4LLQB

Structure of redesigned igg1 first constant and lambda domains (ch1:clambda constant redesign 2 beta, crd2b) at 1.42a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
b'PKAAPSVTLFPPSSEELQANKATLVCAISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAAWSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mutated CH1
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 17
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llqB00
1Q9KA 4PGEB 4ONFH 1KB9K 5GGUB 2B2XL 1CGVA 2CRYA 2P45B 4E41D 4LCIL 4ZQKA 1U3HA 2Z92A 2BFVL 8FABB 4NO2B 3ROOB 1RFDH 2VLMD 4AIOA 4MNQE 5B8CC 1G9NC 4K71C 3GIZL 4XH2A 1Q0XH 1I3GH 4DZBB 2VTFA 3BESR 4IDJH 3WUZA 2FYYB 4P3DA 4JVWA 5CBAB 4JFHD 3I3DA 2WWKO 3OWEA 4DTGL 4LRIA 4YZFE 1F4XL 3IDXL 4V2BA 4DGVH 4PJDF 3SQOL 2P5EB 4CN4A 3WO4B 4HMEA 3IGAB 3G6AA 2WP3O 1H5BC 3F7RA 4P5KB 3L5WB 3QT2A 3H8NA 1K3ZA 3QXDB 1JFQL 4KQ3L 4KDVA 2QHRL 1MRFH 1V3MA 4HGWA 5D7JB 3S4SA 5DRNB 1JZ7A 1RK1A 2DQIL 2AV7B 1A3QA 1IM9D 3V7AE 2NY1C 4KK5C 1DSFL 3F7VA 3C8KA 3LN9A 3STBA 1CDHA 2NNAA 3LS4L 3WO3B 3TO4C 2NX5D 4D94A 3P9WB 1S9WB 3IJYB 3MRLB 5JW4M 4PJCF 5IVNA 4HKJA 4XRCB 5CS7A 4BH8A 1LO5A 4AEEA 1U6AL 2DTML 4FQLH 1D5IH 4GW4A 4FQXB 2CQVA 3MLVH 2VLJD 1W0VA 4TNVK 4WW2F 3BP7A 4P23D 5DMYA 4PRPD 4CU8A 5JW5A 2DBLH 2DQFA 3REWA 4OZIF 1YNTA 2NY4D 4I0KA 5DK2B 3FOMA 2JJTA 2VERN 1XF3A 4R4FH 4YAQB 3S36L 5L88L 1JGVH 3V6FB 5FHAL 1WBXB 1NPUA 3TPKA 3O8XC 3ULUF 3QCUL 1X5LA 1HINL 1P7QD 2GAZA 4NUGH 4OUUB 2DQEH 5A16A 32C2A 2HJLA 5M95B 5ID1A 2ZP0T 4CVWA 1RIUL 5F71A 5D1QC 4Z7WA 4LCYB 2A0LD 4HV8A 3D18B 4LSSH 5T1KA 3VA2C 4F3FA 1J0KA 4MD5A 4CVUA 4EVNB 1YNLL 4OZHF 3EYUH 1LQSR 8CGTA 2GCYA 1YDPB 4KRMB 4GO6B 3RZWA 3SE4C 1P7HL 3SKOB 1ACYH 2Z91B 4LSUL 1KEGL 3BP4B 5I30H 1XT5A 3KPRB 5C0FA 5D1ZD 4G8GD 4HS6B 4KTEL 4Q9BA 1YJDH 5E4EB 3MLSL 5EU7C 1A5FL 4R7NA 1T1ZA 4N9OB 3LPFA 4OD1L 3EYFA 3JXAA 4XVUC 4C58B 4JR9L 4MDIA 1VHPA 5DD3L 3PHOB 4K7PY 4WI8A 4FNLL 5L2KB 2HRLA 4LNVA 1YY8A 4J8RA 1K4CB 5DRXB 2J6EH 4XNMA 4Y4HC 3TZVD 4L4VE 1S9XB 4RBPH 3QJHB 5BOZG 3SDAA 4F9LC 4HKZA 4ODVL 4U1GB 4TPRH 4G43A 2D7OA 1MAML 3QHFH 4IRJB 4M4RA 2BNRA 1GHFH 4I3RL 5FGSA 3VFTB 2OX5A 4OM1H 3SDXF 4PJDE 3MLYL 4Y4FB 3BKYL 4WV1C 2DMKA 3LQAC 4YUEL 3P9MA 4U33A 1NCBH 4KPHH 3RHWK 5EO1B 3NGBC 3EZJB 2JKXA 3T8XA 3BVNB 1TZIB 4R4ND 4D9RD 3GB7B 2Z8WC 3STLB 1MREH 2BVOB 1OAQH 2EEDA 4XPHL 4R2GC 5EB9A 3L6FB 3Q1SL 4HIHA 1GZQA 4JLRB 1NFIA 2PTUA 4X4MA 3MNVB 4UV4L 3JV4A 4YJZL 3FAWA 3HB3D 3CLFL 3RUGA 3WNNA 1WSST 1SJXA 3KPSA 1BF2A 5IR1B 4HLZH 3BEVA 5GRWA 1R5VB 1J05B 1CT8B 5IB2B 4P2RD 3QRFM 2OTPA 3IDUA 2JJUA 2Q1EA 3ULUL 4PJCE 1MEXH 2P7TA 4AEHL 3RX7A 3KLHD 2EDHA 4HK0A 2ZUTA 4FQ1H 2HG5B 4MJ5B 1MCJA 1N5YH 1CFQA 5E6IB 1YMMA 1ZT1B 2HYMA 3LHPH 4TVPL 1SBBA 3QEHA 1P4LA 2GSGA 4OZIE 4RZCA 4YR6B 5IHLB 2YZ1A 3V5HB 5I66A 1UKTA 3T4YA 2X2YA 2HTLC 1MHEB 3NCYS 2DWDA 2D31B 4PRHA 3ULUE 4OTXL 4PJIF 4QGYA 1OSZA 2Z4QB 3DVGB 5FYKE 4LGPB 4QO1A 5EBLA 3T4AA 2NW2A 4FFWD 2NMSA 2WIIB 4RGOL 2FSEB 2WUBH 4OKDA 4TVPE 1OAZL 2IAMD 4XNUL 2MKWA 4OZHE 1S9YA 2VL5B 3DI2B 5DQJA 3UO1L 3RNKA 3CUPB 4ERSL 5JUEH 1NGPL 1N3NA 4X99B 1G9NL 1BGXL 2X4OA 4Z0XB 1TCMA 5H2BB 3BHBB 1U41A 3RTQC 1ZT4B 2AJZB 2B8OT 5DHVB 3B3IA 3H6JA 3GSNA 4L4TE 3EHBC 3MJ7A 4MNGB 1UZ6F 5DWUL 5BV7H 4WGWB 2R1XB 4P3CL 4LCCB 2Q76B 4GUPA 1FNSL 3IETA 5SX4I 2AJUL 4K55A 3AXLA 3HC3L 4G6FB 3QUXC 3QDMB 1DBBH 1M6OB 3OGCA 1OAYH 2ATPB 1SJHB 4FFZH 4LKXB 1K4DA 2YRLA 4YHYB 4LAQL 3V7AG 3MV8B 1NAKL 1R5WB 5JHLH 1IM3A 4HQQL 1IJ9A 3CVHB 2R69H 3ZT5A 1FG2B 1RU9L 5D1XD 1AXIB 2FZ3A 4ZOEA 3OF6A 1BF8A 3MGTB 4QT5B 1CICB 5IW1A 1D5BB 3SDXE 2VDKL 4JFEB 4YPJA 3LKOA 1A7NH 1GPOH 2WWMC 5C07D 5I1AA 4PJXB 4KJYB 4IRSA 5E00A 1ITBB 1T21A 1IGMH 3HG1B 3MZTA 4E5XA 2DQGH 4XBEH 1MFNA 3W82A 5E8PA 4PJFA 1EEYA 4FQCH 3ECBB 3RDTD 3T1WA 3D0LA 4Q2ZB 4Y5VC 2FL5A 1XIWB 3EJZC 4X7CC 3DTXB 3T1FA 2KUTA 5L8LB 4PIRF 2IANE 3R1GL 2CK0H 4W4OA 2Q8BH 3Q2CA 3H9ZA 4PJAF 2VZUA 4C56D 4GG6A 4LPYA 4EI5B 4JHAH 4X0KB 3MRJA 1VDGA 4S0TD 1I9JL 1NC2D 5MENE 1E6OH 1HHKB 5J57B 4HULB 1AQDA 4BA8A 2FJFB 1E4KC 5IT2H 2R29H 3DRQB 1EIBA 5EO0B 1UYWH 4G6MH 4Z0BH 1NEZB 2OI9C 3K74B 3FQWA 3KVQA 4CUCA 3MX0A 5IHUH 4AL8H 5A2IH 3WYRA 4NUJB 3VD7A 3SDDB 3CDGB 1FP5A 1JV5A 1LO4H 4JQIL 2MCPL 4X4XA 4Z77A 3GBNH 5CJOL 4LRNL 2A1WL 2NY2B 4H0HB 2XZZA 2VZ1A 3U7AA 5F70A 3RBSA 3G5ZB 4S1DC 4JDVB 4U6VH 1HOCA 3MRDA 5DJYB 3L3JB 3T0AA 3VGBA 4XCFL 2COQA 1F6AB 4PJIE 1EA9C 2PTTB 5C71A 1QSFB 3VW3H 1JWSA 3O4OB 5HYSB 4JFQA 3G6DL 4HBQA 5GRJL 3D3VA 1K2DA 3V6OA 2X6MA 1R3KA 2BC4B 1U92B 3EYQD 3QFJA 5I17B 4OF5A 1NMBL 5LWYL 1XF5A 3IFNH 4IMLA 5A40E 1NBVH 3MRGB 1OLLA 5IHZA 4X6EA 3GJEB 1CG9A 3G9AB 2X1QA 1YNKL 5J6HB 4M6NH 5CJQL 4Y89A 3S3SA 1J8KA 1YYLL 4X6DB 5EU5B 5EU7E 1HWGB 5SV3A 3ZYZA 4PP2B 3EOBA 3VXSD 1UZ6E 1RZJC 4IOFD 1Z6JT 4V1DB 1WC7A 3O3EB 4P2OB 1L7IH 4XVJH 1JYVA 3KYOA 4HXAL 1XGRB 3HI6H 4OM0H 2LE9A 1G7MA 1KCSH 4MD0B 3LQAL 3W0WA 4FS0A 1TENA 3K8LA 1Y18A 4ZFFA 5ILTL 3HLAA 3BGMB 1FYTE 5GS1C 2XWBA 5EWIL 2XXMB 3LEVH 4PREB 1BM3H 1OGTB 4ACPA 3INUH 1I8IA 4LGRB 3TBTB 2XI9A 1A1NA 1YEHL 4I48A 4EOWH 1Z0NA 1P69B 2MOVA 2PNDA 1I4FA 3HAEB 