4LLQB

Structure of redesigned igg1 first constant and lambda domains (ch1:clambda constant redesign 2 beta, crd2b) at 1.42a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
PKAAPSVTLFPPSSEELQANKATLVCAISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAAWSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords mutated CH1
total genus 17
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llqB00
5KVGH 3MRCA 1UYWL 4FTVA 4Q0XL 4MWFA 5EORH 1XIWC 4G8IA 3QG6A 3MLTB 2ZJSH 3I9GL 2DKUA 1Z0MA 3QRFM 5FUZL 5IKCA 2YSSB 1UH3A 2R1YA 1GGBH 2C1PB 4GRLA 2AGJL 4M62H 2XRAH 1EAPA 4CGTA 3ZKXC 3F58L 3QDGD 4JFZL 2NW3A 5BRZD 4TNVK 4LCUB 5DJ2A 1HDMA 3OJMB 2FL5B 5FGBC 1U93A 3MX0A 4P4RA 4HFWA 5JO5B 4BZ1L 5CEZL 2DQDL 2G9HB 2Y06H 4LCIL 3U82B 3KXFE 5TGBB 4M5YH 3C60B 4L1HA 2E7LA 4LSQL 4S1RL 4NP4L 2CKBB 1M71B 1MVUA 4N90E 1FORH 2A6DB 2CIIB 3BDXA 3EZ8A 3VWJA 5JPNB 4KGJA 3QO1B 5TJWK 3D69A 3U2SB 5L2KB 2HLAB 3STBA 3VFVA 1BMGA 2X4OB 5HYSB 2GSGB 1MCPL 3V6ZA 1IQWH 3RWHB 4PJ5A 1CXIA 1GHFH 5CMAA 2R56H 4HQQH 1JHTA 2P7TA 3IFLH 4M7LL 3QJFB 1SMOA 1MHPH 3MRKA 1YN7B 3GMPA 5TDPB 3TO4D 4PTUB 3QUKA 1IEHA 3H9SB 3UTSD 1KGCD 3H7LA 2KDGA 4O02L 2FO4B 4FFYL 3CSYB 4D0BA 4X6BA 5H37G 2DQFA 1BX2A 2DS4A 4C57C 4K9EH 1OTTC 5D7SL 4LMQE 5C8JA 4XHJC 2O5YH 2ZSVB 1KN4H 4YQXH 3HG1A 4UIKL 2H3NB 1BVLA 4X7TB 2E7HA 3F65A 3VMNA 3HRZB 3RGVA 5E70A 1H3UA 1X7QA 4I1NB 4XVTL 4IIQB 1I85C 4LLVB 3HE7B 3OR7B 1CQYA 1J05A 4PJBE 1RIVL 4HS6B 2H32B 1OCWH 1IGYB 2IQ9H 4JFYA 2Z31A 4LNVA 1KT2A 4U6YA 3P4LA 5E2WH 1R3JA 4OUUB 4ORGA 1NC2D 3NCCB 2E27H 3WIHL 2VDKH 1XGYH 3QUML 5I1DA 3QFJA 4CVXB 3TPKA 4BSVA 1WTLA 2A9NL 4AG4L 5D9SB 1YMMB 3EBAA 2VDML 5L6YH 3B2VL 1JGEA 2J5LB 2ZUSA 4M6MH 1QTYT 1CDBA 2W0FA 3EYVA 4PGDB 5GS1C 2H1PH 3IETB 1ZHLA 5HYQA 1PKQB 1FCGA 2VXQL 2MQ3A 3QG7L 4F2MA 4JRXA 4PJXE 3T0EC 2R2EA 2HJFB 1BJ1H 3CZFB 4HEME 3BN3B 4D0DB 4PJGE 4XP6L 1XR9B 1EJOL 2JTDA 2DYPB 1OPGL 2WM0A 5IQ9A 1NJ9A 3O4LB 1C16B 4OI9A 2X1XR 4AY0A 1PKQE 3I75A 4EQ2A 4WJ5A 3PV6A 4KTDL 5GGQL 5KJRL 1A1OA 4R4ND 3L7EA 3U0TB 4YC2C 5A40E 5KBNC 1SMAA 4F9PA 4U3HA 4WUKH 1FL3B 2WINA 4LSUL 2IBZY 4JKPH 2DQTL 1ORSB 5I1KL 4FXLA 2CKNA 2X42A 3Q0HA 1MCQA 3DVGB 4GUPB 2J8UB 3FB7B 2C3XA 2IADA 2VOTA 4S1SL 2VZ1A 3BP6A 3D39E 2XN9E 1FYHB 5JORA 3CPLB 5GRYA 4KQ3H 2A6IB 2BERA 4YE4L 3AM8A 5DJ8B 2GT9A 4NQCD 2F53E 2JB6B 1ZGLP 1B0GB 3CUPA 4NGHH 4WUUA 3QDJD 4NP4H 1UA6L 4JDTH 1NGPL 2A83B 3TVMC 1S7TA 2PNDA 4PRDB 1N2RB 4JGJA 3RVUC 5E5MB 3O4LD 1OSPH 4M7KH 2ZSWB 1CT8A 1YEFL 5ALBH 4Y7MA 3O9WD 3V4PH 2R69L 2YOCA 5KG9B 35C8L 4KK5C 3G6AB 2FIKB 4FQJL 4OCNC 4JG0H 4K3DL 1ZXQA 1RJLA 2AV1A 2UVEA 1WFUA 3VJ6A 3HE6A 3PE9A 4PJDF 4EXKA 1FHGA 2AJYL 2EKSB 1JHKH 3I6LD 3OZ9H 4G9FB 2K7QA 5B4MC 5DJ2B 5JHLL 3TBWB 1G6VK 2H9GA 4CJ1A 5HYQB 1XF2A 4JY4B 3VH8G 5B38A 3ZT6A 4PJGA 5ID0A 4R7DB 1O7SA 4LAQH 3SO3C 2Z93A 3P77B 1AXSA 3KPRE 2V17L 2X10A 1T1ZB 4UNTA 4R90H 3QXDB 3MNZB 4KRPD 4PJHF 3E6HA 3UMTA 4JCLA 2IFFL 1CE1L 1U8HB 1NGXA 4BQBA 3PV6B 3Q48A 3ULVE 2H26A 3FQUB 4H1LB 5E6IC 4XP9H 3W39A 5GS1B 4HFWB 4IDJH 1NFDE 1F6LL 3BJLA 3QA3B 5ITFA 3ULVF 1JJUA 3FT3B 4U2YA 1WFTA 4QHKJ 3QJFA 1JPSL 3WIIL 2IC2A 5EC2B 1QFOA 5HGHA 3O6LH 3JVGA 1U8KB 1XR8A 2MJWA 4OLZH 4U0RC 3MZGB 2R4SH 4KTEH 4P3DA 5EU3B 4LSVL 5BMFH 4HS3B 5DMIH 4M5ZH 4RFNB 1ITCA 1SVZA 2GT9B 5JQ6L 1RZ7H 4XX1G 4NQCA 2Q86B 4LSRH 1WZLA 4ZFOL 1LDPH 1ZHLB 3B9DA 2VQ1B 4PV9B 4RGOH 4AM0B 2F54B 3TNMB 2ZWLT 4ODHH 2KKQA 4P9HH 1FBIH 4WI2A 4N9GA 1MEXL 5F6IC 1VEMA 5LBSH 3IVKA 1BVLB 3IDIA 4X7TA 2GJ6A 1ZTXH 2X4RB 1CD1B 3H7BB 4P3WA 5TDPA 4ZUTB 2GYSA 2FIKA 5F96H 3N50A 3SGEI 1U3YA 5JMRA 4JFFD 3PGCA 1JRHI 5DMGD 1QLFA 5HDQL 3KPLB 4RNRB 5T3XL 1P84K 2GUOB 4Q0XH 3BIKA 4LSUH 3WS6A 1EHAA 4XC1H 1I3GL 2DQTH 3BRFA 2FX8H 5JOPD 4N68A 5KSBA 3WXVH 4YBQD 1VERA 5DD1L 2VERN 4PGBA 5BO1H 5I8OH 2BXZA 1NLBL 3ARFD 3CMGA 3ET9F 4NM8H 2E5EA 1FN4B 2ZUTA 5GJSH 4IRSC 2AK1L 4OJFL 2I9TB 1A7OH 1D5ZB 2LU4A 1C1EH 5CINL 4X6DA 2W0FB 3PIQA 3GMMA 3V79C 5JW3L 2R0ZL 5IB5A 4GW1A 4N8VA 1J8HE 5BV7C 4EI6B 4KUZL 4Z7VB 1HHGB 3H0TA 3WS3A 3NN8B 3QULB 3MJ8B 5TF0A 3SO5A 3U7YH 3VFUB 1N2RA 3CLFL 1DQQB 2BOCB 3THML 3O45A 4ZO6A 3P4NA 1BOGB 2GJJA 4JKKA 2XG5A 3M17A 4YPGB 4K8RL 3MC0A 3GJFK 3T2NH 3OKLA 1RZKH 5DK2A 5DRZB 3UZEA 5L8KB 3WIFA 1W8NA 1RU9H 3VCLB 2ZNWA 4PPTA 5IVXB 4NWTH 1XF3A 3D2UD 5EIIB 2AJZB 4OSUH 4XNMB 1HQRB 3F5WA 4PB9H 5F7LB 4JFEB 1F00I 2JE8A 2JIXB 1P1ZB 3BN9C 5JNYA 3MRQB 1QRNA 1BJMA 4P2QD 4PP1D 5KOMC 4EUPB 3SDXE 1JZ7A 1UCTA 4WVRA 4W81A 3O41A 2ICWB 4OBSA 1RK0B 4K7PH 2HP4A 1RD6A 4OZIF 4NKDB 5F88A 1IM9A 4WFGE 2AJ3A 3O8XA 1G9EA 4GKZB 1EGJA 3MV7E 5EZOH 3LRHA 3UTSA 4F3FB 1P2CB 3VWKD 5CMAB 1M1SA 1ADQH 5GS0H 4FQPA 4WI3A 5ALBL 4LHUB 3ROLB 3GSXB 5DO2C 5ESAB 4MXQC 2X1OA 3BFOA 3AB0B 5ANMB 3WS6C 4M1GL 3HG1E 1RIHH 1J0IA 2J2ZA 2PYFB 4JAMB 5J8OA 3EJZD 4LPCA 3CX2A 5HVFB 5J6GB 4Y2DA 1OF2A 3RVXD 3GKWH 3LV3A 1OGAB 4Z18A 5I71C 1DBMH 3BWAA 1JV5B 1A5FL 4H8WL 2SEBB 3QHZL 1RZ8B 4RSVA 4WHDA 5KVEL 1HKLH 5EOCH 1C5CH 4MXWH 4S10A 3VXOB 4LLAA 1XGPB 2C26A 3PWJB 1MNUL 2ZUVA 1BIIA 2X7LB 1QOKA 2R1XB 3T3PF 4J3UA 4XWGH 5E8DL 1VB9A 4NQED 4NZTL 3Q5OA 1QPXA 