4LLOA

Structure of the eag domain-cnbhd complex of the mouse eag1 channel
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
173
structure length
173
Chain Sequence
GAMGTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEATLAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium voltage-gated channel subfamily H member 1
publication title The structural mechanism of KCNH-channel regulation by the eag domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 49
structure length 173
sequence length 173
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lloA00
1SQ4A 5KHHA 2ATFA 1X7NA 4J1XA 1EPZA 3PNAA 1CAUB 1O7FA 1RUNA 2QJVA 3DL3A 4MGKE 4IEYA 5FQ0A 2ETEA 4EROA 1I5ZA 3H1YA 1CAXB 3R6SA 3FJSA 1OMIA 2GU9A 1ZZ6A 5KHGA 4LLOA 4IEQA 5BUVA 2OPKA 1ZVFA 4XFGA 4Q0SA 1XRUA 4WVZA 4EWDA 4F8AA 3UKNA 3HQXA 3RYKA 5JCTA 4ZU7A 2XKOA 4HMZA 2VQAA 3S7IA 4IERA 2Q1ZB 4LA3A 4PJYA 3CLPA 2OZJA 4IEZA 2B9UA 2O1QA 3CJXA 3OF1A 4QXKA 2PQQA 4OFGA 3WW1A 4YRDA 2HJIA 3L2HA 3D82A 3UKTA 4WBBA 4I3PA 4MX3A 5KHJA 3OCPA 1QY4A 1WLTA 2H0VA 5CU1A 2D5HA 3EJKA 5JSRA 4FT8A 3KGLA 4MGYE 3HT1A 2PTMA 2IXKA 2BNOA 2XKPA 4D7TA 2MNGA 3IBMA 4IESA 3ELNA 2XHKA 3JZVA 5FCCA 4A2UA 4Q29A 1ZZCA 5C8WA 3IIAA 3I7DA 4I2OA 4AVAA 3D0SA 4HZFA 4UBGA 4HLTA 3RNSA 4FAGA 5HI0A 2Z2SB 2K9ZA 4HBNA 2B8MA 4XFFA 2C0ZA 5FDBA 5LEKA 1JUHA 4L11A 5KHKA 1GQHA 3B02A 2QDRA 2PAMA 3SCHA 4HVRA 4BIFA 4HSJA 2GAUA 3LA7A 4B29A 1DZTA 3M70A 4E2SA 3FWEA 4XFCA 1UPIA 4R8HA 2OZ6A 3FZ3A 1Y3TA 2CGPA 3MPBA 3LOIA 4META 3G7DA 5J3UA 3WW3A 3QACA 4EWEA 1FT9A 4HN1A 1NE4A 2XL7A 1J58A 4EWAA 3RYPA 1Q43A 4XETA 3E6CC 4Q0UA 3KCCA 2Q0AA 2ZCWA 1PM7A 4MH0E 4QGMA 5J7MA 5BY5A 1ZRDA 4QX5A 2B5HA 1YUDA 4PIZA 4H7LA 4MUVA 3VHRA 3NSTA 3BU7A 1YFXA 3KMHA 3CO2A 4LTAA 3CEWA 4YARA 4IEVA 2PHDA 1O4TA 1YHFA 4Z82A 2P17A 3WW2A 1OFNA 3H1WA 4Q0PA 2XL9A 4HVQA 5LRRA 2ZKLA 4Z07A 2EAAA 1ZRCA 1YFUA 2WC2A 3LWCA 4I02A 2PA7A 5F1RA 3FX3A 3KGZA 1SEFA 3I59A 1CGPA 1YWKA 2Y0OA 1HW5A 3DN7A 4BHPA 4OLLA 2PHLA 3RYRA 3EBRA 1YLLA 5JSPA 3EO6A 1ZNPA 4I01A 2H6CA 4HSLA 3EHKA 3U10A 3NJZA 1O3TA 2XLGA 1J3RA 1CAUA 3CL1A 2CV6A 5E16A 4PIXA 1RTVA 2GC1A 4XFBA 1ZRFA 4LUMA 1Q3EA 1NE6A 3PLQA 5EFUA 3IWZA 4PIYA 3U11A 1RC6A 2D93A 1CAXA 3BCWA 3ETQA 4KU7A 4MGZE 2FMYA 2HKXA 3ES1A 3H9AA 4KU8A 3U0ZA 5I0SA 3TNQA 3NL1A 4N9IA 3SCFA 2D40A 4JTNA 5BV6A 3LAGA 4L2NA 4QGLA 5JR7B 4Q0QA 5K8SA 2BNNA 3S0MA 3QOPA 1PMIA 1GQGA 2UYAA 4QM9A 5CADA 1QWRA 4LUKA 3UKVA 1WA4A 1UD1A 1O3SA 3KSCA 4AVBA 2IXHA 2V09A 2PFWA 2CAUA 1X8EA 4I09A 1WGPA 3EQEA 1CAVB 1YFWA 3BPZA 1LB2A 3M3IA 5J48A 3E6BA 1VP6A 4WZCA 1OD5A 3RZZA 2IXIA 5D1IA 1RGSA 4AXOA 5KHIA 1ZZ9A 2VPVA 2O8QA 5JAXA 1X82A 2OA2A 2VECA 2E9QA 3H3ZA 1CAWB 5I91A 2WFPA 3E5QA 1ZX5A 1NYWA 3HIFA 1FI2A 1O5LA 2MHFA 1QXRA 3SCGA 4JTOA 1Y9QA 2UY9A 1FXZA 4RD7A 1DGWA 1DZRA 4XFIA 3S7EA 4FAHA 4QM8A 1V70A 3HT2A 4MV2A 4XFAA 1YFYA 3ST7A 1IPJA 3N4MA 4IEWA 4UXAA 1J3QA 3H7YA 4NVPA 4ONUA 4KL1A 2ET1A 4XFHA 1XE7A 5I93A 3GBFA 4IEXA 2IXLA 1UW8A 5C6CA 4GULA 2EVXA 2PAEA 3NVCA 2EA7A 5FQ0B 4ZU5A 4MZUA 5BXXA 3ROUA 4TLFA 4LA2A 4YYOA 2KXLA 3CF6E 3GYDA 1SFNA 1EP0A 1DGRA 2I45A 2IXCA 4O9GA 3H7JA 3C3VA 5I0UA 2CAVA 3H50A 2F4PA 5JSOA 2FQPA 4LEJA 4ORFA 1EYBA 2Q30A 5LEJA 5I0TA 3ACLA 3USSA 4J1WA 2D5FA 5BPXA 2QVSB 1LR5A 1O3RA 2DCTA 1O3QA 2PAKA 5AVPA 4XF3A 2XGXA 3E6DA 4X6QB 4E2QA 3FE5A 1X8MA 1NZCA 3LA2A 3SHRA 1UIKA 3H1MA 4XEZA 4E2GA 5LRSA 2K0GA 2XLFA 4ZU4A 1UCXA 3NW4A 4N9HA 4IEUA 2MPFA 2BGCA 1ZZ7A 1G6NA 1J59A 4FBFA 4DINB 1IPKA 1J1LA 1Q5OA 2QCSB 4AVCA 1TQ5A 4K8FA 4AQ2A 3FHIB 2GC0A 1ZREA 3LZZA 1U12A 5I0RA 5FLIA 4BYYA 5FLJA 4I0AA 2ET7A 4XF0A 4I0BA 4BH9A 1H1IA 1OI6A 3NKTA 4P9GA 3LA3A 4R52A 5FPZA 4XF1A 3ZDSA 2GC3A 4KWJA 2PYTA 1VJ2A 1ZZ8A 4MGIE 3I54A 2OYZA 3MZHA 3RPQA 1ZZBA 4QMAA 5KBFA 1NXMA 3SXWA 1EY2A 3OGJA 4LULA 4AQ6A 5I8YA 4CYDA 4KWLA 2BYVE 1QXJA 2GC2A 1CAVA 2H6BA 4YNIA 1XE8A 4Q0VA 3BALA 4EV0A 4KWKA 2UYBA 2GH2A 3H3UA 3MDPA 1UIJA 1I6XA 3DKWA 3IDBB 1RUOA 2Z69A 4F7ZA 3ES4A 3H8UA 4HN0A 5I8SA 5E1RA 1H1MA 4YSFA 4IETA 2N7GA 1CAWA 5T3NA 3FFQA 4IEPA 2IXJA 2UY8A 3OTFA 1RL3A 4D7SA 3E5XA 1ZRRA 1CX4A 2GZWA 5FLHA 3PVBB 2XLAA 2Q4SA 4JV4A 3TNPB 4QGNA 3D0JA 1VR3A 3E97A 4XF4A 4IEOA 5FPXA 3IDCB 3OD0A 3MYXA 3I59B 3BB6A 1L3JA 4HVOA 4O9EA 5CVRA 5EZWA 2IC1A 4XF9A 4UBHA 3O14A 3SMHA 1J3PA 4JVAA 5I8TA 3RDIA 3DV8A 2QNKA 2BNMA 3WW4A 4X6RB 2BEOA 1LRHA 3E5UA 1LKNA 1O5UA
chains in the Genus database with same CATH superfamily