2HVJB 5TPWL 1WWWX 2X42A 1CGTA 2A83B 5AUMA 1GL4B 2EYRB 2G5BA 3D69A 3SO3C 2VDRH 4LLWB 3QH3B 5KVDH 1KXQE 4NZRL 5H37H 5EOCH 1DDHB 4XP4H 3BIAX 1F58L 4JPVL 1K85A 2CRMA 2I9LB 4HUUB 1P84K 2IALA 1SEQL 3HMXA 3RIFF 5KSUB 2DD8H 1MCFA 4XPBL 4ELMF 5EUOB 3C6LA 5JOFA 4U49A 3SBWC 3GMNB 2E27H 3D6GA 3KG5A 4PJAE 2OS7A 4ZMAT 1DBJL 3QG6B 3LS5L 3WNKA 4LF3A 1MQ8A 1ZSDB 4RIRB 4RMTA 5IFJA 4ZUWA 2FNBA 3M07A 1GOFA 4YNYA 3AM8C 4Q9QL 4NWTL 1HXYA 3G5YA 5FFLA 4HWBL 1LWRA 1KJVA 5SX5H 1INEL 5EC2B 2HMID 3QEQD 3F7YB 5IIEA 1A2YB 3IDGA 1G7LA 2E6QA 3RWJB 4EBQH 3CH8A 4FOMA 1IILE 1IEAA 5DD0L 3CVIH 1BD2E 4YEEA 5B39B 4NQCD 1WT5C 2DLHA 3GSOB 4K8RL 4LVOC 5K9OB 5DHVH 5T3XE 1WBZA 1OP5K 4U7MA 4R90H 3OAUH 3CSPA 1XGYL 1X4XA 4RFNB 1YQVH 3QDGA 3TBSA 3R06A 4TSBL 2CD0A 2CKBL 3IF1B 1I3RA 1PBYA 3FB6B 4PB9H 3VFOA 4UQ2B 4NSKA 3P4MB 5FAAA 3R4DA 3PV6A 5A3ID 2RQ8A 1OVZA 3MRCB 1ZANL 4KMQA 3O2WL 2R1YB 1D5XB 4OGAD 5F6HI 3L3IB 4JVUA 4I0PD 5DXWA 3VXRB 5AWNH 4P5TD 4ZTPH 4R26L 1GGBL 3OB0H 3I6KA 2CDGB 2FX8H 2I26N 3IXAA 4IRZH 4HS8L 4M9OA 2BHYA 4UAOC 1R0AL 4P5MB 5E5UB 2JJWA 4Q0XL 2BZDA 1KACB 3SDCA 4MSWA 1H9VA 4Y4KA 3IDIB 4RWYL 5L8JB 1EGJL 4TTDC 4UV7H 1NGYB 2XACC 4JQXC 1EV2E 4NHUA 4ALAH 1R3HB 2ITCA 1BVKB 2X41A 4OQTA 3BDYL 5EZLA 1OP9A 5SWZB 1T2QH 3IU4H 1OARL 1YEEH 4GW1B 3QUMA 1LVEA 4OGXH 1CR9L 1HQRB 4UI2A 1I1AD 1HH6B 1T0NB 2AJSL 4J1UB 1C5CL 1TTUA 4K94C 2VXTH 3FFDB 3VFSB 3TBWA 2PO6C 2VIRA 3NH7L 2P43B 5KW9H 4QHKI 4YIQB 5D7IA 3RWHB 4FTVE 2J3SA 5FOJA 2XG5A 1TVHB 4DGYH 4UQ3B 2Z31B 2A9ML 1TJIH 4LNRA 1JGLL 2MQCA 1S78D 4H26A 5T1LD 2H2PC 4KK9D 3BPCA 5E6IC 5I74B 3KYNA 1BEYH 2BSSA 2NW3B 3T04D 2B1HL 5C2BH 1FGNL 4OLVH 5D70L 4PJ5B 4F80A 4GOSA 4ELME 5GGTA 4X5XB 2PXYA 4I2XA 1HCFX 4OFKA 2C7UA 5EPMB 3IFPA 1FO0H 3B9AA 3QEUB 4GG8A 3HRPA 2IPUG 2P1YA 1DBML 3P0GB 3P0VL 5JO5A 3OV6A 3CFKA 4WFGD 4OCYL 2JB5L 4HJJL 4WO4C 1I75A 4NJ9H 3TH3T 5KAQF 1QOKA 3PQYA 1J8HD 2ORBL 4J3OC 2CSPA 2K7PA 2B5IB 4R4BA 1DQQA 2NY5H 4F37K 1AO7A 3AMLA 4PR5B 4PRDB 6FABH 3QNYA 1LGVA 4MQ7B 1AE6H 1K8IB 3BW9A 4IHOA 1TDQA 2MMXA 1AC0A 1S5IH 5IFHH 3D25A 2ED8A 4ZQKB 1RZJL 1U3HB 2Z92B 2YK1L 5FOBB 5FA3A 1UFUA 4DUWA 2DQUH 2V7HA 1FFPB 4JZJA 4OZFA 3EYSL 5IBLD 2YKLH 1DLHA 5CD3A 3O2VL 2BXZA 4O2EB 2X9YA 4P3DB 2CRZA 1R3LB 4QRPA 1DBAH 1W2KT 3PWPA 5AYUH 3GSVA 3QXWA 1QYGH 3ELAT 1G1YA 2YPVL 3JTTA 4XVTL 5FKAA 2P24B 4M7LL 2B2XH 2WBJA 1G9MH 3G5VA 4E41A 4LK4A 4X9BA 3FO0H 4LCIH 2BFVH 4PY8I 4JO1L 4OCMC 4QCIA 4OLEA 5GS0D 4H0GA 4ETQA 2FEEI 4NQEE 2FHFA 4S1QL 4NO5A 4HGWB 1NGWA 2R56L 1HEZB 4G9FD 3WFCH 4QRRD 1QZ1A 3JSSA 4DTGH 5I1DA 4JM2D 2O5XL 2YA2A 4MXVF 3WJLC 1I7ZB 3X3GH 4PGCA 3LN4A 1KCVL 1YYML 3MLWL 3TV3H 1IC7L 3A67L 4Z76A 2ZUQC 4OT1H 5MERA 4NBXB 2I25N 1C7SA 1W0WA 2OQJA 1NFDB 3CC5A 3FB7A 5I9QC 3L5IA 1ZVYA 3NPSB 3OKMB 2ED9A 4BH8B 3ULVF 3W9DA 5B4MD 4GW4B 1W0VB 4YHPA 2VDOH 3BP7B 2PYFB 3DUSA 1FIGL 5B38G 3SDDC 1CDGA 4ODTL 3VI4F 3T77A 1IM9A 4XC1H 5C0JA 5I1KL 5FIEA 3WN5B 3SJVD 3K8KA 4UIKH 2VB5A 3FOMB 3UDWA 2Z0BA 1DSFH 4KZEH 3SGJC 2NX5A 1OTUC 3LS4H 5JZ7C 5CP3H 1IAOA 4MWFB 3MACL 4OIBA 5DO2C 2BJMH 4KHTL 32C2B 5ID1B 1NCTA 5IJVA 5GGSA 4B41A 1C8PA 2DTMH 3BN9D 2V2WA 2VLJA 5DD6A 1RZ7L 4HV8B 4F3FB 3IJHB 1RY7B 4P57A 2N7BA 3OJVC 1UM4L 5IHBA 2IG2L 3SO5A 4M00A 3DROA 3RFZC 4LQFH 3OR6A 4M43L 5CWSA 5C0FB 2HFGH 4KTYA 2ZOKA 2XIDA 2NXZC 1FL6B 3QIWD 1PSKL 4N0YH 1T1ZB 5JORA 3NAAH 4OD3L 3S36H 5BRZE 5L88H 5DC9B 5FHAH 2AEQL 1QR1B 3GO1L 1P7QA 2UZYB 2H32A 4QHUA 4UOW1 1W72L 3KLSA 3IT8D 2DM7A 2A9NL 2VKWA 2XNAB 1CDCA 4J8RB 5L2KE 1ZLWK 4JFZH 1V8HA 4UT6L 2E7LC 3X11B 4EUPB 1YNLH 3UTSB 2FECL 5DD1L 1ODAA 3MRFB 2A77H 3SDAB 4HKZB 1ITCA 1KEGH 3EYOB 1BPVA 1D9KD 3I9GL 4G8GA 4ODWA 4KTEH 4G43B 5CSZA 4L9LB 3K3QA 1QP1A 5JTWA 2BNRB 4HHAB 2UYLA 4LPUA 4OD1H 5D8JL 5C0CB 2GIYA 3I2CH 2YD4A 4JR9H 4TULL 5DD3H 1YQ2A 3P9MB 3C60B 1FORH 4K94L 4YXKH 1VCAA 2L7JA 2FR4A 3WUWG 4XMLL 5IB5B 2YRPA 3VMNA 1X3DA 4EZMA 4DK6A 1MCIA 2DQCL 1GZQB 4P59H 1MJ8L 1UT9A 4YHLL 1BX2A 3MJ9L 3JV4B 4RQQB 1EHLH 3QXUA 5LAXA 1CIDA 3RUGB 1I85A 3KPSB 4MXVE 1NLDH 5IQ9A 3MLYH 3BEVB 4YUEH 1EJOL 4Z9KB 1II4E 1L0QA 3NABH 3BIBX 5GRYA 2E9IA 4XI5C 4GRWB 1MCOH 3QHTC 3ULVE 5K9QI 1AJ7L 4BK4A 1CFQB 1T6WA 3Q1SH 5FDWB 3ILQC 1CLOH 3ZKXB 1T1XB 5MEPB 5C0DA 3QEHB 3VI4E 5D9SB 3MA9H 35C8H 3NFSH 4HIXH 2VABA 4K7FB 1ZS8A 3MNZA 3M17B 5H35B 4KGLA 3U79A 4PRHB 5C9KA 4P2RA 4U3XA 1OSZB 4NOBA 4J3WA 4O2CA 2HTKD 3S37X 1O5DT 5EBLB 5DJCB 5A43C 1NDMA 3T4AB 3OG4B 4AEHH 1RJYA 3D85D 3P3YA 1JNNH 5F44A 3Q48A 1I1YA 3V4VL 1I1RA 1X5YA 3JUZA 5EUKB 5DQJB 5DK0A 2E9WA 5L0QB 1B2WL 2N7AA 4XB8A 4FQJH 1QFWM 3V4PH 3EOYG 3H3PL 3QP3A 4X6DF 2C3VA 4Q6IC 1AD9A 3MJ7B 2VLRB 1BFVL 1EAJA 4ZS7H 4GUPB 3ROLA 3IETB 3AXLB 2R1WB 1LK3L 3PWVB 3BE1L 1BOGA 5JIKA 1PY4A 4RGOH 1A9BA 1PZ5B 4XNUH 1EK3A 5DEZA 4TUKL 3UO1H 4ERSH 1NGPH 4OIAA 3BAEL 5F9OL 1RIVL 2NTFB 3WS6A 3L1OL 3KS0J 4CVZA 3A6BL 1F3JA 2J4WL 4HBCL 4KXZI 1QBLL 5DWUH 1PX3A 4HCRH 4P3CH 5F6HJ 3UZQA 2AJUH 5I1AB 2Z93A 4HKBB 4IRSB 1UXWB 2G75A 5E00B 3QAZC 2ADFH 4RRPG 5HI5D 3HG1E 4F7CB 5CZKA 3K0WA 5E8PB 4HUXB 1QA9A 2W9LA 3QZWB 4PJFB 3QO0A 1NAKH 1FVDB 3D0LB 3IDNA 1V7NL 1HNFA 5DI8A 2CH8A 4M9PA 