 2RR11 1OUXA 2BVVA 4IEXA 4D6SA 3KCXA 1N1SA 4LQRA 3AMPA 4N53C 1UYYA 2VOVA 1ZYBA 3K4AA 1RHI2 2R7EB 4JVAA 1QY4A 4UFKA 3E6CC 4KL1A 1LJ7A 4QQHA 4Q4Y2 4XYXA 3N9NA 4OLLA 5BNOC 3MFCA 3PJYA 3SXWA 2D93A 1DCSA 1I6XA 2RR12 2WWUA 3I4IA 5FKCA 3SH5A 4B3NA 5J7MA 1SACA 1RUC1 4CCKA 5A6XA 1JHJA 2VQTA 4FOYA 1H2LA 4XFGA 1SLLA 4D7YA 1LGBA 2B4KA 5LB6A 4F3JA 1V6JA 4ZZ8A 3VD9A 4EN0A 2VOKA 3ZN6B 1GQHA 4MHUA 1P8JA 1D2SA 4FCAA 4H3WA 1TNRA 3OGRA 3QH7A 2ZX3A 4RHV3 1RUI3 2W1QA 4AHYA 2JDHA 1RUH3 3RZGA 1W9FA 5HXVA 4GA9A 3BTXA 1OMIA 4IV1A 1GP6A 5IVCA 4LKEA 4IV3C 2WA4A 3VL9A 4FPEA 2BOIA 2A73B 5IWFA 4AZZA 2VQUA 1MS4A 3ZDSA 3ALQA 3I7DA 3INAA 3TEZA 3V0BA 3OPZA 4M3CA 1UKRA 1VBB3 3NKGA 4FTBA 2Z2SB 1AR62 4XQ4A 2QQIA 4XJ8A 4F8AA 5A7SA 5FZBA 5JVVA 4DB5A 2Q4SA 3WDUA 1C1FA 4DY5A 4OUMA 1UY1A 3ORJA 5L9BA 3CJIB 4FAHA 2QJVA 1XE0A 2XLFA 2EIDA 2RM21 5FZ9A 1H1MA 4P9XA 1TEIA 4NHMA 4Q4V1 4FOQA 1OPOA 2K46A 1YJKA 3DYOA 4YGEA 2J22A 3ZR6A 5AC91 5F9TA 1C8M3 2YUEA 4OHYA 1YHFA 3RYKA 1QDOA 1RUD1 3POEA 1X33A 3ZKUA 1JYTA 4H7MA 4Q0SA 3B94A 2HEWF 4YW6A 3JU9A 4V2WA 3KGLA 4LK7A 4Y26A 4XF3A 1OUSA 3HIFA 4LBKA 3H7YA 4K9SA 4ASKA 4ZS2A 5F5AA 5C3QA 1W03A 5BNNC 3OGJA 1V6OA 4QB2A 4EJRA 2EIBA 1Q8VA 2YFUA 3PMSA 2UYAA 1REFA 3POSA 4LKFA 2VZOA 4L11A 2BV4A 5DAVA 4YW7A 5GLUA 3ZXLA 4YLZA 2HWC3 2WNOA 3AXDA 3GBWA 4JKLA 4WV8A 5BPXA 2VZSA 4HK9A 2F4PA 3WXPA 1JZ2A 3I2OA 2GNDA 5CYYA 3SNMA 5FQ0B 4XABA 4RGKA 3RG0A 1LHOA 3AP4A 3C7OA 4A3ZA 4AEJA 5KXCA 1WCUA 5JXIA 2B39A 3ZXEA 3O1RA 3I3DA 3AMHA 4UT5A 1ZRFA 1RUI1 1NZIA 2JD9A 1W0OA 2WBKA 3WNLA 2XJVA 4CU8A 1OPMA 1UZYA 4E2SA 4KU7A 1UOJA 2JB4A 1VR3A 3UGFA 2BDRA 3F2ZA 3FL7A 4R4XA 1UL9A 2VZQA 3HNBM 4YZ3A 3S7EA 4CEWC 1LODA 2Y8KA 1RUC3 1CQ9A 5CG9A 4LBJA 4Q27A 2ZEYA 1CESA 4YVSA 1MVQA 2ZAAA 5L9RA 2QQNA 3LOBA 1UD1A 4XFBA 5A3WA 4RHV1 4KNCA 3AFGA 1AL21 4PBOA 3WNXA 4BU2A 3EQEA 3JD73 3NSTA 3NJYA 5JIUA 4XHXA 2OPKA 5EV7A 3I3BA 2DUQA 4RQPC 4CSWA 3DUIA 3HT1A 4XZUG 1UIJA 3LOIA 5C71A 5A3NA 4J6GA 1TE1B 2JE8A 1VAVA 5IATA 4WVWA 2WC2A 1RC6A 4RQPB 1DG6A 2NM1A 4CP0A 2QNKA 3IN9A 5I93A 4JQRA 3WQ0A 2BNOA 4B4QA 2FCTA 5EJZB 2FDGA 3NNGA 3POJA 4HSJA 5KR7A 4U36A 5FZEA 2CGOA 2JE9A 2VMDA 1PVC1 1OKOA 2RR13 3QBQA 1URXA 5KHHA 3GBGA 4O9GA 4WVZA 1OLME 1GFF2 2XHNA 1DF0A 4Y1YA 4LEJA 4NRPA 4BMBA 1OI6A 3H1YA 5FZGA 1YXWA 3I2DA 4HANA 4IV1B 3VBFA 1B35A 4XEZA 5IK4A 1TME2 3ECQA 5A1AA 4GWMA 1MZEA 3AP5A 5BNNB 4LHNA 1XNCA 2VCBA 3WV6A 2GAUA 1N1TA 3D8CA 1MQTB 3GZAA 2ZEZA 4JTOA 3GZEA 4RS5C 5I8YA 4CDQB 1ACCA 1VALA 2XBO1 2P6HA 4AFDA 3LZZA 5EJ1B 1QXRA 1OBNA 3L2HA 3WF1A 2RM22 3ZXFA 4A3XA 3ZYJB 3D3AA 4TWTA 2VCCA 5AVPA 4Q4V2 4CDQC 5J37A 1LOGA 4CUCA 1RYYA 2GNTA 1JZ5A 1GZCA 2Q1FA 4YZ4A 1MQTA 1R1A1 2CGNA 1EUTA 2ET1A 3POYA 2B42B 1O4ZA 4QGMA 1AR93 1XSRA 4D94A 3ENRA 5F7UA 4Q4W3 1XYNA 5A80A 5EJ3A 4HOOA 4R8HA 2BWCA 5GZGA 4IL7A 1F5JA 1JUHA 4E2GA 1REEA 4BQXA 1RUJ2 1N3QA 2D3SA 3AMQA 1OOPA 1HW5A 3ILNA 3MIHA 1OC1A 1QHDA 3WSOA 3ZXAC 2GC2A 2P3KA 4LLOA 1JHNA 1EP0A 1DQ6A 1UMZA 2VCAA 1UN1A 4K7JA 2DTYA 5F3CA 3UJQA 3RZLA 4IV3A 4DXZA 5KBFA 1AYM2 1V9U2 1BVVA 2IXHA 3AJYA 3V0BB 4JDNA 2W2IA 4AGRA 2V4AA 1RUI2 1POQA 2JG8B 4PIXA 5FZDA 2R042 1CGPA 1AYM3 1V9U3 4JRAA 2A71A 5E6HA 2E63A 1AR63 4YM3A 1VBD3 3E5QA 1BHGA 1A8DA 2RE9A 1HJFA 5A7WB 2LM3A 4AI3A 1TZOA 1GP5A 4BCUA 2WNUB 1JMUB 3BTAA 4E4HA 4HXCA 3MIDA 5DDJ1 3EHKA 3KMHA 3POWA 4DOUA 4JC1A 4XJAA 3VHOA 2OXBA 1N1YA 5EYXA 2G9FA 2X5IB 2WLPA 2HWF1 1E5SA 3VL8A 3JD72 1JS9A 4CDXC 5FJHA 2RS53 3DPRA 5DDJ2 3KCCA 5A3OA 4XW3A 1XRUA 3ROUA 3QACA 4YG0A 5F1RA 3VBHB 1QJY1 4QQPA 4PF1A 1RMU2 4AVAA 4CTEA 1ND3C 3S30A 4XF1A 2XVKA 4YW1A 3VGIA 2HWF2 3WF4A 2AC1A 4BISA 5CADA 1Q5OA 1ND3A 1U5ZA 2QQUA 3TYJA 2Y0OA 4N8MA 3JB4C 1AX1A 3TOJA 2YC2A 1AJOA 4XHBA 2OQ7A 3OGVA 1GZ9A 1RMU1 2QQVA 3FBMA 4XUTA 2CAVA 4CP9A 4DO0A 4PLMA 2AZ5A 2LTNA 3MBWA 4YVSC 2B45X 4ASLA 1H6YA 4AEKA 5E89A 5FO9B 1RITA 5H9SA 3V56A 3KHCA 1DBNA 5FPZA 1NXMA 3S6PA 1V0AA 1YI9A 3U14A 4MGTA 2KXLA 4BXSV 4LIVA 4LPLA 4LHKA 3HD8B 1IS5A 5IUQA 1XC6A 3KVAA 5CU1A 4WZFA 2YPDA 2E7TA 5H9PA 2EAAA 2C1FA 5IVBA 1Q56A 3O0WA 2VG9A 4FOWA 4QGNA 