4JGZC 1SQ4A 2BZDA 1QEXA 2K46A 2YDEA 2ATFA 1NCRB 2Z79A 4HOOA 3U07A 4WVVA 4R4XA 3PNAA 1RUNA 3DPRB 3B7MA 1QJFA 2V4AA 2E32A 3CDZB 1UZZA 2EF6A 5A1LA 2QJVA 4IV3B 4HT1T 2JDYA 2VMIA 1AR72 3HJRA 4C90A 5FQ0A 3HBZA 3ZR6A 4GXLA 2VL4A 1DQ6A 5AC92 5F2SA 2RE9A 4RHV2 1OMIA 1I1EA 4CDWC 3LIHA 2ES3A 5BUVA 4FFHA 4RS5C 2OPKA 4LO6B 4CDUC 1W28A 4NIHA 4PLMA 4RQPA 3M3CA 4BJ0A 4BQ2A 4EWDA 2FMDA 4H3WA 3UKNA 1H4GA 2LRPA 2C9AA 1ULEA 2RM23 3HQXA 4RR3B 5DZEA 5FZ8A 4FI9A 5G05L 2QE3A 3FHAA 4QDQA 3BTZA 1UKGA 3HVDA 1XNKA 2VQAA 2A5ZA 4IERA 5SV5A 2Q1ZB 4LA3A 1FMD2 1E5RA 2WABA 3BOPA 4YVWC 2O1QA 2OQ7A 1COV1 3OF1A 3POBA 1UX6A 4OFGA 4QXKA 5ABJC 3L2HA 5JPMB 1R1A3 5FPAA 2DDUA 2VCAA 3OCPA 1QY4A 3NRUA 1WLTA 2H0VA 2F6BA 3NKGA 4UYBA 1D4M2 4K8RB 5JSRA 4XIOA 4FT8A 5KC6A 3HT1A 1AL22 4AI1A 3JB8A 2BP6A 4OULA 4Y26A 4D7TA 2MNGA 2E53A 3IKWA 5FBJA 5JMOA 5ISLA 3NNFA 3L9JT 1G9CA 4Q2FA 3H8XA 5FJHA 1GOGA 4YFWA 5T50A 3IIAA 1AYN1 2QQVA 1RUG2 1H0BA 4DEVA 5HCAA 2GNBA 5CFCB 2FDJA 3ZFEA 1PO12 3SKJE 1RVF1 5ANQA 3WV6A 2RR11 1AR91 3USUA 4A3XA 3S57A 4AI8A 2C0ZA 1BHGA 1OVSA 3MIHA 5LEKA 4Q4Y2 3RQ0A 1LHVA 4QQ2A 3RJ2X 3ZMOA 3CJIA 4MSVA 5IVVA 1STMA 1LAJA 5LA2A 1TME3 2PAMA 4W6WA 2A6XA 4M00A 3C7OA 1MEC3 1TMF2 1RMU1 2GAUA 3LF7A 4HSJA 2W94A 1WCDJ 4EQVA 2Y6HA 5FPLA 5DG2A 3VBOA 2W1UA 1OUXA 4PF5A 4EN9B 4JGZB 3M70A 2OVUA 3WCRA 4XDPA 3JD73 4E2SA 3FWEA 5DXDA 1QOOA 2WO7A 2K2SA 4XHBA 1S0BA 2VNGA 2VQUA 3PUAA 3FZ3A 1W6QA 3AKPA 4CVUA 1Y3TA 5B4XA 3T1MA 4OCTA 3EB7A 4ZXKA 2CGPA 1IG0A 1VRBA 1VBC3 5LZ6A 3LOIA 5J3UA 4GMP3 1CWPA 4XIKA 3O1TA 1K5MC 3WW3A 2A75A 3P6BA 2KD7A 4CDWB 3THPA 4N53A 4W65A 1CVNA 4QHOA 1GMMA 3T0BA 3PL0A 2HWE1 2WS92 2XL7A 4GJYA 4NRMA 4Q1RA 3RYPA 1GNHA 4A7KA 1Q43A 2GNTA 4Q5OA 4AHYA 1LECA 4FFFA 1KFXL 2VCBA 2ZCWA 1D2SA 1PM7A 2C6SA 3KZ4C 4LHSA 1V6JA 2C5DA 4FTSA 1W6NB 4QX5A 3WHTA 1YUDA 3LDRA 1US3A 2AGSA 4K20A 4PIZA 4C1WA 3VHRA 1R082 2FDIA 3KMHA 1YFXA 1AX1A 3ZYPA 5C3SA 3W21A 2VGDA 4EN8B 2R49A 2H0BA 4YARA 1N1SA 2V5DA 4COYA 4IEVA 2QBXA 3APBA 4CP2A 2LTNA 5A1AA 1ND3C 1O4TA 1YHFA 2HWD2 5FZAA 2B39A 2P17A 1W06A 4XUNA 1BEV1 4Y22B 1LTEA 1QIQA 2XL9A 2ZHMA 4YM0A 4HVQA 1L7QA 3NO8A 3T1LA 2VMHA 1D7PM 2ZGUA 2WC2A 1W6MA 4C0HA 1VMJA 3GBWA 5F1RA 3FX3A 1W9WA 3VBSA 1MZEA 3HN1A 4KWUA 3MIBA 1CGPA 4OI4A 2QQOA 4QX1A 5A32B 2SBAA 1UU6A 4WM8B 1DF0A 1JTZX 1QKQA 2JB8A 2RS51 3DCQA 4AHXA 5C3QA 5KWRA 4HFSA 3H8OA 2PHLA 3SQOA 1KFUL 2Q8DA 1JZ8A 4YVSA 1GBGA 2L9LA 4XJ9A 5F3IA 5JSPA 1VIWB 1IKPA 1NKGA 4I01A 2WFF1 3W20A 4HSLA 3BIWE 1K45A 3J8F1 1QQP2 1W8TA 5HXVA 5JI9A 3D4KA 2V5YA 4FPCA 1REEA 3NJZA 5LATA 1PO23 5K0UB 1DYPA 1QJU3 2HWF1 2QQIA 1H6YA 1NCRA 4ZZ8A 1JYNA 3RS6A 4AR2A 1J3RA 1V6MA 3CL1A 1IZ3A 3EXUA 1W2NA 1LESA 1W8OA 2RJKA 1JYWA 4XFBA 1ZRFA 1UZYA 3IDEA 1Q3EA 1HRI2 3L2YA 4IV3A 1V9U2 1RHI2 5BNQA 1HX6A 2FZ2A 2VNVA 4RGKA 5DAWA 1FX5A 2P34A 3ETQA 4MGZE 3POIA 3TWIA 3ZSLA 1POV1 3AC0A 1MS8A 5IUQA 5I0SA 4N9IA 3BYWA 5A3WA 1PVC3 2ZGKA 1RITA 3JBG1 5FPBA 3T4HB 4DEQA 4L2NA 4QGLA 1HV0A 4QKNA 4RR3A 4XBQA 3ZXDA 3ABZA 2W1QA 2WDBA 3PVNA 1PHMA 1Z7S3 3QOPA 4EN6B 2Q1FA 5CFDC 2VZRA 1B35C 1KD7A 1ZA7A 1GNZA 2ARBA 3I2KA 5GJ6A 5TSWA 4QQOA 5GZDA 4KI5M 4ASKA 3N7JA 4LKSA 4OI0A 2CAUA 1IG3A 3UV9A 1UQXA 4A41A 5A6ZA 1X8EA 3DXTA 1WGPA 4JDNA 5FXVA 1N47A 2X5IC 5ERLA 5T55A 1YFWA 4QHZA 3NNJA 1UOBA 5EYXA 3VHNA 5J96B 2JIJA 2ZGNA 3D5OA 4JRAA 5L9BA 5FPUA 1UY3A 2ZMKA 3UK9A 3ZDVA 1OD5A 1NY72 3VBHC 5FMOL 4M3CF 1ND3B 3DKQA 4LMFA 2O14A 3AXDA 5C5UA 1RGSA 4AXOA 1G86A 1WCSA 1HRV3 2QKDA 3ZYFA 1RUF2 2ZEXA 2O8QA 4YM2A 1BLZA 1IHMA 2WSVA 5CFCA 2D6MA 4W50A 1WW5A 1OA2A 2E9QA 2WRAA 1GR3A 1W6OB 4UFHA 4XQDA 5I91A 5IHRA 4LITA 3WG3A 1ZBA1 3KV6A 3HIFA 1OOPC 1FI2A 2DVGA 1DCSA 4MLOA 5K4LA 4WVWA 4LKEA 3WNKA 5HCHA 4JTOA 1VRH1 5T5OA 4AZZA 3ACHA 1FXZA 2CL2A 5E89A 3MIGA 2FZ1A 4LT5A 3GCWA 1DZRA 4GWJA 3D8CA 3K2OA 5AC93 4RHV3 3ZN6A 1UNBA 4LBMA 4MV2A 3WVJA 1OHFA 1DLCA 4JGZA 5JXHA 4XFAA 4AI0A 1ZBE3 3PMSA 3RMXA 4UW3A 3ST7A 1UL9A 4ZKTB 3NAPB 2NQYA 1REFA 3RVHA 4CCKA 2W87A 2D3SA 4ONUA 2ET1A 4XFHA 3HEIA 5FY1A 5FZBA 4CCOA 4BXSV 3BIEA 2W3JA 5A3OA 2VW2A 2YV8A 1F8VA 5L73A 1OD3A 1ASJ2 1EAH1 1FMD3 5T5PA 4CDWA 2FDHA 2C24A 1XYOA 3LDKA 1OKQA 1KXGA 3K3OA 1L7LA 1QJY2 5FMOS 4GWNA 5FO7B 5LBCA 4QQLA 2PAEA 4DUXA 1E57A 4OHZA 1O4YA 4AOCA 1C1LA 2EA7A 2JE7A 2VXJA 2ZX1A 3K46A 4ZU5A 5BXXA 4LHLA 4TLFA 4LA2A 1UZWA 3ECQA 4FXGB 2VZTA 1XE0A 2ZGOA 3GYDA 3FLPA 3OEAA 4X8NA 1DGRA 1LGBA 1PK6B 3TBDA 5CFDB 1W6NA 4OYUA 5I0UA 5A7WB 3H50A 1RUC2 1BK0A 3N9OA 3PJYA 3TN92 3CZJA 1GV9A 4NRQA 1IQDC 1VBE3 2CU5A 5C7GA 3H42B 1RUG3 2VCCA 1H2KA 5LEJA 5I0TA 2MEV1 1Q8SA 1A8DA 1PO13 2VMCA 2JB4A 4P9JA 4XMAA 1W0OA 2AUYA 4JQTA 3POGA 1JW6A 3MV01 4Q27A 4Y22A 3AYAA 3S30A 1O3QA 1HKDA 4E2QA 3FE5A 3PVEA 4AQSA 1SLTA 1X8MA 4OHVA 1LEMA 1D0HA 5J36A 4P9LA 4DS0A 3GZAA 1XU2A 3IDAA 3H1MA 1WLDA 1WMFA 3T30A 3LEIA 1ULGA 5FZCA 3WQ0A 4E2GA 2K0GA 2O8OA 2W46A 1N1YA 3FMGA 4Y20B 3WNNA 4B4PA 1S0EA 4ZU4A 4WM8A 1X50A 2ZPXA 3WEZA 1OOPB 1SDDB 4FPKA 2YBSA 2BGCA 2OPWA 2RS32 2WJSA 2Y8KA 4JC1A 2FCVA 1H30A 3VZOA 2WZR3 4TYSA 1F4HA 5H9QA 4FBFA 2DVDA 2HEWF 1GUIA 4YFZA 1VPHA 1J1LA 5K0UA 4K1YA 5FZDA 4K8FA 4AQ2A 4BK4A 2C1FA 5C3RA 4LE4A 1YQ6A 3IAPA 2ZKNA 3LZZA 1U12A 2B42B 4OUSA 4C1XA 2OX0A 5HXMA 4GB31 3NV3A 4RN5A 1W0NA 3IIIA 1UOJA 1PMHX 1ULDA 4LLFA 2OW4A 3GDBA 2VD7A 2W95A 4ZPIA 3LE0A 3SEEA 1H1IA 2ZS6B 5A7SA 1QXPA 2RHPA 3AJZA 4HXCA 4IE0A 1W2AX 3AP5A 3NKTA 4K9SA 1NOVA 3LA3A 4N7UA 1S4CA 2A7AA 4D0QA 4XF1A 2JWPA 3SNMA 2GC3A 4CPBA 1R083 5J98B 3POFA 1ZZ8A 4WV8A 5DDJ3 3OJBA 2RM22 2VBBA 1ULPA 2WBKA 1JZ2A 3N9MA 1X36A 4L8QA 1V6KA 3CKHA 1IS4A 5A7NA 3SC7X 4FPYA 1PGL1 3WF0A 5J37A 1LOFA 4Y4YA 3LPGA 3TEYA 1VBB2 1AF9A 3A0NA 5IK8A 1GANA 5CYYA 2G1MA 2WQ8A 1QXJA 4Q4W2 3NNGA 3NNMA 1L7RA 2YPJA 4Q0VA 2GP5A 3UGHA 3ZFEC 4LOSA 4P9IA 4SLIA 4KWKA 1UMHA 1QOSA 4Q4X1 1QH6A 5DMYA 4P00B 5LY2A 2V73A 2Y34A 3K51A 3MDPA 1ND3A 