5D1XA 4XP6L 3X13B 5EUOF 4DN4L 5GZND 3VH8A 2RHEA 3LV3A 1W8NA 4GG6B 1IC5L 5IF0B 2VDKH 3MFGB 5C07A 5BO1L 4KVCL 5DRWB 5F7KC 4G42B 5ITBL 3ARBC 1AQDB 1PKQE 1DL7H 1URLA 4I77H 4XXCA 3WIHA 4QHKJ 3O41A 4M1DH 4MJID 5C0IA 4M1GL 2EYSA 3O6FD 1F42A 2GYSA 4FN0A 5KAQG 3RDTA 5IOPB 2W65B 1KJ3L 4U0QB 4D0DA 5JIPA 1JV5B 1IQDA 4X4XB 3DYPA 4Z77B 2XRAH 3GSRA 3KYMA 1N6QH 4B7LA 1PZUB 3OKOA 5TE4L 4F7EA 3QUYD 1NC2A 1HOCB 2CMRH 3WEXA 4F37F 2WUCL 3I6LE 3MRDB 1QKZH 3NCJH 5E2VL 4KJWC 1U3HC 4MHHI 3G08A 1FLTX 5JA8B 1A4JA 1QSFE 4XPAL 3UXFA 1JWSB 4W81A 4JFQB 1ZLVH 2IH1A 3AU1A 1XF5B 4MVBD 2EKSA 5LVEA 2EXWC 2YPLB 1BJ1H 5GISL 4EUPH 2MCPH 4X6EB 1CG9B 5CJOH 4LRIC 1RV6X 2FX9L 1ROWA 2VH5L 4O5LH 4X6DE 4RMUA 3KJ6L 3EOBB 1NLBL 3OL2A 4LVNB 3MUGA 5HPOA 2KQMA 1A3RL 4AIZA 4X5WB 4V1DE 4XCFH 3O2DL 2ZJSL 3SGDH 5ANMB 1OB1A 4QYOB 2W0FA 2Y7QB 1QFUL 3W0WB 2PCPA 5GRJH 4H25A 4APQB 3QUKB 1IGCL 1MCNA 4U0RC 3UTPE 2W9EL 5KVMC 4ZFFB 4AENA 2C5DC 2OBGA 1IZJA 3CLEL 4I4WA 3HLAB 2Y72A 2ZG2A 1T1YA 2XWBB 5C09B 3NFNB 2P49B 1CFNA 5HGGS 1YZZA 5CJQH 3O3DB 1YYLH 1XF4A 3MFFA 4XPTH 3VXSA 2WBWB 1QFOA 5FYLD 4HLJA 3TH2T 1AQKH 3P11L 1J0JA 1BFSA 1EFQA 2GQHA 3IRPX 1S7TA 3NN8A 4WNQB 1UG9A 2ED7A 3C87A 1PW3A 1ZEAL 5AUMB 5DGRA 2G5BB 3D69B 1QLRB 2YD6A 3LQAH 1MCWW 1VADB 3H9HB 2CR3A 1MF2H 4ZO6A 3CAFA 3FQXA 4MA1C 1N2RA 2NY0B 1MCRA 2X4QA 5EWIH 1R3JB 2IALB 3KPPA 3OKLA 3Q3GB 4K3DH 1P53A 2RIKA 5DFTA 5EUOE 5JOFB 4UU9B 3ARQA 1LE5A 4HK3J 4EDWL 4YC2B 5DC0A 1U8LA 1FBIH 3RZCD 1FJ1A 1KJ2L 2A6KA 5IFJB 4HC1L 2CLRA 3FHQA 3MV9D 1EMTL 2OR7A 3UC0H 4C83A 5C2UB 4NZRH 1S8DA 4I5BB 3MLTA 1HXYB 3G5YB 4OLUL 5CZXC 3DHJA 2ZCKL 4JPVH 3G9VA 5J7CC 3K8MA 4JFYA 1SEQH 1EHAA 3TJHC 4XPBH 5F89B 4PRIB 1BWWA 1KOAA 1IEAB 1LD9B 5BZDB 1U8MA 2IBGA 3BKML 2BOCA 1V7ML 2AK4E 3FRUA 2GI7A 5JMRA 2FX7L 5D5MA 1DBJH 3VXOA 4GMTL 1FAIH 3QHZH 4HIJB 4N0CD 4GXUN 4MJ4A 4ZNCD 3WHE0 4XAKD 1PG7H 4ZOAA 3KLDA 4N9GB 1WGOA 3GSQA 3QDGB 2OCFD 3UTTD 3V6ZA 3U7WL 3BD3A 4HWBH 2DLIA 1M7DA 5I75B 3QEQA 5E2WH 1INEH 3SDAC 2H6PB 3VFOB 1FH5L 4TSAL 3R8QA 2BCKA 4AJ0A 2A74B 3D2UB 4WFED 5GGVL 2RCSH 5D96B 4NQCA 3VXRE 3VFPA 3I6KB 4ZAKD 1MJJA 3IXAB 1B3JA 4K8RH 2HT3C 1L4IA 2I9TA 3WLWD 1MHCA 2AJYL 1GGYA 3SDCB 1OLZA 4Y4KB 3WL9A 2R0WL 5C0BE 2CKBH 1BZ7A 3PHSA 4JQVA 1MY5A 2ITCB 1P9MA 4HFUL 1N6UA 2YBRA 4QLRA 4F15C 2LABA 1ZANH 5SWZE 4JRXE 4I0PA 5T3XD 3QUMB 2VMFA 5JW4Q 4P5TA 4MA8L 3QQ3A 1GGBH 2UVFA 3TBWB 3BPOB 3ZYOA 3RIAK 4R7DA 4LOUC 2VDML 3V52H 5LQBL 3V5DA 5BJTA 4EN3D 1NEZG 2YD1A 4LNRB 2F19L 4QXGL 1K3IA 1EGJH 2E9BA 1FGVH 4H26B 4J3UA 4TOYL 3WKNA 2NZ9D 2DLTA 4WJ5A 3BPCB 3KYNB 2BSSB 1H3XA 3BDYH 4X9IA 2X1OA 1JPTL 2CIIA 3DMMB 3MLRL 1KFAL 3ZDYF 2NXYD 3DURB 1I1AA 1Q9OA 3PIQA 3TVMB 2HFEB 4PJ5E 5I8OH 2AJSH 4Y16C 5LCVL 3VXUB 3RVXD 4HGMA 3MOBL 4WCYL 1ZHKA 4ETYA 1UCBH 4PJ8D 2C7UB 2GTZB 4PJGB 1VGKA 2R39A 1U3ZA 2Y25A 3NCCB 4S2SA 2A9MH 4OKVB 2DQTL 4GG8B 4L5FL 3TT3L 1L7TL 4NKOA 4U3CA 5GGRA 4Z8FH 4Z7WF 4Z7VB 5JO5B 4Y5XB 3U4EB 3S88H 3CFKB 3MUZ1 3HHRB 2V2TB 5DR5H 3IKCA 4WUUD 1F4WL 5C3LD 3V5KB 2B1HH 1XFPA 2IQ9H 1FGNH 3WE6B 4MNHA 1JL8A 3MRNB 1WQVT 1U8KA 2OK0H 1A9EB 3CDCA 5HYIA 3QNYB 4LHUG 3T2OA 1LMKA 4HS3A 4IHOB 4ZNEA 5BXFA 3QCTL 4DFIA 1FL3B 1LK2B 2XFXA 3GGWA 4YE4H 5CD5C 2GITB 1XGPB 1DBMH 3LKNB 2SEBB 4KK6D 5FA3B 5FF6A 2XPGB 1DFBL 1HXMB 4JZJB 4OZFB 2OZ4H 4PP1D 4OFPA 2JB5H 4HJJH 4ZPTB 1DLHB 5CD3B 2FDBP 2B39A 2UUDH 4U1KB 1J8HA 1KIQB 4OD2B 3QISA 1U58B 4QRPB 1OSPL 4GKZB 2ZZUT 3PWPB 4U05A 4KWUA 1MRCH 3HAEG 2X4TB 3H42H 5FKAB 4LP4A 1NL0H 2WBJB 5E0QA 3GJFA 3TYGH 4YEFA 3X14B 4GH7B 4XBPA 1RZJH 1UVQA 5E2JA 4YDLB 3LRSA 3NVQA 3FO1A 4LSTL 1RQ5A 3S37L 2VXQL 4JPIA 4ODXA 1XEDA 3AFLA 1JWUB 4P4KB 1YC7A 1A6TA 3ARFD 4NO5B 3GK8L 2W07A 4DVBA 1X5GA 5I1DB 5DFVC 3RUGF 2VSDA 4PGCB 3LN4B 2YPVH 1MJUH 1CTOA 4ZPVA 5I19L 5CGYC 2BNQD 2QSQA 5ESQA 2D0HA 1W0WB 3PGDB 5J13C 1F13A 5JOPE 3CC5B 3FB7B 3GI9L 5A2KH 4JO1H 4GRWF 4U1LA 5A2FA 2ICWI 1XMWA 5DLML 4L1DA 4PTUA 3S98A 1JI2A 1Z5LA 4JCLA 3QB7C 3HNVH 4S1QH 5FKPB 4N1HB 4G9FA 2OMBA 4QRRA 5I73C 1H0DA 1CDJA 4JM2A 4YFLI 2D7TH 2P5ED 3ZDYE 1MWAL 5B39G 4X7DC 1IGIL 4D9QE 3FMGL 1AHWC 2O5XH 1DQLH 1J10A 4D0BA 3MLWH 2NX5B 2B0SH 1KIPA 3FQUB 3A67H 4RGMC 5DUMH 1CL7I 5IEHA 4UT7H 3SQBA 3SCMD 5F8QC 1WFNA 4O58L 4KI5F 2IPTH 5IJVB 5GGSB 5D7JD 2V2WB 3T2NL 1CE6A 3QWQB 5DD6B 1M7IB 3ES6B 5J9PA 4HGKC 4CAGA 4KROC 4DVRH 5IJKC 4PGDA 3DROB 5CKAA 4QHMB 3SJVA 4OZGA 5GPRA 3ZTJH 4KUCD 2UZXB 4PUBL 4OB5L 5JORB 3HN3A 1P7QB 4EDXA 2DWEB 2H32B 3HFML 3MACH 3QIBD 4FQXD 4KHTH 4QHLA 2PUQT 4ODUA 3HS0A 3VRIB 5J4MA 3P2TA 3ZKSD 4ZUUA 3OXSB 1RZ7H 1JE6A 2FO4A 1AGDB 4BQCA 4JB9L 4NM4L 4W6XB 5IKCB 3QIWA 4ODWB 3BZEA 1EZVY 2Q20A 4LIQH 5CSZB 1PSKH 4QTHA 3WS3A 4HJ0D 5EOTA 2O26U 5E8OA 1M7XA 2BNRE 4NRYA 3RKDD 1OTTC 5T3ZE 1R5IB 3OJDA 3CJJA 2HH0H 4HH9A 4XX1E 1T03L 2FR4B 5BCAA 3K1KC 4Q9RH 2P8PA 4JO3L 4NYLA 4KRNA 4RA0C 2EH8L 5IROA 3KPRD 2OTUA 1OQXA 4Y2OA 1U36A 4PJFF 4WU5A 5MEOA 2NY0C 1D9KA 3KYKH 5GGSY 2V6HA 2DM2A 4X4ME 1XH3A 2Y6SD 3C6LC 1NKRA 5LAXB 5IMLA 5D8JH 4LHJB 4GG6F 3RUGE 4TULH 3KPSE 5IQ9B 4GMSH 2V9TA 4G3YH 1FC2D 3FJTA 1O7SA 4UZGA 1EHXA 4LLVA 4DEPB 1FDLL 3LKQB 4GRWE 3BISA 3G5XB 