1GOHA 2EXHA 4AHWA 1CX1A 1AR83 4G3YC 5FUIA 2FMDA 2ZGTA 5HXMA 3LEIA 5ANNA 1SLAA 5AFBA 4NIAA 5LA1A 4Q4Y1 2JKXA 1F5FA 1KDKA 1MS9A 1VRH2 2VNRA 4YFZA 3I2JA 5FZCA 4E4DX 1S0CA 4QKDA 4AFBA 1WLWA 3SCFA 4IE7A 3IWZA 2NN8A 3VN4A 4BZ4A 4M3CB 5CFCA 3AMMA 1E5RA 1H8TC 3OJBA 4RFT0 1UY0A 2ADDA 4U2AA 1F4HA 4Y5SA 4XBLA 2Q30A 4FFFA 1NCQC 2HWB3 5JZGA 3B02A 4Y5TA 1CVNA 3W58A 2ZPXA 3VBOA 5LCWL 1Q43A 2UY8A 3NV2A 1IKQA 1YO8A 2Z5WA 4QWNA 5ERLA 1WD4A 5IVYA 5JZGB 1H30A 4N43A 5FPAA 1SFNA 4QQ2A 2DU0A 2XBO2 2R062 4RR3B 1SG3A 1G9DA 4UF0A 4NAMA 1U5YA 2VW2A 2DF7A 4OFGA 4Q8LA 2YGMA 4FPGA 2WQZC 4KWKA 2ZGKA 1D0GA 3MV11 4BPZA 2WA3A 1NT0A 1I3HA 3VHPA 1IG0A 1HKDA 5JCTA 3R0RA 3BN6A 5IK8A 3LA7A 2HBUA 1IS3A 4CE8A 2EXJA 2UYBA 3CEWA 3H1MA 3AYCA 4M01A 3TRSB 1MQTC 3NJZA 2VW0A 2Z79A 3SCHA 1FATA 2X05A 1W9YA 1F9KA 1VAMA 2JDKA 3WNKA 5CEHA 5FPXA 1CD3G 1DLCA 3ZXKA 3PVBB 2NMOA 3SHRA 5CFCB 3VDCA 5L36A 3WF2A 4UFHA 2Q8OA 5L7OC 2GC3A 2I07B 1J1TA 3HJRA 4G9SB 1W8TA 1VBC1 4KI5M 4JAAA 1I5PA 1HRI3 4JDMA 4A7KA 1YFYA 1Z7S2 4QAWA 1RUG2 1CJPA 3BIWE 5L7OA 2P3YA 3ILRA 1W6PA 2SLIA 4RL7A 5CNAA 1AXZA 1VPHA 2DYCA 2FMYA 1PIV2 2XKOA 3JD71 4YW4A 1UZ0A 3SEPA 5F3EA 1AL23 5TSWA 5JR7B 3VDDC 3LFMA 1GUIA 3CO2A 4A41A 1W04A 2VL4A 3RZZA 4UFIA 2XHKA 2RS11 4HKWA 4I09A 1OURA 3WDWA 2O8OA 2QFEA 3T1LA 5F6LB 5C6CA 5JAXA 5J96B 2O14A 4OZOA 1FX5A 3RRDA 4A6SA 4JGYC 2BGCA 1POV3 3FN9A 4YRDA 1PGSA 5T50A 4OQ9A 4X6RB 3J26N 2CTVA 1X8EA 2NLRA 4BLJA 5FPVA 3GM8A 3MW4A 5FYHA 3JBG2 3I59B 4IEOA 1V00A 4LO7A 3AYEA 3AX4A 1FNYA 4XCBA 3UT0A 2R49A 4DXTA 4E4ZA 1QXJA 1TVGA 2MPFA 4E8DA 5AFEA 2P37A 4YGBA 3OPWA 3T0BA 3AYDA 3POIA 5I0UA 2OT7A 4ZU4A 4YYOA 4HT1T 2XOMA 1A34A 1QH6A 4KQ7A 2CDPA 4PBPA 4IE5A 4XUPA 3HEIA 1HXS3 2JDUA 4QHZA 1S2BA 5FV3A 2F17A 1DGRN 3AC0A 4Q26A 4I30A 3JCIA 3WCRA 4PQQA 5FY1A 1VLNA 1K5MA 1OLRA 4KWLA 2D6KA 1Q3EA 4EROA 2X5IA 3MF6A 2F4LA 1WLTA 1F15A 3WR0A 2VW1A 3B7MA 1BXHA 5CFCC 3NW4A 4IE6A 1ASJ2 3WNMA 2A3YA 1B35C 3ZMNA 1NKGA 2ZKNA 4I0WB 4LXLA 3GZUC 4PCRA 2XJPA 4QMAA 4BHPA 5KC5A 2WR9A 4TYSA 3WG2A 1XNDA 4A45A 2EXKA 4IEPA 5FLIA 1C57A 1S1AA 1W8UA 2Y34A 4NVPA 4XOGA 1B35B 1DQ4A 2GNMA 2OS2A 3L2YA 4HVOA 3O1MA 2V5YA 2NYYA 2R0HA 1W2OA 3OGGA 2BFUL 3T2TA 3H3LA 2WT1A 4GMP1 4XTPA 3ZSEA 3CZUA 4C1XA 2V73A 1VJ2A 1YEWA 2BTVC 1ZVFA 4LHSA 4XACA 5DZFA 5A7QA 3LFIA 5KC6A 2Z4FA 4ATFA 1ND2C 1AZDA 4Q0VA 5DPNA 3ATGA 4GH4C 1NCRB 1A6CA 3VBHA 4PLOA 4OI1A 3VKMA 5A3TA 2WWSA 5JSPA 4JGYB 2OZJA 4I02A 3THDA 2FDKA 5SV8A 2E33A 4N7UA 2K0GA 4FT8A 1LB2A 3FHIB 1LU1A 3IDBB 4YFWA 4CDUA 5CISA 1OVSA 2C0ZA 2F6BA 1DQ0A 1KFUL 4HG6B 1YI7A 1XU1A 1W9TA 5F39A 2PHWA 1RUF3 1W0NA 2HWE1 3WW3A 2W1UA 3SISA 2UWAA 1ENXA 4K6BA 5IVJA 1HXS2 3N3HA 3U78A 3VLBB 1NQDA 3THCA 1VBC2 4PJYA 1H1IA 3T08A 1HQLA 3FUQA 4YPJA 3QOPA 2XUEA 2XJRA 4ITCA 4CCOA 4M0HA 2C6SA 5FYCA 4AQTA 3U75A 2JG8A 3VBRB 2VZRA 3TN91 2JWPA 2VM9A 4XF4A 5DUVA 4N9IA 5I8TA 2PAEA 2DVFA 3BIEA 2ZMNA 2JG8C 2DVDA 4COVA 3PUAA 4DZGA 2VO5A 3B9IA 3LDRA 2VZTA 3THPA 4IV3B 1H2KA 4IESA 4QQLA 2ADEA 1GMMA 4CU9A 5JR2A 1S55A 2J7MA 4Y1ZA 1NCRA 1OD5A 1MVEA 3K77A 1CIYA 4MZUA 2ATFA 1SFPA 1T2XA 5IFTA 4RS5A 3WP6A 2VUJA 3PUHA 2RS33 4AEMA 4NRMA 1IPJA 4Q0QA 2TNFA 3TB0A 1RUE1 3FE5A 3WCSA 1O3SA 1JU3A 4IE4A 1DGLA 2YC0A 5FZIA 1EPZA 2W1SA 5LA0A 1TNFA 1DZRA 4EWAA 4ARXA 1L7RA 3M3OA 4N9HA 2CHHA 1BBT2 1F2NA 2Y33A 3N7JA 4PDWA 2Q8EA 4HVQA 4GIQA 1OVPA 5FZ8A 3KGZA 3VBSB 4YG6A 3VBHC 2VECA 2FDJA 1LOFA 3AFKA 3IAQA 4JZRA 3CDZB 2DVGA 2FZ2A 3SC7X 3PIJA 5FOBB 4LBOA 2VUDA 2EVXA 2OZ6A 4YM0A 4RQPA 2A70A 2MNGA 4QXBA 4UXAA 3NNJA 1DYOA 5I0RA 2FDHA 3N7LA 1W0PA 1W3VA 4D8MA 2JE7A 3PU3A 3J7MA 4QX8A 5FPBA 3D82A 4AVTA 1LAJA 2P2KA 3IIAA 1HQWA 1SPPB 1Y9QA 4HKLA 5I91A 2EICA 5FKBA 2FHRA 3O0VA 1J3RA 4P9JA 1QOSA 5IAVA 3P3PA 4HZFA 5EXOA 4RS5B 1U12A 2Y6FA 1PO21 3CJIA 3EO6A 4HKOA 1OKQA 3FFZA 1YFWA 3WZ1A 4DFSA 3ZVXA 4AI9A 1PO11 2WNVA 3POBA 3B5LB 2C26A 2GMPA 2E26A 1WCDJ 1ASJ1 5FZMA 2R30A 3QLQA 1CAVB 2E53A 3USUB 4Z2AA 1QF3A 3RYPA 1BEV3 1NLQA 2XJQA 4DXSA 5BXXA 1YCIA 3QD6A 2JEMA 4XURA 1J83A 1BJQA 1JW6A 2ZBJA 3OBAA 4UWDA 5DAQA 5ACA2 3RZMA 2MEV3 