3AMPA 5A3PA 2AH2A 4IV1B 5FZ4A 5L36A 2NYYA 4AEKA 3VZMA 2P3IA 5A80A 1DLLA 3RI8A 1C4RA 3B01A 2EIEA 4UW6A 2ADDA 4IW3A 1WW6A 3U1XA 4U36A 1M4WA 3ZSEA 3RZMA 4AWDA 4IETA 2HWB1 4U2AA 3VBOC 1QQP3 2VOTA 4RA0A 1NQDA 1W6OA 3AKTA 3OTFA 2CNAA 2TUNA 3M3QA 4OQ8A 3VKOA 3ZPOA 5FLHA 5A33A 1NCQC 5GKAC 2XLAA 4YZ2A 3KF3A 2PHUA 4LIUA 4MG2A 4BLJA 2DU0A 5CISA 2BVBA 3P3PA 5G04L 1SBDA 2AR6A 3V64A 4ZONA 4RYDA 3ZXKA 3IMNA 1YXWA 1RHI3 3QLQA 3UGFA 3T2OA 4GD4A 3WG1A 1GWLA 1LOGA 3IDCB 5LK5A 1AXZA 1BBT3 3I59B 4P14A 2XMLA 1UYXA 2A6YA 4HVOA 4Q4V1 3ZMNA 2Y6LA 5EZWA 3ZFGC 1CQ9A 1Y43B 2W0XA 2A73B 4LKFA 4S2FA 1MVEA 5FPVA 3U37A 1VBA1 3PTYA 4UBHA 5KR7A 4DZGA 3Q8EA 1BQPA 3NAPA 2G4IA 1AL0G 4NIGA 1OH3A 1W99A 1AR83 2DVAA 2RR13 1FPN2 1FOD2 4B8EA 3N7KA 4J1XA 1SZBA 2XVGA 2A6VA 2GNMA 2IWGB 1CD3G 4GH4B 3GALA 5KXDA 2VUJA 3OD4A 3H3LA 2EICA 1GLHA 3N35A 2E26A 4YG0A 4PI0A 4A44A 1RMU3 2GN7A 2ZEYA 1TE1B 3NQHA 4MGKE 4IEYA 4L9BA 4FQ4A 1RUI1 1AX0A 2X10A 3U14A 1CAXB 2BV4A 3I8TA 3Q8CA 3MLKA 4AYUA 4LLOA 2Y64A 5DUVA 3WD5A 1PK6A 3J7HA 1ZVFA 5F8PA 5CFDA 1LHUA 2YBPA 3AVRA 3OUIA 1XRUA 4N90A 2B46X 4Q0SA 4WVZA 5A7WA 3VDCA 3VBRB 4CTEA 5FIXA 2BOJA 5DAVA 5FUNA 4LHNA 3RYKA 5LWBA 5JCTA 1RUF3 2R061 3CBNA 1AJOA 4AEDB 1QJX1 3AJYA 2JICA 3ZKYA 3ETPA 4LBOA 4HMZA 4A3ZA 4FQZA 3SKVA 4KNCA 2ZZJA 1DQ0A 4BDVB 3QH6A 1GZWB 4OI1A 5FR3A 2CYFA 2OZJA 2B9UA 2HWC1 4LNVA 2HWE3 2J1SA 4XABA 1JN2P 2PQQA 4NO4A 4YRDA 4CUBA 5J1XA 1MZ6A 1ZM1A 3A7QA 4XJWA 4WBBA 3I2IA 4MX3A 2ZZQA 5EJ1B 4WVMB 4ASLA 5LA9A 1YQCA 1N3PA 4AFCA 2D5HA 3K48A 2QZ2A 3UYJA 3RI9A 2BNOA 4BMBA 2XKPA 1NCRC 4IESA 3ELNA 4YZ3A 2XHKA 2E33A 3MO4A 4PI2A 4AFMA 2IVJA 4A2UA 4Z2WA 2BOIA 2W52A 2I07B 3DPRC 4Y20A 1JZ5A 2KM2A 5JMCA 3WG2A 1OOPA 1MS0A 4ZS2A 1NCQB 3ZXAC 1KGYA 2CHHA 4EE2A 5C3PA 1N1VA 4AVAA 3IT8A 3VV1A 1DDLA 2OUJA 1DYOA 4CCNA 2W1SA 4BZ4A 1TG7A 2UURA 2A3WA 1DYKA 5LBBA 4HONA 4E9KA 4AFAA 1WBLA 1S2BA 2EXJA 5LA0A 1JOBA 4YZ5A 1LU2A 1R091 3GZUC 1GOFA 3ZFGB 3ZYBA 1GQHA 3B02A 3FC0A 2QDRA 2VU9A 3AFGA 4RR3C 4JCKA 5FZ3A 4AVVA 3WHUA 1D4M1 2JE8A 3SCHA 4DFSA 2BQPA 3OUJA 4BIFA 4JDMA 2ENRA 2DWRA 1IKQA 5FK7A 1MS1A 1VMHA 5DAQA 1C57A 5L9RA 5GLUA 3VDAA 1RUE3 2P3KA 4A6OA 4LKDA 1IQAA 4MHUA 5SV8A 1ZA4A 1AJKA 1PVC2 4LJHA 4CA9A 1VB4A 2ARCA 1DGRN 1G9BA 5EV7A 3SEPA 3TN93 4RL7A 2ZA9A 3VL9A 2VO5A 3J8F3 4BM8A 4BPZA 4LBLA 4M3CE 1Z7S2 2X05A 1UOGA 2HWF3 1H1AA 1W8UA 2D6PA 1JXNA 4ASMB 4EWEA 3ILRA 5DG1A 3ZXEA 2RV9A 1W9YA 4UAPA 4HN1A 2ZX2A 1NE4A 3VZLA 3KCYA 4QB6A 4LBQB 5LY1A 5IWFA 2DURA 1TMF1 4FXKB 5CFCC 5CKNA 1NUKA 4R9AA 3E6CC 4Z1VA 4AI9A 3ZR5A 4OHWA 4QGMA 1A6CA 2VULA 4KGGA 1WLWA 3GBGA 3QH7A 2B5HA 4AEJA 2D7FA 3PHMA 4MUVA 4JZRA 1LEDA 4K1ZA 3BU7A 4IV1A 2PHTA 1MZ5A 3VZNA 4CXWA 3V0BB 1Z78A 4LQRA 5FYCA 4JAAA 5F3EA 3A21A 4YW3A 4A4AA 4CZSA 2RS33 2ZEZA 4AVSA 5HPOA 1NAEA 3SISA 3KT1A 1S2KA 3PMEA 1OBNA 5IJRA 2AEYA 3WF2A 4NPLA 3HBKA 3ACIA 1OFNA 3H1WA 3C2UA 1MACA 1BMV1 1LHWA 3ZM8A 2WS91 1PX3A 5EP9A 2D97A 2EAAA 3WINE 4D6RA 1YFUA 2GN3A 4FP3A 3LWCA 2VXRA 1FATA 2XVKA 4D8MA 4DIQA 4FPHA 1H9WA 3M3EA 3MIFA 1R64A 5GALA 1HXS3 2R043 5FKCA 3KGZA 1WMEA 2Y38A 4NOTA 3ZSKA 3I59A 3LFIA 3N9QA 4NPMA 3T09A 1BVVA 1OH4A 1XPWA 5H9SA 1YWKA 3UETA 2R0HA 3DN7A 1ZBE2 1G9FA 4KG0A 3VD7A 3PUQA 3WCSA 4PCRA 1YIPA 3PJQA 4XBNA 5DZFA 1NZIA 1XNBA 3AL6A 1C28A 5JI7A 2H6CA 4CU9A 3EHKA 1LCLA 3AZWA 1XC6A 2VZOA 3PURA 1S55A 4XUTA 3KS7A 4PDWB 3SITA 2R6QA 1VBD1 1AR61 2LALA 2VOVA 4DXRA 3FHQA 2R30A 3J7NA 1RUJ1 1H6XA 1VBB3 4KBZA 1H2MA 2X29A 4LBQD 5E16A 5FUIA 4YZ4A 1RTVA 2PQSA 2YYOA 4OMDA 3MW2A 3KT7A 4BISA 4Q4W3 2PHFA 1APNA 2OT7A 5DAXA 4AG4A 3FFZA 1WZXA 3FBMA 4LO8A 1RC6A 2D93A 1CAXA 3MW3A 4KU7A 4PIYA 5DPNA 5EYYA 1CIYA 3THDA 4CCDA 4Z2AA 2YG0A 3ES1A 1HQWA 2AC1A 4LHKA 5JLVA 1RUD2 1VAKA 1JZ6A 4JTNA 4BXFA 1LJ7A 2E31A 3BTXA 2ZHKA 3W58A 3LAGA 3VBRA 3WNMA 1UPSA 2TBVA 5K8SA 2VR4A 1VBE2 4QX3A 2F4LA 4TTGA 2VG9A 1IS6A 3W59A 1GQGA 3U78A 2R072 1QWRA 4FP2A 5FZMA 3VHPA 2HEYF 3AKRA 4LUKA 1W2OA 3UKVA 3IZOA 5FO9B 1UD1A 1IS3A 1YNAA 5JWPA 4ATEA 1GZWA 1JOPA 4P5YA 2RMU1 5F39A 1OKOA 5FMBA 4AAPA 3O0VA 2V09A 2VBDA 4WM8C 2E6VA 3RSJA 4FSJA 1C3HA 3EQEA 4B4RA 4CEYC 4QPWA 1S1AA 3WNXA 1S0FA 1RXFA 1V9U1 1WD3A 4WVMA 2FDGA 4M4PA 2J1AA 3ZXJA 4Q8KA 3U4XA 1EPWA 1LB2A 5LBFA 3VZKA 5DQ0A 2UU8A 5J48A 1VP6A 4WZCA 1OLME 4HK9A 5K0UC 1CN1A 1QDCA 4AL9A 5FOBB 1PNFA 4IL7A 1YIFA 3LEGA 4UFKA 5EWSA 1NCQA 3HQRA 3KT4A 3MICA 4PLOA 5H9RA 1X82A 3ZO0B 3OGVA 5J09A 1H2NA 3CZUA 4Y1ZA 2OA2A 2AZ5A 2VECA 2WZR2 4Y1XA 4JKKA 1YQ2A 2DYCA 5ACA2 4TSVA 4AW7A 1FPN3 3TRSB 1FOD3 3C7GA 4YGEA 3V56A 2F17A 2UWCA 2ZGTA 3DEMA 1TZOA 5FRAA 4FPOB 1UYZA 2DVFA 4ES8A 4GJZA 5IW0A 3ZFGA 4BK5A 5EPAA 2PLV1 2WT1A 3LEKA 5JPNB 2Y26A 1SLCA 1O8SA 4RD7A 5FYYA 3WF3A 5L7OB 2HYXA 1PIV3 4BQYA 4NAMA 3DGTA 3I3EA 3S7EA 4QDRA 1OT5A 4AEMA 4YPJA 3ZX7A 3WG4A 1LOFC 1SBEA 1AXYA 2J1TA 1QGLA 5DABA 1EV12 5LA1A 4UFIA 3T08A 2QQMA 1VB2A 2PHWA 4JHZA 2NM1A 4IEWA 1HB2A 3N4MA 4UXAA 3O1VA 2ZJCA 5DDJ2 3H7YA 4XUPA 5IK4A 4UFJA 3PTRB 1V6IA 5I93A 2G9GA 3BU0A 3VDDB 2IXLA 4JKLA 1UW8A 3ZFFC 4LPLA 1Z0HA 4BMEA 1DQ2A 2E63A 3NMBA 3POYA 1OA3A 2GSYA 4LBQA 1H9PA 1RUH3 1VLNA 2XUMA 3C7EA 4QU2A 1AYM1 2ZHNA 5CB7A 4AGRA 