3T2PA 2HKHL 2KKQA 1QSEB 2DQCH 1YMME 1MJ8H 5C0DB 4YHLH 3VGDA 2YS4A 5HVHB 3MNWA 4ZUTB 2XZAL 1I9RH 3P77A 5FB8B 2VABB 3BGFC 4LSQL 3HMWL 3LRGA 1ZS8B 4X6CB 4S0SD 4U1SB 5FHBL 2ARJQ 3T2QA 3TNMB 3O11A 1VESA 3GSNL 2AP2A 1NCCL 4P2RB 4J6RL 4PRHE 2AXGA 1F2XK 2XZQL 4PV9B 3ARVA 1FNLA 4KI5E 3HPLB 3EJYC 1RJYB 3U82B 1UM5H 2H1PL 4H20H 2P46B 4YDKL 2W60B 1OY3B 2VQUA 3ZKNC 5FA4A 3TN0D 4HAFA 5I1JL 4DKFH 4ZTOH 1QSZA 2A6JA 5D7SL 5D96C 4GXUM 5CIPH 2C3VB 3LDBC 4LLDA 3F5WA 5F9WC 3V2AR 4DN3H 4GQPH 1SJEA 3ULVD 1ES0A 2B4CC 1S7RA 3S3JA 5JHDB 2OJEB 3O6KH 3D85A 3H3BC 4Y4KC 1MFDL 1A9BB 4PBWD 3S4SG 3GUTB 3V4VH 4X6BA 4XVSH 2LAGB 1CGSH 3HC4L 3VFRA 1N7MH 3U36B 4M7ZC 4CVZB 4Z5RB 2FD6L 3ZKMC 1MI5B 2WZPD 3GRWH 1NBQA 2ZNWA 5HY9A 1BFVH 5ISZD 4AH2A 3I6GB 2VAJA 5LGJB 3RIAF 4YX2H 2AEPH 5DVNA 4JM4H 4BFGA 1EPFA 3J7HA 3BE1H 2A6IA 2DTSA 2G75B 3U46B 3DGGB 5IB4A 5ACZA 4N90D 5TDPB 3KNBA 1IGTA 3WKMH 3RVWD 1ZKAA 1QA9B 3OAYH 1TVBA 2NYYD 3KHOA 3BAEH 4PJFE 4RNRB 1RIVH 2VZOA 3IDNB 3OZ9H 5DYOA 5DI8B 5D1XB 2IQAA 4ZG1A 3L1OH 5IMKA 5JW3L 2J4WH 4HBCH 2OL3A 4G6FD 1TLKA 3QDMD 2PXYC 4GG6E 3MRBA 2BSED 5F6IB 4J4PC 3DYOA 2YA0A 4WHYG 5LGHL 1WUNT 5HHVL 3MV8D 4ZODA 2HRPL 3O41B 1E6JL 5CEZL 5D72H 4OSUH 1TQCB 5D71H 3QIUB 1QVOA 2YZ8A 5KN5B 5T33H 1G6RL 4QTIH 1V7NH 1JK8A 1UWGL 1CICD 2Z35A 4JFED 4XAWH 2DKMA 3MUJA 3KYMB 3ARGC 4AY0A 2W9DL 3RWIA 1N64L 3MLPA 3OKOB 3QFDA 1A6WL 5C6TL 5INDB 1FRGL 1YN6A 3KLAA 4X7TA 1TFHA 1C08A 3WEXB 4KVCH 4QRUA 2WW8A 2UY6A 1I1CA 3CK0L 5ITBH 3PGFL 3C6SB 5CEZE 4JN2A 2DQDH 3G08B 4JFPB 4IBLT 3PJSA 4MJIA 3O6FA 3NTCL 4LP5A 4M1GH 3V6OE 3D3VE 4L8SA 4QXTA 3QFJE 3AU1B 1KJ3H 2Z8RA 4LEXL 5F3HA 3B9KC 1CLYL 1VFBB 4EI5D 3MA7B 1CVRA 1KIUA 3M8OH 5E94B 1KN2L 1X5KA 3QUYA 4XX1G 3MUGB 3C2AH 4RAVB 4Y2DB 3RY6C 2OLDA 4AIZB 1Z2KA 1CXLA 3D1MC 2J8OA 4NGHL 5HGDA 3VWJB 3WCYA 4X98A 1EO5A 1TQBC 3L3KA 4XPAH 2F58L 2W0FB 1A14H 2PCPB 3W0WE 2APXA 1ONQA 1OWWA 2ESVD 2NY2D 4MXWL 4AENB 4I4WB 1D6EB 4XB7A 2ZUWA 4XCEA 4NKIL 5GRXG 1S7XA 4AZ8A 3N1GC 1CFNB 4JJ5A 3VGAC 3EDDA 1XF4B 1HE7A 3HMXL 3KPNB 3VXSB 3KJ6H 4CMMA 4ZFOB 1NLBH 5D7IF 3L7EA 1H3VA 1IKFH 7CGTA 3B5TA 3GKZA 5I8CA 3NN8B 3O2DH 2ZJSH 3LB6D 1LNUA 2MPAH 3LIZL 2J88H 5KSVA 2AJ3B 4WU7B 1LEGB 2W9EH 3MCLL 1HHGA 5I16A 3MXVL 3BI9X 3FQXB 2HT2D 3CLEH 2ZCLL 2G9HA 2NY3B 3VG9B 2X4QB 4NM8H 4P48A 3OKLB 1XGUA 4JKMA 1M05A 4P2OD 1T5WB 1NUGA 1PFCA 5JXED 3NIGF 3FT3A 3MV7D 1MIEL 3P11H 4ONHA 5IG7A 1EEQA 1UJ3B 1FJ1B 1IT9L 2A6KB 2IWGA 2ILLA 1A7QH 5HYQB 2XWTA 4KMTH 1BIIA 1DEDA 4JFFA 4C83B 1ZVSA 3SKJH 4D8PA 1X5FA 3PDGA 3ZSTA 3IJSB 1VACB 3QUZB 1FIEA 3MYJA 4P23C 4XMKL 2R2HA 5TE6H 3RA7H 4MS8D 4J3XA 4YBQD 2AABL 3MYZA 4ENED 1F6FB 2NY4C 4JFYB 4PS4H 2IPKB 4R0LA 5F72S 1E4XI 1U8MB 5DUBA 1QHOA 2BOCB 1RZIB 3FRUB 3HI5L 5DEFB 3L9RA 3RZCA 5D5MB 3PV7A 1WK0A 4JKKA 1VFMA 3MV9A 4HC1H 2GUOB 4I9WE 1EMTH 1PX4A 3SE3A 1F00I 3QDGE 3TBVA 3N85L 4K3GA 4OLUH 2ERJB 3S5LB 3TT1L 3BWUC 5FGCB 4ELKA 2ADGA 5D1ZC 3K2UH 5I1IH 2VXSL 5J6GB 5MI0C 2DLGA 1RJLA 1YPZA 3MREB 4TRPL 1QPXA 2V5RA 1V7MH 3N1MC 5HGAA 5DVMA 2CDEB 1JUFB 5I8KH 4OUOA 3LAFA 1MHCB 5F88A 2HFTA 3UTTA 3OQ3B 4R8WL 3TZVC 2E8YA 4U1MB 1LP9B 4H88L 1NC4D 3WL9B 4F58L 3ARDB 1E28A 1A1OA 4K9EC 4TSAH 1BFTA 4X5LA 3NACL 2FJHA 3GMRA 4P5TB 1DTUA 5FM4A 1DN0B 5DMKA 4ZAKA 1OTSD 1WFUA 2QBWA 1KC5H 3WIIL 4BQ6A 4R7DB 4GRMA 4J12A 4KTDL 5D7IE 3DETC 5GGTL 5A1AA 5F7LB 4HFWA 3V5DB 5BJTB 2AJYH 4R4NC 1HCVA 1X7QA 4DKAA 3QA3A 4BZ1L 2AJXL 1I8KA 4LCUB 4XCYB 1I7TB 5HGBB 2QEJA 4HFUH 3GSUB 1UB6B 1T7VA 3DLQR 3PGCB 5ICYB 3RPIA 1F3RB 1Q9OB 3HB3C 3RVVD 3WHXB 1CZ8L 3RGVD 3RWGA 2VDNL 5JDSB 3OSKA 3NIGE 3RQ3A 5EZJA 2XA8L 4JG1L 1ZHKB 1GAFL 5JA9A 4I2XE 1CGXA 4EN3A 4UINH 2O61A 1A21A 1A6VH 4GAFB 4JY5L 4NKOB 4M93B 5F7HA 4TOYH 1G7PA 3JV6B 3IDYC 5EN2A 3FONA 2EIZA 3E2HB 1RUML 5EIVA 4NCC2 3LEYH 4U1IA 2CK2A 2J6EA 3RAJH 4MJ6A 3E1F1 5C6PB 1JGDB 3PQYE 3D48R 3NCEB 3QPXL 4OV5A 1NCAH 4RFOH 2Z31D 5LCVH 1AO7E 5DQ9B 5IB1B 4PJ8A 2BRRH 3MOBH 3IAGC 4WCYH 1EEUA 3P4OB 5BXFB 5I1GL 4WUKL 2XFXB 4N0FB 2VQ1A 4O4YL 4HUVA 5MP6L 4FFWC 3TT3H 1L7TH 5GZOD 3BPLB 2ICEA 2DI8A 2I60L 1IBGH 1EUUA 2YN3A 5E2TH 2IAMC 1CXIA 4U1JA 4WUUA 2JCCB 4YLQT 4M7JH 4PJ5D 3K4ZA 3MJ8B 5DRZA 4DKEL 4UTAL 3LKPA 1R3IL 1YEFL 4QRPE 2ENSA 2CLZB 4G80A 1TPXB 3PWPE 1ZVHA 4QRQB 3RWEB 1OT1A 2MSPA 4GRLD 4NZUL 4WI5A 1WISA 1V3KA 1WTLA 1W8OA 2QADB 3L5HA 2DMBA 3GJFB 1JNHB 2IADA 3SY0A 4MCZB 4XBPB 1FHGA 4E41E 1P7KA 1UVQB 2R0LL 4P9HL 3C9NA 3FO1B 3ZTNL 2ADJB 4JPIB 1MRDH 1UQSB 3THML 2HJFA 1JI1A 2XXCB 1WWCA 3RGHA 4JFHE 5D1XC 5GGRY 1G7IA 4RAHA 1OSPH 3ZDXF 4DVBB 5E56A 3MRPA 4OCWH 4HUWB 4GBXB 4LPCA 1R24B 4MAYD 5F6IC 4U4BA 1AI1H 3KPOA 1ORSA 4DZ8A 1NCUA 3MC0A 4QHNA 2R4RL 5EBMA 4XXCC 1QEWA 5F9JA 4LU5H 3H7BA 2EDOA 2ARJA 3TYFA 3CFDA 4PTUB 1MQKL 3ARFA 4ORGA 3RDTC 3WFZA 4G9FB 3SGKA 3ZSSA 5F7DB 4PGEA 1GXEA 5GGUA 5CINL 4JM2B 4B7IA 4NN6C 3VD3A 3AB0B 1S3KH 8FABA 2DYPD 1JMXA 1G6VK 1KEMH 5I19H 2BNQA 2ZOLA 2X70A 2NX5E 5B21A 2WINB 5IEHB 2LU7A 2FYYA 2ZWLT 2OTWA 1I3VA 5CBAA 1WBYB 2JJSA 5DLMH 2VLJE 5C1MB 5J9PB 4Z7OF 4UB0L 3KJ4B 3HZVA 4M6ML 3EO0A 3TNNB 4PGDB 5C3TA 2P5EA 3ZT6A 1MWAH 3Q6FA 4M4PA 4YO0B 3LH2H 4D2NA 