4QPGC 1JZ8A 4BLIA 1CWPA 2AEZA 2BRTA 1EAH3 1GZWB 1VRH3 4GALA 3LEGA 5B4NA 4CXXA 3KV5A 4PLNA 1ZA4A 4P02B 5LY1A 3ZN6A 3TNPB 5A7PA 1EV12 4XDOA 3VBRC 1PZ7A 3O14A 2AACA 2HLEA 3FX3A 1LR5A 1MEC1 2ARAA 2VMHA 1JU4A 2WAAA 3MEPA 4JV4A 3BKZA 5FRAA 4OHZA 1U5IA 1UU6A 1R091 3DPRC 4JKMA 3KWVA 3FZ3A 2YPJA 4LKDA 1CAXB 2GP5A 2XVGA 4E9KA 1VRH1 1HQNA 3H1WA 5JLVA 2VZ3A 1R093 2LRPA 4OVEA 1VBD1 4CXYA 2MEV1 2Y6KA 2B5HA 5CG8A 2CL2A 1ZRIA 2YDEA 2H0VA 1F35A 1RVF2 1HX6A 1J3PA 4OMCA 3OEBA 4UBGA 4AHZA 1WZXA 4NMIA 1O4YA 3LA3A 4PQ9A 2Q1ZB 3SCGA 2O0OA 2CSGA 4AAXA 1ULPA 1SQ4A 1H9WA 1MPXA 3MFAA 1SBFA 1ZBE2 2DCYA 3VBSC 5JPMB 1US2A 3W5NA 1UQXA 4GWIA 2VOWA 3LE0A 3KZ4C 5KHIA 2VBDA 4D3WA 1SMVA 4QDRA 4E27A 1HJGA 4UFLA 4GQ7A 3K75B 4YZ2A 2WKKA 4GWNA 4XTMA 1ZZ7A 5G04L 3ETPA 3UGHA 1VMFA 5FP4A 3P5BA 4AYUA 5I0TA 3VBUB 2DUPA 2D44A 1C4RA 4AQ2A 5KHKA 1ASJ3 4M3CF 4Q4W1 4UFJA 1LESA 1AR91 2GH8A 2VTFA 4GH4A 4Y20B 4Y33A 4P08A 4ZS3A 3N36A 5JXGA 1BVP1 4LO8A 3SH3A 3IMNA 3PJQA 2XGXA 3LD8A 3NAPB 1OH3A 5A7NA 5BYNA 5IYYA 3KQRA 2JDYA 2RS52 3ACGA 4ZU7A 5DG2A 1TMF1 2VNOA 5LBCA 1XB9A 4W4ZA 5LBFA 1NY71 1ZREA 2QZ2A 2WLQA 3AXEA 5KHJA 1WBLA 1O8PA 2VNVA 3NAPC 4LR4A 1Z7S1 3VZOA 1MS5A 5C8CB 5DN2A 4BQ2A 5JSRA 1A3KA 1OOPC 3I59A 1ZZ6A 3IPVB 4ORFA 4R52A 1W8NA 4XE9A 4JGYA 5FR3A 2HWD2 2XLAA 2PA7A 3LQCA 1NCQA 1IKPA 1VBA2 2IXIA 4HLTA 1WBFA 4KG0A 2VBBA 1DGRA 4LORA 4LT5A 1CONA 1UPSA 4Y20A 1Q8OA 4CZSA 3LIGA 3ETQA 5LBEA 4NOTA 3PVOA 4GMP0 3LCPA 4ISRA 3ITQA 1UZWA 2W92A 1UMIA 1H8TB 1BKZA 3K4DA 3PVNA 1NA1A 3GDBA 4NWWA 3T1MA 1OF3A 2GC1A 2ZEXA 1Z0HA 4EN9B 2ZGMA 2HYXA 2VC9A 1ODMA 4FVVA 4FQ4A 2VE1A 4C0BA 2XH6A 4JQTA 5HV0A 3MZHA 4XBNA 2P3IA 3D6EA 1GNZA 2BJSA 4CCEA 3KT7A 2A75A 3KV4A 4CP9B 3B00A 5ACA1 4CDXB 5FWJA 1Y7BA 4R9AA 2PXJA 3W9AA 5EWSA 3ZLIA 4CCCA 2HJIA 5T5LA 4WVMA 3KM5A 5FPLA 4XF0A 3ZFEC 1BZWA 1ND3B 1ODNA 1UPIA 4DUWA 1UOBA 4S2DA 3HT2A 2X5IC 3E1F1 2Y6LA 1F8VA 1ULGA 1VIWB 4NIGA 2HH9A 3HPNA 1RUOA 4CPBA 3KCYA 5F6KA 5LRSA 3PTYA 4B7EA 1UZZA 1R64A 4MYEA 4HMZA 1NOVA 2AGSA 1YQ5A 2W3JA 4LO4B 3OY8B 1RINA 3E5XA 5LA2A 3WVJA 4ZONA 4Z92B 4WVMB 1YJLA 2E7QA 4OI0A 2H6BA 5T5OA 1XU2A 2DVAA 2JIGA 1LHVA 3WEZA 4DINB 2JIJA 1VBE3 3ZX7A 3O1TA 1JOPA 2XL9A 3ILFA 1ZX5A 3LA2A 2P34A 2JDNA 2JECA 3LDKA 4I01A 1ND2A 1S0BA 3E6BA 3T0AA 4BIFA 4IEYA 1IZ3A 4A7YA 5C8CC 5A6YA 1AL22 1AVBA 1HV0A 2RVAA 3C7EA 3LPGA 4OZXA 4CU7A 1IGOA 4XZPA 3LEMA 4CUAA 2DCTA 4P9WA 3KD4A 5FZ7A 3S5AA 1MR5A 3HMYA 2J1VA 2HWC1 4RGAA 1J84A 2D7FA 2Y6GA 1CAVA 1R092 1OHFA 1MS8A 1SHWB 2IZWA 4LBQB 3VUOA 2VUAA 1QMJA 3TEWA 2WNVB 3N9QA 3ACLA 4LITA 1JYIA 1JTZX 4FPKA 3NRUA 4LNVA 1ZRDA 1YQ6A 4OHWA 2B7YA 2Q8DA 3ZYPA 3S0MA 2CWMA 4CEYB 3M7AA 4BM8A 1K5MC 2D3RA 2QVSB 2VTXA 3OF1A 3AP6A 1UZVA 4ASMB 2AH2A 4ZPIA 2IC1A 3MIGA 3TN93 1C8M1 1B09A 1KITA 4CA9A 1DZTA 2D6PA 2VVFA 4L9BA 4Q4V3 2LW8A 1K5JA 4XFFA 2G9GA 3UETA 4A42A 4ES8A 4B4RA 2RM23 4CDWB 3MDPA 1IOAA 2YROA 3PNAA 1DYKA 4HPKB 1TME1 1HXS1 3IDCB 4HFSA 4OYUA 3A7QA 4AK3A 2V09A 4WM7B 4AXOA 2YBPA 1ULOA 4BE3A 5C70A 1M06G 4MVTA 3UGGA 3OBRA 2EIGA 1WGPA 2RDNA 5IAXA 5ISLA 2YC4A 3B3QE 1VBB1 3CJXA 3IBMA 4LBNA 1XOYA 2A6YA 1C5HA 1RHI1 4K8RB 1G9CA 2WT0A 5FYSA 4K20A 1ULEA 5GZCA 1DU3D 2V4VA 3EJKA 4QDSA 4OI2A 2ZGSA 5FXWA 5L19A 1XJAA 2YV8A 3B69A 3H8XA 4EWDA 1OQEA 3BOWA 3T2PA 5KWRA 3OTFA 2NMNA 4E4SA 1GZWA 1Y43B 4ARYA 3VKNA 3WDXA 1FPN3 2EXIA 2WZR2 5FMBA 2QKDA 1H2NA 2BVBA 1LOEA 1G9BA 2IFWA 4S2HA 4EN6B 2WIIB 3AJZA 2XONA 3FUOA 5F2SA 3WUDA 4GMP3 1BLZA 5APAA 4ZU5A 2YG0A 3MUZ1 1X7NA 2VMFA 1DQ5A 4NO4A 5EYYA 1V6IA 2V72A 2RS13 2EIEA 5FZ1A 4DPNA 4YARA 4F7ZA 3WF0A 1SEFA 1O3RA 2V5DA 2VMCA 3VDDB 5LWBA 2C5DA 2K9ZA 2Y0IA 3GHMA 2QQKA 1SBEA 2DURA 3WOGA 5HPOA 3U4SA 2P5BA 1ZM1A 4AAPA 5FBJA 5JOZA 4MGZE 3WP5A 2WNVC 1UOGA 1EPWA 1PGW2 3N9LA 2WDBA 1WMXA 3HWJA 1AXKA 1LU2A 1S4CA 1X9PA 1LECA 4LOSA 1GNHA 3N9MA 5DQ0A 4ZXEA 3J7LA 4Z8BA 3KB5A 5FMOS 2J1TA 3LF7A 1NCRC 4NPLA 3GNEA 2WINB 1MS3A 5FK8A 1DP0A 5F5IA 2P1BA 5EPAA 1JYNA 3AVRA 4IXLA 3B01A 2R063 4YW2A 5T5JA 3VDAA 1CPMA 3U07A 1NG0A 3IDEA 5E88A 4Z2WA 3H9AA 3APBA 3U10A 2JDMA 4AF9A 1X36A 4FPOB 3LDBA 