1WCQA 4QPIB 4XILA 2KXLA 4YYOA 3CF6E 4H2AA 3AKSA 4GALA 1LHOA 1SFNA 3ZN5A 3B3QE 2I45A 2D6KA 4O9GA 3WNPA 1U5ZA 1SLLA 1LODA 1W6PB 4J25A 4AVTA 3AYCA 5JIUA 2ZTNA 4BQ4A 5A3NA 3UL2A 5FY9A 4A42A 3V0BA 1CJPA 2WINB 5JVVA 4DPNA 1GFF2 3I2HA 4GKYA 2AENA 1FV2A 5DZGA 4CEYB 4ZS3A 5CAZA 5M0TA 3LCPA 3VKLA 3ACLA 3IN9A 1GSLA 1SPPB 4YGCA 5IAVA 1ASJ1 4YLZA 1H8TC 5IFPA 1COV2 1LR5A 4W6YA 3TB0A 5CKMA 2WL1A 2VTXJ 2TNFA 1QJY1 2PAKA 2RDSA 2WN3A 4LORA 5FV3A 3VBUC 2XDVA 4XVHA 3IPVB 5AVPA 4XF3A 2VZPA 2XGXA 3NAPC 3DPRA 4NWVA 4X6QB 1YQ8A 1G9DA 3JB4C 4NIDA 3AMQA 1EUTA 1NZCA 3LA2A 2NMNA 1KDMA 3KWVA 4QHBA 3SHRA 3KVBA 2BBVA 3MLJA 5LRSA 1XSQA 1GP6A 1BBT2 1YEWA 4QX8A 4Y1VA 4OUEA 1RUC1 4COVA 1AYN2 3OGSA 3ZN4A 3DF0A 3NW4A 4LOTA 4B7EA 2BPA2 1UY1A 2MPFA 2Y6GA 2YHJA 1ZZ7A 4B4QA 3WUCA 3K77A 2ZGMA 4QPGC 1YRZA 5B2GB 2A1XA 2RR12 1AR92 1AR82 5FYIA 3HN3A 2VTXA 4IE4A 4PDWA 1Q5OA 4LBNA 1PK6C 1TQ5A 5E8AA 4CDXC 1ONAA 3J4UH 1ZREA 2AYHA 1WWYA 2A6WA 1SCRA 3DECA 4E8CA 2C26A 5DUUA 5I0RA 3BTAA 1RMU2 2C4XA 2RS13 3T4VA 2ET7A 4I0BA 1CPNA 3RJRA 2V4VA 5DAPA 1DQ4A 3PUIA 2P1BA 4KG8A 1V00A 4H7MA 1UU4A 4AK3A 1VBA3 4NPRA 4R52A 1E5IA 1DGLA 1XB9A 4DUWA 3ZDSA 2XBO1 1F4AA 2E7QA 3OUHA 2PYTA 4KWJA 4ET7A 1VJ2A 4MGIE 5GZEA 3TAYA 5A6XA 3ZFFB 4QX7A 3GZEA 4QKFA 1VE0A 2ZABA 1ZZBA 4YWAA 2QZ3A 4HPKB 4MGTA 2JDAA 3KD4A 1YI9A 4L97A 4RFT0 1V6NA 5BNOB 1Y9GA 3OGJA 4GA9A 4LULA 5FP7A 4AQ6A 5HV0A 2GNDA 3W5NA 2HWE2 3GF6A 3WDWA 5C9AB 2BYVE 2GC2A 5FYHA 1XE8A 1MS5A 1NLQA 1WUVA 4OHXA 2GH2A 3H3UA 4HL0A 3LB9A 2WT0A 1OPOA 2WSUA 3VKFC 4IE7A 4ZY9A 1UIJA 2DTWA 3THTA 3ZYHA 3ZYRA 1H8TB 1RUOA 2Z4FA 2Z69A 2WYSA 5LW9A 1F31A 3BPSA 1QJX3 2RM21 3VBUB 3VN4A 3ES4A 3H8UA 2XHNA 5BNNB 1AUYA 3MGUA 5I8SA 1H1MA 4P9WA 3VLBB 4DO0A 3A23A 3J9SA 3URFA 2WIIB 2HWC3 5T3NA 3FFQA 1JZ7A 1BEV2 2UY8A 4FPJA 3BKZA 3NV2A 1CX4A 2GZWA 1MS3A 2EIBA 4ISQA 2RDQA 4CCLA 2CDOA 1F35A 5IVJA 4QD2A 2VZQA 1HB1A 4JV4A 1R1A1 4LE3A 4CE8A 1NT0A 3Q8FA 3O1SA 3WP3A 1VR3A 3I2OA 5CA6A 4XF4A 4OMCA 2JDMA 4QPGB 1JYTA 1A3KA 1L3JA 3RZGA 1RUE2 4O9EA 1QHDA 3FUQA 2GMMA 2DCKA 2IC1A 4MADA 1YJLA 1RUD3 4IGQA 1W2UA 3K4DA 3O7OA 1JOJA 2PXJA 2GH8A 3HPNA 5I8TA 3O1UA 2QQUA 2WFF2 2J7MA 3J8F2 1P8JA 4BE3A 2QNKA 2BNMA 1C8M3 1SHWB 3WW4A 4IGOA 2BEOA 1RYYA 3E5UA 2VBPA 1JS9A 5H9PA 2HWF2 3M3OA 1O5UA 2R073 5KHHA 1X7NA 3SH4A 1EPZA 2E51A 1H2LA 3RGBA 4AQTA 3AYEA 4I3GA 3VDDA 1JUIA 4MYEA 2XB6C 4IV1C 2BERA 4LR4A 1URXA 1OUSA 3SH5A 4ATFA 5K9YA 2XPJA 1F5FA 1TME1 1ENSA 2JG8B 2D44A 3I2JA 5F32A 2ZEWA 4V2VA 1MEC1 1ZYBA 4H14A 4YM1A 4EROA 2UWAA 3H1YA 4QPIA 5FYUA 4XTMA 3FJSA 1HJFA 3U75A 1SLBA 1S0CA 3AZVA 4P08A 1JHJA 2D43A 4CCEA 1T6BX 4IEQA 2GMEA 1YI7A 2WN2A 2YROA 3JBG2 4CCMA 4XFGA 2YBKA 1W6PA 3JD71 4DUVA 1OPMA 1I5PA 1XNAA 3M1HA 4Y3OA 4C0BA 3TEWA 1UWWA 1W0PA 5A32A 4HANA 3ZXLA 5BNPB 3UGGA 2BUKA 4CEYA 4INDA 3OGRA 4ZU7A 4FPEA 3O1RA 1SFPA 1ULOA 3WLUA 1VBC1 2IFWA 4O61A 5IYYA 1SPPA 1PZ9A 1PGSA 4CSWA 2XONA 5ACA3 4EZ4A 3TEZA 2JKBA 3KVAA 1OFSA 3POJA 5AVAA 2Q8CA 1U5YA 2HJIA 4Y5SA 1N1TA 2ZBJA 3BODA 3D82A 3IPVA 4I3PA 4JX0A 3T2PA 4BA6A 4DNYA 5KHJA 1JMUB 5JOXA 2VOWA 5CU1A 2OQ6A 3WT3A 4S2HA 5F7UA 3ME2A 1H8VA 2DUPA 2IUWA 4MGYE 1NQJA 4YM3A 5I0DA 2PTMA 3HMYA 1HXS2 1VMFA 2R042 4YW2A 5FP9A 1J84A 1UKRA 1NA1B 3JZVA 1WD4A 4GH4C 4GQ7A 1C5HA 2JD9A 4P9XA 1TNFA 1WW4A 4Q29A 4W6XA 1EV13 1ZZCA 5C8WA 2X53S 3I7DA 3AP7A 4NHYA 3OGGA 4XJUA 3D0SA 4S2DA 2CGOA 2BWCA 4HZFA 4JGYB 4HLTA 4UBGA 2Y0IA 3O12A 2YB7A 4AF9A 1JYVA 4FAGA 1SDWA 1ZBA2 3WF4A 4Y5TA 4HBNA 5GM0A 5LASA 2WWUA 1SLIA 3HOBA 1IGOA 5FDBA 2YY1A 1O8PA 1J1TA 2E7AA 1Y9MA 3LSEA 3VBRC 3LIGA 5FXZA 4XBLA 4H55A 2ZXQA 4HVRA 3UJOA 4AEDC 2WNEA 4DRRA 2W2IA 1G9AA 2A3YA 2XOMA 3WZ1A 4YZ1A 2VVFA 5GLZA 3AMMA 2RJLA 5FZKA 4QXHA 1KEXA 4MXWB 1DZTA 2VTFA 1GNYA 1ODNA 2ARAA 4Y1YA 3T0DA 4P02B 1WMDA 5GLVA 5GZCA 2RG4A 1W8HA 1UPIA 2WAAA 3LPFA 5DUXA 2NP0A 1A78A 1SLAA 4XTPA 2OZ6A 3ZFFA 1JU4A 2Q5TA 4XUOA 3N7LA 3ACGA 3G7DA 4XQ4A 1EAH2 1PO21 5FUPA 5F3CA 4NWWA 1QJU1 5BNOA 4W8JA 3WDVA 2JDKA 1A8MA 1COV3 1K42A 4XURA 5C9AA 4K6BA 4XJAA 5KXEA 4EWAA 1JYIA 4XMIA 1AVBA 1JHNA 1Q8QA 5T52A 2SLIA 2FDKA 3C7FA 3KCCA 1OURA 2D6LX 2Q0AA 4Q0UA 3WP5A 3E1F1 5BY5A 5D21A 3VBFC 4B7KA 1ZRDA 4FO9A 4CCCA 1W8WA 1X9PA 3D3AA 1PVC1 1UY0A 3NSTA 1H8TA 1RJ7A 4M0NA 1QDOA 3CO2A 2YFUA 1AYN3 4LTAA 1POV0 3VBUA 3CEWA 4L92A 3ZXFA 2MEV2 2BVVA 5BNNA 1Z7S1 2PHDA 1RVF3 1ENXA 3KCXA 3WP6A 5C4WB 4W4ZA 1UYYA 1LHNA 4Z82A 1QOTA 4PBOA 3C8XA 2ZX4A 1AR93 3BUCA 2OKXA 1MQTC 2P37A 2A71A 3Q8AA 1UF2C 5LRRA 4Z07A 2W68A 1ND2C 1OF3A 1ZRCA 2WNUB 3Q9OA 4I0WB 1YO8A 2PA7A 3D6EA 3R0RA 5EQUA 3ZXGA 3SH3A 1PIV2 4N7IA 1TNRA 5IK5A 3N9LA 1WW7A 4QPGA 4C91A 3U4SA 4YW7A 1YCIA 4N43C 2Y0OA 4EZHA 2I2SA 1HW5A 4BHPA 1HRV1 4OLLA 3RYRA 3EBRA 5CEHA 1QJZA 1ALYA 2J22A 1XNDA 4LO5B 3F2ZA 2JJ6A 3THCA 4URAA 1CZSA 3W5MA 1T6GC 4COWA 3MPPG 5A6YA 3UT0A 2XLGA 2C9KA 2JG9B 1O3TA 4FTBA 2VJXA 5FY0A 2CV6A 2PHRA 4PIXA 2ZMNA 5FP4A 5ANNA 1FNZA 2GC1A 4CXYA 1BVP1 1UN1A 4LUMA 1NE6A 2JG8A 2XJPA 4I30A 4E4SA 2XJUA 1RUH2 1GYKA 1AR71 3IWZA 3U11A 3BCWA 4M3CB 1MS4A 2NMOA 5AC91 2FMYA 2P5BA 1M06G 4RHV1 1UYPA 3U0ZA 2WWSA 4KU8A 1RIRA 3TNQA 1DZQA 2J1VA 3SCFA 3T2TA 4CU7A 2QDNA 