3P4NB 4RGNE 3NCJL 5BRZA 3DYOA 1UJ3B 5GS0D 3S34H 3C08H 3VD5A 5T1MB 1NGXB 3HB3C 5KW9L 5DVOA 5IEKB 1F3JA 1VSCA 3B9EA 1T5WA 3IAGC 4DGVH 5BJTA 4MXVF 5T3ZL 2BVQA 3FT2B 5E94A 4JZOA 1I75A 3TH4T 5HHVH 4ZPVA 1U8MB 2MWCA 3JUYA 4R7DA 5HI5D 1ZLSH 5CKAA 1BHGA 4QF1B 5HYSG 3V2AR 3FFCD 1JPST 4ODBD 1DUYA 3EGSB 1FLTX 5E9DD 2DQHH 3HI6H 4OAWB 5I1LB 2G2RB 2BFVL 1VEOA 3FB5A 3NOIA 1KJ2L 2FLRT 5IVOA 4F9LC 3QUXD 3V95A 4PP2B 4YDIH 3B6SB 2EZ0D 2M1KA 2YPVH 3UBXA 3W39B 5EU6D 3ARDB 3ZDXE 1TJIL 3H9SD 3MA9H 1G1YA 1PW3A 4PRHD 5IESH 5J6HA 4GBXD 4K7PY 5TQ2L 4XWOC 3FOMB 2NXZC 1YEEL 3FB6A 3E2HC 4MDJA 3L5WA 3G6JA 3SDDD 2WQRA 2V2TB 4YPGA 4NNYA 4U6XA 1XGRB 5E8EA 3FO9B 3OPZH 1CE1H 4KQ4H 4NSKB 4W6XB 4ORZC 3VG0L 4LCWB 3SE9L 5HHXL 1LVEA 3H2WA 2V5RA 3MRGA 3KHOA 3SKMB 3CPLA 3OAUL 1UWEL 1P9MA 3RZCB 3B8YA 1TETL 1DUZB 3M07A 5L0QC 3H7BA 2GJ6B 2X4RA 1WIOA 3SOBH 4YHYC 3PNWB 4EUPH 1LK2B 1FFRA 1NH6A 1QPPA 4NRZB 3LN5B 1WCQA 3O6LL 1RULL 4EVNA 1SY6H 1NGYA 4UT7L 5ECJE 3L3GB 3NIGE 4CW1A 1II4E 3OGCB 4C58B 4PRPD 4L4TD 3MODL 3BP5B 4X9FA 4QKXB 2D7NA 3OWEA 4OM0H 1EZVY 4AYFA 4FP8H 3UROR 4CKVX 3QNZB 3TVMB 2CLRA 3WXWH 4MS8C 3CSBA 4POYA 1KG0B 1FZKA 5IW3A 4JPWL 3ZKXB 4X4XB 1BVKA 3NH7L 2EDKA 4Z7NF 5IMLB 1QEWA 1CGVA 2CRZA 3O6FA 4I0CC 5EWIL 2EKSA 4G9FA 2BRRL 2JKXA 3LD8B 1T0MB 2PKDA 2IPKA 1Z5LA 3MYJA 3R06A 1C7TA 3ZKMD 5GZOD 4HPOL 1FSKC 1SYVB 2V2WB 3F5WB 2E7MA 4MA1B 3ESVF 2YK1H 1EPFA 5FO8A 3ARTA 4P0DA 4UINH 4PIRF 3IDUA 4MAYB 5EOCL 5DD3L 3X12A 3MGOA 4BKLB 1X4ZA 4W68A 4O2CB 2X4UA 5C09D 2LV4A 2EYRA 4ZD3H 4HC1A 2RFXB 4S1RH 2IAMD 2AK1H 2EIEA 1JFQL 4GRMA 4PTTB 3FMGL 2MKWA 1FORL 1TPXB 4ZDHB 2YRLA 4PGJA 4GKZA 1U2HA 4OGXL 5E6ZA 2DN7A 3KYKL 2WP3O 3HZYA 2QV2A 1FH5H 1IARB 4JO1H 2IANB 1KCRH 1F4XH 3OKOA 2EXWC 3QIUB 1KACB 1IZJA 3IXAB 3IYLW 5BOZG 4OLUH 1MFCL 1INEL 2ATKB 3H6JA 4G6FD 3RWGB 2AP2A 5I71B 3HR6A 4JFEE 1K85A 5C0GA 2WIIA 4NZTH 1JHLL 5DURB 1XZ0A 1QNZH 3GDBA 3O6KH 3ZKND 4E41E 5L7XL 2NXZB 1LK2A 3ULUE 5DVKA 2JB5H 4AM0A 4K7PX 3A6OA 4PJ9D 4RGND 4BH8A 3D87B 5IFHL 3B2VH 3F7RA 2GCYB 3SQOL 1CF8H 1QBLL 5BZDA 3MR9B 3ULUF 4LMQI 3VXNA 3ZMRA 1A7PH 4C59B 3QIWD 2DOCA 4NBYB 2DWEB 2AEQL 5MP6H 1P4BL 1RUQH 4Y4HB 1RHFA 2CLRB 4F7TA 4AEEA 3MA9L 3RWIB 3U4AA 1C5BL 3BZEB 2I60L 5A2LH 4NFDA 3DVGA 1NDGA 4P2OD 1AD9B 1HSBA 1A6TB 3KPNB 1I7UA 4P48A 5INCB 5GGVY 3W2DH 4PV8A 3G5YA 1CXHA 1KJ2B 2PCPB 2BNRB 2YR3A 5IOPB 4TUKL 3NA4A 1Z5LB 1ZE3C 5DFWH 4YK4B 3OKEB 1UG9A 2WUBH 2I25N 3IJHA 1I3VA 4HCRA 4P9HC 1I7ZB 4GLRH 1JWUA 1KFAL 3NFPB 2XN9A 3UYOD 1UC6A 1CR9H 4M7LT 1NCCH 3KNBB 1JGUH 1OARL 4JFOA 1YNTA 3HE7A 5FOBA 4JZJA 4UT7H 4MA3B 4MQXD 2H32A 1HNGA 3WL9B 5L88H 4TTDD 3IDXH 2YPVL 4QRSA 3QQ4A 5DJ6B 4P46C 3MLUL 4N0CC 2B2XH 5CP7A 3TYFA 3TN0C 3U79A 1A7NL 1M7DA 3CAFA 3GEWB 4KRPB 4Y4KD 3PABB 1LD9A 1CBVL 2XXMB 1UWEH 3QNZA 5EUOF 1F6AB 3TVMA 1HYRC 2FEEI 4YHMH 2YPLB 3U48A 3NACH 3PL6D 1IL1B 3JUZA 1T1YA 4YFDB 2A6JB 1D6EA 4N1EA 5EA0L 4PJ9A 3ARED 3I6KB 3BD3A 5C0IA 2F15A 1XZ0B 4GG8A 1Q9KB 4GKSB 2AEPH 2XACC 5HI4C 3L5HA 4WW2B 3QUXC 1A6UL 1ACYH 1MCPH 2HVJB 3LY6A 4XHJD 3S36L 2D3VA 3CNKA 1RIHL 1JWSA 4XCFL 3WDHA 4GAJH 4N8CL 3V4VL 4MHHI 1MRFL 1ZT1B 3TNNB 3TEUA 3WEXA 2LU3A 5KZCB 1ZLWK 3L1OL 5IP4A 3RUGE 4HWEH 5DI8B 1JPTL 2G5BA 5D7JA 2VITB 3HPLB 3QFJE 4YE4H 3T4YA 3FO9A 1VFUA 4E41B 4GKNA 2IAMA 2EYRB 3MLYH 1DBAH 1JF1A 1BGXL 1UADC 4HPYL 1V3KA 4HWNA 1K4CB 3OXSA 4EDXB 3GSNA 2DM2A 1KJ2A 2PCPA 2K1MA 1T83A 3WNPA 1GC1C 2C4FT 1GGCL 1JWMA 1NFDA 1FG2A 4ZUVA 4XP9L 2BSED 2FZ3B 2JJVA 3AMKA 4RAVA 3ZO0A 4L8CA 4NRZA 4RMTA 2NTFA 4PJCE 4QHNA 2Z91B 1BD2D 5HHPB 4WCYH 1ZANH 3VWJB 2ZOLB 3IFPB 3JV6A 5MI0B 4NN6C 4L3CB 4WNQB 3MJ9H 4WHCA 4ZXBD 1OAXH 1AGEB 1FFQA 3O6FD 3QIBB 4MJ5B 1Z9MA 1OW0A 1DTUA 2BC4B 5D7IB 4P9MH 2AS5M 1KCRL 3CX5K 4L4VB 1A6ZB 1NCDH 3MV9A 3KPMA 5DUMH 4PLKD 4YX2L 2HN7A 4X7SH 1P4BH 1FQ9C 2NYYC 4PBXA 1F3RB 1JFQH 2IPTH 1ZHKB 1P6FA 1F90L 5K33A 3C5JA 3T65B 5DJXB 4WUUE 1JGLH 5IESL 2AI0H 5DO2D 5EBLA 4LF3B 1ZLWH 12E8H 1MRCL 3D39B 4KKAC 1T89C 3K81A 4GW1B 4Y16B 4APQC 3AU1B 4EI6A 3DI3B 3TFKD 5EWIH 4Q6IA 1A2YB 4KZEH 2H8PB 4DTGH 4JFPB 4LASL 3G08B 5E2UL 5IW1B 4YXHL 5GHWL 5JHDE 3UBXB 1DSFH 1H3GA 3V4UH 5GQBA 1IGJB 4U1SB 3MBXH 4XGZB 3KJ4B 2OTUA 1KCVL 1WAAF 5FUOH 3WFZA 1PSKH 3GI8L 5L8JB 4YIQB 2OMBA 5GRUH 3S88L 2H45A 2NW2B 1PKOA 4PLJC 3HNSL 3GSUA 1VKXA 2V7NA 3ZLQC 4L9LC 1AGBB 4X0KB 1FBIL 4WEBH 1CWVA 1EFQA 1FVEA 3SBWC 4JE4B 4ONGH 1BQSA 4PJAA 3U0WL 3QUXA 1O5DT 1RPQA 5IB2B 4WFGD 3VFWA 1R3KB 2GTWB 2ICWJ 4PJ8D 2Q7NA 3MACL 2I07B 4PR5B 3OKMB 4EUPA 5EO1B 4PJ9C 4D0CA 3KYMA 4M7KL 2D7OA 1NDMB 1JI2A 5D2LA 4JFXB 1QHPA 1WBZA 2VDOL 4DGIL 4BJLA 4ODUA 4DVBA 2PETA 1A6UH 1NAMA 3EJJX 3EYUH 3SCMA 5D70L 2PO6D 5ESQA 3EDDA 3W0WE 4F3FA 1BQHG 4LRNL 4KROD 1A4JA 1QRNE 1S9XB 4FN0A 2MKLC 4XX1E 4L4VA 3PP4H 5SWSD 4K9EC 4IDLA 1S78D 4BQ6A 5CHNA 3MV8B 1JTPA 4NN5C 5DUBA 5FOJA 5H2BB 1IGTB 4WO4B 3HFMH 2NY4B 4P23A 4LNRB 4XRCB 2XZCL 3T0XA 4M03A 3UC0L 4DGYH 4U1MA 5C09E 2HH0H 5CEZD 3FQWA 1PG7H 5HDBF 3UPRB 2P24B 1I1YB 4O9HL 1NFDF 3C6SA 1BP3B 5CIPH 1CICB 5I73B 4XNZB 3LKRB 4JDVB 3MLVH 1MRFH 3KPQA 3CIQA 2WWMC 2ZCHL 3DPBA 4YHOL 3ZDZF 1BEYL 2NTSP 