4AMKL 1QPPA 3IGAA 1S9VB 4P5KA 3UMTA 4XP9H 1AXTL 4EDXB 3QXDA 3SCMA 4LPWA 2X40A 4ODUB 5J8OA 1XGTA 5D7JA 3BSZL 3RX5A 5DRNA 1JYNA 2FEEL 3IFOB 2Q86A 4ZUUB 1CFVL 1I9IH 3T2NH 2AV7A 3BUYA 3EYQC 5HYJD 4AT6B 4BQ8A 3C08L 3RWCB 2EEAA 1CBVL 4KK5D 4RX4D 5FCUH 1ED3A 4OF6A 4TSCH 1X44A 3QIWB 3MRLA 4G8GE 5CEYA 1UKSA 4K9EL 2DAVA 4FABL 3QULA 4OB5H 5E8OB 4IOFC 3IFLL 4NRYB 1CK0L 1Z3GL 5HHMB 4CJ0A 3QIBA 4FQXA 3HFMH 4HH9B 2AXFB 2Q87A 3I75A 2D7MA 3TF7C 5ABDE 3HE7B 4OJFL 5HPMB 3HZYA 1D5MB 4NYLB 1P4BH 4WWKC 5DK2A 2OTUB 1FSKB 3DNKA 4XP1L 5MEOB 2RAMA 3FL7A 5TQ2L 1D9KB 4YAQA 4JB9H 4Y1AA 3V6FA 1BHGA 1ETZA 4YFEA 4P2YA 1ERNA 4OUUA 1XH3B 3ZDXE 1IC1A 3U2SA 5IMLB 1N6VA 4PRBB 4LCYA 4KVNH 5T1DH 3D18A 4EVNA 2AJVH 4BM7A 1C5BH 4BELD 4X7EC 1J18A 1YDPA 3UTSD 5L6YL 4M6OL 4DW2L 4F57L 2Z91A 3BP4A 3KPRA 4HEPG 2CXGA 3WDIA 4D9RE 1TTGA 3O4LD 1P5UA 3T0EC 1KG0A 1UACL 3AS3A 4YK4C 2NY6B 5C0CD 5CMAA 3PHOA 1IMHC 3MNWB 4HJGA 5FECA 3C60D 2HLFD 5FCSH 1K4CA 5DRXA 3FTGA 3CSGA 1HKLL 1S9XA 1VKXA 3QJHA 3QPQD 2AXGB 4P2RE 4S1SL 1XR9B 1CLZL 2F54B 3VXPB 3FB5B 1ADQH 1FDLH 4OZFG 4UBDD 3QNZA 5TQ0L 5HVWA 4HPOH 2HMIC 2QV2A 3V8CA 4Z7OE 3C5JB 3P9LB 3JBG7 5FA4B 3LMJL 5K9KA 1ZHBB 4YDVB 1MCEA 2XZAH 3CCHB 3HMWH 4O2FB 3KPTA 3BVNA 1BQLL 1TZIA 1DVFB 4HWNA 1QO3B 1D3CA 1SJEB 3GB7A 3DX9A 2NCMA 2FJGB 4MD4B 2BVOA 3L6FA 4YXHH 4JRWA 4R2GD 1SYSA 2QL1A 3BDXA 3D85B 3MJ6A 3MNVA 4PYGA 2MJWA 4HH8A 2ZPKL 2FLBT 3I3EA 4G5ZL 4ZUVA 4YDKH 3ETBF 2H26B 2ZSVB 2LU3A 3K1DA 4JQVC 1HDMA 4X6BB 5EA0H 3TN0A 1P9MC 5A3IC 1F90L 5IR1A 4G6AD 4N0UA 4OGAC 4U6HB 1R5VA 1J05A 5AAMA 3HCVA 1CT8A 1ND0B 2X09A 4I0PC 3VFRB 5IB2A 4PRHD 4P5TC 5L9DH 1GVIA 1B0RB 5D2LB 1RJCA 2C26A 1A6UL 3MBEC 5HY9B 4KI5D 2ENYA 3ME0A 5EORH 2HG5A 4MGXA 5EU6B 4KZDL 3PL6A 4G7VL 4J3VA 1NCDH 2DM4A 3QDJB 1Y6MR 2F5AL 1AIFA 2VLKA 2XY1A 5ACZB 4H1LH 3KNBB 4YR6A 1RSFA 3V5HA 2NY7H 4NZTL 3HC4H 4QXWA 1MHEA 2VLRD 5DYOB 2IQAB 1LDSA 2Z4QA 1I1AC 4XNYH 1FNGB 1E4WH 5D93B 5IMKB 2AERT 4UT9L 1CTNA 2OL3B 5ISZA 3WNPA 4YQXH 2CDFB 4FMKA 1KLGB 2QQKL 1MOEA 4ZO7A 5ESAB 2FSEA 1PD6A 4M62L 5C07E 2W0LA 2VL5A 3CUPA 1S78C 4NJAL 4X99A 5T5FL 5GJSH 4Z0XA 4ZO8A 4KK9C 3BHBA 5EIQA 1W0YT 5DHVA 5EOQL 4K8RD 4AG4H 1MCPH 4MNGA 4ZXBC 2G5RA 5L8KB 1JK8B 2HN7B 4LCCA 2Z35B 3O0RL 4JREC 2Y07L 4KKCC 1LO3L 3QDMA 5HXMA 2V5TA 3QUXD 3RJQB 5BVPL 3QO1B 3E6FB 4X7TB 2ATPA 3PP3K 4YHOH 3T3PF 5D5MF 2UV3A 2AEIT 2QSVA 3BT2L 3TIEA 3MV8A 4NN5C 1R5WA 2YA1A 4JN2B 5HHVH 4HF5L 1KNOA 3PJSB 4MJIB 3FO9A 4PB0L 3O6FB 5SWQA 3ET9F 2D7PA 2A38A 1G0DA 4L8SB 4QXTB 1G6RH 3MGTA 1FVEB 4MAUH 5F3HB 1CICA 5IBUB 5SV4A 5GRZA 5JLZA 3ZLQC 4JFEA 3F6IA 4NQVB 1WCBA 2QQLH 1HIML 4PJXA 4KJYA 3MJGX 2XKSA 1RIHH 4JCMA 4NNPH 5C6TH 3PWLA 3W5NA 1KLUA 1YEKL 1A0QH 3CK0H 5IUSA 1RUPL 1Q9WA 3PF2A 1OD7A 4XBGA 3QI9B 3L3KB 3FB8B 2WMPA 2IBBA 2OXGA 5IBLC 1DQJA 3O6LL 4PJEA 4FQHB 4G7YL 2EE9A 3W11D 3R8BB 4EI5A 4X0KA 4XCEB 1S7XB 4OIIH 5BW7A 4JJ5B 5F7EL 1NKOA 3LD8B 4GKOA 3VFNB 5CUSH 5CAYB 5EO0A 3VXSE 3IXTB 4YDJB 4C57C 2ATKB 4D0CA 3L7EB 3ARUA 12E8L 1QUNA 4NGHH 3VXQA 4NUJA 4JPKL 1F11A 2F58H 5KSVB 4YBLB 3BD5A 1UM6H 2YPLD 5GRUL 3WFEH 1UKQA 2ESVA 2ZUVA 5I16B 4MXWH 1IGYB 1FO0A 2I5YL 2BXYA 4GXVL 4U7SA 5DJYA 5L7XL 1X9QA 3UROR 4XCCH 2AGJH 1F6AA 3SKUD 2PTTA 3VFWB 5HYSA 5KSBA 2OM5A 4LBEB 5C0RH 4HX1A 2BC4A 1C12B 4APQD 1IQWL 1EVUA 1QFWI 5IG7B 4NHCH 3LIZH 3MBXH 2XWTB 2VSCA 2D7NA 4CMHB 1CWVA 2WWKT 3MRGA 5B4MC 3PWUA 3GJEA 4JFFB 3MCLH 5C09D 2AI0H 4D8PB 1ZA3B 3MYJB 5K9JL 2VE6B 2QLVB 3KJ4C 4PP2A 4DUXA 3UBXB 5DJ2B 5TF0A 4P2OA 3O3EA 4JDTH 3CNKA 5JXEA 1JYXA 5E99L 3MV7A 1XF2A 3UYRL 1MIEH 1Q1JL 4OLWL 1VPOL 3PE9A 2R0KH 1LDPL 3T3PE 5D5ME 2CJUL 1ZLSL 2YXMA 3BGMA 4JFDB 3BN9C 2XQYG 1VFOA 4PREA 3JZ7A 3TBVB 1BBDH 1CXHA 3TBTA 2FGWH 2FO1A 2F5BH 4ELKB 5LG1A 2ADGB 2XKNA 4X9FA 2AABH 3QEQE 5FGCE 2UZIL 3B2VL 3GBML 1JTTA 1JF1A 3FZUD 5D7KD 2HVJA 2JJVA 2BSTB 1RJLB 2A83A 4KAQL 4M7LT 1CVSC 2EYRA 4KDWA 4WTZA 4NQCE 4LLWA 3U4BL 4OCSL 3HI5H 2EDTA 4YHIB 5HGAB 2X10A 5HYFA 2F8VA 5I8EA 5A2JH 1MJ7H 4HG4J 5KSUA 3I02A 1FCCA 1HHIA 5CGTA 3GMNA 4PRID 4YHKL 1E28B 1YECL 2VXSH 3VH8G 1C1EL 1TZGH 2EYTB 5FUCC 1JF6A 4DOHB 1DQML 2FJHB 3KXFB 1ZSDA 3N50A 5K9QG 1QSVA 1JYWA 4F9PC 2ZUUA 4ZAKB 5DMKB 2DQHH 5D4QA 5HHXL 1B4JH 4GRMB 4XPFL 5JNYA 1T66C 3LSOA 1OAXL 4HFWB 3GHBL 4LHQB 5EC2A 5FYJU 4WHCA 3F7YA 1A2YA 2AK1L 3HE6B 1NC4A 1X7QB 3RWJA 4H88H 2I07B 1OP3H 4JANB 1I8KB 4L3CB 5CP3A 3D2UD 2EDNA 3NOIA 1QTYT 5EOCJ 3FN9A 1U91A 4JN1H 4BYHA 1CDBA 4ZFGL 3C5ZB 3GSOA 3NACH 4JM2F 4AQ1B 3RPIB 1G9EA 4G8FA 1BBJB 4Y88A 3MXWL 5E2UL 5HSFA 2EDDA 1G7JA 2IPUK 3RWGB 3SDCD 5EZJB 1ZGLB 2GY5A 4EI6B 5D2NA 2O61B 3FB6A 4PG9B 4R96A 1ZK9A 4BFEA 3CDFA 4XC3L 3U0WH 4BZ1H 5DMGC 2OP4H 1G7PB 2AJXH 3W39A 2R1YA 1D5XA 4OCNC 3TCLB 3L3IA 2YWYA 3FONB 5F7UA 2YXFA 2EIZB 3VI3F 3KDMA 5KVEL 2CDGA 3L3GB 3QEGL 4UMGA 5EO9B 2OMNA 4OZGF 4MJ6B 3RGVA 1CZ8H 4ISVB 4OV5B 2VDNH 2FB4L 2XA8H 3IDIA 1QNZH 4KKLC 1NGYA 4EJ1C 2APWA 1YMHA 4ZNEE 2HTKC 2AV1A 2VQ1B 1R3HA 2CLVA 3QQ4B 5E08L 5CCKL 2ICEB 1IRAY 2AXHA 3K81A 3MODL 5HGHA 4P49A 3DMMD 4KRPC 1OAKL 1LEKB 4PJ9B 4AM0A 3EDFA 1HQRA 4WUUB 4WFGE 1HH6A 1T0NA 3TVMD 1RUMH 5FYJH 3VFSA 