3OEBA 1ZBE1 1OA4A 2ZX0A 1OLQA 2OS2A 4TXWA 5JR7B 4Q0QA 3FLTA 3W9AA 1V6LA 2BNNA 3MF6A 3MFCA 5BNPA 2DVBA 3S0MA 1PMIA 2KR2A 3AZZA 3I3QA 2XUEA 4QM9A 1H4HA 5CADA 3AXEA 4GZ9A 3JU9A 1E5SA 1WA4A 1OVPA 2VNRA 2P6HA 1FMD1 2WNVC 3O0XA 4BQ3A 1JZ4A 1BEV3 3P3NA 3VBFB 4AVBA 2IXHA 1DIWA 3WP4A 1W39A 4ISRA 4Z92B 5HBAA 4Y4RA 5CIRA 2LS6A 3GM8A 1DHKB 3ZKUA 3M3IA 3ILNA 4Q4X2 5A3MA 2BRTA 3WDYA 1YC61 4BIOA 4QKDA 2BFUL 4PDWC 1AL21 2BWAA 2FCTA 2VVEA 2IXIA 4YGDA 1JYXA 1W05A 1NA1A 3KLSA 5C33A 2RS53 3P5BA 1LOCA 2JXAA 4IQPA 1MQTB 2VPVA 1DQ5A 1JU3A 1ZRIA 3AVSA 3FL7A 4IUGA 4BQ1A 5B4NA 2ILMA 3OBRA 2LW8A 3LOBA 4XZUG 1ENQA 1ND2B 1BXHA 1RUG1 2ZGSA 3HD8B 3KV4A 2WFF3 2HWB2 4JGYA 4GWMA 3ON7A 1PO11 2DV9A 2ORXA 2ORZA 4FOVA 5FYVA 1UY2A 2WZ8A 3RFRA 3GGLA 2EALA 1ZX5A 3RWKX 3RWNA 4E8DA 2MHFA 2RVAA 2V72A 4N43B 5F9TA 1DBNA 2XQRA 3CHXA 4Q4Y1 4QT6A 4AI3A 1Y9QA 2ZHLA 4S2GA 2QQKA 3MBWA 1S0GA 2VM9A 2RS12 2QQLA 2X8KA 4N8MA 4ARYA 3K4ZA 4XFIA 3S5QA 4JDOA 4Q4V2 1O4ZA 1POV3 4TN7A 2QQNA 5FREA 4QM8A 2YGLA 3HT2A 4MXWA 1VBA2 3JBG3 3HWJA 1JODA 1GP4A 2CY6A 2DUOA 1YFYA 2YU1A 5D8AB 1DU3D 4B3NA 1IPJA 4FOQA 2DBNA 3R4SA 3SLIA 3BGAA 1ST8A 4KQ7A 2G19A 4KL1A 4OZOA 1HN1A 4DRVA 2WT2A 2JDZA 1MS9A 2WWJA 1JH5A 3GBFA 2WZPP 4IEXA 5FOJB 3BN6A 1SACA 4RGGA 3B94A 4SBVA 3WR0A 2HLEA 2P3YA 1XSRA 3ZOIA 1FAYA 2ZAHA 2ZACA 4UOJA 2BFUS 1J83A 3MW4A 3EMRA 1FV3A 3FBYA 4GULA 4CP0A 1XNCA 3NVCA 1OLRA 1RUI2 4MZUA 3ROUA 3VB9A 4L99A 4CCJA 1VAMA 2VUCA 2W91A 5FYMA 4DY5A 4LIVA 5F2WA 1EP0A 2DUQA 1W8ZA 3H7JA 3TEXA 4QXCA 2CAVA 4DMIA 1MZFA 2WNVB 2F4PA 1WCUA 2WA4A 3QCWA 1R081 5FP3A 2VQ0A 2FQPA 4E4ZA 5IVFA 5JSOA 2BGOA 3V0AB 1QJX2 4AFDA 4LEJA 4Q26A 4MHRA 3LD8A 3JQXA 2WLQA 1GZCA 5L7OC 4FPGA 2Z5WA 5C4WA 3USSA 3O1PA 4J1WA 1BYHA 4BU2A 5K7PA 1LU1A 5BPXA 1QNYA 2QVSB 2HWC2 4AHZA 1ZBA3 2HWD1 1GZTA 1O3RA 2DCTA 1PMJX 4GWIA 5FFOC 2RJ2A 4AAXA 1KS5A 5IK7A 1VRH3 4GH4A 4Z8BA 1A34A 2WNUA 3I3BA 5EJ3A 4CDXB 4YW5A 3JQWA 1MVQA 3AB0A 1LENA 4NRPA 1UIKA 3DYMA 4PT6A 1GOHA 1F2NA 3NV4A 2CSGA 3OBZA 1KJRA 4HK8A 5C8CC 3VDDC 2XLFA 3DYOA 5FXXA 1NX9A 1ACCA 1IOAA 2W08A 3ORJA 1B09A 2YXSA 3OG2A 4IEUA 3I3MA 4NN0A 2P3JA 1G6NA 4QPIC 4COUA 1C8M2 1D2QA 3A4UA 3ITQA 3POEA 4XXAA 4AEDA 1IPKA 1DGWX 1QQP1 3CQOA 5T5LA 3RZLA 1X33A 4AVCA 1JBCA 2QCSB 1EAH3 5IATA 2XJVA 4J6GA 4RSUA 1W03A 1R092 2GC0A 2JG9A 3GZTB 5FZIA 3PU8A 2WA3A 3GNEA 3OY8B 4XZPA 1QJEA 4B1MA 5FLIA 4EYUA 1Q8PA 2IVIB 4G9SB 4OQ9A 2VQTA 3IB3A 4I0AA 5FLJA 4EN7B 5C5TA 1HRI1 1MR5A 1RHI1 2ZOEB 4M3CA 1BBT1 4MGSA 2ARXA 3GCXA 4P9YA 4Y33A 1PGW2 1TVGA 5FPZA 2BBAA 1FNYA 2YC0A 5CKQA 4QAWA 5C71A 1XJAA 3MZHA 5F6LB 3R05A 2VUDA 1GWKA 4OI2A 4XDQA 2MEV3 2DFCA 4QMAA 1AR81 4QWNA 5FJKA 4QKBA 5A3LA 5KBFA 2XJTA 1NXMA 1XBFA 3SXWA 1PX4A 4CEWB 1EY2A 2VNOA 1REDA 2P6CA 5FAXA 1VALA 1LOAA 2B9VA 3OYWB 3VBFA 4XUQA 2JDUA 3LGRA 1UY4A 4CYDA 3OPZA 4YG3A 4YW6A 2VUAA 1AZDA 5FZHA 2H6BA 5LB6A 2G9ZA 3WX5A 1GKBA 2VOXA 3RZKA 3VD5A 3BVCA 4EV0A 1W3VA 3ZN6B 3C7HA 5FZ0A 2OXBA 4DXZA 3S5AA 1NXD1 5A7OA 2DBIA 3KB5A 3MUY1 1OXCA 1NY71 3LEMA 3P1IA 2D6OX 2R16A 1SFYA 4UF0B 3IDBB 3KHCA 4ZZ5A 1WA6X 5IVEA 3IM0A 1MQTA 2YPDA 4KBBA 4F7ZA 3ZPYA 1WLCA 2JEMA 3K75B 2GDFA 4JHTA 1RUF1 4XAAA 4CDQC 4BQXA 4GIQA 1ND2A 3S6PA 3AP9A 4HN0A 4YSFA 4HKWA 2N7GA 5JUVA 2HBTA 4RS5B 4CDUB 1BMV2 1ZRRA 1AHSA 5FYSA 1OSGA 4ARXA 4LBKA 3PVBB 4N43A 3G6JB 4XCBA 5C8CB 2Q4SA 4PLNA 2XH6A 3GJAA 4GB33 3TNPB 3UNPA 1W9FA 4QGNA 3D0JA 2ZGQA 4FOYA 1W3XA 2VW1A 3E97A 2XVLA 2Q1MA 1PZ7A 4FFIA 4QDSA 3WUDA 3BB6A 2D3RA 5BNOC 4YVWB 5CVRA 2BJSA 3B9CA 4XF9A 5ABJB 5D8AA 5C9AC 5IVBA 2LM3A 1J3PA 4NHXA 1WKYA 4JVAA 4XJZA 1OC1A 4FVVA 4QQPA 4KH9A 2FD8A 2ZKLA 1T2XA 1VBD2 4D6QA 5JZGC 1PZ8A 4CU8A 5JOYA 1AR62 4KMQA 1RUJ2 2Y60A 3CIHA 1CZVA 2XJSA 5A7PA 1CAUB 1GQPA 1O7FA 2NZ9A 3T2QA 2UWBA 2NN8A 2WO1A 4CXXA 5DUWA 2VAUA 5EJZB 3QD6A 1OF4A 3DL3A 3JCIA 3MV11 5BNNC 5FZ6A 2ETEA 2DU1A 1I5ZA 2GALA 1IPSA 3R6SA 3AFKA 2GU9A 5CNAA 4P5HA 3CNAA 1ZZ6A 4UW5A 3I2FA 4LK7A 4Q4X3 1BZWA 2VMDA 5KHGA 1KDKA 5FP8A 1RUE1 5GZGA 3OSDA 3M8LA 2WZEA 1YQ5A 5LCWL 1RB8G 2XR4A 1GICA 1W2TA 1C1FA 2WNVA 2W39A 1N3OA 4D6SA 4F8AA 5KXBA 2J42A 3TN91 3V0AA 1DG6A 3TYJA 3WNOA 2XKOA 3VD3A 3AKQA 3LQCA 2FDFA 5FY4A 1RVF2 4X8PA 3S7IA 2HWB3 2VZ3A 5FWJA 1HB3A 5KC5A 2YU2A 1RINA 2EXIA 2R32A 4PJYA 2B45X 2RMU2 3CLPA 1OLMA 1S2EA 4IEZA 5DN2A 4JQRA 3CJXA 3PVOA 3ILFA 3WW1A 3PU3A 1POQA 4PQ9A 4YW4A 1ULFA 3UKTA 1W9SA 2QFEA 2QQPA 2JE9A 5JOWA 4CDXA 5FZOB 3MEPA 3AM2A 3EJKA 3N9PA 4CDQB 3KGLA 3AX4A 1US2A 2WR9A 5F5QA 1O91A 2IXKA 4R9DA 5FYBA 1HB4A 3RMYA 1K5MB 3IBMA 1WCKA 5FMCA 4Q4V3 3H8RA 3OPTA 1AX2A 5FCCA 5FYTA 4E27A 1KITA 3RRDA 2B4KA 2DF7A 4NHKA 3IMMA 2JDNA 4I2OA 4ZHNA 1S0JA 1OQDA 2JD4A 2JG8C 3ZYJB 1HN0A 4AE2A 2NLRA 5GLTA 3M4FA 4EJRA 2RS31 1C8NA 5A3TA 1PVXA 4B1LA 1LNSA 3RNSA 5HI0A 2Z2SB 4QU1A 3A22A 2BDRA 2CWMA 2K9ZA 1UXZA 2B8MA 1AXKA 4XFFA 1HLCA 1RXGA 3K4AA 3O1OA 4K21A 1X9TA 4LO7A 5FXWA 1JUHA 1LOEA 3KV9A 4L11A 4OZXA 4YG6A 4D7YA 2PLV2 5KHKA 3MHZA 1GP5A 2HBUA 3OY8A 3AL5A 4AHWA 2VY0A 3VUOA 3WDUA 5BNPC 2WO2A 1RUI3 3WXPA 3M2MA 3LA7A 5FZ7A 4B29A 1HXS1 2R041 1QH7A 5AFEA 2LROA 3LKJA 1CIWA 1KS4A 5JZGB 3LDBA 3VKMA 1JI6A 4XFCA 3ATGA 4R8HA 1ENRA 4BQWA 