4FTVB 4DZ8B 5JIKA 3P4OA 4G8IB 5EO0A 5EZIH 4BQCA 1KCSL 4YDLC 1K9TA 2I9TA 1A2YA 2BCKB 5EIQA 2CDEA 32C2B 1R5IB 2PF6A 4IDJL 3PGCB 3P9WB 5E8OA 1GGUA 2FJFA 4OCMC 1V8HA 1KC5L 4NPYA 3WCYA 3QIUD 5JDSA 3VWKC 5ACZB 3CK0L 3OKNA 3VFUA 1RAMA 2ESVB 5C0NC 4MCYB 1MY5A 1BOGA 1S7XB 1M4KA 5DJZB 4H0HB 3RAJL 4UB0L 5INDA 5D1QB 4G6ML 3AREC 4PRPE 1B2WH 5C70A 4MNHA 4TN9A 2V9QA 4E41A 3B83A 1OD9A 3DX6A 4WU7A 3TYGL 2D9CA 1WWAX 4M93C 2VAJA 5C0CE 3X13A 2QQNH 2NY0B 4UDTB 4U31A 3P30L 3G04B 4OFDA 4QYOB 4XMKH 5JOFA 4KDTC 1LK3H 4ZS7H 2UZXB 1OT2A 3LB6D 5DHVA 5IMMB 5FCUL 1WBZB 1X5JA 1P5VA 3F6IA 3WEXB 3GFUA 3GMQB 5KANI 3G5ZA 5C6TL 2X4NB 4KJWC 2NTFB 3GO1H 4V1DD 1BM3H 1NEZG 4P2OB 1Q1JH 1QSFD 5T5NF 3VXNB 3QDGB 3BHBA 3V6OA 3QAZB 1G9ML 4HIHA 2YD1A 4LNRA 5T5FL 5GS1A 1BD2A 1WBYB 2C1PA 5EUOB 4P23C 5F8RC 2FX8L 3VRIA 4HUVA 4JVPA 4Z5RA 1VACB 4PJ7B 1OP5H 5L2JA 4YIQA 5IJKC 3AY4A 5FGCE 3ARBD 2VLJA 1KUMA 1UVQB 1F5WA 1GOHA 3CFJA 3ZYZA 3T1WA 2W65A 1AD9A 3HNSH 3MRIA 2XPGA 4HDIA 5EU3A 3G5YB 3MPCA 2ITDB 1J1XL 4JY5H 4LVOC 4WIQA 2J6EL 5CSGA 5I0ZA 5JW3H 4A6YH 1J5OH 1HILB 2F58H 1K3ZA 1DQJA 5E9DE 5FUZH 4FG6C 2FHCA 1CK0L 3VXMB 1A6VL 4OLVH 1DSFL 1XCQA 2Z31C 4MLSA 2DYPA 3ARFA 3DVIA 1F90H 2ICCA 1D9KA 2F53D 1MCFA 4MDIB 3OPZL 1PD6A 4NOFA 2EDLA 1YY9D 3SDAD 3RWFB 3Q5TA 2DBJA 1GGTA 3HTLX 2B0SL 4KTYA 5D72H 1S8DA 1A4KA 2Y7QB 3VA6A 1BLNA 3VXME 1U91B 3ALPA 5D6DC 4MX7B 4OCRH 5GJTH 5CBAA 1RI8A 4PS4L 1TQCC 3FT4B 3X17A 1TMCB 1CLYH 1EERB 5D2NB 3KWWB 1BPVA 2Y72A 5DQ9A 3VGFA 3O2DA 5JR1L 1X4YA 4GSDL 3MOBH 4NHUA 2VLRA 4S1DD 3TO2A 5T3ZE 1CVRA 5I75B 2AJUL 2DDQH 3TZVA 3WO3B 1PG7L 4R7NB 4APQA 5D70H 3IRPX 5GRWA 4BYHA 4WEBL 4OUOA 4UMGA 5MEQB 1Q8MA 1IC7H 4C56D 4X6EA 3VXTA 4TULH 4WW2C 4MHHG 3IXTB 1HHIA 4W4OC 1KCUL 4NKIL 5HSFA 3QWOA 3OMZA 4FQLH 3HRZA 3RGVB 5DZNA 3X12B 4G8EA 2MPAL 4L4TE 1ADQL 1DN0A 1Q9OB 1J11A 1ZA3A 3DX9A 3FHAA 3C8KA 3DX7B 4FFWC 3HPLA 1GHFL 4Q9CA 4M61B 5KSAA 1OAUH 5J3HC 3V8OA 1JMZA 1L9NA 3U9UB 3R4DA 1E6OL 4RQQA 3RIFK 1U3HC 2ATKA 2YXMA 4UV4H 5C0RL 1HN1A 3MJ6A 4MQXC 2Z92B 3LS5L 5FECA 4CN4A 3MRHB 3ZDYE 5IIEA 4X99B 3UTQB 3B9AA 3QDAA 5EUOE 4JFDE 3GMRB 3EDEA 4XCCL 2X4OA 3I3DA 4MGXA 5E5UB 3IGAA 3IB4A 3BH9B 4XB7A 1F58L 4MDIA 1T21A 3V6BR 5J9PB 1S9XA 2B1AH 3RWFA 4ZNEA 3EO0A 2WZPD 5IMMA 5IMOA 3FFDB 3W0WB 3PQYD 4TSAH 4K3EL 4N1HB 4U1HA 4DKEH 3QXWA 1NQBA 1JNNH 4IRJB 4IRJC 4OI7A 4EKXA 3QIWB 2N4IA 4D0BB 3QNYB 3LKSB 5EBMA 2AV7A 1B0RA 1FO0H 4YNYA 5HGGS 2VDOH 1SJHB 3V52L 4V1DA 1FL3A 1K6QL 3PQYE 1XR8B 3T0AA 5A2IH 2DLFL 4LHUD 2FGWH 3O9WA 2CK0L 4I0PB 1T04B 2CJUH 2ESVA 2ZP0T 4Y16D 4J8RA 2A77H 4X4XA 2WBJA 3N9GH 4IMLB 1QG3A 5D71L 3PP4L 4XXDA 4JY4A 1OPGH 4FMKA 2GTZB 2I27N 4LQ1A 3REVB 1QLEH 5IK3B 4G6FB 4UQ2B 1HINH 3MRIB 2YUZA 3EOTH 2HJKB 4TNWK 3IDMB 2ILLA 2A1WH 2X9YA 1JL8A 3L3KB 3MLSH 4FFYH 5TFSH 3K8KA 5GGRB 5FYKL 3M1BA 3R06B 3RP1A 4JM2A 1LHZA 4NGHL 5DMKB 3DO7A 5I30L 3E8UL 5CEXA 4HF5L 5C0CA 3A0OA 3P0VH 2A74A 2L0DA 1CU4L 3HS0A 2F9BT 5DR5H 1CT8B 4HT1H 1T80A 1J9CT 5C0ND 5IMLA 3ALWA 1NKRA 3JTTA 3BXNA 3O8XC 1DL7H 1WEJL 1T66D 3QQ9D 1KYOJ 2Q8BL 2EYTA 4KHXH 3MLZH 3UTPE 3BUYB 1ZS8A 1F02I 3GSUB 1WIUA 2X4TA 4WFHE 1WCBA 4OLVL 4RQQB 3FCTB 2EYSB 3EUUA 4RDQG 1IEBA 3WFHB 3QT2A 1I1AC 4N0UA 4OCYL 4DCQB 3PGDA 1YECH 3JV4A 4DVRL 3IAPA 1YEFH 4FQ1H 2NXYD 1UVQA 3P11H 2XZAL 4ZO8A 3TO2B 5C07B 3RPIB 4JJHA 4MVBC 4S1SH 4FQHA 3FTGB 1K8IB 4Y0GA 2NLJA 5I76B 3P40A 1U8OA 3KPRA 4LSSH 1I3GH 1CDGA 4XP5H 4DZBB 4YHLL 3FRPG 4L8SC 3AAZB 3K46A 3WN5C 1JK8B 4OM0L 2NZ9C 3ZT5A 3IRZA 3V7AG 3FOLB 5JW5B 4G8FB 4W70A 4H1LH 4S0SD 1MCLA 2P44B 3GHEH 1FNHA 4OIBA 1PG7X 5HDOA 3I50H 4ZXBC 4HUVB 4UV7H 4XVSL 1A7RH 5A43C 4ZS7L 1IILE 5HYJE 2JJSC 3ZSTA 4LRIC 2W60A 3P3YA 2N1KA 4MDJB 4JQVA 2R9HC 3BE1H 1VPOH 3WUZA 2X70B 1WFNA 2BY2A 1QVOA 4PREB 4L8BB 4WFFD 5D96C 1AHWA 3QEGL 5I15L 3TN0B 1P7KB 3RUGA 2YC1A 4RGMB 4PFEA 4G6AD 1H9VA 2Z35B 3TPUA 1G9NC 2HWZL 3KWWA 1DBKL 1ZMYA 3U0PA 4HK3N 2IFFH 3ZTJG 1NUGA 2ZSVA 4LSVH 1H3WM 3AS2A 1YY9C 4YWGL 2BDNH 3LKQB 1AJ7H 4QRRE 3TM6A 4JFDD 5TE7H 3PNWA 4DZ8A 1OTSD 5IQ7L 4NJ9L 3LZFL 3FQNB 4HBCH 1R5WB 2ADJB 4A6YA 4RZCA 1D5IH 1KB5A 1AIFA 5E4EB 4BZ2L 4B7LA 3NACL 3PHOA 3DGGB 1QR1A 1Q0YH 4NN7B 1J5OL 1XT5A 5FKPA 4ELME 1T20A 3KYKH 5C7XL 1VGKB 3BKMH 5DRNB 1EEZB 4XAWH 5F44A 3ECBA 2HN7B 4Z0BH 1T7WA 2BMKB 3LS5H 4JQIH 1IC5L 1P84J 5CSBA 3FFCA 4PJ5D 4GT7A 4R26L 3MA7B 1KYOK 3P9LB 3WNOA 4O2EA 2AJZA 4TTGA 1QHOA 4U1LA 4NNXA 4NQXA 1YNLL 4WU7B 3L1OH 1IC1A 5LQBH 2F5BH 1OAQH 3X13B 1PDKA 5B39A 1OTTD 2L7UA 4Q9QL 5IB4B 4GS7B 1AO7B 3V6OE 1X4XA 4TUOA 3TP4A 4HHAA 1Q9LA 4AT6B 3AROA 1CFQB 2VLMD 1A7OL 3K74B 3TGXA 1MI5E 2RCSL 1EAJA 1R0AL 1MVFA 4NWUH 4PY8I 1MPAL 3O6FC 2ZG1A 4QNPE 1BAFH 1U8IA 1A6WH 2UUDH 4HF5H 2BVYA 4CVUA 1AGFB 2AABH 43C9A 1A1MB 1WFOA 4TULL 1J0ZA 4CNIA 1DVFC 1U8JB 3VDAA 1XCTA 2VDQH 2X1QA 1WSST 3LEVH 5DMIL 4ZXBA 3RL1A 5J6GA 5TDNB 4GKNB 2IPUK 5J06A 4UT6H 3GMOA 5DMYA 4JJ5A 1RZKL 3UXFA 4UILL 3QIUC 1R3IH 3D3VB 1WZMA 4FTVD 1C7SA 5EO1A 1FE8L 3KR3L 2EDJA 3V5KB 1MIEH 4N8PA 5EIIA 1CGWA 1SVCP 3JV4B 4QGYA 5J56B 2PN5A 4IMLA 1E28B 1L6XA 1CGSL 2GI7A 2A73B 2K3TA 5HHMD 3LQZA 1U36A 3MLPA 4X83A 3WKML 