4PI0A 3VB9A 4XDPA 1JUIA 5CFDB 2H6CA 1AHSA 1PMIA 3AP7A 1REDA 1Q8SA 4NHXA 4YVWB 5K9YA 4UW4A 2HKXA 3BB6A 1QOTA 4V2VA 4IE0A 4GXLA 1WLDA 3LPFA 4QKNA 5K8SA 4XUOA 3CZJA 5HCAA 2DBNA 3OBZA 1ZZCA 2R1DA 1SBDA 2OA2A 3ZDVA 2W39A 4WM7C 3AKQA 5KXBA 2RS32 1RXGA 1IQAA 2HWB1 2K2SA 4LK6A 4BQ3A 2RMU1 3CHXA 4Q1PA 2QQMA 4YGDA 4FPYA 2QUOA 4FP2A 1FV2A 4W50A 3DECA 3GCXA 1U5XA 3OYWB 3N9OA 5BY5A 3C7GA 3MLLA 4A44A 3HAGA 3RGBA 4OQ8A 4A7ZA 2Z42A 4LBMA 5HCHA 4GAZA 5GKAC 2TEPA 2YY1A 1C8M2 2A1XA 3ZOIA 4ZHNA 1JODA 2ZHMA 5ABJB 3LIHA 3B9CA 4QT6A 2GSYA 5E8AA 4J25A 3KLSA 4KU8A 4MG2A 3ELNA 3IT8A 4AG4A 4ET7A 1UCXA 3ZFFC 4XIOA 4IGQA 1HRI1 1QNWA 2JENA 3FBYA 5A7WA 4COZA 3GJBA 5IK5A 3F95A 4LMFA 4YVWA 1QJU1 3RJ2X 1O8SA 1HB1A 1RMU3 1W2NA 1AR73 2ZABA 5C9AB 2UWBA 2A3WA 2R32A 2UU8A 3VHNA 4JTNA 3ZFFB 1GP4A 1QJZA 1GLHA 4YWAA 1CX4A 2D6NA 2RJKA 3LSDA 3RWKX 2ES3A 3HBZA 3ZFGA 1QNYA 5B4XA 5IJRA 3ZYIB 5HI0A 4FP3A 2VJXA 4OMDA 3UESA 1RJ8A 1DYPA 1ZBE1 4AQSA 2ET7A 2C24A 4QPGA 3UK9A 2YFZA 5IHRA 4MXVA 5A1FA 4OHVA 2EALA 5DZEA 2DV9A 3PMEA 3W59A 4XFHA 4EZ4A 1HRV3 3PVEA 5EHDA 4LKSA 2WABA 3VBRA 4XQDA 3PLQA 5C3OA 5LATA 3ZN4A 3RZKA 3D0SA 2IVIB 3WDTA 4L2NA 4YSFA 2RJLA 5GJ6A 2WZEA 4MGKE 3ST7A 5D2AA 1AR92 1JXNA 1W06A 4KGQA 4DIQA 3WINE 1SZBA 3IKWA 1CPNA 1S0FA 1HB2A 3M8LA 3NWKA 1W99A 4BK4A 2YU2A 3GZTB 4AGVA 2BOJA 2PHTA 5F5CA 5FP7A 5M0TA 1V70A 4QB1A 1WWYA 4Y24A 1OQDA 3TWIA 2VVEA 2E7AA 2BYVE 4LUKA 3IDAA 5A3PA 3MO4A 2J42A 2Y38A 4LULA 3USSA 3N35A 3A0KA 2B8MA 3Q8BA 4BWOA 4GZ9A 5E16A 1FOD2 1HRV1 2JICA 2ZAHA 3GXUA 1RUJ1 3O1OA 2R043 4PI2A 1H2MA 4XJZA 1AX0A 4CEYA 2G9ZA 2HEYF 5LRRA 2WS92 1O3TA 3RNSA 3TEXA 5IT6A 4IEUA 1AR81 3VKOA 3BODA 3WY6A 1R083 4R9BA 1Y9GA 2JD4A 4H14A 4A2UA 1G9FA 2VCMA 3VBFB 3O1VA 3WLUA 4YM1A 4Q8KA 3AL6A 2W95A 3LKJA 4JCKA 4Q0PA 3R4SA 1AYM1 1V9U1 3N7MA 3V0AA 2BW8A 5D1IA 3GCWA 3OUJA 1MZFA 5FZ3A 1RUG1 1KS5A 1VP6A 5T55A 1MS1A 2VQ0A 1HDKA 5HBAA 2ERFA 4ES9A 2FBEA 3RI9A 3IB3A 4CPBD 5AC92 1O59A 1ZBA2 4D7TA 3O1SA 1PGW1 1RUG3 4MO3M 3D4KA 4NHKA 5FP9A 2ZA9A 1OLQA 3W21A 1VB2A 4E8CA 3AZZA 4L8QA 2GN7A 5FXZA 5C4WB 2CYFA 5A6ZA 4FPHA 1M4WA 2RS12 5FUNA 3VD3A 5CBLA 5GZEA 1APNA 1R081 1CAWB 3OG2A 2WJSA 3ACHA 3AP9A 3WW2A 5FZ4A 4Y4YA 4B1MA 2WO3A 3RZJA 1PGL2 1OSGA 3OD0A 2OUHA 4KGGA 2R041 4QU2A 2QCSB 4HN1A 5CZKA 4CU6A 1E57A 3KF5A 1GNYA 1MACA 2FDIA 1W6QA 4FQZA 2ZKLA 3ZM8A 2IWGB 3X29B 1JI6A 1W2AX 1PIV3 5FZFA 2PFWA 3KS7A 4P9YA 5D21A 2UURA 2VXRA 3J4UH 3NV4A 5FCCA 3O1PA 1PGL1 3N9PA 1CAUB 3NNLA 4XXAA 1JYCA 3URFA 1XNKA 5DDJ3 1WW4A 2A5ZA 3FHAA 3R05A 5DG1A 2PAKA 2RMU2 1LEMA 4IERA 5EFUA 4N7IA 2GDFA 5IFPA 2W47A 2HBTA 2Y26A 4P9IA 5JOWA 4Y1UA 3S5QA 1W6OB 2IVJA 2HWC2 1QJU3 2Y64A 2TBVA 1BQPA 4UF0B 1VMHA 3I49A 2QDNA 1NQJA 4BQ1A 1PX3A 5C3RA 4COUA 2I74A 3H7JA 5GM0A 4FPCA 4MGSA 4ATEA 5FBZA 4WM7A 4QXKA 2JDZA 2LS6A 2PMWB 2RHPA 2X09A 5CKNA 4YNIA 1W05A 2AR6A 2GALA 3MYXA 1FPN2 2WZR3 3JB8A 4BQ4A 4LO6B 5BNPA 2G1MA 3FHQA 5JIAA 3WP3A 1UY3A 3MPPG 4XFAA 1HB3A 3ZYBA 4RR3C 1COV3 3ZFEB 1WKYA 4DEVA 2AYHA 4AVBA 1G7YA 5IVEA 1PNGA 4IW3A 1YRZA 5GLVA 3THTA 4ZZ5A 4LE3A 1BMV1 1RGSA 4OUEA 4XPVA 5FYBA 3U11A 2PQQA 1JYXA 5FPUA 1LOBA 3E5UA 4BDVB 1FPN1 1JZ4A 1BK0A 3ZFGC 4GKXA 5I0SA 2VOXA 4IEZA 4NJ4A 1GR3A 2W9XA 2DFCA 1LKNA 1YWKA 1V6MA 3Q9OA 4FPFA 3HQXA 1C8NA 1W8OA 3LEKA 1HIXA 4FBFA 3C8XA 3KF3A 1Q8QA 1BMV2 1WW7A 5K0UB 4QXCA 5CA6A 3MIFA 4AEDC 2XQXA 3CLPA 1NAEA 2VXJA 4NPRA 1OFNA 3ZKYA 2R6QA 4J1XA 4C90A 4DRRA 5IVFA 5KHGA 3TNQA 1HB4A 1K3IA 4RGGA 1FYUA 2XB6C 2O1QA 3AKTA 4IQPA 4S2FA 4EWEA 3VBUC 1V6LA 4AVVA 3IPVA 1DFQA 2RV9A 2XUMA 3C3VA 1OOPB 3WW4A 5A3LA 1GOGA 3D5OA 4NROA 1WCQA 1ZBA1 4YGCA 5FYZA 2QE3A 3WHUA 3GJAA 3BYWA 4LLFA 1UX6A 1RUD3 1JYWA 4H7LA 2CNAA 1NLRA 1H4HA 1PVC3 3WQ1A 4CEWB 2VQAA 3RMYA 3Q8EA 1CZTA 3VZKA 3T4HB 3NAPA 1PMJX 3LWCA 2R061 2VZ1A 3A4UA 4Z1VA 1WCSA 3HN1A 4MXWA 1QJX3 5GZDA 2PQSA 3VBOC 3WHTA 4PHZA 2P4EA 2QQWA 1R082 1KS4A 3FLRA 2OIIA 1W8FA 4XF9A 4CUGA 4M0NA 4QXHA 1D4M2 3HQUA 3PURA 4GB32 3NV1A 3VD4A 5DABA 2J1AA 1XQNA 3ZMOA 5JWPA 1SCSA 2XWBB 4N53A 3ZR5A 2E31A 3OBTA 2E6VA 4RFRB 2BQPA 5C8WA 4QKFA 