2P4EA 4F3JA 4D3WA 3N9NA 2R063 1W90A 2VOKA 5F3GA 5FMDA 1K5JA 5IVCA 3JXSA 3MPBA 5EXOA 4D69A 4META 5E88A 1QMJA 4A45A 5A33B 4CEWA 2DFBA 1Q8VA 2QUOA 1VAVA 4O7XA 1NA1C 3MLLA 1FT9A 3QACA 3OYWA 5A6QA 1VBB1 5FZLA 3ZSJA 1HV1A 4BQ5A 2ZGPA 1J58A 1JYCA 4TZDA 4XXPA 2HH9A 1AR73 1AYM2 3I2GA 4LXLA 3K3NA 2ADEA 5HCFA 1DQ1A 4E4DX 4Q4W1 3WQ1A 4JGYC 3IAQA 4XETA 3ZSMA 2NPIA 2ID4A 4MH0E 5J7MA 4CPBD 5L7OA 2VE1A 4K7JA 3OBAA 1S0IA 4H7LA 2Y6JA 5LK7B 4G4FA 4UF0A 2RS52 2BTVC 1PNGA 3KQRA 3PUHA 4XJ8A 3GXUA 2P2KA 3AMHA 3RZHA 2DCJA 2VMGA 2PHXA 2FCUA 3B00A 1S0DA 5E6HA 2FBEA 5HCBA 2EXKA 3N36A 1W8FA 1BCXA 1XYPA 2IZWA 3WW2A 5FZ9A 4RS5A 4Q0PA 4CDUA 4CP9B 2EXHA 2Q8EA 2YC2A 3Q8BA 4QB2A 4IDZA 1R093 2DTYA 4O65A 1G8WA 3F95A 4A7YA 5C8CA 1D0GA 3HNYM 3VKNA 4K3UA 4I02A 4MO3M 1D4M3 1SBFA 1UAIA 3PIGA 4PBPA 5CG9A 3VL8A 1AL23 3GJBA 3T3YA 5EHDA 2VZ1A 4D94A 1CX1A 3A0KA 1B35B 1SEFA 3QBQA 1NG0A 1YJKA 1PM4A 4GAZA 5IFTA 1LULA 5FZFA 4YVWA 2B7YA 2YMZA 1XQNA 2O0OA 5FY8A 5ABJA 2WYFA 1HIXA 2X5IB 3SCGA 1YLLA 1CZTA 1SMVA 2OUHA 1BKZA 3EO6A 4WM7C 1ZNPA 5FYZA 3B9IA 4FPLA 1DP0A 4AFBA 3WDTA 3U10A 2ZGLA 1QF3A 4XYXA 2YUEA 1FPN1 4L0PA 1FOD1 2WNOA 5APAA 3VBHB 4GMP1 2W9XA 2KA3A 4Q4Y3 2CWSA 3B69A 5FBZA 1CAUA 3NJYA 2D98A 1XYNA 4XCAA 2HYKA 2IFRA 5A1FA 1BJQA 1XU1A 1XXNA 2PELA 4XC9A 3FN9A 3J7LA 1K12A 1TMF3 2CGNA 3PLQA 5EFUA 1Y7BA 1PIV1 5C4WC 4GKXA 1KQRA 3PUSA 2HKXA 2D3PA 3HAGA 3H9AA 5IAXA 4OVEA 2PMWB 2A3XA 3NL1A 2XBO2 2D40A 1LGNA 1UO9A 1I9RA 4NUBA 5BV6A 2BU9A 5KXCA 1EUUA 4BWOA 2XJRA 3JUUA 2WNUC 2CDPA 2XXZA 4CUAA 2JIGA 3WOGA 1BK1A 2VZUA 2UYAA 3ZIXA 1UZ0A 2XJQA 5L9VA 2Y6FA 2BGPA 1QU0A 1CPMA 4CP1A 4RQPC 4BCUA 1O3SA 1IS5A 3V65A 1DFQA 1SCSA 3KSCA 3OOXA 2A70A 4XPVA 4NROA 2PFWA 4AGGA 4QQHA 2WS93 4I09A 5JXIA 3MUZ1 4TWTA 5FY7A 1CAVB 1VRH2 4KGQA 4QXBA 4AI2A 2RDNA 2VH9A 2VVDA 1RUH1 3TOJA 3BPZA 2R1BA 2W1WA 5FZOA 5JR2A 2JX9A 4CDQA 3MIEA 2JENA 2AACA 3E6BA 3MF9A 5JDBA 3VD9A 1O59A 4DQAA 5FZ1A 1K5MA 2BW8A 4XQWA 3RZZA 4CUCA 4NE9A 1HQNA 5D1IA 2JG9C 2R7EB 5F5IA 1UXXX 5KHIA 1ZZ9A 1GU3A 4NR1A 5JAXA 2JECA 3ASIA 4M0HA 1HJGA 2HWD3 2WKKA 3H3ZA 3ZLIA 1CAWB 2WFPA 4BLIA 4IE6A 3AZYA 3E5QA 1VBD3 1AR63 3I97A 3N7MA 2VMFA 4HPKA 1UMZA 4WZFA 5T5JA 1NYWA 3AMNA 1O5LA 2DCZA 2W47A 1RUJ3 3J26N 4FPFA 1QXRA 3BOWA 3DYPA 4XW3A 1R1A2 1V6OA 4XACA 5A7QA 1C5IA 1CJDA 5FK8A 4UFMA 4FOWA 2UY9A 4Q8LA 4IXLA 4XE9A 4Y5Z0 2PN5A 4CUGA 4PHZA 2Y33A 2J1UA 1DGWA 3X29B 3AZXA 1OQEA 4WM7B 3HQUA 1NLRA 1U0AA 2QTWB 4BOWA 4FAHA 3ZYIB 1V70A 2JDPA 3CJIC 4DXTA 4PF1A 5JZGA 4R4ZA 2QQWA 1V0AA 2R1DA 4UW4A 2ZAAA 4LK6A 3EYPA 3VD4A 1J3QA 4NVPA 4NIAA 3WDXA 3NV1A 2AREA 3I2DA 1U5IA 4A6SA 1XE7A 2XWBB 3INAA 4NHLA 5EIYB 1W9TA 4HG6B 5A70A 1G7YA 4DXSA 1KRIA 2RMU3 5F6KA 1UOFA 2ZGRA 2WO3A 3LFMA 2GMPA 5C6CA 1TEIA 1TME2 2EVXA 3I49A 1HRI3 1V9U3 1MEC2 5FQ0B 2WQZC 4CRQA 2RS11 1YYNA 3PDQA 5FWEA 1SG3A 1XNTA 4RGAA 4N53C 2G9FA 2YFZA 4AGVA 2IXCA 2GP3A 3JD72 3C3VA 5GLWA 1HQLA 3N3HA 5F5CA 5FY5A 4RQPB 4E4HA 1LOBA 3T0AA 4MVTA 3VHOA 5D2AA 4QB1A 3R4DB 4COZA 4ORFA 4M01A 1EYBA 3KHBA 1VBC2 2Q30A 1FYUA 3DUIA 3NWKA 2D5FA 1Q8OA 1UX7A 4QPYA 2W5FA 1XOYA 3ZVXA 1I3HA 2Q8OA 4CP9A 5IVYA 2VZSA 3POWA 5D8AC 4YGBA 3KV5A 1CONA 1KJLA 4QX0A 4Q1PA 4TLGA 4CU6A 3E6DA 2PLV3 2E7TA 4JRLA 4PQQA 4LO4B 4GB32 5C70A 3WNLA 1UMIA 3ENRA 3AYDA 2JDHA 3OBTA 5LBEA 3UJQA 5CG8A 1GWMA 4HKOA 2QQJA 3MIDA 4NAOA 3POSA 4G3YC 5FO8B 4XEZA 3ACFA 3HR9A 1B35A 2EAKA 2YZ4A 4R9CA 2OIIA 3OPWA 3WQ7A 5JXGA 2FHRA 2I74A 4M4RA 2JKXA 3I4IA 3ZYGA 4Y24A 1GZ9A 1UCXA 2ZX3A 4QX2A 5FZEA 4N9HA 4DB5A 2X5IA 2W92A 1O6UA 3GHNA 2WAOA 3AP6A 3ZFEB 3VBSC 1J59A 2TEPA 3FUOA 4DINB 4NMIA 3USUB 5C3OA 1PGL2 4F83A 4ITCA 1UZVA 3VBHA 4URTA 3CU7A 3FHIB 5GZFA 4YVSC 1CR7A 3CJIB 3ALQA 3O0WA 3UESA 4OHYA 1LGCA 3AP4A 2VMEA 4BYYA 2RDRA 1AYM3 4IE5A 2VCMA 4LBJA 4XF0A 3BTYA 4BH9A 4FCAA 4XAEA 4JKMA 3VBOB 1OI6A 4FTEA 1R1ZA 5CBLA 4P9GA 1UU5A 2R0FA 4UWDA 1WBFA 2YGMA 2Z42A 1RUD1 4YW1A 4IV3C 3FLRA 4XHXA 4XOGA 4NIIA 1N3QA 1W6QB 3I54A 2OYZA 4EN0A 4MXVA 5F37A 3KQ4B 1VBE1 1C8M1 3RPQA 5F5AA 2D6NA 1PO22 5FKBA 3OB8A 3BI3A 1QJU2 2R071 1ASJ3 2YC4A 3B5LB 4N53B 5BYNA 3WF1A 3HNMA 1E5HA 4XDOA 1U5XA 1QJY3 4NJ4A 4V2WA 5I8YA 4KWLA 2EIDA 3B93A 1CAVA 3KF5A 4YNIA 3NJVA 5IT6A 5FZGA 5T54A 1CESA 3BALA 3R4UA 3O5SA 3RZJA 4K40A 1WMXA 2DCYA 4OUMA 2CTVA 2UYBA 1MPXA 2XG3A 3I3DA 5A3UA 5HV4A 4FFGA 3KM5A 1Q56A 1PGW1 3LSDA 1I6XA 1RUC3 2VZVA 3CMGA 2ZMLA 5L19A 3DKWA 3NJXA 4NHMA 3WY6A 4V1PA 1Y4WA 2EIGA 5JXJA 3O1MA 3NNLA 4MGQA 2HEVF 3HNBM 2J1EA 2VW0A 4ZXEA 5E1RA 5CZKA 5FTTC 5AFBA 4MOAA 1CAWA 4IGPA 4RFRB 4UFLA 2WZR1 4IEPA 2IXJA 1HDKA 1NLSA 1RL3A 3E5XA 4D7SA 4ES9A 2ERFA 3WSOA 3M7AA 5ACA1 1F9KA 2VC9A 2Y6KA 3AK0A 4HETA 4UT5A 4HKLA 4BB3A 3GHMA 4DY3A 1D4VB 4GMP0 3RG0A 1W6MB 1W04A 1RJ8A 2WQ4A 4R9BA 2XWJB 4C8DA 3VDBA 3DXUA 4IEOA 4WM7A 5FPXA 3VBSB 3OD0A 3MI8A 4Y1UA 2J1RA 3MYXA 1W8NA 1K3IA 1F5JA 2X09A 3ZIWA 4CEWC 1ODMA 2AEZA 3VGIA 1HRV2 2A6ZA 1EV11 2LUWA 2XBO3 4DOUA 1JZ3A 2XQXA 3O14A 1F15A 3SMHA 3H0OA 4YVSB 5JIAA 5JOZA 4UI9L 3PIJA 3RDIA 2WUHA 3DV8A 3VZJA 2R062 5DDJ1 1ULCA 1QNWA 2WLPA 3WQBA 4A7ZA 1OQ1A 3J7MA 4X6RB 1LRHA 1LKNA 3MFAA
chains in the Genus database with same CATH topology