1IAMA 1J1XH 3QXAB 1P4IL 4ZSOA 4RGNB 2C3WA 3FFCD 3LKPB 4YIQA 3RWHA 3VXUD 1QRNB 1J8HE 3EOTL 3UCRA 5DDHB 3ARRA 1I7UA 4ODSL 5SWSD 1J1OH 4CJ1A 1SYVB 1NBZA 1WZ1L 2IADB 3SY0B 5AD0B 1P7KB 2NW3A 4JGJA 1NAMB 2I60H 4G9DB 4X6FA 3D39B 1IEBB 4HSQA 2FH8A 5DQDL 4LLYB 4X9HA 1R3IH 4HPYL 1G7IB 1MFEL 1YEFH 1MCKA 1BJ8A 3QEUA 1K8DB 3MRPB 2L7UA 4GRLA 4RMWA 1HH9B 2P8LA 1X5ZA 4P46D 1MCHA 5E8DL 1ORSB 4P9HH 4QHNB 5IBTL 1WJ3A 3OKNA 4N1CA 4WO4D 4YFLF 1AR1D 1QEWB 5F9JB 5HI5C 1PQZB 5EULV 3BJ91 1LO2L 3H7BB 1GOGA 3VJ6A 3TYFB 4PR5A 4ORZC 3ARFB 5ID0B 3ARTA 2FATL 1K8IA 2HWZL 4MHHG 4G9FE 4QRRE 4KHXH 2BVQA 5EU4A 2VKXA 2PR4H 5GZNC 3S9DB 5HTSA 2WBJD 2BOBB 2EO1A 1GC1C 4MAYA 1X6NA 4H8WC 5FOBA 3Q5TA 2BNQB 2ZOLB 1JPFB 2X70B 2D2OA 2GEEA 3B2UD 4NDMB 1FFPA 4LSRL 3I84A 4O2EA 4MDJB 4P4KD 2OTWB 4CRPA 1R3LA 5BV7B 4LCWD 3GM0A 3P73B 3U9PL 3PABB 5KZCB 4G6JH 3HZVB 3VI3E 3EO0B 2P24A 5CINH 5DT1L 4RBPK 3WBDA 3Q6FB 5DEGB 3SJVE 1HKFA 4LLUB 4OZGE 1J1PL 2DYPA 3ARED 3B9VA 1U3JA 4NP4L 3QUYC 1CXKA 2QSTA 3CGTA 2F15A 4RFEA 5IEKA 3SCMB 5KSAB 5KVFL 5BMFL 3JTSB 4PRNA 9CGTA 2VDLH 3SOBL 3IDMA 1XGTB 4GS7C 5KBNC 5LXGL 2P42B 1HEZA 2Q86B 5IB3A 4M5YL 3OG6B 3BUYB 4HCRA 1U9KA 4V2CB 3OKDB 1FLRL 1I7ZA 2QQQA 4K23L 1ED3B 4DUVA 1KPVB 2B1AH 4Q7DA 2JF1A 5EU3B 2VR4A 2J5LB 4WFFD 5AAWA 5CEYB 2X7LB 5J1TC 1NCWL 1F3DH 1NFDA 1UWXH 1H5BA 3QULB 3OKMA 4F7TB 3TJEL 3GEWB 3QIBB 4K07A 2CPCA 3RIFK 1M4KA 3I75B 2PYFA 3VG0L 3HZYB 3E0GA 5DTFA 5HYJA 3WN5A 2J8UB 1MHPH 2VUYA 1WFTA 4RX4A 4WI3A 1JF5A 5KVGH 3WLBA 1H3UA 1A64A 2X05A 4Y1AB 3U1SL 1CE1H 1MFCL 1ETZB 1ZHNB 2VDQH 4MWFA 4PLKD 4YHMH 5FUCE 4K9EH 3L3OB 3U2SB 1MVUA 1CL7L 4Z7QF 1Z3GH 1AFVL 3IJHA 4IMKA 1WVZA 3DHMA 2DF3A 3ESVF 5TFSL 4NZDA 1QBML 2D9CA 1DLFH 2ZKHL 4LSVL 2LQRA 3WNOA 3C09C 3AMKA 1FL6A 4MB5A 1KG0B 4WEBH 4XP1H 4O00A 4YWGH 2BERA 4BSVB 5I1HL 4FZEL 5TQ2H 3OTTA 1QR1A 5CMAB 2ARWA 4C59B 4R0LC 4HJGB 2VC2H 5FECB 2XNAA 3VXTB 1HZHH 1TITA 1RUAH 4NWUH 3FTGB 2GJJA 3X11A 3RZCC 4EUPA 4N8CL 1BP3B 3UTSA 1VKXB 1MCSA 2IC2A 3MRFA 4OF7A 3TESA 5F96H 5L6YH 1SY6L 5IESL 2BY1A 3EYOA 1JNLL 1H15A 1TIUA 3O4LA 1XCTB 2LVEA 3QNZB 1UACH 4L9LA 5DK3A 4HHAA 4HZAA 5C0CA 3OAZH 3WFBH 4GAJL 2JB6B 4LSDA 5DA0B 4AEIL 5K9KB 3C60A 5JW4R 5F7FA 5IB5A 3MROA 1HSBA 2ZSWA 1HKLH 1TJHH 3BPNB 5ALBL 1Y6KR 3DX9B 2EDWA 4N0CC 4OZ4A 4S1SH 1CLZH 3BQUB 1QSED 1KN4L 3QDHA 1SYSB 4GAYA 2EDJA 4RISH 5E7FA 2EEBA 2VDPL 2ICCA 3O45B 4RQQA 2D7QA 3CH1B 3JWDC 4XHJD 2MQ0A 4ZUVB 2H8PB 1IGJB 1TZHB 2FHBA 1NAMH 1HDMB 3TN0B 4K3HA 5IP4A 2L4OA 4WV1A 5F7WC 2IH3A 2X5PA 4N0UB 3LMJH 4NQDD 1NMCB 3HCVB 3W5MA 4ZD3H 1VFUA 3WFHB 1F4YL 1BQLH 3S34L 1QQDB 4OCRH 5DZOA 5HDLA 5F1IB 5D2LE 5FYKL 4BSWB 3MLXH 1K5NB 4HWEL 5J11C 1C16B 4PFEA 1NUFA 3SDYL 5FDWA 1XAUA 3PL6B 4CGTA 1T1XA 5MEPA 3GBLA 2OJZH 4HIIB 5D9SA 5GIRB 2VLKB 1AIFB 1A4KB 4G5ZH 1KENL 1KXVC 3MRQA 4K7PX 5DFWH 4K7FA 3RRQA 3OHXB 3WXWL 3M17A 5H35A 3R0MA 1AGCA 3SGEI 2YMXH 5K33A 4JVPA 1MVFA 5DJCA 3P30L 5JHDD 1KB5B 1JZ2A 5ISZB 4Z7QE 1GC1L 3LQMA 4EN3C 4KZDH 5EUKA 1IEHA 5HJ3B 4G7VH 1YJDC 2EH7H 2F5AH 5CGMA 3FN0H 2MKLC 4NCC1 3DJ9A 3BD4A 2VLRA 1MI5D 4NZTH 1N59A 2NXYC 3HR5A 1NUNB 3PNWB 5GSVB 1XCQB 1ZGLM 4JHBA 1CDUA 3DV6B 3L3HA 3BIKA 2AVGA 2R1WA 2KL6A 4HWBA 3PWVA 2G2RA 3RVXC 4PJ8C 4M5ZH 1PZ5A 4OFIA 1EO8L 2R8SH 1T22B 4M62H 2X4RA 3QRGL 1S9KC 2R15A 3IDJB 1MHHB 2Z9TA 3MCKB 4MXQD 2WQRA 3TIEB 4KQ4L 3ALWA 5T5FH 1A7OL 2NTFA 1KNOB 3O3AB 4HG4K 3FO9B 3RBGA 4MJIE 5SWQB 2P8MB 5GS2H 2LTQB 3LKSA 5JLZB 2IFGA 1FZKA 3ARYA 4A6YB 4DAGH 4KDTA 3FRPA 3O0RH 1WCBB 1MLBA 3QUXA 2HVKA 1LO3H 4HKBA 1YPZF 3RJDA 1UXWA 2CKBA 1MNUL 5BVPH 3PWLB 1MCDA 1KLUB 4F7CA 4FZ8H 4M48H 5CJ5A 4HUXA 1Q9WB 3BT2H 3QIUD 1VFAB 1ZTXH 1JHKL 3QZWA 1JGUL 1NGQL 4TUOB 1FVDA 4KK6C 3VRJA 4HF5H 4XBGB 4GAGL 4PJHA 4PB0H 2ITDB 2EZ0D 2IMMA 4XPGL 1J0YA 5FYJE 4CW1B 3X13A 5ICXA 2QHLA 1EERB 4HEME 1DQJB 4PP1C 4PJEB 3NMEA 4IS6B 5IF0A 25C8L 2VZ3A 1EGJA 4YXLH 5DRWA 2YUWA 4G42A 3SE8H 1QFHA 4TN9A 3MOQA 4DK3A 1JWMA 3V0WH 4XMPL 4LVHB 3NA9L 2Q8AH 4D0CB 1FE8L 1RUPH 2XV6B 5BS0B 4Z18A 5IOPA 4N8VA 2W65A 5EZIL 3VXQB 1GGIH 4XGZB 1F11B 4EQ3A 5C7XH 1U3YA 3WIFA 3BO8B 4NN7C 5DJ8A 2ESVB 1KBGL 4NRZA 3SPVB 4X80L 1TTFA 3O6LH 3TPUB 4NQXA 3ARFC 3UPAA 5DMIL 1FO0B 3SGKC 4ONFL 1U8NB 4JEGB 3F65A 4HDIB 4Y2DD 5SX5K 2UY7A 4M3JA 1E4KA 2HFFB 2WANA 4WY7L 5FYLE 3VWJD 4PRAA 5KSBB 3OPZH 12E8H 4HX1B 4NOFA 1Q0XL 5C08B 3MQIA 5I15H 1I3GL 1IAII 4IDJL 3SE9L 3H0TB 2YPLA 3PWUB 5GRUH 2JJSC 4JFFE 1J88A 1IE5A 2I5YH 2HLAA 4GXVH 4LSPL 3PUCA 5FUOH 3WO4C 3GKWH 5L7XH 4JZOB 3L5JA 4X5WA 1QLEL 4XNQB 3MV7B 3AROA 1NANH 3LRHA 2EO9A 5ANMA 4MNQB 1TXKA 1XF2B 3N9GH 2OZ4A 4QYOA 2Y7QA 2NTSP 3BP5B 4FMFA 2X9WA 4APQA 5C0GB 3QUKA 1IQWH 3SCMC 4G8IB 3OB0K 2R4SH 3TO2A 1JRHH 3JVGC 5D7JC 3MV9E 3MLZH 1J5OH 5GSRB 2NY3D 5C09A 3NFNA 3VGHA 2GK2A 1CXFA 5LBSL 2Z8SA 1BIHA 3O3DA 1KELL 2NLJB 2XKNB 3S35H 3F6LA 4I3SL 3JWDL 4OFVA 3MLUL 3VWKB 3GMOB 4W6YB 1JF1B 1BVZA 4KMLB 3E8UH 1BJ1J 4WNQA 2EXYD 1QLRA 1YPZE 3UYRH 2DDQH 3ZL4H 1Q1JH 5D7LA 1VADA 3H9HA 3OB8A 5F7MC 3QIBC 4FQXC 4KK8D 4Y5YA 3MLVL 3CU1A 4LPTA 1ZLSH 5JQ6H 5J3HD 5GS1A 3QUZD 5I8EB 4XAKE 5JPNA 1MCWM 1R3JA 3B8SA 2YC1A 3UTTE 