1WCKA 4CEYC 4COYA 3SKJE 4ZY9A 4FTEA 4FFHA 5FZ6A 3WQ7A 1RUH1 1FAYA 4ONUA 4QPIB 1S0IA 1DHKB 1XXNA 1LENA 4TLGA 4P14A 2N7GA 2UY9A 2RG4A 5T3NA 2ZEWA 1UYXA 3JBG1 4AWDA 1CAUA 4XQWA 2VZUA 4MOAA 3I54A 4WM8B 4E2QA 1HV1A 3JBG3 4NAOA 1SCRA 4R4ZA 1DGWA 3RFRA 1O3QA 1WMFA 2BPA2 1S0DA 4S2GA 1QQP3 2D40A 3GALA 1TME3 5LBBA 3CMGA 4TN7A 1GV9A 1UXZA 3M70A 5LZ6A 4INDA 1E5HA 3IZOA 4HBNA 5DAXA 3PUSA 1N3PA 3NJVA 4F83A 1C28A 1QKQA 4EN7B 4MADA 2W1WA 4C1WA 2ZGLA 4C91A 1RHI3 3KV6A 1RUNA 2W52A 4Q0UA 3C7FA 1UWWA 1W8WA 3M2MA 1N3OA 1V6KA 3RS6A 4AI1A 1C1LA 1L3JA 4XXPA 4BJ0A 3H50A 1X50A 4AR2A 5ACA3 1ALYA 1BCXA 1GYKA 2G19A 2KR2A 2O8QA 1RXFA 4MV2A 5SV5A 2A6XA 5JDBA 2YYOA 3DN7A 4GH4B 1KQRA 5FMOL 2ZX0A 3AK0A 2QBXA 3FJSA 3PDQA 1HRI2 1LHUA 3DYPA 3WNNA 3UJOA 2JXAA 1W6NB 3WUCA 5L9VA 4KWJA 1UKGA 4YM2A 2JG9B 2G4IA 5BUVA 4PDWB 5FO7B 1RJ7A 2WQ8A 4QX2A 3A22A 4W6XA 4XFIA 1W9SA 3SMHA 1ZBA3 4XCAA 5AC93 2JB8A 1Y3TA 1YC61 3VZNA 5IVVA 3BCWA 4CCLA 3WX5A 4I3GA 2DVBA 4AL9A 3KHBA 1AF9A 3PUIA 3U1XA 2J1RA 3E97A 3UV9A 4QPWA 5T54A 5BNOA 4NHLA 1YLLA 4QX0A 3MV01 1K45A 2YGLA 5KXDA 2YMZA 1O5LA 3U37A 4MHRA 4ZKTB 1UOFA 1D7PM 2XKPA 1VBE1 2MEV2 5CFDA 1Z7S3 1GBGA 2ZX2A 3JXSA 2BU9A 2KM2A 5FXVA 5FREA 1AYN3 4NUBA 3BGAA 1TMF3 2Y6JA 3CF6E 5FFOC 3ZSMA 1SLBA 3OPTA 3G7DA 4OUSA 4L97A 4BMEA 2VUCA 5FYIA 2VBPA 1GOFA 3FWEA 2BEOA 1LOAA 2W68A 5J48A 3LSEA 4K8FA 1JN2P 2VMIA 4KG8A 2WL1A 4IEQA 1CAXA 3H0OA 4HK8A 5FY8A 1D2QA 3VBSA 1LGNA 1UAIA 1HLCA 3I3QA 4CDWA 4NIDA 4DNYA 1FNZA 2D5FA 4IEVA 2D5HA 3NNMA 2E51A 4LJHA 4BK5A 2FZ1A 3K4ZA 4W6WA 2JX9A 3MI8A 2DWRA 4IUGA 4TTGA 1O4TA 4AEDA 1K42A 1S2EA 4L99A 3MLKA 2YXSA 4AGGA 1UY4A 1AX2A 1H6XA 1KJRA 1T6GC 2VZPA 5FO8B 1D4M1 1PM4A 1VRBA 2UWCA 1YNAA 2WS91 1PM7A 2AUYA 1AR82 1XSQA 2Q5TA 5CAZA 3VZJA 1JZ3A 1EY2A 1W2TA 1EUUA 2Z69A 3SKVA 2JJ6A 2VMEA 3SQOA 1IS4A 3I2FA 3MUY1 5IK7A 4R9DA 1OH4A 5C4WC 4QB6A 4TLFA 4IEWA 2OW4A 5I0DA 1G8WA 1US3A 2ZGOA 3IAPA 4K21A 2D6LX 3DEMA 1NE6A 4QHOA 2VPVA 1A78A 2Y6HA 3WDVA 5C9AA 4XUQA 1QDCA 2W87A 5JI7A 2WRAA 4PT6A 5FYYA 1ZRRA 4FI9A 1X9TA 2R073 1GSLA 3NO8A 1GU3A 4BQ5A 2YBKA 4Z07A 3E6DA 4JDOA 1OA2A 4QGLA 5FY9A 2X29A 1SLCA 3EXUA 1U0AA 5BNOB 4QX5A 1W9WA 4RYDA 5FAXA 2RJ2A 5A3MA 1YUDA 2ZX1A 5FQ0A 2ZJCA 1E5IA 4GB31 5A32B 3IMMA 5DMYA 1UO9A 3OD4A 1XNBA 3PIGA 4J1WA 3ZN5A 4MH0E 1YFXA 1V6NA 1FT9A 1J3QA 3OYWA 4HONA 1PIV1 2WSVA 2XXZA 1JOBA 1K5MB 1VBA3 3P1IA 4XAEA 5C5TA 1L7QA 4OHXA 3OGSA 3OOXA 1OFSA 1ONAA 2GH2A 4HPKA 4BA6A 2VAUA 4YZ1A 2BGOA 3AKPA 3OCPA 4KMQA 4URTA 3VZLA 4L92A 1UY2A 3PU8A 4AOCA 4YVWC 1Y9MA 2W94A 1RUF2 2D6OX 4Q4X1 4AW7A 1LULA 4CEWA 2VVDA 4QHBA 4RD7A 1QH7A 3RVHA 1W90A 4M00A 2WN2A 3T2OA 3HBKA 1BYHA 1XPWA 4D6QA 2C4XA 3D0JA 1QJY2 3AL5A 3MW2A 4DUXA 5EQUA 5J1XA 4XUNA 2BERA 5FXXA 4BYYA 1QWRA 1C3HA 1LHWA 3J8F3 2IUWA 2I45A 2P3JA 1ULCA 4KWUA 2IXLA 3WT3A 3RZHA 3ACFA 4Y4RA 5B2GB 2ZXQA 4YZ5A 5FYTA 3CU7A 4CDUC 2XVLA 4QM9A 1LHNA 1H8TA 4MGYE 4LIUA 4K1YA 3RWNA 1DLLA 4WVVA 4HETA 5BNQA 2ENRA 3WG1A 1DQ2A 3DKWA 5FDBA 1VBE2 3PUQA 3HNMA 5LEJA 1EV11 4CCNA 2RDRA 5FZ0A 3I2GA 3C7HA 1LOCA 3O12A 4PF5A 4QPIA 1AJKA 5JSOA 1AXYA 1QJFA 3I2HA 2XWJB 2DCJA 4GJZA 5FUPA 3WG3A 1SDWA 2PHUA 3T30A 2RDSA 3C2UA 2KA3A 5EP9A 1O5UA 4AVCA 1W28A 1RUJ3 4XIKA 3HVDA 3ZSJA 4AVSA 3EMRA 5F8PA 3PL0A 4SBVA 4UBHA 3R4UA 4DS0A 2TUNA 2ZZQA 4OI4A 4HSLA 4P5HA 2VNGA 1ZZBA 1VAKA 4P9LA 2GU9A 3BTYA 5LASA 4UAPA 3UKTA 4D7SA 3ASIA 3OUHA 1F4AA 1RIRA 2R071 1X8MA 5FMCA 4BIOA 4MGQA 2Q1MA 2EA7A 4FFGA 2OX0A 1XNAA 2W0XA 5CB7A 2QQJA 1MEC3 5T52A 1FMD3 3LGRA 4MUVA 3DV8A 3CL1A 3OSDA 1LEDA 4GULA 4I2OA 3PTRB 4UW3A 1DIWA 5G05L 1NXD1 4QDQA 1GWMA 2WZ8A 4G4FA 4PIZA 5A3UA 3V64A 2GZWA 2ZTNA 3RYRA 2Y60A 3RJRA 5A7OA 3W5MA 1GANA 3I97A 4IETA 2DCZA 1R1A2 1EAH1 1PO23 3J8F2 3BOPA 2WO1A 5FLHA 1AUYA 1FXZA 1RVF1 1W6MB 3RDIA 1ZBE3 3JQXA 1SDDB 4FOVA 4FXGB 5F32A 5FZAA 1DQ1A 2ARBA 2BUKA 3VBOB 3M3EA 3AYAA 3WQBA 1NA1B 5BNPC 4FTSA 1O91A 5LA9A 1C5IA 2LROA 1UMHA 3U0ZA 1S0GA 5FJKA 5JI9A 1KDMA 4LBLA 2QQLA 2PLV2 4WZCA 5FY5A 4M3CE 2DCKA 3EBRA 2WFF3 3ZSKA 1PHMA 3FLPA 4QX7A 2WNUC 5C7GA 3U4XA 3P6BA 3AB0A 3ZSLA 