4L3EB 4OZHA 2VDNH 1A47A 4NQSB 1ZA6B 1AQDA 4Q6IC 5I18L 3WO4B 3EFFA 3LKSA 1OP9A 5EBMB 4ZSOE 4ZFOA 2QJDA 3W9EA 2KQMA 4PJFF 4G42B 3FFCE 1HE7A 3MLXH 1QFPA 3HCVA 4ZOEA 3HS0B 3OSKA 4P2QA 1QRND 3QPQD 1JF6A 1WT5A 4LFHD 1HSBB 5DRWA 1DL7L 1WEJH 1C1EL 5CINH 3NCBB 5IVZB 3TV3H 2OP4L 3LH2L 1I9IH 2DM3A 5C2BL 4PJCA 1I7RA 5C0BA 4FABL 4MMXC 2FHBA 1X5HA 1MI5A 3ARBC 2NY4D 5E7FA 1I7ZA 1IAMA 1RZ8A 3TWCL 2QQLL 3JXAA 5IM7B 6CGTA 3C5SA 2CGRL 3VD7A 2NY3D 4KK9C 4Y4KA 1FVCA 4X6FA 3K1DA 3RL2B 1MNUH 4DZBA 1PQZB 2BP3A 3R0NA 5GXBB 2E3VA 5JQ6H 1ZWIA 4O2FA 2XTJE 5DEZA 1IGFH 1RZJH 4L3AA 5HHNB 1IQDB 4AH2B 1EEZA 1A6AA 2CIKB 3BQUD 4DCQA 2WLZA 1PGRB 3P0VL 5HHOB 2XN9D 2BDNL 3CFBB 1HI6B 3VE0B 2XWTA 1RVFL 2OZ4H 3RZCD 4P2RD 1AC6A 4TPRL 3BRGC 4QOKA 5CEYA 4M1GH 3FN3A 3UDWC 1N6QH 5CIPB 4R0LA 3C2AL 5DQDH 1MFBH 5C07E 3MREA 4XVJL 3IDYC 3HZVB 3OHXA 5T3XH 5JW5A 1SBSH 2Z0BA 4MCZA 1Y6MR 5TQ0L 4OLYL 1BFOA 2XWJB 2BRRH 5MENE 2XY2A 3MSPA 1H3VA 1DJSA 2XFXB 3ORJA 5DUML 2CO6B 3GSRB 1MLBA 4WI9A 3AFLA 4RRPA 3QP3A 3BRDA 4QRRA 4GOSA 4ZFGL 1S7QB 3S96B 3G6DL 3T4YB 5K9OA 1HQ4A 4FQ2L 3ZHDA 1YPZF 4MA1C 2AV7B 4I3RL 3HZKA 5TQ2H 3BIKB 5F3BA 5I16A 3QCVH 5D1XB 4NQDD 5JORB 1FFNB 4XPFL 5FHAH 4I0PA 3SGEH 5I17B 4P2RB 1JWMB 1YEIH 4JGUA 1UKTA 4K3HA 5FO7A 3WHE1 1FV1A 2EIDA 1KIPA 4X6CE 1QA9B 5KSVB 5L8LB 4RMVA 1PVHA 3V5DA 4K8RH 2V2WA 1BQLH 1RZKC 2EH8H 1IGML 5DLMH 3QQ3B 4HXAH 3C5SB 2DJ4A 3INUL 3PWNA 1A4KB 5DMKA 2VDQL 4XNYL 3GI9L 2AV1B 4MX7A 1CXEA 3EO1B 2R0WL 3U1SL 2M8XA 2VABB 2VXQH 1N26A 5L7XH 2NY6D 4PGCA 5F6HI 4YXKH 4Z7UE 5LAXA 5FKAA 5KS9B 5KZCD 4NC2B 2DM4A 3EIFA 3MXWL 4WHYG 4KPHH 2QHRL 4GBXC 3EDFA 3TBSB 1J8HB 1MAKA 4LLDA 3PWPA 4NKMB 5IF0B 3EYQD 1KEGH 3MROB 1CYGA 4DW2L 5EOQL 1D5BB 1S9WA 2YN5A 3ZYJA 2C3WA 4M7JL 3EYVB 5C71A 5BW7C 3JWOC 3D9AL 3QXDA 4N8VG 5GGVH 2VRAA 1GL4B 1A3RH 4I48A 4LLYB 2Q8AH 4G3YH 4OZIE 2DQUH 4X5WB 4OIIH 1DLFL 4KXZH 4JZJB 3IS0X 2O5YL 5IWLC 1MRDH 3BQUA 5TH2A 1KJMA 2ZKHH 3C6LD 3NTCL 3O4LA 2CMRH 2D4FA 1J1XH 3MUGA 4JY5L 4NNYB 2ADGA 2QHLA 5EFIB 5HPMB 2AJXL 4HUWB 4Y5XA 4L4TA 5E2TH 4PRPA 4OZGB 2OYPA 1I7TA 5LJYH 1NUNB 4UDTA 1N4XL 5KSBF 3CXDL 3LEYL 4NQVA 5CD5D 5D1ZA 5HHNA 3MLVL 1WV7T 2HJFA 1ZGLM 4Y5YA 2G75A 3MTRA 5EIVA 4U7KA 5FYLE 3WJJC 1RJZB 1NGQH 3OKOB 4LLQB 3EFDL 1MAMH 3E3QC 3B9KB 2V6HA 4BQ8A 1K5NB 3LMJL 1KIRA 4XAWL 5C0BD 3EDKA 3VD4A 4PJ8B 1ZA6A 2Q3AA 1P6AB 4PRIA 2Y36L 4UT9H 5FB8A 1H3PL 1SQ2N 1MI5B 5EUOA 4PJ5B 4PJBA 5CP3A 4PD4K 2DMBA 3W0WD 3PQYB 3HNVH 3OAUH 4J4PD 5FO9B 2HYMA 4OT1H 5FEBA 2ED8A 3RWDA 4LOUC 2CGRH 1KULA 2APWA 2FJHA 4LAQL 4P57A 4XP6H 4FZ8H 5F7KC 3ILPB 4PJHB 1FGVH 1S7QA 3WKMH 2DYPD 1NCWH 2PXYC 2ITDA 1FIEA 5IVZA 4A2MA 5JW4R 3C5ZC 2NZ9D 4NKIH 3QCUL 4RBPK 1NEZB 2I5YH 2IPKB 1C5BH 4HW6A 2DQJL 4KZDL 2JCCF 3A67L 1LEGA 5BVPH 1WZKA 4Z8FL 5E9DA 1F4AA 4JDZA 5A1AA 4CMMA 1BOYA 3BWUC 1JRHL 3HC0B 4LHJB 4JDVA 4PRAB 1MJUL 4JFED 1VGEH 2IJ0C 3VRLE 2AQ1A 1MWAB 1G9NH 3WDJA 3V6FA 4F57H 4MLIA 3CMOH 4HH9B 3QEQE 5T3XD 1RJYA 3NMEA 1T0NA 4QOKE 2H2SC 5E0QA 5EN2A 4KKAD 4HS6A 3JWDC 3ARQA 4ZDHA 5J12C 5C2BH 4CADB 1RK1A 2VAAA 3TFKC 3SDXF 3ZHLA 1A6AB 4M43L 1NSNH 1TVDA 5J0BA 3MV8E 3O6MH 4I2XE 4TNWF 5I66B 4RMQA 1KENH 2VIRA 3VCLA 5KVMC 5DRXB 1WAAE 2D31B 3WDIA 4UU9B 4N0UB 1EJ6A 4JQXA 5BQ7B 1YN6B 3VMOA 5F7EL 1A7NH 4G8GB 4NRXA 4BFEA 2R1WA 4N0RA 2A6KA 3QWOB 3UAJC 3U36B 4B0MM 1BFVL 5C07D 3EYOA 2UY7A 4ZG1A 2BVOB 2B5IC 2OL3H 3SE8L 5EU7E 4K8RD 1H0DB 1JK8A 2A73A 4KV5F 5FK9A 5J13B 2NX5B 3I6GB 3V5HB 3GZKA 5ETUB 5IROA 4XTRC 4X4MA 4F58L 4N9GB 1FZJA 2XNAB 4Z95L 3EFFB 5FYJU 4ODVH 2C3HA 1XF5A 4UAOC 2CH8A 4XBEH 5GPRA 3VWJD 1X5GA 4E5XA 5EOQH 4G7VH 3O8XD 1I8KB 3E3QE 2CMRL 4Z0XB 5DEFB 2BSSB 1T2QH 4G7YL 4KRPC 1UENA 3SDCD 2FLBT 2YK1L 1S78C 1CGYA 3AXLB 3UJIH 1JNJA 3MLYL 3KPLA 5L0QB 4S2SA 3KPSB 5GHWH 3O6FB 1N5YL 4XBGA 3S4SB 1JGDB 5M95B 4JFDA 5B3JE 2OL3B 1P4IL 3I6LE 3ULSA 2CPCA 3B5TA 5F1SA 3MUY1 4P3CH 4XP4L 2W0LA 1KJVA 5HHMB 2W1NA 4DFHA 15C8H 4CU8A 3EJYC 1YUHA 2A9ML 3OXRA 1S9YA 4ZUSB 5HYJB 3V6ZB 1R5WA 2ADJA 1I1RA 2BSRB 5CJQH 1HYSC 2NY0D 4EXPX 2H8PA 4RWYH 5SWSA 4XCEA 1VFOA 3ARXA 3FZUD 2MTPA 3U7WH 1RVFH 1UZ6E 3NIDE 4OD1H 3SGJA 4TPRH 3S37L 1A3RL 4PB9L 5DFTA 1H3PH 1KV3A 5IEKA 4XCFH 2AERT 2GK2A 1KXTB 1NC4A 4I18B 1X5ZA 5F7MC 2BC4A 2W0PA 5D7IA 3CSYA 1EEYB 4ZUWB 1W2KT 5FO9A 5C86A 5TE7L 5C9JA 2ESVE 2FGZA 2GTZA 5D2NC 5EU6E 3VXUB 3O3DA 3MZTA 4MMZC 4PGEB 3O4LE 3MJ7A 3RA7L 3DETD 5D2LE 4OKVA 1ZOXA 5IB5B 2G5RA 4P99A 5IB4A 2H32H 3B4NA 3OJVC 3C5JB 3P4OB 4TUOB 5GS0L 3QB7C 1YC7A 5DEGB 3OF6D 4DGYL 1CFTB 2EKJA 2VJXA 3D1MC 4DKFL 1EVUA 4J4PA 3DV6B 1MLCA 4FQHB 2EDHA 4H26B 2WANA 3IU3B 4HX1B 2ADGB 5EFIA 1U8IB 2XNAA 5ERWA 4EN3A 1QBBA 2EC9T 2YEZB 3LVEA 4L4TB 5DTFB 1NMCB 2JLLA 3WIFB 4M7JH 3QUYB 5GGSA 4ZFFB 4PGZA 1JPGB 3FOLA 4HGWA 3IDGA 3ZDZE 1ZHBA 5CD5C 2X89A 3EOBA 2C4FU 4LLUA 2IFGA 1AJ7L 3LN4A 2CRIA 2NW3B 4R96B 1PSKL 3GI8H 4YBHA 5C0CD 2R4RH 2XG4A 1VKXB 1H3TA 4BSWB 1TTUA 2YXFA 1V7NH 2YHGA 4PJAE 2A1WL 4KJPD 3FTGA 1JPTH 3JV0A 5E7BA 1NCWL 4R2GB 1HHJA 5F7WC 4KZEL 3KJ6H 3AAZA 2NYYD 2R0WH 4NQCB 1U6AL 2OTWA 3BQUC 4UOW0 1RHHB 2PR4L 2V9RA 4ZSOB 3MOAH 5SWSE 1DQDL 3SQBA 3KYMB 