2VAAB 4XNXH 3Q3GA 1JTOA 3I02B 3RL1B 3EOAB 2KBGA 3IS1X 1HHIB 4UU9A 1RK0A 1JGVL 2R9HD 1OL0A 4KV5F 3SHSA 1JBJA 4X7SL 5F1OB 5C9JB 4WFEE 3GI8L 4HWUA 4HJ0C 1RZFH 3RKDC 4AYFA 5T3XL 1GH7A 1VEOA 2RFXB 4OCSH 4FXKB 2V17H 4U6YA 4PG2A 5J06A 4I5BA 5JNYB 2J2ZA 3LSOB 4MA7H 1KB5H 5HHNB 4QEGA 1ACYL 3ARXA 1QBAA 2H9GA 4BFBD 1QACA 5I30L 1NC4B 5IGXH 5F89A 3QCVH 3BH9A 4PRIA 1LD9A 1YJDL 5E4EC 3SBWA 5BZDA 3Q6GL 4YHKH 43CAB 1HN1A 3NZHH 1T4KB 2BMKB 1U91B 1MIML 3DGCR 2Y6SC 1E4XL 1QG3A 2VUOA 4HIJA 4G8FB 3MCG1 1G7JB 5GQBA 1F8TH 2J6EL 4N9GA 5HHXH 1DE4B 2KZWA 4XPFH 1NFKA 2AQ2A 5D2NB 5I6XB 1OAXH 4WVRA 3AS2A 3ZT7A 2H6PA 4R96B 3ARDD 4HKXB 4U1GC 3LN5A 2KQNA 2D3VA 2A74A 4TPRL 3D2UA 3W39B 3QHFL 4IRJC 1GHFL 3FT4B 4OM1L 3KDMB 2ZNXA 4BZYA 4Y4FC 4ZFGH 4NKMB 4C54A 4JRYD 3A6CH 3M1BB 1NCBL 4KPHL 2P5WA 3RGVB 3O6MH 5AYQA 4A6YH 4L4VB 1MAKA 5F7NC 4OLZH 1YMHB 4FFYL 4Z7UA 1OAQL 2AV1B 1X4ZA 2CLVB 4MA3B 3CMOL 5HGHB 1I8LC 4IOIB 4Q97A 5HI3D 3VXNB 4OGYH 4PV8A 4AM0B 4UOJA 4WUUE 1KB9J 4PJDB 3AY4A 4ZSOB 3QEGH 3KR3L 3TA3B 4LOUD 4J2XA 4P2QD 1QRNE 1NMCC 4KUCF 1I7UB 1FZOB 3H3KA 1ZT7B 2FB4H 4QOKD 5IVZA 4KH2A 2D03L 3U6RB 1RI8A 4FQ2L 3ULVC 2WIMA 1G1CA 2H2SD 1NBZB 4FQ1L 4WEUD 4UOW0 4WIQA 3LHPL 3DMMA 2DLEA 4X6FB 2EKJA 3DURA 1OAKH 3TVMA 2HFEA 1GZPB 2YD5A 3VXUA 2D0FA 3FFCA 5B3NA 3VD9A 2GTZA 4KV5E 4PJGA 5SWSA 4JFOA 1F4AA 4OKVA 1UJTA 1JZ4A 2QR0A 4GRLB 3QJFA 4XZUB 4Z7VA 3BKJL 3GMQA 3U4EA 4Y5XA 2P8LB 2R23A 4WW2B 2V2TA 5HHPB 4OCLC 4L3ED 3V5KA 3OKNB 3CSYA 3WE6A 3MRNA 1A6ZA 2EC8A 3VJ6B 1A9EA 5EDXA 4LL9A 5K93A 5T1MA 1C5DA 3MOAH 5I18H 3GIVA 3CU7A 1S7UB 3O3BA 1UZ8A 4HPYH 2BVQB 4LCCC 4YH6A 1MFEH 5EU4B 1FL3A 1G7HB 1LK2A 4HXBL 2QADD 4LARL 2GITA 5F97E 1XGPA 5CD5D 4MAYB 3LKNA 2SEBA 4P46A 4FFZL 2XPGA 3OJ2C 1HYSD 2BNQE 1HXMA 4YHYC 5E8DH 4PLOB 4NIKB 4WO4A 4ZPTA 5CIPA 1A3LL 4U1KA 5JHLL 1KIQA 1BJMA 3NZ8B 4OD2A 1U58A 2VXVH 3ISWA 4GFTB 4GKZA 1EBAA 4L4TB 1DCLA 3X17A 3TFKD 3HNSL 4XCNB 3ZHKA 4POZD 4OAWB 2DBJA 2X4TA 1CICC 2QKIA 4GBXD 4K7PL 4I3GA 4DFHA 4NNXA 1OAUL 3JWOC 4M6AA 2IBZY 1P5VA 2P5EE 2AAVA 3O3UN 3X14A 4WWID 1N0XL 4IIQA 2DYPB 4BKLA 4U1NA 1IGML 1A1MA 4RFEB 1L9NA 5B8CB 2DQGL 4K71B 4XBEL 3GIZH 5EG6C 5IEKB 1JWUA 4PRNB 4LSRH 4P4KA 4FQCL 3IDMB 5DC4B 1XIWC 3GRWA 1EVTC 5IB3B 4LCWA 2AS5M 1ZLUK 4PLNC 1F4XH 3U9PH 3IDXH 3EJJX 2Q8BL 5IQ7L 2FGZA 3SQOH 5F9AC 4EI5C 4JHAL 1DR9A 4GW5B 5CGYD 3K80A 1E6OL 3AREA 4LLMA 1KTDB 1J1PH 4X4YA 3PGDA 4NP4H 1H5BB 2GK0B 4JJHA 4ONGL 4GLRH 4MJ2A 4G6ML 4Z0BL 5TDOB 1JFQH 5KVFH 5BMFH 4JZNB 4KQ3H 2QHRH 2FWOA 5DF0A 4AL8L 5IHUL 5FKPA 4QWWD 4GSDL 1SM3L 1LO4L 2DQIH 5DTFB 5HYJB 4E42A 2NY2C 2Y36L 1AR2A 2J8UE 4WHTA 2NY1B 3WJLA 5JXAL 3WLBB 5DJZA 4U6VL 5MENB 2V7NB 3TO4B 4Y1AE 3FQUA 1KT2B 1AXSB 1FNHA 5KANI 4ZUSB 1I7RA 1MVUB 1MAJA 3VW3L 4XTRC 1U6AH 3O4OC 3AS1A 2W92A 1M7IA 3ES6A 3LB6C 1NJ9B 3VG0H 3IFNL 2NY5C 3WD5L 4QGTA 4QHMA 3KPRE 2HT2C 4M6NL 1T83C 3QWRD 4NBYB 2F53D 3O8XB 1D6VL 2X4SB 2DWEA 3QCUH 4PJIB 4P2OC 5HHMD 1HINH 4UIMB 3S6CA 1WZKA 1HHHB 4XVJL 5DJ0A 5JXEC 1NSNL 3HI6L 4OM0L 2ZG1A 3VRIA 1J7VR 2CUMA 4GKSB 1CL7H 3HE7D 1RIUH 3OXSA 5D1QB 1AFVH 3VDAA 1PLGL 3IB4A 2C3XA 5TFSH 4MB4A 5IW6A 1AGDA 4N8PA 3VDBA 1RAMA 2EC9T 4QXUL 1KGCD 4LSUH 2XTJD 3LEVL 2JLLA 1H15B 2ZKHH 3O4LB 3DV4A 1BM3L 4LSVH 2E7HA 5IKCA 3INUL 1H3WM 3PDDA 3MLSH 1A5FH 1G9MC 4MS8C 2M26A 4YBQC 4ENEC 4EIGB 4WHDA 4EOWL 2P47B 1ZGLP 1R5IA 5FYKU 3KPMB 1YN7B 4FNLH 4PJXF 4N5ED 4Y4HB 2HAZA 2VDRL 3ARWA 1H8NA 3MROB 5KVDL 1HSBB 1H3TA 1KUMA 3VCLA 3GM8A 2ZSWB 4N8CH 5EOCL 3CD4A 1S7QA 3VD5A 4OZ4B 1I1FB 3BZDA 3MRHA 2YPKA 3ULVL 1FYHB 1SY6H 4ODVH 5I0ZA 3ESUF 4HLZG 2NY6D 2DD8L 4GAYB 4MLIA 4FG6D 2OYPA 4L8BB 1MAMH 4PJEF 1XF1A 2E27L 4I3RH 1FL5B 3F62A 3O2DA 4GAJH 4CVXA 3BKYH 4WV1B 2IH3B 4P2CG 3DSFL 2E7BA 4N0UE 3NGBB 2VISB 3FCTA 5HVGB 3CSBA 1KTLA 4F8TA 2F54D 2CUIA 1CCZA 2XN9D 3LKQA 1BZQK 3G5XA 1FVCA 2YSSB 3DIFB 5DJDB 1QSEA 4R2GB 4XPHH 4HUMB 2MNUA 4X8JA 4PLJD 2GW5A 3B9DA 4UV4H 3UZVB 4ZUTA 2VLKE 5FB8A 3MRQB 1FFNB 3CLFH 4PJAB 4X6CA 3SKMB 1SMOA 4U1SA 4NQDA 3TNMA 1DVFD 5EBGA 1AGCB 4R90L 1OTSC 2WLZA 3S34H 4PV9A 3ULUH 5DD5L 4LLQA 5FYKH 4RFNC 3HPLA 3GMMB 5ISZE 1OGAD 5KSBF 4RMVA 5I1LB 3EJYD 4HWEH 5D2NC 5TH2A 2LAAA 3SDYH 2W60A 5IMOB 4TVPH 4P4RB 4CDGC 4OF3A 2DKUA 3ZKND 3HNTL 4N90E 5B38B 2CRIA 1BD2B 1J12A 1KENH 4ZOBA 3T0XA 3CVHL 4HC1A 4PJBA 1N59B 2FX8L 3HR5B 2VITA 4MNGE 1ZLVK 3RNQB 4B0MM 4OTXH 3RVVC 3L3HB 3BIKB 2V9QA 3RGVC 1N5AB 4P0DA 5JHDA 5EU6D 2OJEA 2G2RB 3GSXB 3JWOL 3P30H 1EDQA 3QDME 1HQ4B 3QDJD 1GC1H 1OAZH 3GUTA 2X4RB 4M1CD 3HUJA 4BSJA 3O9WD 1G9NH 3MV8E 1BGXH 1LHZA 1CGYA 1YC8A 3U36A 3LKRA 4Z5RA 4Q6IA 1MI5A 3ZKMD 1AP2B 2FHCA 3LKSB 5KW9L 2CO6B 1AGBA 1IZKA 1FZKB 4HIEA 3ALPA 4JFEE 4DGYL 3I6GA 1FNSH 1MLBB 5LGJA 3HC3H 2Z31C 5ICZB 3QUXB 2HVKB 2CKBB 4PJXE 1TJIL 3HRZA 1KPRA 3PWJB 3U46A 3DGGA 1EAPA 1EO8H 4FQQA 2PYED 5GHWL 5TDPA 1PKOA 3QNXB 4LAQH 3QRGH 5GZOC 5I74C 1BEYL 5J12B 4RNRA 3VRJB 1T04A 4HQQH 4PJHB 1B6DA 1RU9H 5ICXB 4PJEE 2DICA 4FTVB 4NKDA 4JHZA 4RSVA 4J4PD 1KULA 3FQRA 1BQHA 2EDRA 4M03A 4GRLC 2JELL 1JWMB 5CP7A 3BEWA 5TE7L 3QIUA 5KN5A 4OLXL 1GCFA 1RZGA 3S97C 1JHKH 3UAJD 4N8VB 2CO7B 4NJ9L 