4D69A 3MICA 1KJLA 2VGDA 5C8CA 3H8RA 2ZACA 2NQYA 4X8PA 2OVUA 2PLV1 1CN1A 3CNAA 4LE4A 2PHLA 1G9AA 2YBSA 3MF9A 2XJUA 3M4FA 1ULFA 1OA3A 4XDQA 3H3ZA 2CV6A 3O7OA 3I3EA 1IG3A 4O61A 1I9RA 3ZIXA 2ZHKA 5I8SA 3NQHA 2RMU3 1CZVA 5C9AC 1PZ9A 4A4AA 3T2QA 1POV0 2W5FA 4N43B 4UI9L 2CDOA 3T3YA 4Y22A 1KRIA 2XL7A 3DL3A 1WMEA 3GF6A 3OB8A 1ND2B 1IQDC 3VBUA 1YIPA 4AI2A 1UYZA 1W8HA 4BOWA 5LK7B 2ZCWA 5CKMA 4IV1C 2D43A 2D3PA 3NKTA 4XMIA 4LO5B 4C8DA 1PO12 2VULA 3JZVA 4CP1A 4XETA 5BV6A 4GKYA 3V0AB 1LRHA 2FCVA 5FLJA 5K4LA 3USUA 1TG7A 2ZS6B 3WNPA 3HOBA 1SLIA 5D8AA 5C33A 3AMNA 3KV9A 4Z82A 1N47A 4UW6A 4XILA 2WZPP 1WW5A 3VHRA 1W6PB 4AFCA 3V65A 2HWE3 1RUF1 4Q4X2 1UX7A 1CAWA 2VU9A 1KGYA 3M3CA 3GHNA 4H55A 3AZXA 4B1LA 1DZQA 4CRQA 2GN3A 1SPPA 1YQCA 3VKFC 3RI8A 1PK6B 1TQ5A 2P6CA 2WWJA 4RSUA 2ORXA 4HN0A 4FXKB 1XNTA 2JG9C 2WO2A 5JPNB 5K7PA 1AYN2 4JRLA 3ZYRA 1PK6A 4D0QA 4COWA 3ZYGA 1NA1C 4B29A 5BNPB 1W6QB 4NIHA 4META 1PK6C 1XE7A 3T09A 2WUHA 2IFRA 4K1ZA 1IPKA 1QQP1 1W39A 2X10A 2PHRA 4LBQD 3KSCA 1J1LA 2OPWA 4AQ6A 4XFCA 2PYTA 2D6MA 4NN0A 4CXWA 3ZYHA 1UNBA 1WW6A 3BVCA 3FFQA 2HWB2 3M1HA 2BZDA 3VKLA 1NLSA 2XJSA 3J7HA 1G86A 1BBT3 1W6OA 2J1UA 2R072 3ZIWA 5C3PA 5CFDC 5A32A 2XG3A 1Z78A 1QQP2 2VY0A 4NE9A 3NL1A 1O7FA 4CP2A 4JX0A 2EAKA 1T6BX 1N1VA 3MIBA 4KBZA 2XMLA 3MPBA 4QKBA 3AKSA 4EYUA 2BGPA 4UFMA 4Y22B 1RB8G 5DUWA 2XLGA 2AENA 2QDRA 4ISQA 4XMAA 4CUBA 4MGIE 2R0FA 4Y1XA 4AE2A 1FOD3 1JZ6A 1FMD2 1FI2A 1UW8A 3CIHA 3I2KA 1QEXA 4Y5Z0 2WNEA 5FIXA 2Q0AA 1CIWA 5AVAA 5LEKA 3WDYA 2PELA 3EB7A 1OF4A 1S2KA 3ABZA 3NJXA 1OLMA 2HWD3 2VH9A 4XJUA 3K3NA 4QPIC 2VTXJ 3K46A 1QJX1 4RA0A 5CIRA 4JGZC 1VBD2 5ABJC 3TN92 5H9QA 5HV4A 1QXPA 4N43C 5ABJA 2LALA 2ARXA 2FCUA 2WNUA 5HCFA 4AEDB 4TSVA 4Y3OA 3OUIA 3IIIA 2OQ6A 5FY4A 5FZOB 1JH5A 4JGZB 1GKBA 1QGLA 2SBAA 4JHTA 2XR4A 4NHYA 2VMGA 5FZKA 4NPMA 1VBB2 2IXJA 3A21A 4AFAA 2PN5A 1QJX2 2ZGNA 5C4WA
chains in the Genus database with same CATH topology
1I5ZA 5A33B 4I3PA 1ENRA 3L9JT 4MSVA 2PTMA 1TMF2 1H8VA 2CWSA 4KH9A 1W6MA 2ZGUA 3H3UA 3ES4A 1S0EA 5BNNA 4XJ9A 3K48A 2GC0A 2XJTA 5DUUA 2HWD1 3RQ0A 3A0NA 3JUUA 2HYKA 2E9QA 3AKRA 4Q4W2 3JQWA 2FQPA 1PNFA 1I1EA 4MX3A 5DZGA 1FOD1 3MIEA 2PLV3 2ZHLA 1UF2C 2BFUS 3FMGA 1HRV2 4W6YA 5GALA 4PIYA 3RSJA 3J9SA 2IXCA 2PAMA 3S7IA 4B7KA 1J58A 3DF0A 1OA4A 4QPGB 4Q4Y3 1POV1 2A3XA 4CYDA 1QOOA 1WD3A 5J09A 1RUE2 3R6SA 4FSJA 3DPRB 2H0BA 4DY3A 4AHXA 3ZFFA 4FO9A 5A33A 1PO22 1COV1 2OYZA 4EN8B 1BBT1 1GICA 2A7AA 4ZXKA 3SITA 2D98A 4KBBA 1UIKA 2WZR1 2A6ZA 4W65A 1KXGA 4JGZA 2CGPA 2QQPA 4EV0A 4DRVA 3MLJA 4FPLA 5GLZA 2NZ9A 5T5PA 4QD2A 3MW3A 2AREA 2DU1A 3ZXJA 1H1AA 2OUJA 3UL2A 5GLWA 1VBC3 2ZGPA 4YW5A 3KT4A 3H8UA 1ZRCA 2NP0A 2BWAA 4CDUB 3GBFA 4MLOA 3ES1A 4QPYA 1ULDA 4HL0A 4FPJA 5K0UC 1QU0A 1ZZ9A 3AM2A 4WM8C 1MS0A 3ZFGB 2ZGRA 4UW5A 1LCLA 1Q8PA 1QJY3 4N90A 4WM8A 3R4DB 2WQ4A 5DUXA 1D4VB 1NE4A 2W08A 3AZWA 1WA4A 3BALA 4FAGA 3SH4A 3FLTA 4OULA 4X6QB 2DTWA 4Q1RA 3RPQA 1FMD1 1PZ8A 3AZVA 4Y1VA 4LA2A 3ZPYA 4NWVA 2R16A 1JOJA 3ZXGA 5HCBA 2A6WA 3M3QA 2WSUA 4I0BA 1CR7A 3SLIA 3ME2A 4YVSB 2CY6A 3KT1A 4QQOA 1W2UA 5FOJB 3WD5A 3N7KA 4B8EA 3K51A 3ZXDA 3I8TA 3FC0A 4YG3A 1QJU2 2PHFA 3TBDA 4CDQA 2ILMA 4MXWB 1PVXA 1LOFC 4PDWC 4AI0A 5JOXA 1YIFA 1X82A 3BPZA 2WFF1 1ENSA 3HR9A 3B93A 4B4PA 2ZMKA 1WUVA 1KD7A 3LAGA 2EF6A 4C0HA 1SFYA 3VDDA 4QM8A 1EV13 4XBQA 2ZGQA 3TAYA 2WFPA 1J59A 1JBCA 5FTTC 4K40A 5J98B 1RUC2 4NR1A 5DXDA 5L73A 5J3UA 1MZ6A 2YHJA 1NYWA 5JZGC 1RTVA 2HWE2 4Q4X3 1W6NA 1UU5A 2B9UA 4Q29A 2BNMA 1RVF3 1EAH2 3J8F1 2ZHNA 3UKVA 1S0JA 1NY72 3UKNA 2IXKA 3CJIC 1A8MA 4O9EA 4SLIA 4LA3A 3M3IA 1VBA1 1LTEA 2MHFA 4AI8A 2HWF3 2QZ3A 2XBO3 4K3UA 5JMCA 4XJWA 1ZZ8A 2X53S 1MZ5A 5EZWA 3QH6A 3QCWA 4P9GA 5GLTA 2PHDA 2R1BA 1COV2 2CAUA 2LUWA 5L7OB 2RS51 1UU4A 3WW1A 4LBQA 1XYPA 5H9RA 3O5SA 1LGCA 3ZFEA 2ZX4A 1ENQA 4AFMA 1VB4A 3GYDA 4HVRA 2BBVA 2ZMLA 4CDXA 5D8AC 1F31A 2GMMA 2HEVF 1AL0G 5LK5A 1BEV2 2D97A 3WG4A 1DGWX 1H0BA 4Q2FA 5CVRA 2I2SA 2WS93 3IM0A 5D8AB 1AR61 3AZYA 4TZDA 1AR71 1ZNPA 3WP4A 4I0AA 3DGTA 2X8KA 2DFBA 1NZCA 4RR3A 4WBBA 5GZFA 2JG9A 