2D7MA 3BKCL 1R3LB 3P9MA 3QUZC 1CBVH 5J9PA 2DTMH 2F5AH 5D2LB 3AUVA 1KENL 4HFUH 4LHUA 3ROLA 3RX5A 3RWEA 1QRKA 3CDYA 3T0ED 1FDLH 2K7PA 3DMMC 5HHME 1N0LA 1A6PA 2R1XA 3QWRA 3BKJH 4L8BA 1IQWL 1FYTB 4JKLA 4IRSA 4UQ3B 1NEZA 5C0JB 1LMKA 1NCBL 5C0AE 1CD9B 5DUBB 2DQIL 1VDGA 2Y25A 1WVZA 4G80B 4FQIL 2MHAA 2OL3L 4WEUD 2D4DA 1T04A 3H3PH 3LOWA 5GRUL 4I3GA 4PYGA 4NKOB 5CBEA 4LIQL 1HHHB 1GZPA 2OX5A 3STLA 1JZ5A 4KRLB 3SKJH 3S97C 1N5YH 1RURL 3RZCC 4MD4B 4QXGL 4Q58C 4JFQA 2H2SD 1KN2L 5GGRA 4N0FA 3EYOB 4R4BA 5DRNA 3QUZB 4YAQB 4LCYA 2FATH 5L2KE 1EO5A 2RFXA 3HI1B 5HY9A 5KSAD 2AI0L 1KJMB 5H37H 4X5XA 1FE8H 3KR3H 1OCWL 1ND0A 3BXNB 3MUGB 4WO4C 1XEDA 1S7WB 3H42L 4LPXA 2PO6C 2F53B 1ES0A 2F8XC 5BQ7A 2FNBA 4WI7A 4HIEA 5ACMA 4KJYA 2N56A 4PRPB 3LKPA 2OZ4A 4ZAKA 5HHQB 2VDKL 1JZ3A 3SE3A 5I1DB 4L9DA 2OJZL 1KCLA 3NCJH 2BHUA 4L4VE 2ED7A 3UYRH 3AREA 5DA0B 2AVGA 4C56A 2WMPA 5HVHC 3LKNA 4X6EB 3NPZB 3NCYS 4BA8A 3LZFH 1F11A 1NMCC 1YPZA 3MNZA 2Z4QA 2RBLA 4OCXH 3L5XL 1S7UB 3L3DA 3QYCA 3LQAC 2R2EB 3DX8A 3K2UH 1MJ8L 2J6EA 3CZFA 2AXGA 2F8VA 5FYJE 5CSZA 3LSOB 1PZ5A 1N3NB 4Y4HA 1OM3L 5C0EB 3GO1L 3U4EB 4U6XB 5E8EB 3TO4B 3B3IA 3AY4C 5CBAB 4R6UA 3HNTL 1A0QH 3PG2A 4M6NL 3MV9B 3C8HA 3N1PC 4ZPTB 4LSPL 2Z8WC 1NFIB 1WBYA 4KKBD 2IBBA 4GS7C 5I74B 3U4BL 3VRIB 4P2RA 4GAGL 3RZCA 3LN4B 5IIEB 5FFLA 4HIXH 4MNGE 1PYWA 4KC3B 4EJ1C 4Y4FB 4HKZA 3OBAA 2YD7A 2YKLL 5F72S 5FM5M 3SDDB 4JFFB 5KANG 4Y4KC 3KAAA 3Q1SH 5L2KA 3V0WH 1U6AH 4WUUB 4EI5C 1RHHA 3EYFB 2GSGA 3ZL4L 2KL6A 3ARBA 5FXCH 3UTZA 3QIWA 4TOYL 4G43A 3VFTA 4LSQH 1INEH 1MFCH 1N6UA 2DBLL 4CVXA 1NC2A 3MJ9A 1S7WA 5D1QA 4QXTA 4XCNB 1G7JB 4Z7QE 1RULH 4UILH 5GRJH 1AGDA 4X4YA 1CTOA 5C0JA 4OKVB 1A6VH 1YA5A 2VMFA 5EOTB 4XVUC 2MHAB 5T3XE 5BCAA 2OK0L 3HG1D 4IRZL 4GSDH 4NHUB 4ZAKC 3GIZH 3GMNB 1HHHA 3BT2L 4I48B 4LLYA 1NLDL 1K2DA 2XZCH 3DUUB 3KPPB 1OSZA 5TPWL 1HHJB 1B2WL 5JPNA 1I1FB 3WIIH 2BNQB 4DN4L 5JXAH 3MRRB 5T5FH 5I8OL 1NAMB 4OQ1A 4RAUB 2FEEL 4IRJA 3X3GL 3S9DB 1R3LA 3TO4A 1MJJA 3O2DL 1QSZA 1YN7A 3GBNL 1P69B 4F37K 3QIUA 3VE0A 2DD8L 3QFJB 2VDRH 1LEKB 1MHHA 2P48B 3E8UH 4DOHB 2FD6H 1GC1L 4NFBA 3TT1H 4O00A 1T2XA 1VHPA 2X6MA 3NBNA 1A14L 1ZVSA 1X5IA 4QRPE 2WBKA 1EXUA 1KEMH 2YUWA 4RRPG 4TRPH 3QJHB 5IWLA 4E0RB 1FFOB 4F9LA 4HUUB 4NQCE 3MCLH 4FHBD 5J1TC 5C92A 4C56B 1HZHH 1ZSDB 4M5ZL 4RIRB 2NY7H 5JOEA 4DQOH 1CLCA 4TSCL 4LCCA 4GAFB 3AB0C 4XCCH 1XGTB 5EO0B 4OF6A 2HTKC 2BSRA 4YXLH 1E0OB 3RFZC 1KF9B 3CVIH 4P9HL 5JLZB 1A22B 5T1DL 3L3HB 2R39A 4DW2H 2LVEA 5IUSA 1KN2H 2FJFB 5AUMB 4L9LA 5B3JF 4P23D 3ROOA 1LO3H 4LCYB 3O4OB 4NNPL 1YEHL 2EH7H 1FFNA 3GHBL 5BMFL 4PJEA 3KHQA 1LE9A 1WITA 2R0ZH 5SWZD 3LDBC 2AQ3A 2FB4L 4JG1H 3UX9B 3HC4L 4G8GE 2B0SH 5LXGH 2R0LL 2AW2A 3OB0H 4Q97A 1Q0XH 2EDEA 3R0MA 3G5VA 1VESA 3BKJL 4D8PA 4OT1L 2SEBA 3MUZ1 1TZIA 4OBRA 5HHQA 4GO6B 1CD8A 4QXUL 1CTNA 3RPIA 2MPAH 1NCBH 3BEWA 1E4JA 5D71H 5MEPB 2E7BA 4OZGE 5CCKL 5DUPL 2NLJB 4NM4L 4UV4L 5C0RH 4X6DE 5I76A 5D7JC 3QG6B 1Q9WA 2H6PB 4ZOCA 1YDPB 3GSOB 4R8WL 5KTEL 3HAEA 1CL7I 3VGDA 4U1KA 2YD2A 3VFSA 4XNUH 2FX9H 3GKWL 1F4HA 1NFKA 4ZFGH 1UJ3A 4OLWH 4EOWL 4BFIB 1VFBA 5DC9B 1PY4A 1ZAGA 3PF2A 5DQJA 2CO7B 3IS1X 2BMKA 1ZT7B 1JNLH 4HWBH 3QEQA 1HSAA 3F7QA 3TBTB 4K3EH 1BWMA 3RVTC 4YDLB 3MGTB 3MRDB 3I6KA 1CDYA 4NQXB 2NY2C 3BVNB 1AKJB 3SDYL 5ILTH 2ITCB 3HNTH 2EDDA 4OV5B 1B3JA 1J1PL 4HJGB 5B39B 5FGBA 2NY1C 5D4QA 3QSKB 2W9EH 3TLRA 5C0AD 5D1ZB 1L7TH 1U3HB 1ZEAL 4ISVA 1CICC 4F7EA 5LGKA 3D5OF 3OQ3B 4HKBA 4PJIE 2OLDA 2Z8VC 1NCUA 2LTQB 2AEIT 1NUDA 5SWZA 4Z7UB 1JF5A 1FLRL 4KMQA 3TN0D 2D03L 2EE3A 5J11C 3ARDA 4IOIA 4ZS6C 2V5MA 1YYMH 1DEEA 3BESR 2HG5B 3FO1B 1BJ1J 3BP4A 4JHWH 4LDEB 4OZFA 5BZWA 1RK0A 3L3HA 5MI0C 4KZDH 1D5MA 2NY0C 3TJEL 2HFGL 4DN3L 2QSVA 1IKFL 4XRCA 4PUBH 3GSNB 3KPRD 3UTSB 2EDBA 2EDXA 1WWCA 3S36H 4OCYH 3QA3A 2KUTA 4J7RA 1YQVL 3K2UL 3ULVH 2JCCB 3W82A 1XH3A 1R0AH 4I3SH 4LLQA 4XXCA 2X1PA 5T3ZD 5GGSY 2FJHB 1KXQE 5CJOH 2DD8H 3SHSA 4F7CB 3DOSA 4KJQD 3IDMA 2OQJB 5I15H 1CLOL 2EDQA 4HLJA 4HS3A 4ZTOH 4JR9H 4Y2DD 1A1NA 5FHBH 1DLHA 1QSVA 4L3CA 2Z35A 1NAML 5B38B 2CR6A 4EI5D 4ZUSA 2GJZA 3V52H 4HUUA 4UV7L 4RMWA 4RFOL 4N0UE 1RUAL 1UWXH 1KCKA 1GXEA 4IRJD 3U0WH 1UCBH 4QXTB 4XCNA 2Q76A 4WY7L 1IM9D 1KB5L 5CZXD 1NCAL 1V3LA 4JREC 2FECL 1T7YA 3MRRA 1HHKB 3QDJE 5FGRA 1RK1B 4WTZA 2CD0A 1LE5A 3WE6B 3T3MF 1IAOA 3WFEH 1ZGLB 1UFUA 4OCXL 3X3GH 1TQBC 4XVUD 4DVRH 3FRUB 1C5DB 1HQRA 3PABA 4Z7VF 1A21A 1SJVA 1B4JH 4HBQA 4HXBH 3GBNH 2VIRB 2WBJD 4PJIA 2X9WA 2DI9A 3CFDB 5DHYA 1L0YA 2ESVD 4Y16A 4P3DB 5IHBA 5JW4Q 3KPPA 4YDJB 1EVTC 3ARRA 4ODWA 3BZDA 1RJYB 4XB8A 1R3KA 5IVNA 4Y19E 4JY6A 2VXVL 4NCC1 5EN2B 2Q8BH 1N64L 1AP2B 4ODTL 5AAWA 2VDLL 1OAQL 4MAUH 4LSPH 1DEEB 2YBRB 2VZUA 1Q9LB 4AT6A 3NN8A 3QULA 4M9PA 1ZVYA 5I66A 1VPOL 2EDWA 5AG8A 4E42A 2XV6B 4HIXL 5LWYH 1AD0B 1CDUA 2JF1A 4NWUL 3BPCA 1UM4H 3ZZ1A 1B9ZA 1MQ8A 2OI9C 1D5IL 1Q94B 1Y18A 5HPMA 4AEHH 1KNOB 2DLEA 5FM5O 2NNAB 43C9B 4FFWD 1J0YA 1CCZA 4LASH 5E2UH 3W9DA 1CFSA 1XIWB 3F6LA 4NM4H 3O9WB 1JYXA 3NZ8B 4QOKB 5CEYB 1IE5A 5JZ7D 2BVOA 4NNPH 5FM8A 2VUYA 2HTLD 4LVNC 2I9LB 3MV7A 3UTSE 1Y6KR 1MHEA 1KPRA 3EO9H 4OFIA 