4Y5VB 4GAGH 3WIFB 1G7QA 5DJ8B 4NRZB 2B5IC 2ESVE 2NY5L 3R1GH 6FABL 2EIBA 4U2ZA 3ARGD 4NQXB 5D6CA 1CQKA 1AE6L 5INDA 25C8H 4F7PA 4NQTA 3TLRA 1I9JH 3OJMB 3MV11 5IFHL 3ARBA 1AGFA 1WV7T 3C6SA 4XT1C 2BVEA 4MAYC 2PW1B 2Y06L 4JFPA 4DQOL 3BZ4A 4XMPH 3JV5A 3QI9D 4PRAB 2OI9B 5FYJD 3FQNA 1WICA 3DECA 5KSBE 4NO3B 3MRRA 4NFCA 4I13B 1MCQA 4RCAA 1MPAL 1P84J 1MFBL 5FO9B 5FV1L 3T0VA 3B9KD 1VFBA 4JQIH 3OKKA 1B4RA 3DXAD 4LRNH 2A1WH 3MA7A 4NRXA 4X80H 5E94A 2Y5TB 5DMIH 2C1OB 2HLAB 2G60L 2AQ3A 4Y2DA 4RAVA 1S7SB 3N1QC 1G9ML 4DKDC 3G6JA 1X5AA 3FO0L 4WY7H 3VWJA 5HI4D 3DX8B 3MV7E 3ZZ1A 3BGAA 6CGTA 1Q9LA 4CU7A 3G6DH 3DX6B 5IVXA 4L29B 1NMBH 5LWYH 3VGFA 2K1MA 1D6EA 3SE9H 3TO2B 5HHOD 3NPZB 3WFCL 1SEBB 1YNKH 1IL1B 2DQJL 3X3GL 3KPNA 4IJ3B 4LSPH 4ZFOA 4Q58C 5DUPL 5H37G 5DZNA 3TV3L 1BFOB 2A6DB 1CFSB 4OBRA 4OT1L 1QLEH 1PG7X 4NKQB 4HXAH 1FPTL 1WZMA 3CFCL 2W91A 3NPSC 2FEDD 5ITFB 5D7LB 2AJ3A 1NDGB 4WU7A 1LEGA 3F12A 4NQEB 4Y5YB 4JFFD 5ILTH 4WDIB 2VDOL 3IRZA 2GT9A 2R2BA 4ZFZB 5GS1B 5JPNB 1DN2A 2Q7NA 4XC1L 4MZ3A 5LBSH 1H3GA 2YC1B 2FIRT 3WN5C 3HI1A 1CYGA 1E0OB 4UIKL 1T5WA 2JJTC 1YEHH 4KZEL 2Q7YB 1KELH 4KI1A 1RK0B 4I3SH 3JWDH 3VFGL 2D4FA 2O93L 3MLUH 3BDBA 2BJML 1UJ3A 5IVOA 5TPWH 4P3WA 5HYQA 3SO3B 1QFWL 4JFDD 3V95A 4QRTB 4U6YB 1HILB 4KKAD 3SEPA 3EYVA 1VACA 3IJSA 3QUZA 4IMKC 1EUTA 4NPYB 4CN6A 3CFBA 1F58H 1FQ9C 5HYEA 2H9GB 1JVKA 4LQFL 2BVPA 4PPTA 2IPKA 2HFGL 3BH9B 3DPBA 4NFDA 1U8OA 1L0XA 2GKIA 4HUNB 4N0YL 3NAAL 1U8QA 1RZIA 4IOSD 5GGQL 5DEFA 3LS5H 4X7SH 3GI8H 3HPJA 1AKJA 2GUOA 1ZA6A 5T3XH 3DVNA 4JFZL 5CBEB 3AC0A 5KG9A 4Q9QH 1SVZA 4NWTH 4CADB 2CIKA 3QXVA 1A6AB 1MWAA 3ZDZF 3S5LA 2DI7A 2A77L 5D2NE 1Z9LA 1RJZB 1EXUA 3EFFA 3LN5B 5J6GA 3UP1A 1KIRA 4M8VA 2BY3A 4UNUA 5DD0H 3RWFA 4L9LC 5CZVL 3MREA 3UPRB 5BRZB 3Q6GH 3KXFD 4BH7B 3I2CL 2C4XA 1MCLA 2GFBB 1MIMH 3CMGA 4UILL 2CDEA 2X44D 1JUFA 2I27N 1PVHA 4LVOB 1E4XH 3C8DA 3U0PB 4M3KB 3LOWA 3KHQA 1FORL 3C60C 1VERA 2HLFC 2P5WB 5ENWA 4YXKL 5KOVC 2UUDK 3EO1A 1FFOA 1XGYH 3QQ9D 4U1MA 3F7QA 1LP9A 3HE6D 1JIBA 3EDKA 3L95A 4TSBH 3QPQC 1UH3A 3DX7A 5CILL 3ARDA 4Z7UB 4P59L 4UBDC 3RKPA 2AKRA 3O2WH 3C5ZD 2E7MA 5C0AA 1EHLL 1UH2A 1DUZB 4PV8B 1W72B 1DN0A 4R26H 1NLDL 4JRYA 3JWNC 2XQBL 1CDIA 4HS8H 4ZSOE 4UAOB 1R0AH 3BH8A 3DETD 3NABL 3TCXA 3V0VB 4Z7NF 4Q0XH 1D5ZB 1NFDF 1L9MA 4R3SB 5IVZB 5E1AB 5FO8A 1DZBA 4NNYA 7FABL 2C9AA 1MCOL 4RWYH 5CKGA 1JHLL 2KDGA 5TDNA 4LCUA 2ICES 4FFYH 4XCYA 1I7TA 5I1EL 3ZE2F 3F58L 5HGBA 1CLOL 3ZKXC 3GSUA 1UB6A 1CIUA 3CMOH 1OARH 3PGCA 5ICYA 3MA9L 35C8L 2GTWA 3NFSL 1CR9H 4HIXL 3WHXA 4HAGA 1C5CH 4FQIL 5JDSA 2PO6B 3FFCB 3MMEB 3NH7H 4G6AC 4P2QA 3KR3H 3OXRB 3KPQB 3T65B 5SWSB 4QOKA 5F9DC 1RD6A 4JFOB 5HYSG 5TJWK 2D03H 4KI5C 1JGLH 2QR0B 1CFBA 3QJFB 4FQ2H 1CD0A 3JV6A 3GMQB 2R23B 1JNNL 2GHWB 1HI6B 2UWEA 4PJ9D 2DL2A 1QBBA 1XR8A 3SN6N 2EE2A 5L0QC 5INCB 3CSYB 4FQJL 4RGND 1A6ZB 5D70H 1QFPA 1B0GB 1QRND 3V4PL 1JGDA 1VGEL 3W9EA 2VZSA 1CU4L 4Y16A 2JIXA 1MCCA 3CFEB 1DEEA 5DQ9A 5T1MB 1CI5A 1C5DB 5IB1A 1FV1B 3GIVB 4ZS6C 3PXHA 3O3BB 3P4OA 1WIPA 1ADQA 1UZ8B 4W6WB 4LDOB 4ZS7L 4N0FA 3L5XL 5E4IA 4E0RA 5FM5O 1PDKA 5DHXB 5IK3A 3P0VH 4P46B 3BKJH 4PJ7A 2JE8A 4PYHA 2JCCA 3D39D 4L3EA 4OCYH 3ZDZE 5DS8B 2BRQA 3MJ8A 4WO4B 5CIPB 3BX7C 5JIIA 4NO0B 2ORBH 3VRLF 2EIDA 5DVLA 2CLZA 4K8RC 3UJTL 3VU2A 5GXBB 4MZ2A 4QRQA 3RWEA 2QKIB 4NNXB 4HCRL 1FNEB 4KDTC 4WTZG 4HXBH 4QF1A 1JNHA 4MCZA 4LARH 1J9CT 4IIQB 4IRSC 1TCRA 4BKLB 5BOPA 4NT6A 2YK1H 1NH6A 4U1NB 2ADFL 1A1MB 2WBKA 2ADJA 1IGFL 3FQTB 1G0YR 1RHHB 1OD9A 4BQ9A 1UQSA 1Q0YL 3EYSH 2HJKA 4CNIB 4EKXA 5J12C 2APFA 1A3LH 3O2VH 3UX9B 3V6BR 4OI8A 4LCWB 2IFFL 3Q5YA 3HNSH 2X89D 2WAHA 4HUWA 4QNPF 4GBXA 1JHTB 4W4OC 1R24A 4K7PH 4XVTH 4XWOD 4M7LH 1OAUH 5IMMA 3AREB 4LLMB 4FRWA 4RAUB 1N0XH 2E8ZA 4X4YB 4H1LA 1DL7L 4Z7NE 2VYRE 4I77L 1NFDE 3BJLA 4M1DL 1RVFL 5K59F 4UDUA 4U1HA 2FWOB 5BVJB 1S7VA 3ZE2E 5F7DA 2R56H 5DJ6B 5KZCD 4HWZB 3OKEB 2EE6A 2XRAL 4E42B 1SJVA 1ZHLA 5HYJE 4WHTB 3AAZB 1N6QL 3W11C 5IQ7H 4LASL 1KCVH 1YYMH 5DJZB 2CMRL 2L0DA 3BP6A 4W4NA 1QKZL 1IC7H 2ZUQB 2WINA 4Y19D 3NCJL 1PKQB 2GJZA 3EO9L 3IYLW 1U95A 5KSAD 3RY4A 5I9QB 1I7RB 3H9SA 4MQXD 5C86A 4LAJH 4ONGH 1WBYA 5GS2D 3V6OC 2WQ8A 3W2DL 2V5SA 1FIGH 4GSDH 1ORQA 4TQEL 1SM3H 4ODTH 3TNNA 5EIIB 1U8HA 3IU3B 3ZYJA 1BAFL 5CLWA 5I1KH 1NUDA 4YO0A 1UWEL 1AHWA 1FNFA 2Y36H 2VRAA 5TGBB 5E6ZA 4WTXA 5JXAH 4O5LL 5CHNB 1G84A 1S9VA 2GSIB 3VFUB 2VNCA 4M8QB 4LVNC 3RWDA 3DSNA 5T3ZL 5DJ0B 3HTLX 3P4NA 1G6RA 3IFOA 3VDCA 5F3BB 5AG8A 4APQC 1F4HA 4AT6A 3RWCA 2N56A 5IW6B 3UTSE 5IJKA 1UM4H 3WD5H 2IG2H 4Y1AD 3DV4B 3D9AL 4M43H 2NR6D 3O4LE 2NXZB 3QWRA 3VRLE 3GMPA 1XZ0B 2F53A 4XPTL 4IJ3C 4OD3H 5C6WH 2AEQH 5C0CE 3V4UL 3GO1H 1D6VH 2E5EA 1AQKL 4LHUB 1T89A 1W72H 2AXFA 2VN4A 1NSNH 2F8XC 2A9NH 3HE7A 1T0PB 3MGAA 5HPMA 1BECA 1H3PL 4UT6H 1D5MA 3VA6A 1PLGH 3VCLB 1SBSL 1MF2L 4Y5YC 5C0NC 1S7QB 4WWKD 5DD1H 1N4XL 3MRHB 1N26A 4KJQD 2YPKB 4QXUH 1ZMYA 2ZUXA 4TTGA 3I9GH 4PJHF 4Z78A 4K3DL 1MFAL 2MWCA 4PRBA 4QNPE 4EXKA 1SMAA 3FZUC 4YC2C 5E5RB 4CVXB 5ETUB 1FBIL 4K94H 3OAYK 3FCTB 4XMLH 1KTLB 4F7MB 5AG9A 3UC0L 1FVCB 4PG2C 1KCLA 1A02N 3KWWB 5K59E 1QLFB