4JGZC 1SQ4A 3U07A 2YDEA 2ATFA 1NCRB 2Z79A 4WVVA 4R4XA 3PNAA 1RUNA 3DPRB 3B7MA 1UZZA 2EF6A 2QJVA 4IV3B 4HT1T 4C90A 2VMIA 1AR72 5FQ0A 3HBZA 4GXLA 1DQ6A 5AC92 2RE9A 4RHV2 1OMIA 1I1EA 4CDWC 2ES3A 5BUVA 4RS5C 2OPKA 4LO6B 4CDUC 4PLMA 4RQPA 3M3CA 4EWDA 2FMDA 4H3WA 3UKNA 1H4GA 2C9AA 1ULEA 2RM23 3HQXA 4RR3B 5DZEA 2QE3A 1UKGA 1XNKA 2VQAA 2A5ZA 4IERA 5SV5A 2Q1ZB 4LA3A 1FMD2 3BOPA 4YVWC 2O1QA 3OF1A 1COV1 4QXKA 1UX6A 4OFGA 5ABJC 3L2HA 5JPMB 1R1A3 3OCPA 1QY4A 1WLTA 2H0VA 2F6BA 3NKGA 1D4M2 5JSRA 4XIOA 4FT8A 5KC6A 3HT1A 1AL22 4AI1A 3JB8A 4OULA 4Y26A 4D7TA 2MNGA 2E53A 3IKWA 3L9JT 1G9CA 4Q2FA 5T50A 4YFWA 3IIAA 1AYN1 1RUG2 1H0BA 5HCAA 2GNBA 5CFCB 3ZFEA 1PO12 1RVF1 3WV6A 2RR11 1AR91 3USUA 4A3XA 4AI8A 2C0ZA 3MIHA 5LEKA 4Q4Y2 3RQ0A 1LHVA 4QQ2A 3RJ2X 3ZMOA 3CJIA 4MSVA 1TME3 2PAMA 4W6WA 2A6XA 4M00A 1MEC3 1TMF2 1RMU1 2GAUA 4HSJA 1WCDJ 5DG2A 3VBOA 4PF5A 4EN9B 4JGZB 3M70A 2OVUA 3WCRA 4E2SA 3JD73 3FWEA 5DXDA 1QOOA 2K2SA 4XHBA 1S0BA 2VNGA 3FZ3A 1W6QA 3AKPA 1Y3TA 3T1MA 4ZXKA 2CGPA 1VBC3 3LOIA 5J3UA 4GMP3 4XIKA 1K5MC 3WW3A 2A75A 4CDWB 3THPA 4N53A 4W65A 1CVNA 2HWE1 2WS92 2XL7A 4Q1RA 3RYPA 1GNHA 4A7KA 1Q43A 2GNTA 4AHYA 1LECA 1KFXL 3KZ4C 2ZCWA 1D2SA 1PM7A 1V6JA 2C5DA 4FTSA 1W6NB 4QX5A 3WHTA 1YUDA 4PIZA 2AGSA 4K20A 4C1WA 3VHRA 1R082 3KMHA 1YFXA 1AX1A 3ZYPA 2VGDA 4EN8B 2R49A 2H0BA 4YARA 1N1SA 4COYA 4IEVA 3APBA 4CP2A 2LTNA 1ND3C 1O4TA 1YHFA 2HWD2 2B39A 2P17A 1BEV1 4Y22B 1LTEA 2XL9A 2ZHMA 4HVQA 4YM0A 3NO8A 3T1LA 2VMHA 2ZGUA 2WC2A 1W6MA 4C0HA 3GBWA 5F1RA 3FX3A 3VBSA 1MZEA 3HN1A 3MIBA 1CGPA 4OI4A 5A32B 2SBAA 1UU6A 4WM8B 1DF0A 1JTZX 1QKQA 2RS51 4AHXA 5KWRA 5IK5A 4HFSA 2PHLA 1KFUL 4YVSA 1GBGA 4XJ9A 5JSPA 1VIWB 1IKPA 4I01A 2WFF1 4HSLA 3BIWE 5HXVA 3J8F1 1QQP2 5JI9A 3D4KA 2V5YA 4FPCA 1REEA 3NJZA 1PO23 5K0UB 1DYPA 1QJU3 2HWF1 1NCRA 3RS6A 1J3RA 1V6MA 3CL1A 1IZ3A 3EXUA 1LESA 2RJKA 4XFBA 1ZRFA 1UZYA 3IDEA 1Q3EA 1HRI2 3L2YA 4IV3A 1V9U2 1RHI2 5BNQA 1HX6A 2FZ2A 1FX5A 2P34A 3ETQA 4MGZE 3TWIA 3ZSLA 1POV1 5I0SA 1MS8A 5IUQA 4N9IA 1PVC3 2ZGKA 1RITA 3JBG1 4L2NA 4QGLA 1HV0A 4RR3A 4XBQA 3ZXDA 3PVNA 1PHMA 1Z7S3 3QOPA 4EN6B 5CFDC 1B35C 1KD7A 1GNZA 2ARBA 5GJ6A 5TSWA 4QQOA 5GZDA 3N7JA 4OI0A 2CAUA 3UV9A 1X8EA 4JDNA 1WGPA 5T55A 1N47A 2X5IC 1YFWA 5EYXA 3VHNA 5J96B 2ZGNA 3D5OA 4JRAA 2ZMKA 3UK9A 1OD5A 1NY72 3VBHC 5FMOL 4M3CF 1ND3B 3AXDA 1RGSA 4AXOA 1G86A 1WCSA 1HRV3 2QKDA 1RUF2 2O8QA 4YM2A 1IHMA 2WSVA 5CFCA 2D6MA 1WW5A 1OA2A 2E9QA 1GR3A 1W6OB 4XQDA 5I91A 3WG3A 1ZBA1 3HIFA 1OOPC 1FI2A 2DVGA 4MLOA 4WVWA 4JTOA 1VRH1 5T5OA 1FXZA 2CL2A 5E89A 3MIGA 2FZ1A 4LT5A 1DZRA 3D8CA 5AC93 4RHV3 3ZN6A 4LBMA 4MV2A 3WVJA 1OHFA 4JGZA 4XFAA 4AI0A 1ZBE3 3PMSA 3RMXA 4UW3A 3ST7A 1UL9A 4ZKTB 3NAPB 2NQYA 1REFA 2D3SA 4ONUA 2ET1A 4XFHA 2VW2A 2YV8A 1F8VA 5L73A 1ASJ2 1EAH1 1FMD3 5T5PA 4CDWA 1XYOA 1OKQA 1KXGA 1QJY2 5FMOS 4GWNA 5FO7B 4QQLA 2PAEA 1E57A 4OHZA 1O4YA 1C1LA 2EA7A 2JE7A 2ZX1A 4ZU5A 5BXXA 4LHLA 4TLFA 4LA2A 3ECQA 4FXGB 2ZGOA 3GYDA 3FLPA 4X8NA 1DGRA 1LGBA 1PK6B 3TBDA 5CFDB 1W6NA 5I0UA 3H50A 1RUC2 3PJYA 3TN92 1GV9A 1VBE3 1RUG3 1H2KA 5LEJA 5I0TA 2MEV1 1Q8SA 1A8DA 1PO13 4P9JA 4XMAA 1W0OA 2AUYA 1JW6A 4Q27A 4Y22A 3AYAA 3S30A 1O3QA 1HKDA 4E2QA 3FE5A 3PVEA 4AQSA 1SLTA 1X8MA 4OHVA 1LEMA 1D0HA 5J36A 4P9LA 4DS0A 3GZAA 1XU2A 4E2GA 3H1MA 1WLDA 1WMFA 3WQ0A 1ULGA 2K0GA 2O8OA 1N1YA 3FMGA 4Y20B 4B4PA 1S0EA 4ZU4A 4WM8A 1X50A 2ZPXA 1OOPB 4FPKA 2BGCA 2WJSA 2RS32 4JC1A 1H30A 3VZOA 2WZR3 4TYSA 5H9QA 4FBFA 2DVDA 2HEWF 4YFZA 1J1LA 5K0UA 4K1YA 4K8FA 4AQ2A 2C1FA 4LE4A 2ZKNA 3LZZA 1U12A 2B42B 4OUSA 4C1XA 4GB31 3NV3A 1ULDA 4LLFA 2OW4A 1H1IA 2ZS6B 1QXPA 2RHPA 3AJZA 3AP5A 3NKTA 4K9SA 1NOVA 3LA3A 4N7UA 2A7AA 4XF1A 3SNMA 2GC3A 1R083 5J98B 1ZZ8A 4WV8A 5DDJ3 3OJBA 2RM22 1X36A 4L8QA 1V6KA 1IS4A 4FPYA 1PGL1 5J37A 1LOFA 4Y4YA 1VBB2 1AF9A 3A0NA 5IK8A 1GANA 1QXJA 4Q4W2 2YPJA 4Q0VA 3ZFEC 4P9IA 4SLIA 4KWKA 1QOSA 4Q4X1 1QH6A 2V73A 3K51A 3MDPA 1ND3A 3AMPA 2AH2A 4IV1B 5L36A 2NYYA 4AEKA 3VZMA 2P3IA 1DLLA 3RI8A 1C4RA 3B01A 4UW6A 1WW6A 4U36A 1M4WA 3ZSEA 4AWDA 4IETA 2HWB1 4U2AA 3VBOC 1QQP3 4RA0A 1NQDA 1W6OA 3AKTA 3OTFA 2CNAA 2TUNA 3M3QA 3VKOA 5FLHA 5A33A 1NCQC 5GKAC 2XLAA 4YZ2A 2PHUA 4BLJA 2DU0A 2BVBA 3P3PA 1SBDA 2AR6A 3V64A 3ZXKA 3IMNA 1YXWA 1RHI3 3QLQA 3WG1A 1LOGA 3IDCB 5LK5A 1AXZA 1BBT3 3I59B 4P14A 2A6YA 4HVOA 3ZMNA 4Q4V1 5EZWA 3ZFGC 2W0XA 1CQ9A 1Y43B 2A73B 4S2FA 1MVEA 1VBA1 3PTYA 4UBHA 4DZGA 1BQPA 3NAPA 2G4IA 1AL0G 2RR13 1AR83 2DVAA 1FPN2 1FOD2 4B8EA 3N7KA 4J1XA 2XVGA 2A6VA 2GNMA 2IWGB 1CD3G 4GH4B 3GALA 5KXDA 2VUJA 3OD4A 1GLHA 3N35A 4YG0A 1RMU3 2GN7A 1TE1B 4MGKE 4IEYA 4L9BA 4FQ4A 1RUI1 1AX0A 1CAXB 3I8TA 3MLKA 4AYUA 4LLOA 5DUVA 3WD5A 1PK6A 1ZVFA 5CFDA 1LHUA 4AGVA 4Q0SA 1XRUA 4N90A 2B46X 4WVZA 4CTEA 3VBRB 4LHNA 3RYKA 5JCTA 1RUF3 2R061 1AJOA 4AEDB 1QJX1 3AJYA 2JICA 4LBOA 4HMZA 4FQZA 4KNCA 2ZZJA 1DQ0A 3QH6A 1GZWB 4OI1A 2CYFA 2OZJA 2B9UA 2HWC1 4LNVA 2HWE3 1JN2P 2PQQA 4NO4A 4YRDA 1MZ6A 1ZM1A 4XJWA 4WBBA 4ASLA 4MX3A 2ZZQA 4WVMB 1N3PA 4AFCA 2D5HA 3K48A 2QZ2A 3RI9A 2BNOA 4BMBA 2XKPA 1NCRC 4IESA 3ELNA 4YZ3A 2XHKA 4AFMA 4Z2WA 4A2UA 2W52A 2I07B 3DPRC 4Y20A 2KM2A 5JMCA 3WG2A 1OOPA 