3FQNA 2WK2A 3PWUB 1AGCB 2R29H 4KH2A 4PG9A 2B20A 4I5BB 1E6JL 3QEGH 1HOCB 3DHJA 1GIGL 4UB0H 2D0FA 1F2XK 4XP1L 2Y07L 1Q9WB 3D0VA 3MACH 4NDMB 4TUJB 3RI5K 3G5XA 1NGYB 3UTZB 3RBSA 5ENWA 2NMSA 5EB9A 2VUOA 1RSFA 5IG7B 1A7BA 3VXRA 4JRXE 4N5UA 1K8DB 3I85A 4U6YB 2CDGB 3Q6FA 3ILPA 4PJHA 4AIZA 2ZG2A 1FNGA 1BBJB 1ETZB 4RMUA 5F7UA 3TZVD 2WAHA 3L3IB 2P4AB 4OI8A 1BVKB 5IHUH 3N85H 3PDDA 3FCTA 3O11A 3WUWG 2PW1B 4GMSL 3HFML 5DRWB 3CX5J 4CMMB 2Y9RT 1MHCB 3LEXA 1G9MH 1Y0LB 1CZ8H 3C09B 2V7HA 4JFHD 5HDLA 3IFOB 4D94A 1BFOB 3C87A 1QSED 1UZ8B 1I9EA 2BNQA 4OV6F 3LQAH 5C3TA 1NMAL 2BVTA 5D93B 5IQ9B 2ZCKH 4X5XB 3SDAA 2VAAB 4QRSB 5DJ6A 2F53A 3TCXA 1SJXA 1SM3H 5JUEL 5HI3D 1ED3B 4WTWA 4OZHE 4YHPB 3OV6A 2JB5L 4HWUA 4IS6B 4WV1A 3TJEH 4K3JH 1QACA 5E4IA 4WFEE 4PUBL 2QL1A 3LRSA 4QO1A 4AH2A 5E99H 4YGVA 4S0TD 1I8LC 1INDH 1BAFL 1JNHA 3DARA 2J3SA 4GW5A 3DYMA 4JPIB 2VLJD 1RUKL 1WTGT 4MJ6A 5DFVD 1KTRL 2GHWB 3L9RB 3V5DB 1BZQK 2F54D 3QUMA 1HH9B 5GJTL 3LAFA 5FV1L 4I5BA 4IEFB 3TO4C 3ESUF 3GHBH 2BNUB 1R5VA 4K71C 1GOFA 3PL6C 3ZDXF 3J7HA 4Y16C 2X05A 4C4KO 1IMHC 1D7FA 4PJEE 2HTKD 5DI8A 4JN1H 2EO1A 3SQOH 1F4XL 4NZUL 2NXYB 3EZJB 3D9AH 1MLBB 3U30C 4L1DA 1QFHA 4YPJA 5I73C 4FFZH 2E8YA 1FYTA 3BD5A 4M6AA 4WUUD 5AAMA 4QY8B 3GJFA 3MRJB 1YY8A 5K9OB 2F74A 4EZMA 4LQFL 1Z0NA 3PHQA 4JZOB 4KROB 4WFED 3ABZA 4ZPVB 1DFBH 3BI9X 4I3RH 4YO0A 4OLWL 4MAUL 4EOWH 2QEJA 2FATL 4IM8A 9CGTA 5ISZB 1QYGH 4G6AC 1MHCA 1MCRA 1KJ3L 1AH1A 5DHVH 4UINL 4O5LL 4LPYA 5IM7A 1TZGL 1MUJA 3OXRB 1S8DB 1M6OB 1FV1B 1V05A 4R4FL 5TE4H 1MQKL 3EJZC 3G6AA 1MHEB 3V7AE 5L9DH 3VXUD 5AEAA 3BGAA 3LN5A 4K71B 4ODWB 1UM4L 1UB6B 1K4DB 3ZE2E 2VDMH 3ARPA 2CUHA 1MEXH 3I02B 4GRWE 2J8HA 1PEWA 4G9FE 4XCYA 5DK0B 1R3JB 4OUUA 1QBAA 2VR9A 1S7SA 3GIVB 4FABH 1WBXA 4GBXA 3FOMA 4I18A 4PBVC 2YA1A 5MEOB 3V0VA 3L5WB 1OSPL 3D39D 2G60L 3OF6A 1OAXL 1F58H 1J18A 5GRVK 3EYSL 3VW3L 5L88L 1YEKH 3GUTB 1CXLA 5F89A 1Y18B 1CDJA 4EQ3A 4HC1L 3EW3B 1E27B 5F6IB 1CDCA 1X5AA 4R0LB 2EDNA 4JPIA 3L5IA 3GSWA 1HCFX 3ILQC 3MROA 1OARH 1GCFA 3FQXA 4ALAH 4Z7WA 4WHTB 1QBLH 2R8SL 3SKOB 3QCUH 3HI1A 3KPTA 4NKDA 3MV7B 4NQUA 4QTHB 4OZIA 2Z4QB 1P7HL 4NOBA 2B2XL 2UYLB 4ELKB 1WWWX 1IGMH 2YUXA 25C8H 3BP5A 3BDYL 4QRUA 5D5MA 5TDOA 1FPTL 2OM5A 4HKJB 2P5EB 3BT2H 4D9LL 3W9DB 5FV2A 5GIRB 2VL5B 2NR6D 1WC7A 1DBJL 2ADIB 2Z8RA 3HLAA 4HJ0C 4LVOB 4XPTL 4P2QB 1EHXA 4URTB 3AS0A 4I4WA 4Z78A 1U95B 3TC9A 5I8CA 2AK4B 4IOSD 4XNQA 5DT1L 3L7FB 4YR6A 1QSFB 4DEPC 4H0IA 3RPKA 2GTWA 1U41A 3CDGB 5T1LD 3DO3A 4QWWD 3TCLB 3MLUH 4BQ9A 1U8QA 3QEUB 5DC4B 1IRAY 4F7CA 2A6DA 1AGCA 3BZFB 1HCVA 5DXWA 4NWTL 5DR5L 4LP5A 3UTTA 4Y5VB 3ZE0E 5C0DA 5BV7L 5D6CA 4WI8A 1EZVX 3QFDA 2GIYA 3WLBA 1INDL 1MWAA 5DJYB 2APFA 3QPXL 2B8OT 1XF4A 5A2JH 3IFNH 1F97A 2XQYG 4NBZB 1OWWA 4RZCB 1LQSR 4ZTPH 2X4PB 2LABA 5DVMA 5I19L 2AJXH 4AK1A 1FNFA 4R0LC 4XPHH 3WN5B 5EPMA 1T89A 3MV8A 5IHZA 4N8VB 4NFCA 2NR6C 2X40A 1OWRM 5CEXB 3QO0A 3RKDC 1ZLUK 3VGAB 4NHCH 1N6QL 1FC2D 3FT4A 5SX5H 5IMKA 2NY2D 4U7SA 4YH6A 2ZCKL 2D7TH 1MWAL 4YGAB 1QKZH 3EHBC 4KRNA 4WWID 5C0AB 4G80A 4S1QH 4P5MB 5EU6B 3OKLB 3Q3GA 3U9PL 3LKRA 4Q6YA 3TESA 4N9OB 4X5LA 1WCBB 5IR1B 3FO2B 5JXEC 2VWEE 1AO7A 1AQKH 3CXDH 3P0YH 3O2VH 4RISH 2D7QA 1S5IL 2G2RA 5FYKE 5DHXB 1JZ8A 3MJ8A 4ZS6D 4OKDA 3MV01 3B8SA 4PD4J 4XH2B 1KJ3H 1W0YT 3KDMB 3KVQA 3D2UA 2WSKA 2W0KA 4K07A 3WUWB 5CAYB 1HH6B 1G1CA 3N85L 4NO0A 2UZYB 1KLGA 4G6JH 2PTTB 5DD5H 3RKDD 4BFIA 1U8OB 3KPRB 1QLEL 1U8HA 5F3HA 1HNFA 3AC0A 3HMXL 4MQSB 5J6HB 3D18B 1T1WA 1JE6A 2JELH 4HCRH 4QRUB 1JF1B 4LQFH 1TCRB 3X14B 3QNXB 3DUSA 1FO0A 4Z7UF 5DD6A 4CNIB 1WICA 3EHBD 4PRIE 4ELMF 1LO2L 3MLRH 3OKDB 4XCYB 2O61B 1JBJA 2E7CA 1KLFA 3T0EB 1DZBA 4KUZH 2UZIH 5FA3B 4IJ3B 1IGIL 3MJ7B 3RNQA 1GIGH 1OAKL 4M48H 4DGVL 5JDJA 3TCLA 1QRNB 4YXLL 1G0DA 4P4RB 2D31A 1PX3A 4Y8DC 4EI5B 1DANT 5F1KC 3E6FB 4AMKL 2IMNA 4HGMA 4HWBL 3KLAA 3WIHH 1OF2B 2FWOB 1EBPA 3ALXA 4MNQA 4DUXA 1OGTA 4MAYC 1TQBB 1H8NA 3CCHA 3SKNB 1BZ9A 4QRPD 2CIIA 3RVVC 5D7JD 4HV8A 1NANI 3V7MA 4YFEA 4K3GA 1MJUH 2BHYA 4PJHE 5ADPH 3W0WA 1I1AD 2IF7A 1MAML 5L9DL 1JZ2A 3DV4A 2XZQL 4LRNH 4M5YL 1ZVSB 5I8EB 5BRZB 2VLLA 4PRID 1N8ZB 1ORQA 4LPVA 5E2VL 1T20B 3CDCA 5KVFH 1T3FA 3NCMA 5E9DB 4ALAL 4X7EC 2GJ6D 1FFOA 2P43B 2LQRA 5FA4B 3WFCH 4HK0B 4NYLA 1I3RB 4LVHB 4YHZH 2BRQA 3C60D 4I4WB 2FBOJ 4Z78B 2HFGH 5JMOC 3WLWD 5D1ZD 1U3HD 4L8CB 4O9HH 1FN4A 4U1LB 3BZFA 5JXEA 4GG8B 1WISA 4BFGA 5LGJB 2DJSA 3FONB 3QXAB 4Y89A 3K8LA 3QBTB 2PTUA 5JTWA 3UCRA 1HIMH 4WNQA 2A9NH 5KG9A 3DO7B 1AY1H 2CLVB 3DURA 4HS8H 4JN2B 1MFAH 3O3EB 4J3OC 4KAQL 5EH1A 5BVPL 3O3BA 2ZNXA 4GG6A 3BO8A 4GXVL 5EG6C 3V0VB 3ELAT 3WN5A 2VISA 3AGVA 1NAMH 4NIKB 1TLKA 4Q9BA 2PYEB 4HIIB 2P42B 2FD6L 4IOFD 1VFBB 4KMLB 4TVPH 3RTQB 1NKOA 1GYAA 1G7JA 4Z7OE 1ZT7A 5FA3A 4NRXB 1X5XA 1YMME 2F19L 4QRQB 25C8L 1EEYA 4ZUWA 2BX5A 4MZ2A 7CGTA 3MJ9L 1DVFB 3OX8B 4P4KC 4XVTH 4WHTA 5ICYB 3K4AA 3WD5L 5A3IC 1AXSB 1G7IB 3TYGH 2DQEL 5FUCC 4MJ6B 1T1ZA 3HZVA 1HKFA 3OHXB 1DQML 1J86A 5ITBL 4K9EL 4YK4C 3EYSH 1ZT4A 4ORGB 3T09A 1YNLH 5CJOL 1BEYH 4KK8C 1UKSA 5IFJA 1FL6B 4X9HA 3SGDI 1VFAB 3HUJB 3VXSB 4OD2B 3HE6D 1I9JL 5L6YL 