3RMXA 1BEV1 3VZMA 1FV3A 3OY8A 1GQGA 3PHMA 1PO13 1R1A3 1RUD2 2C9AA 1RUH2 1AR72 4CDWC 4DMIA 1D4M3 1NCQB 4DQAA 3N4MA 2B46X 3G6JB 1D0HA 1XYOA 1G6NA 1SLTA 3MGUA 4LHLA 1AYN1 2BNNA 4V1PA 1RL3A 1WLCA 3BU7A 4LTAA 2NPIA 1EYBA 5JOYA 2GNBA 1H4GA 2ETEA 2GMEA 4RHV2 4BH9A 3ZO0B 3LB9A 4X8NA 1R1ZA 5F5QA 2WT2A 2YZ4A 3NVCA 5J36A 3O0XA 3VV1A 1DDLA 3NV3A 2WFF2 3P3NA 1IHMA 1YYNA 1MEC2 5K0UA 4GB33 2P17A 1RUE3 1IS6A 1KFXL 1WMDA 3VBFC 2RS31 2XPJA 1BK1A 4LUMA 2ZZJA 4YZ2A 2PHXA 1H9PA 4YW3A 1O3SA 1YFUA 2ZOEB 1OQ1A 1CJDA 2JKBA 5E1RA 1XE8A 4N53B 2A6VA 2DUOA 1PVC2 4R9CA 2RR11 2BVVA 4IEXA 3KCXA 1N1SA 3AMPA 4N53C 2VOVA 1ZYBA 3E6CC 1RHI2 4JVAA 1QY4A 4KL1A 1LJ7A 4QQHA 4Q4Y2 4XYXA 5BNOC 4OLLA 3MFCA 3PJYA 3SXWA 2D93A 5J7MA 1I6XA 2RR12 3SH5A 3I4IA 4B3NA 1SACA 1RUC1 4FOYA 1H2LA 4XFGA 1SLLA 4D7YA 1LGBA 4F3JA 1V6JA 4EN0A 2VOKA 3ZN6B 1GQHA 4H3WA 1D2SA 4FCAA 1TNRA 3QH7A 2ZX3A 4RHV3 1RUI3 4AHYA 1RUH3 5HXVA 4GA9A 1OMIA 4IV1A 4IV3C 2WA4A 3VL9A 4FPEA 2A73B 1MS4A 3ZDSA 3ALQA 3I7DA 3INAA 3V0BA 3OPZA 4M3CA 1UKRA 1VBB3 3NKGA 4FTBA 2Z2SB 1AR62 4XQ4A 4XJ8A 4F8AA 5JVVA 4DB5A 2Q4SA 3WDUA 1C1FA 4DY5A 4OUMA 3CJIB 4FAHA 2QJVA 2XLFA 2RM21 1H1MA 4P9XA 1TEIA 4NHMA 4Q4V1 4FOQA 1OPOA 5AC91 1YJKA 4YGEA 5F9TA 4OHYA 1C8M3 2YUEA 1YHFA 3RYKA 1QDOA 1RUD1 1X33A 4H7MA 4Q0SA 3B94A 2HEWF 3JU9A 3KGLA 4Y26A 4XF3A 3HIFA 4LBKA 3H7YA 4K9SA 5BNNC 3OGJA 1V6OA 4EJRA 3PMSA 1Q8VA 3POSA 2UYAA 1REFA 3ZXLA 4L11A 5GLUA 4YLZA 2HWC3 3AXDA 3GBWA 4WV8A 5BPXA 4HK9A 2F4PA 3WXPA 2GNDA 3SNMA 5FQ0B 3RG0A 5KXCA 1LHOA 3AP4A 4AEJA 2B39A 3ZXEA 3AMHA 1ZRFA 1RUI1 1W0OA 2XJVA 1OPMA 1UZYA 4E2SA 4KU7A 1VR3A 4R4XA 1UL9A 4YZ3A 3S7EA 4CEWC 1LODA 1RUC3 1CQ9A 5CG9A 4LBJA 4Q27A 1CESA 4YVSA 1MVQA 2ZAAA 3LOBA 1UD1A 4XFBA 4RHV1 4KNCA 3AFGA 1AL21 4PBOA 3WNXA 3EQEA 3JD73 3NSTA 5JIUA 4XHXA 2OPKA 5EV7A 2DUQA 4RQPC 3DUIA 3HT1A 1UIJA 3LOIA 4J6GA 1TE1B 1VAVA 4WVWA 2WC2A 1RC6A 4RQPB 1DG6A 2NM1A 4CP0A 2QNKA 3IN9A 5I93A 4JQRA 3WQ0A 2BNOA 4B4QA 4HSJA 4U36A 2CGOA 2JE9A 1PVC1 2RR13 3QBQA 1URXA 5KHHA 3GBGA 4O9GA 4WVZA 1GFF2 1DF0A 4Y1YA 4LEJA 4BMBA 1OI6A 3H1YA 1YXWA 3I2DA 4HANA 4IV1B 3VBFA 1B35A 4XEZA 5IK4A 1TME2 3ECQA 4GWMA 1MZEA 3AP5A 5BNNB 4LHNA 1XNCA 3WV6A 2GAUA 1N1TA 3D8CA 1MQTB 3GZAA 4JTOA 4RS5C 5I8YA 4CDQB 1VALA 2XBO1 4AFDA 3LZZA 1QXRA 3L2HA 2RM22 3ZXFA 4A3XA 3ZYJB 4TWTA 5AVPA 4Q4V2 4CDQC 5J37A 1LOGA 2GNTA 1GZCA 4YZ4A 1MQTA 1R1A1 2CGNA 2ET1A 4QGMA 3POYA 2B42B 1O4ZA 1AR93 4D94A 3ENRA 4Q4W3 1XYNA 5EJ3A 4R8HA 2BWCA 5GZGA 4IL7A 1F5JA 1JUHA 4E2GA 1REEA 1RUJ2 1N3QA 2D3SA 3AMQA 1OOPA 1HW5A 3ILNA 3MIHA 1QHDA 3ZXAC 2GC2A 2P3KA 4LLOA 1JHNA 1EP0A 1DQ6A 1UMZA 1UN1A 4K7JA 2DTYA 3UJQA 4IV3A 4DXZA 5KBFA 1AYM2 1V9U2 1BVVA 2IXHA 3AJYA 3V0BB 4JDNA 4AGRA 1RUI2 2JG8B 4PIXA 2R042 1CGPA 1AYM3 1V9U3 4JRAA 2A71A 2E63A 1AR63 4YM3A 1VBD3 3E5QA 4AI3A 1A8DA 2RE9A 2LM3A 4BCUA 2WNUB 3BTAA 3MIDA 5DDJ1 3EHKA 3KMHA 3POWA 4DOUA 4JC1A 4XJAA 3VHOA 1N1YA 5EYXA 2G9FA 2X5IB 2WLPA 2HWF1 3VL8A 3JD72 4CDXC 2RS53 3DPRA 5DDJ2 3KCCA 4XW3A 1XRUA 3ROUA 3QACA 4YG0A 5F1RA 3VBHB 1QJY1 4QQPA 1RMU2 4AVAA 4CTEA 1ND3C 3S30A 4XF1A 2XVKA 4YW1A 3VGIA 2HWF2 5CADA 1Q5OA 1ND3A 1U5ZA 3TYJA 2Y0OA 3JB4C 1AX1A 3TOJA 1AJOA 4XHBA 1GZ9A 1RMU1 3FBMA 2CAVA 4PLMA 2AZ5A 2LTNA 4YVSC 2B45X 4ASLA 4AEKA 5E89A 5FO9B 1RITA 5H9SA 3V56A 1DBNA 5FPZA 1NXMA 3S6PA 1YI9A 2KXLA 4LHKA 3HD8B 1IS5A 5IUQA 5CU1A 4WZFA 2E7TA 5H9PA 2EAAA 2C1FA 1Q56A 3O0WA 2VG9A 4FOWA 4QGNA 2EXHA 4AHWA 1AR83 4G3YC 2FMDA 2ZGTA 1SLAA 5AFBA 4Q4Y1 1F5FA 1KDKA 1MS9A 1VRH2 2VNRA 4YFZA 4E4DX 1S0CA 4AFBA 1WLWA 3SCFA 3IWZA 2NN8A 3VN4A 4BZ4A 4M3CB 5CFCA 3AMMA 3OJBA 1H8TC 4U2AA 4RFT0 4XBLA 2Q30A 1NCQC 2HWB3 5JZGA 3B02A 3W58A 1CVNA 2ZPXA 3VBOA 1Q43A 2UY8A 3NV2A 1IKQA 1YO8A 2Z5WA 1WD4A 5JZGB 1H30A 4N43A 1SFNA 4QQ2A 2DU0A 2XBO2 2R062 4RR3B 1G9DA 1U5YA 2VW2A 2DF7A 4OFGA 4Q8LA 2YGMA 4FPGA 2WQZC 4KWKA 2ZGKA 1D0GA 4BPZA 2WA3A 1I3HA 3VHPA 1HKDA 5JCTA 3R0RA 5IK8A 3LA7A 1IS3A 2UYBA 2EXJA 3CEWA 3H1MA 3AYCA 4M01A 3TRSB 1MQTC 3NJZA 2Z79A 2VW0A 3SCHA 1FATA 5FPXA 1F9KA 1VAMA 1CD3G 3ZXKA 3PVBB 2NMOA 3SHRA 5CFCB 5L36A 2Q8OA 