1MS0A 3ZXAC 1NCQB 1N1VA 4AVAA 3IT8A 3VV1A 1DDLA 2OUJA 4BZ4A 2UURA 2A3WA 1DYKA 4E9KA 4AFAA 1WBLA 1S2BA 2EXJA 4YZ5A 1LU2A 1R091 3GZUC 3ZFGB 1GQHA 3B02A 3FC0A 2QDRA 2VU9A 3AFGA 4RR3C 4JCKA 4AVVA 3WHUA 1D4M1 3SCHA 4DFSA 2BQPA 4BIFA 4JDMA 2ENRA 2DWRA 1IKQA 1MS1A 1C57A 5GLUA 1RUE3 2P3KA 1IQAA 5SV8A 1ZA4A 1AJKA 1PVC2 1VB4A 1DGRN 1G9BA 5EV7A 3TN93 4RL7A 2ZA9A 3VL9A 3J8F3 4BM8A 4BPZA 4LBLA 4M3CE 1Z7S2 2HWF3 1H1AA 2D6PA 1JXNA 4ASMB 4EWEA 3ILRA 5DG1A 3ZXEA 4HN1A 2ZX2A 1NE4A 3VZLA 3KCYA 4LBQB 2DURA 1TMF1 4FXKB 5CFCC 4R9AA 3E6CC 4Z1VA 4OHWA 4QGMA 1A6CA 2VULA 4KGGA 1WLWA 3GBGA 3QH7A 2B5HA 4AEJA 2D7FA 3PHMA 4MUVA 1LEDA 4K1ZA 3BU7A 4IV1A 2PHTA 1MZ5A 3VZNA 3V0BB 1Z78A 4JAAA 4CZSA 4YW3A 2RS33 4AVSA 3SISA 3KT1A 1S2KA 3PMEA 1OFNA 3H1WA 3C2UA 1MACA 1BMV1 1LHWA 2WS91 2D97A 2EAAA 3WINE 1YFUA 2GN3A 4FP3A 3LWCA 2VXRA 1FATA 2XVKA 4FPHA 1H9WA 3M3EA 3MIFA 5GALA 1HXS3 2R043 3KGZA 1WMEA 2Y38A 4NOTA 3ZSKA 3I59A 1BVVA 5H9SA 1YWKA 2R0HA 3DN7A 1ZBE2 1G9FA 4KG0A 4PCRA 1YIPA 3PJQA 4XBNA 5DZFA 1XNBA 1C28A 5JI7A 2H6CA 3EHKA 1LCLA 3AZWA 1S55A 3KS7A 4PDWB 3SITA 2R6QA 1VBD1 1AR61 2LALA 2VOVA 2R30A 1RUJ1 1VBB3 5E16A 1H2MA 2X29A 4LBQD 4YZ4A 1RTVA 2YYOA 3MW2A 3KT7A 4Q4W3 2PHFA 1APNA 4AG4A 3FFZA 3FBMA 4LO8A 4PIYA 1RC6A 2D93A 1CAXA 3MW3A 4KU7A 5EYYA 3ES1A 1HQWA 4LHKA 5JLVA 1RUD2 1VAKA 4JTNA 1LJ7A 2ZHKA 3W58A 3LAGA 3VBRA 1UPSA 2TBVA 5K8SA 1VBE2 2VG9A 1IS6A 3W59A 1GQGA 2R072 1QWRA 4FP2A 3VHPA 2HEYF 3AKRA 4LUKA 5FO9B 3UKVA 1UD1A 1IS3A 1YNAA 5JWPA 4ATEA 1GZWA 2RMU1 4FSJA 3O0VA 2V09A 4WM8C 2E6VA 3RSJA 1C3HA 3EQEA 4B4RA 4CEYC 1S1AA 3WNXA 1S0FA 1V9U1 1WD3A 4WVMA 3ZXJA 4Q8KA 3U4XA 1EPWA 1LB2A 3VZKA 2UU8A 5J48A 1VP6A 4WZCA 4HK9A 5K0UC 1CN1A 1QDCA 5FOBB 1PNFA 4IL7A 1YIFA 5EWSA 1NCQA 3KT4A 3MICA 4PLOA 5H9RA 1X82A 3ZO0B 5J09A 1H2NA 4Y1ZA 2OA2A 2AZ5A 2VECA 2WZR2 4Y1XA 2DYCA 5ACA2 4TSVA 4AW7A 1FPN3 3TRSB 1FOD3 4YGEA 3V56A 2UWCA 2ZGTA 5FRAA 4FPOB 2DVFA 4ES8A 3ZFGA 2PLV1 2WT1A 5JPNB 2Y26A 1SLCA 4RD7A 5L7OB 1PIV3 3DGTA 3S7EA 4AEMA 3ZX7A 3WG4A 1LOFC 1SBEA 1AXYA 1QGLA 1EV12 1VB2A 2PHWA 2NM1A 4IEWA 3N4MA 4UXAA 2ZJCA 5DDJ2 3H7YA 5IK4A 1V6IA 5I93A 2G9GA 3VDDB 2IXLA 3ZFFC 1UW8A 4BMEA 1Z0HA 1DQ2A 2E63A 3POYA 4LBQA 1OA3A 2GSYA 3WCSA 1H9PA 1RUH3 1VLNA 2XUMA 4QU2A 5CB7A 1AYM1 2ZHNA 4AGRA 4QPIB 4XILA 4YYOA 2KXLA 3CF6E 3AKSA 4GALA 1LHOA 1SFNA 3ZN5A 3B3QE 2D6KA 2I45A 4O9GA 5JIUA 1U5ZA 1SLLA 1LODA 1W6PB 4AVTA 3AYCA 2ZTNA 3UL2A 3V0BA 1CJPA 2WINB 5JVVA 4DPNA 1GFF2 4GKYA 2AENA 1FV2A 5DZGA 4CEYB 5CAZA 3LCPA 3VKLA 3ACLA 3IN9A 1GSLA 4YGCA 1ASJ1 4YLZA 1H8TC 1COV2 1LR5A 4W6YA 3TB0A 2WL1A 2TNFA 1QJY1 2PAKA 3VBUC 3IPVB 5AVPA 4XF3A 2XGXA 3NAPC 3DPRA 4NWVA 4X6QB 1G9DA 3JB4C 3AMQA 1NZCA 3LA2A 2NMNA 1KDMA 3SHRA 4QHBA 2BBVA 3MLJA 5LRSA 1BBT2 4Y1VA 4COVA 1RUC1 1AYN2 3ZN4A 3DF0A 3NW4A 4B7EA 2BPA2 2MPFA 2YHJA 4B4QA 1ZZ7A 3WUCA 2ZGMA 4QPGC 1YRZA 5B2GB 2RR12 1AR92 1AR82 4PDWA 1Q5OA 4LBNA 1PK6C 1TQ5A 5E8AA 1ONAA 3J4UH 1ZREA 2AYHA 2A6WA 1SCRA 5DUUA 5I0RA 3BTAA 1RMU2 2RS13 2ET7A 4I0BA 1CPNA 3RJRA 1DQ4A 4KG8A 1V00A 4H7MA 1UU4A 4AK3A 1VBA3 4NPRA 4R52A 1DGLA 3ZDSA 2XBO1 2E7QA 4KWJA 2PYTA 1VJ2A 4MGIE 5GZEA 3TAYA 3ZFFB 2ZABA 1ZZBA 2QZ3A 4HPKB 3KD4A 1YI9A 4L97A 4RFT0 1V6NA 5BNOB 3OGJA 4GA9A 4LULA 4AQ6A 2GNDA 2HWE2 3GF6A 3WDWA 5C9AB 2BYVE 2GC2A 1XE8A 1MS5A 1WUVA 4OHXA 2GH2A 3H3UA 4HL0A 3LB9A 2WT0A 1OPOA 2WSUA 3VKFC 3THTA 1UIJA 2DTWA 3ZYRA 1H8TB 1RUOA 2Z69A 1F31A 3VN4A 1QJX3 2RM21 3VBUB 3ES4A 3H8UA 5BNNB 1AUYA 3MGUA 5I8SA 1H1MA 4P9WA 3VLBB 3J9SA 3URFA 2WIIB 2HWC3 5T3NA 3FFQA 1BEV2 2UY8A 4FPJA 3NV2A 1CX4A 2GZWA 1MS3A 4ISQA 4QD2A 4JV4A 1R1A1 4LE3A 3WP3A 1VR3A 5CA6A 4XF4A 4QPGB 1A3KA 1L3JA 1RUE2 4O9EA 1QHDA 3FUQA 2IC1A 2DCKA 2GMMA 1YJLA 1RUD3 1W2UA 3O7OA 1JOJA 2GH8A 5I8TA 2WFF2 3J8F2 4BE3A 2QNKA 2BNMA 1C8M3 3WW4A 2BEOA 5H9PA 3E5UA 2HWF2 3M3OA 1O5UA 2R073 5KHHA 1X7NA 3SH4A 1EPZA 2E51A 1H2LA 4AQTA 3AYEA 4I3GA 3VDDA 1JUIA 4MYEA 2XB6C 4IV1C 4LR4A 1URXA 3SH5A 4ATFA 5K9YA 2XPJA 1F5FA 1TME1 1ENSA 2JG8B 2D44A 1MEC1 1ZYBA 4H14A 4YM1A 4EROA 2UWAA 3H1YA 4QPIA 4XTMA 3FJSA 1SLBA 1S0CA 3AZVA 2D43A 4IEQA 2GMEA 1YI7A 2YROA 3JBG2 4XFGA 1W6PA 3JD71 1OPMA 3M1HA 4C0BA 5A32A 1W0PA 4HANA 3ZXLA 5BNPB 2BUKA 4CEYA 4INDA 4ZU7A 4FPEA 3WLUA 1VBC1 2IFWA 1PZ9A 1PGSA 5ACA3 2JKBA 1OFSA 5AVAA 1U5YA 2HJIA 1N1TA 2ZBJA 3BODA 3D82A 3IPVA 4I3PA 4BA6A 4DNYA 5KHJA 5JOXA 2VOWA 5CU1A 3WT3A 4S2HA 3ME2A 1H8VA 2DUPA 4YM3A 4MGYE 1NQJA 2PTMA 3HMYA 1HXS2 2R042 4YW2A 1UKRA 1NA1B 3JZVA 1WD4A 4GH4C 4GQ7A 1C5HA 4P9XA 4Q29A 1TNFA 1WW4A 4W6XA 1EV13 1ZZCA 5C8WA 2X53S 3I7DA 3AP7A 3OGGA 4XJUA 3D0SA 4S2DA 2CGOA 2BWCA 4HZFA 4JGYB 4HLTA 4UBGA 2Y0IA 3O12A 4AF9A 4FAGA 1SDWA 1ZBA2 4HBNA 5GM0A 1SLIA 1IGOA 5FDBA 2YY1A 2E7AA 1J1TA 3LSEA 3VBRC 4XBLA 4H55A 4HVRA 3UJOA 4AEDC 2WNEA 1G9AA 2A3YA 3WZ1A 4YZ1A 2VVFA 5GLZA 3AMMA 2RJLA 4MXWB 1DZTA 4Y1YA 1WMDA 5GLVA 5GZCA 5DUXA 1UPIA 2NP0A 1A78A 1SLAA 4XTPA 2OZ6A 3ZFFA 2Q5TA 3N7LA 3G7DA 4XQ4A 1EAH2 1PO21 4NWWA 1QJU1 5BNOA 3WDVA 1A8MA 1COV3 5C9AA 4K6BA 4XJAA 5KXEA 4EWAA 1JYIA 4XMIA 1AVBA 1JHNA 1Q8QA 5T52A 2SLIA 4Q0UA 3KCCA 2Q0AA 2D6LX 3WP5A 5BY5A 4B7KA 3VBFC 1ZRDA 4FO9A 1PVC1 3NSTA 1H8TA