1JRHH 1TJHH 2OBGA 3MBEC 3OGOE 1MJJB 3MNWA 4O51A 1S5HB 2FB4H 4ELMA 4RBPH 2ID5A 4GW4A 5C9KA 2NNAA 4RA3A 4M1CC 3BIAX 1UJ3C 4FA8A 3CMOL 2VH5H 4PV8B 5C8JB 1ADQA 2FCBA 2NXZD 4UTAL 1FZOB 4XZUB 4QY8A 4DK3A 3UP1A 2AXJA 3IJYB 4U6VL 3GMRA 1QA9A 4PJ5E 2EDFA 4ONFH 4XMPL 2VQ1A 2R4RL 3JWNC 1LEIB 2RAMA 1BM3L 3BH9A 4AG4H 1C16A 5IBLD 3RDTB 1NSNL 2FHFA 3V0AC 4AMKH 2XQBL 1T0MA 3HMWL 4G5ZH 2AXGB 4NQDB 2AJYH 2F58L 3FFDA 3CUPB 2G60H 4HSQA 1B4RA 2XTLA 3HI5L 3V6FB 4AENA 3ARFB 2IQAA 5JDSB 3RGHA 5C09A 3MMEB 4WHYH 3RRQA 3G6JF 1FAIH 2VABA 5HI5C 3SDXB 3BMVA 2WNGA 4YNYB 4OB5L 3WFDL 4BELD 5ICXA 2IWGA 1MIMH 1Z6JT 3BP6B 1G6RH 3SE8H 1Q1JL 3HMXH 4RFEB 3LKPB 1KCUH 5H94A 2D0HA 4HJJL 3PP3H 4LLDB 4NKMA 5ACLA 2VN7A 1IL1A 2EICA 2DJUA 5TQ0H 4QOKD 1N7ML 2D2OA 3AREB 3HZYB 2PXYA 3PWVA 1XF1A 1DVFD 1XAUA 1FNAA 3MRLA 4LVNB 4YHIB 4FQQA 2HTLC 3CFBA 4RGMC 4D9RD 4JRXD 2CLZB 2FH8A 4PJFB 3W81A 3PWLA 5E8PB 2O93L 3MOQA 5ID0B 1JWSB 4F33A 3SDDC 3IF1A 3CFCH 3LSOA 4EEEA 4PS4H 1ZWIB 5FYJL 1YYLL 1U92A 3JTTB 4XPFH 5FHAL 1UWGH 3VD9A 3S5LA 4Y19D 1P9MC 2CIKA 2XWJA 4D2NA 1S5IH 5ESVA 1CL7H 5DJCB 5EC1B 3WJJA 4HAGA 4XC3H 4FQCL 1F3DH 5FF6A 3DX7A 1A8JH 1KPUB 3P77A 2ZUQB 3RIFF 5E08L 1QLRA 2HA1A 3NGBC 4M6OH 1PKQA 3DECA 1LEIA 5EDXA 5A16A 1JTOA 3LCYA 4LCWE 4JRXB 3V5KA 3P9MB 4R97B 2W91A 3SDDA 4FMFA 3UYRL 1OTUD 3KPSE 3MRHA 3RVXC 2NY5L 5F8QC 3WNNA 4Z7UA 4JO1L 4K94C 1XR9A 4AENB 1TVHA 4E42B 3SKJL 3HPJA 2ZOKA 2CJUL 1YEGH 1YEJL 3FONA 3QXAA 3OGCA 2RJMA 3QQ3A 2MQCA 3QHTC 3VFTB 1CIUA 3LIZH 5J1SC 5D2NA 1FNSH 4HIHB 4NM8L 3W9EB 2CKBH 3O2WL 3VGGA 5IT2H 1FCCA 2VNCA 1I7UB 2OR9L 4WENB 3RUGF 5IFJB 5GS2D 1ORSA 4AJ0A 3ULUC 5GZOC 2MNUA 3QIWC 4YHLH 4NYLB 4F7MB 1YY8B 4LIQE 4V1DE 1P4LA 1S7RB 1LDPL 2PYEA 4HIIA 1C08A 5ITBH 3TF7C 2CDGA 3Q6FB 3RJDA 3HB3D 3O3DB 4LGSB 4JHZA 4X6CA 2R0KL 4I77L 1BBJA 4GMTH 2F19H 4L3EE 1GGCH 2Q20A 1I8IB 2B1HH 3KLSA 1SEBB 3VXMA 5F97E 4HZLA 3VFMB 3U46B 2F8OA 4N5EC 2E6QA 4NZDA 2GJZB 5DGQA 4RFNC 2ARJA 1FH5L 3RDTA 3UJTH 5IG7A 3RX7A 3WUWA 4Q2ZA 1MLCB 3C8KB 5IBUB 4MB5A 1P5UA 3JSSA 3ZYIA 3LHPL 1GAFL 2NX5E 2DWDA 5I6XC 1U91A 2D0GA 1F3JB 1LP9F 3QDGA 3UJJH 8CGTA 3MRBA 1IAII 5SV3A 3OX8A 2R4SL 4GRLD 4KTEL 2OCFD 3HUJA 4P49A 4HBCL 2ZCLH 4KDTA 5IGXH 4LLUB 4MNGB 2BVUA 4M7ZC 3GB7A 5A3ID 1QFWI 3B2UC 2R1WB 4QTIH 1HI6A 5ADPL 4NO5A 3TZVB 5HPOA 3BKML 2FJGA 4PRNA 1T03L 4JN1L 2NCMA 2VH5L 4LSDA 3UO1H 2NY6B 4XNMA 4FOMA 1FVDB 3PJSB 4K8RC 4YBQC 4FZ8L 1L0XA 3I6GA 1JN6A 1AC0A 4H5SB 1LP9B 2BOBA 4XTRD 4MWFB 3VWKA 1G6RL 1KTLA 1S5HA 4JQXC 3IFPA 4LRIA 5D5MB 2VQUA 2HFTA 5F88B 3S37X 1IGTA 4WO4A 5GGRY 2NPLX 5CCKH 1N7MH 4WDIB 4PJEB 2C1OA 5DWUH 5KTEH 1S7VA 2XRAL 2AXFA 3J8F7 1N8ZA 1KFAH 1ORQB 5DVNA 4L8DB 2XZAH 5D5MF 4XPGL 3S7GA 4G8GD 4XBGB 5GJSL 5E1AA 5I74C 1CFSB 1YJDH 5AWNH 1WQVT 4ISVB 1R24A 5I6XB 5EU4A 1IFHL 1X3DA 5DD0L 3PWPE 4JM4H 3TT1L 3BDYH 3KYOB 5E6YA 4N90D 1WWBX 2GY5A 1OHQA 1DE4B 2P5ED 5EBLB 4PJAF 1TQCB 2HJLB 4YHML 2FDBP 4WGWB 2VO5A 2AJVL 1MCBA 3DVNA 3GRWA 5ANMA 1YNTB 4XNZC 4LCIH 3WD5H 5I1JH 2BJMH 4DOHE 1MCCA 1M7XA 5MHSD 1FLRH 1B0RB 3T0DA 2VYRE 3MFGB 3RI5F 5CS7A 3GHEL 3ROOB 2WLYA 2EECA 1RUKH 4FNLL 2OQJA 4M8QB 1LNUB 4TOYH 5JNYB 3FFCB 4PGBB 3GK8L 5HDBE 3VGBA 2YPLE 4QWWC 1K2DB 1A6WL 5LXGL 3WHXB 4JPVH 4Y1AB 3LS4L 5I1GL 4NNXB 1NBQA 2R56L 4HQQL 4DN4H 2ZUXA 5JXAL 5T1DH 2WBJC 3FAWA 4LHUG 1HH6A 1RMFL 1F13A 3L3JA 1IAIM 1ZLUH 5TF1H 1EH9A 2OR8A 4UT6L 3FB5B 2NY2B 3VFPB 1BBDL 5CP3H 3WLWC 1JI1A 3ZKNC 4JR9L 5EBWB 5TH2B 2P5WD 5J13C 1UM6L 4I0KA 4Q2ZB 1KTDB 1MCSA 1HINL 4JKWA 3M17B 1U8MA 2L4OA 3D6GA 5E95B 1JIBA 2HAZA 5TPWH 2OTPA 1W0VB 1B6DA 4P2YA 5TDOB 5FYLH 5JHDD 2CKBA 3LV3B 3MV11 2P5EA 2P49B 1NEUA 1U8JA 5F93C 4E5XB 3C8DA 2E9JA 3W11C 5EU4B 1NDMA 1Q72H 2ICEB 4MQTB 5D7IF 2V5YA 1QUNA 2ITCA 3N1FC 4WV1C 4OV5A 4MNQB 3B6SA 4KVCL 4CDHA 1C08B 3UZVB 3O3UN 4RAVB 3BMWA 4QTHA 3C6SB 1TZHA 5IBLC 1U8QB 3QEUA 4JFDB 2FJGB 2HJKA 1HEZB 1BREA 5EUKA 4WWKD 4DUVA 5AD0A 5GSVB 1KJVB 4OF5A 1T2JA 3N1QC 1LK3L 3S5LG 2AABL 3IU4H 2VSDA 5FKPB 1D5XA 5CJXC 5FCUH 3S34L 4GH7B 1W8OA 2OR7A 1JN6B 4OGAC 5AUMA 3ZTNL 5KN5B 4IOIB 4CUCA 2CDFB 1WZ1L 1I1AB 1I8MA 2VDNL 3BN9D 4AL8H 4G43B 4CBPA 4U6HA 1U95A 3UZQA 2VB5A 4OCSL 4POUB 4XNUL 2ATPB 4G9DB 2HLFC 2IQ9L 5MENB 4ZYKA 4OD3H 1PJ9A 3TBVA 1NLDH 1G84A 1MREH 4X6CB 4X9BA 2NX5D 3OKKB 1F3DJ 4D8PB 4I8DA 1A7PL 4Z95H 3D25B 1FJ1B 2X4QB 4ODVL 4U49A 4UIMB 3KYNA 5D7LB 3RVTD 2JELL 4HCRL 4P5TA 5C0FB 1DN2A 2XZQH 3HC0A 1KCVH 5FUOL 4NZJA 3ZSSA 5I1EL 3DETC 1GJIA 1GGIL 4PJDA 3GSNH 1J1PH 4QCIA 4H20L 4JO2H 3GMLB 5HGBA 2WWMD 3UO1L 2EE6A 4ETYA 5C6WH 4YBLC 3CVHB 1FPTH 1YEEH 5E03A 5T1KD 4WFFE 4YHYB 1U92B 5K59E 3WL9A 4J6RL 5IJVA 3M8OH 3S5LB 4X8JA 5DZOA 5ID1A 2K9UA 4I0PC 5HTSA 2YRZA 1XMWA 1AKJA 5IFAH 3QDJA 1A1OB 3MBEA 1UT9A 4NC1C 2PR4H 4DQOL 4M8VA 4IMKC 1KIQA 2X70A 4NO5B 2EC9U 2PW1A 5EULV 1AHWB 1D5BA 1RZJL 1S9WB 4NQTA 1AHWC 3C9NA 1I3UA 4X8XA 4Y2OA 5D7LD 2VLRD 1Q9KA 2QQQA 3D3VE 1Z9LA 5BS0E 1KPVB 3ARGA 3V4PL 3HR5B 2OR9H 2OZ4L 4MQ7B 1S7UA 5A16B 2X4UB 2O26U 3UDWA 1Z3GH 3KYAA 4U05A 3KS0J 3IDIB 3LD8C 5J3HD 2WBWB 1JVKA 4PY7A 4ZUTA 4DFIA 2GITB 5GGUB 4LPWA 1UH2A 2WINB 3QCVL 4P5TC 5FYKU 