5L7OC 2GC3A 2I07B 1J1TA 4G9SB 1VBC1 4JAAA 1HRI3 4JDMA 4A7KA 1YFYA 1Z7S2 5L7OA 1RUG2 1CJPA 3BIWE 3ILRA 1W6PA 2SLIA 4RL7A 5CNAA 1AXZA 2DYCA 2FMYA 1PIV2 2XKOA 3JD71 4YW4A 1AL23 5TSWA 5JR7B 3VDDC 3CO2A 3RZZA 2XHKA 2RS11 4HKWA 4I09A 3WDWA 2O8OA 2QFEA 3T1LA 5F6LB 5C6CA 5JAXA 5J96B 1FX5A 3RRDA 4JGYC 2BGCA 1POV3 4YRDA 5T50A 1PGSA 4X6RB 3J26N 2CTVA 1X8EA 2NLRA 4BLJA 3MW4A 3JBG2 3I59B 4IEOA 1V00A 4LO7A 3AYEA 3AX4A 1FNYA 2R49A 4E4ZA 1QXJA 2MPFA 5AFEA 2P37A 4YGBA 3AYDA 5I0UA 4ZU4A 4YYOA 4HT1T 1QH6A 4KQ7A 4PBPA 1HXS3 1S2BA 1DGRN 4Q26A 4I30A 3JCIA 3WCRA 1VLNA 1K5MA 1OLRA 4KWLA 2D6KA 1Q3EA 4EROA 2X5IA 3MF6A 1WLTA 3WR0A 2VW1A 3B7MA 1BXHA 5CFCC 3NW4A 1ASJ2 2A3YA 1B35C 3ZMNA 2ZKNA 4I0WB 4PCRA 3GZUC 4QMAA 2XJPA 4BHPA 5KC5A 4TYSA 3WG2A 1XNDA 2EXKA 4IEPA 5FLIA 1C57A 1S1AA 4NVPA 4XOGA 1B35B 1DQ4A 2GNMA 3L2YA 4HVOA 2V5YA 2NYYA 2R0HA 3OGGA 3T2TA 2BFUL 3ZSEA 2WT1A 4GMP1 4XTPA 4C1XA 2V73A 1VJ2A 2BTVC 1ZVFA 5KC6A 5DZFA 4ATFA 1ND2C 1AZDA 4Q0VA 3ATGA 4GH4C 1NCRB 1A6CA 3VBHA 4PLOA 4OI1A 3VKMA 2WWSA 5JSPA 4JGYB 2OZJA 4I02A 5SV8A 4N7UA 2K0GA 4FT8A 1LB2A 3FHIB 1LU1A 3IDBB 4YFWA 4CDUA 2C0ZA 2F6BA 1DQ0A 1KFUL 1YI7A 1XU1A 2PHWA 1RUF3 2HWE1 3WW3A 3SISA 2UWAA 1ENXA 4K6BA 1HXS2 3N3HA 3VLBB 1NQDA 1VBC2 4PJYA 1H1IA 1HQLA 3FUQA 3QOPA 4ITCA 2XJRA 4M0HA 4AQTA 2JG8A 3VBRB 3TN91 4XF4A 5DUVA 4N9IA 5I8TA 2PAEA 2DVFA 2ZMNA 2JG8C 2DVDA 4COVA 4DZGA 3B9IA 3THPA 4IV3B 1H2KA 4IESA 4QQLA 1S55A 4Y1ZA 1NCRA 1OD5A 1MVEA 4MZUA 2ATFA 4RS5A 3WP6A 2VUJA 2RS33 4AEMA 1IPJA 4Q0QA 2TNFA 3TB0A 1RUE1 3FE5A 3WCSA 1DGLA 2YC0A 1EPZA 1TNFA 1DZRA 4EWAA 3M3OA 4N9HA 1BBT2 1F2NA 3N7JA 4PDWA 4HVQA 4GIQA 3KGZA 3VBSB 4YG6A 3VBHC 2VECA 3AFKA 1LOFA 2DVGA 2FZ2A 5FOBB 4LBOA 4YM0A 2EVXA 2OZ6A 4RQPA 2A70A 2MNGA 4UXAA 5I0RA 3N7LA 1W0PA 2JE7A 4AVTA 3D82A 2P2KA 3IIAA 1HQWA 1Y9QA 4HKLA 5I91A 2FHRA 3O0VA 1J3RA 4P9JA 1QOSA 3P3PA 4HZFA 5EXOA 4RS5B 1U12A 1PO21 3CJIA 3EO6A 4HKOA 1OKQA 3FFZA 1YFWA 3WZ1A 4DFSA 3ZVXA 1PO11 2WNVA 3B5LB 2GMPA 1WCDJ 1ASJ1 2R30A 3QLQA 1CAVB 2E53A 3USUB 1QF3A 3RYPA 1BEV3 2XJQA 5BXXA 1YCIA 3QD6A 2JEMA 2ZBJA 1BJQA 1JW6A 5ACA2 2MEV3 4QPGC 4BLIA 1EAH3 1GZWB 1VRH3 4GALA 4PLNA 1ZA4A 3ZN6A 3TNPB 1EV12 3VBRC 1PZ7A 3O14A 3FX3A 4JV4A 1LR5A 1MEC1 2VMHA 3MEPA 5FRAA 4OHZA 1U5IA 1UU6A 1R091 3DPRC 3FZ3A 2YPJA 1CAXB 2XVGA 4E9KA 1VRH1 1HQNA 3H1WA 5JLVA 1R093 4OVEA 1VBD1 2MEV1 2B5HA 5CG8A 2CL2A 2YDEA 2H0VA 1RVF2 1HX6A 1J3PA 4UBGA 4AHZA 1O4YA 3LA3A 4PQ9A 2Q1ZB 3SCGA 2O0OA 1SQ4A 1H9WA 3MFAA 1SBFA 1ZBE2 2DCYA 3VBSC 5JPMB 2VOWA 3KZ4C 5KHIA 4D3WA 1SMVA 4E27A 4GQ7A 2WKKA 4GWNA 4XTMA 1ZZ7A 4AYUA 5I0TA 3VBUB 2DUPA 2D44A 1C4RA 4AQ2A 5KHKA 1ASJ3 4M3CF 4Q4W1 1LESA 1AR91 2GH8A 4GH4A 4Y20B 3N36A 1BVP1 4LO8A 3SH3A 3IMNA 3PJQA 2XGXA 3NAPB 5BYNA 3KQRA 2RS52 4ZU7A 5DG2A 1TMF1 2VNOA 1ZREA 1NY71 2QZ2A 2WLQA 3AXEA 5KHJA 1WBLA 3NAPC 3VZOA 4LR4A 1Z7S1 1MS5A 5C8CB 5JSRA 1A3KA 1OOPC 3I59A 1ZZ6A 3IPVB 4ORFA 4R52A 4XE9A 4JGYA 2HWD2 2XLAA 2PA7A 1NCQA 1IKPA 1VBA2 2IXIA 4HLTA 1WBFA 4KG0A 1DGRA 4LT5A 1CONA 1UPSA 4Y20A 1Q8OA 4CZSA 3ETQA 4NOTA 3PVOA 4GMP0 3LCPA 4ISRA 1H8TB 1BKZA 3PVNA 1NA1A 4NWWA 3T1MA 2GC1A 1Z0HA 4EN9B 2ZGMA 4FVVA 4FQ4A 3MZHA 4C0BA 2XH6A 4XBNA 2P3IA 3D6EA 1GNZA 3KT7A 2A75A 3B00A 5ACA1 4CDXB 1Y7BA 4R9AA 3W9AA 5EWSA 2HJIA 5T5LA 4WVMA 3KM5A 4XF0A 3ZFEC 1BZWA 1ND3B 1UPIA 4S2DA 3HT2A 2X5IC 1F8VA 1ULGA 1VIWB 1RUOA 3KCYA 5F6KA 5LRSA 3PTYA 4B7EA 1UZZA 4MYEA 4HMZA 1NOVA 2AGSA 4LO4B 3OY8B 1RINA 3E5XA 3WVJA 4Z92B 4WVMB 1YJLA 2E7QA 4OI0A 2H6BA 5T5OA 1XU2A 2DVAA 4DINB 1LHVA 1VBE3 3ZX7A 2XL9A 3ILFA 1ZX5A 3LA2A 2P34A 2JECA 4I01A 1ND2A 1S0BA 3E6BA 4BIFA 4IEYA 1IZ3A 4A7YA 5C8CC 1AL22 1AVBA 1HV0A 4OZXA 1IGOA 4XZPA 2DCTA 4P9WA 3KD4A 1MR5A 3HMYA 2HWC1 4RGAA 2D7FA 1CAVA 1R092 1OHFA 1MS8A 2IZWA 4LBQB 3VUOA 2VUAA 1QMJA 2WNVB 3ACLA 1JYIA 1JTZX 4FPKA 4LNVA 1ZRDA 4OHWA 2B7YA 3ZYPA 3S0MA 2CWMA 4CEYB 3M7AA 4BM8A 1K5MC 2D3RA 2QVSB 3OF1A 4ASMB 3AP6A 2AH2A 2IC1A 3MIGA 3TN93 1C8M1 1B09A 1KITA 1DZTA 2D6PA 2VVFA 4L9BA 4Q4V3 4XFFA 4ES8A 2G9GA 4B4RA 2RM23 4CDWB 3MDPA 1IOAA 2YROA 3PNAA 1DYKA 4HPKB