3JWOL 4PJ7E 5FGCB 3F7YB 1ZEAH 3MNWB 1N5AB 5GGTH 5E00B 4RWHA 4UIKH 2JJTA 3QDME 3VFNA 1DQMH 1I7TB 4YFLF 1OLZA 4IS6A 4PTUA 3BW9B 4RMRA 1VCAA 1D9KD 4LKCB 2EH8L 4KKBC 3LRSB 5I1HH 2IGFL 2VE6A 3SE4C 4YBLB 4PRBB 5HGDB 4J8RB 3INUH 5ALCL 3MRMB 1MFBL 2IAMC 5I8EA 5I1IL 2W38A 1DQJB 1RQ5A 3O11B 5CLWA 1XCQB 5HGHB 3GI9H 3DXAE 1DDHA 3L9RA 1VA9A 3SJVA 4Y4FA 2E8ZA 4POZD 1EO8H 3B9KD 4JZNA 2GK0A 3BDBA 2ICEA 3HG1B 2AEWA 1UB5B 5CJXA 1YQVH 2EXWD 1GZPB 5FO7B 2EO9A 1V7MH 4I2XB 5E6IB 4LSRL 1C8PA 4U6TA 3IKKA 4XT1C 4JM2F 3IJHB 2B4CC 5C0CB 3MXWH 3K4ZA 3G6DH 4EVNB 3MMEA 4FG6D 4PJ7F 1QSEE 2HMIC 2Z31D 1RY7B 4B50A 5E1HB 3T0WA 3DRTA 4JM4L 4KJPC 3QXUA 2H1PL 4ONFL 4XMPH 4KK8D 4JRYB 4Y19A 2DTSA 3T2OA 1WUNT 4C56E 4UDUA 4DKEL 2VLKE 2AEPL 4OLYH 1DN0B 3C6LB 1U9KA 3MBEB 4Q74A 4PJIB 3OL2A 3GKZA 5J1AB 5IB1A 3WHXA 3O9WC 3F62A 2DLFH 4WY7H 4PLJD 1RZFH 4N0YL 2BJML 3IETA 4E41D 3MYJB 2A6JA 2CRMA 1L7IL 4OLZL 2J8UF 4XNYH 4KUCD 5CZVL 1CF8L 2BNUA 5FDWB 3OZ9L 3HZMA 2KPNA 1G7IA 2AEQH 4FFVD 5HXMA 3IDYB 1Z9SA 4F15C 5MP6L 2DQJH 4DWHA 5JOPE 4HG4J 1ZK9A 2BNQE 4U6VH 1TVBB 2GEEA 3BZEA 4WU5B 5LBSL 1D5XB 3CXHK 1CD0A 3THMH 1IJ9A 2XTJD 4WGVB 2COQA 3CLEH 3D85D 1NGZA 5BV7B 3VXSA 2W92A 6FABL 5F9AC 2BXYA 2HT2C 3D0LB 4HD9A 3TA3C 3B43A 3T2NL 3SJVE 3U1SH 2ATPA 4XBPA 2LTQC 1XH3B 1QO3B 2VLJB 2J8UA 2R69H 3FB7A 4QGTA 2DQCH 3OAYK 3IDNA 3ZKSD 2GK0B 4OZFH 2DBLH 1IT9L 5JIIA 1U0QA 2NXYC 4ZOAA 3OAZK 5ANME 3WXVL 4IMKA 1OAUL 1AY1L 1RZJC 4HS8L 5D8JL 3NAAL 3KYNB 5C08B 1MFAL 4KAQH 4XAKE 3VG9B 1RFDL 2R23A 3WIHA 3L95B 1JYNA 2Y5EA 5JR1H 4IHOA 3VXPB 1OB1B 4L4VD 1HK6A 4PGCB 3GK8H 2DWEA 4Y19B 3ZE1E 2PO6A 4Z7VA 1HXMB 4PY8J 2AKRA 4MD0B 4ZODA 5DJDB 3F7YA 4YHNB 5GSRA 5M7QA 3CDFA 2V17H 1RZGA 5E00A 1QZ1A 1UXSB 3HE6B 4O2FB 3EFDH 3T1FB 3WE6A 3HE6C 2ZKHL 2VZTA 3BPLC 4KWUA 3T0EE 3VRJB 3CFKA 2UWEA 4YZFF 3X11B 3FRUA 1ZHNB 3ZTNH 5D2NE 2WWKT 2ADFH 3G5VB 3H3KA 3DHMA 1A3LL 1NMBH 3ZE0F 4CAGA 4CN1A 1GGBL 4I9WE 3QEHA 3CH1A 1FNSL 3ISWA 1NBVL 2FO1A 3O2DH 5HYJA 1T2QL 2Q7YA 1N59A 4UBDD 1P7QD 4YC2B 4X9GA 1GRWA 2E6PA 3N9GL 4NC1E 2VXSH 4NPYB 2GAZB 4FQXB 1JP5A 3OKNB 4K7FB 1XFPA 1LO4L 3BO8B 3A6CL 3VGEA 4RDQF 4ODXA 5GZNC 3KPOA 3OJDB 5DC0A 3TIDA 1XCTB 4GRLB 1AD0A 2HRPL 3KGRA 5C7XH 1Q94A 2J8UE 5CGYD 3HUJF 3FB8A 2CSPA 2DIAA 5ICZA 1OT1A 1GZQA 2OJEB 1EO7A 1CDHA 4HXAL 1HKLL 5E8NA 5BXFA 5CZKA 5MEOA 1GOGA 2FL5A 2X2YA 5IR1A 3QR2A 3MRCB 4M02A 4P4KA 4J6RH 2PYFA 4JAMA 3KPSD 4XPBH 2ICWA 5TGBA 2Y36H 4UT9L 2Y6SC 4DTGL 5SWZB 1EEUA 1FYTE 1G0YR 1NL0L 5IFAL 1KB9K 2HVJA 2X4NA 5F7YC 2AJ3B 1H5BB 4WWKC 3C08L 1HEZA 2J12B 3GSQA 1KELH 3I3EA 1EO8L 1SEQH 3HI6L 4OB5H 3FQRB 4W6WB 4AIOA 5DTFA 5F9WB 4B7IA 2NW2A 5ABDE 3QH3A 3QQNA 1XGQA 5MERB 4GMSH 4A6YB 3OKDA 4ESKA 3HN3A 2VITA 3KLHC 4R97C 1A4JB 1I1AA 1MCIA 5LG1A 3D48R 2I5YL 5C3LD 4PJAB 1Z3GL 4QHUA 4OZGA 3QI9D 4ZO9A 3BPNB 1XF5B 1VGKA 3RU8H 5IW6A 3WJLA 3MRNA 4QRPA 1PLGH 4LLWB 3PGFL 2NY3B 3Q3GB 2VN4A 4PRAA 1L0QA 4PJCB 5GS3A 1H15B 3NPSB 3QEHB 4OTXH 4Y2DC 3UPRA 2YS4A 3NZHL 5F7FA 3S4SA 2HKHH 1LO2H 2X7LA 3MLRL 1F4WL 1KB5B 1YYLH 4S1DC 1N59B 1AFVL 3DGGA 4KHXL 5SX4I 15C8L 5ALCH 3WLBB 1UM5H 4K3JL 2AJSH 3W5NA 3VFRA 4OF8A 3V8CA 4M43H 2H2PD 1YJDL 4G7VL 4KXZI 5AWNL 4C4KT 3BIBX 3KLHD 3F58H 2H6PA 2OS7A 4JFZH 4PP1C 4GBXB 1KJ2H 3X14A 5EU5B 3S98A 5SWSB 2FIRT 1HHKA 3OJDA 3KPOB 3PUCA 5DRXA 4LLMA 3VW3H 3LB6C 3RWDB 3MXVH 1G7MA 1TZGH 1C5CL 4MXWL 4X4ZA 5FYLD 4GKOA 1CFNB 1MQKH 3QUYD 4ONGL 1TTGA 1NAKH 2XZZA 5IB2A 3WKNA 3GRWH 4LU5L 2EYTB 1M7IB 2ZCHH 1HSAB 1MCDA 3NCFB 5H8DA 3MRBB 2H9GB 2EYSA 4D9LH 1C12B 1F6FB 4ZQKA 1AO7D 4MNQE 3VFGH 1FFPB 3GM0A 1EDQA 2PXYB 5D96B 4KTDH 3PL6A 1A7RL 4R3SA 4LGRB 4U1NA 5KW9H 3L3OB 5IEHA 3BGMB 1L4IA 4ZFZA 3MCKA 3ARDC 3JVGC 3IDNB 3OB8A 1FGVL 3ZE1F 3U6RB 5JIPA 1T5XB 4ERSH 5JHDB 4ELKA 4RISL 1I1FA 2BY3A 3FQRA 1TENA 1AGFA 5JHLH 4J1UB 5CD3B 1ZLSL 4D9QD 3G08A 5LQBL 2QQLH 1NGZB 2Z8SA 2VL5A 2R23B 4PJBB 1CLOH 3QWQB 3CVHL 1J88A 3MV8D 4LPUA 4K7FA 5KS9E 5C2UB 3GB7B 3HZKB 1T4KB 1V7ML 4QRPB 1AQKL 3DUHA 5FF6B 4LKCA 2Q1EA 1T22A 3P73A 1TDQA 5D1XD 1P7QA 5E6ID 3A6BL 1YN6A 4YLQT 5D6CB 4Z7VE 3LKNB 1F8TL 3UTTD 5BVJA 3LRGA 1OGAA 3G9AB 4E0RA 1QKZL 4ZMAT 5I19H 3CSGA 3VWKB 4JZNB 1T21B 1UQSB 5EBGA 1KB9J 1UB5A 2IAND 1ZSDA 4RIRA 3BEVA 4UNVA 5AZ2H 5FK9B 2YWYA 4JFOB 2QLVB 5DJAB 5ETUA 1B4JL 2W9EL 3GSQB 3ARYA 5A2KH 4IJ3C 3EO1A 4O51B 1QR1B 3CU7A 3GSVB 2VXTH 5TE6H 2D7TL 4P2CG 3QQ4B 4JRYA 1SJHA 3WNLA 3HKFA 3BZ4B 4HKXB 4JLRB 1B88A 5I8KL 5D6DA 4QTIL 4JREB 4YUEH 3RNKB 3SGKA 3VJ6B 2X1WL 1S7RA 4K94L 1WLHA 2PW2B 1U8NB 1A6TA 3KPNA 1DQTA 5INCA 3RU8L 4M3KB 2FR4A 3ARZA 1WZ1H 5KSUA 3TBYB 2DTML 2F5AL 4HLZH 4LAJH 1A9EB 5K9KA 2V7HB 4ENED 3BD4A 3NH7H 4O4YL 4BZYA 3PDOB 1MCWW 1O0VA 3RWJA 2VDPH 2IQAB 1MREL 5C0GB 2CK2A 3ARUA 5MEND 1ZT1A 3TNNA 5DDHA 2E9IA 4KKCD 4OFKA 1MFNA 1Y6NR 4OIAA 3FN0H 4BH8B 4N0FB 1REIA 2DKSA 3IAQA 4HPOH 4QNPF 2O5XL 3PGFH 4ZOBA 3JTSA 2YZ1A 1P4IH 3O3EA 4JGMA 1J0JA 1KELL 3TA3A 3SKUD 1ED3A 1OAKH 4M48L 4GG6B 4RFEA 3FHQA 5E56A 2EIBA 3BPNC 4JKMA 4KMTH 5EOTA 4NQVB 3S35L 5GRXG 1WJ3A 2VZSA 1YMMA 4GRWH 1W0WB 4OGYH 4M61A 1OGAE 1EHNA 5JIHA 4HIEB 1UACL 4R4NC 5HYFA 4J23A