4LLQB

Structure of redesigned igg1 first constant and lambda domains (ch1:clambda constant redesign 2 beta, crd2b) at 1.42a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
PKAAPSVTLFPPSSEELQANKATLVCAISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAAWSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords mutated CH1
total genus 17
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llqB00
3LOWA 3WO4B 5BS0D 3DGCR 3IJSB 1WTLA 4GRWB 5EBMA 1FZOA 5DJZB 4XWGH 3BZEA 4OZIE 3EYOB 5ANMA 5C0NC 1NGZB 3CX5J 4R3SA 1CT8A 3MRLB 4YHIB 2WLZA 4OJFL 5DEZA 4JM2B 3EYUH 4M7ZC 4ELMA 3OV6A 2F5AL 4PJFF 4YLQT 2MCPL 1OAQL 1OAXL 3STLA 4FTVE 2FSEB 4MDIB 1YEHH 1GL4B 4P3DA 2G5BB 3WE6B 5IGXH 4NN6C 5FGCE 5GIRB 4K94H 4OBSA 1J10A 4NRYA 3UDWC 3ULSB 5JXAH 1NBYA 1TZGH 3D69B 5C0DB 4G9DB 3DSNA 5F9WB 5DQ9B 5F97E 3CLEH 1J0IA 4U6YA 2NXZC 4FQCL 3S35L 5KS9F 5FUZH 3O3EA 3GMQA 2F15A 1R3JB 4Z7QE 4BYHA 1RSFA 3ZKXB 4URTB 2XQYK 3L3KB 4DZBB 1RZ8B 3E3QC 3EJJX 5J89A 4KI5F 3O45A 1KJ2H 1YUHA 4QRTB 2E6PA 1IGIH 4DGIL 3QEUA 3QIUC 4GRWE 5CILL 5IIEA 4G7VH 4CJ0A 1GH7A 2ZUQC 4K7FA 4X7EC 3TP4A 1CTOA 4ODSH 4ZO8A 3BZ4A 5E6ZA 3SDDC 3H3BC 2DOCA 5DXWA 3PDOA 2BSTB 4QYOB 1KXTB 2FJHA 2AXHA 2D9CA 3WHE1 1DANU 1YY9C 4PV8B 1P4IH 5D6DA 3HI5L 3KR3L 3X12A 3C6LC 2HYMA 5I15L 3OKYA 4UV7L 3IJYA 5D70L 2F58H 3V6OC 5KJRL 3KPRA 3AGVA 5DQJA 5F9OH 1ONQA 5DD3L 3QISA 3MRMA 4LEXL 5IBLC 3W9DB 1UGNA 2DAVA 1N0XL 1K3IA 1IC5L 3CLFL 5EZLB 5C0BD 5EU3B 4BKLA 4ELKA 3O8XA 5KVFH 1T0PB 3EW3B 4U7SA 2HMID 3QHTC 4HWZB 3HMXH 4S2SB 3DVGB 4IRJA 1NGXA 1GOHA 3QIWC 1UKSA 1JZ6A 3KPMA 3DI2B 5EZJA 4KJQC 5ICYA 3HPLB 3UC0L 5KTEH 3ARDA 3B5GA 2R8SH 3VH8B 5B8CC 1AGCA 5C71A 1INDH 5E1AA 1A6WL 4GAGH 4P5TA 3HC4H 4Z7UF 1SEBA 2HLFD 3IFPA 5I1IH 1DLHA 3VFTB 4NYLA 4W6WB 1S8DA 1W0WA 3N1QC 1RJLA 3ZHKA 1TZGL 2RJMA 1V3MA 1X5YA 4PD4K 2P48B 4PJ5D 5J1TC 3A6CL 1AR1D 1IGML 4XPAL 1RZKL 2FEEI 2A9ML 4OCMC 2VLRB 2NPLX 5KSAA 1U95A 3RVTC 4LPTA 2VB5A 2IFFH 3QIWB 3WFCL 4J4PA 3T0EA 3MV01 2ZUXA 3MLXL 3P77A 4V1DD 1CIUA 3AM8A 3O2WL 1NGQH 4Y2OA 4KV5F 3JBG7 2KUTA 3FQTA 3QWOA 1IGIL 4I18A 1LHZA 2OZ4A 3TWCH 5ANME 3V0VA 5EOCJ 1ZT1A 2X4OB 4N0FA 5JXED 5FGBC 3OXRB 3W5NA 1RZFL 4UQ2B 4TUKH 2B0SH 3ZE2F 2PXYA 4PJAB 3U9PL 2WWKT 1JWUB 3EO9L 3P73A 4R26H 4HHAA 3BZFB 2DL2A 3G6AA 3RTQB 1LE9B 5ILTL 3MV7A 1LNUB 2AK4A 1F13A 3CLEL 4XMKL 5FYJE 5GS0L 1QLFA 4OV6F 1I3VA 3DXAE 1FFQA 2W65B 4Z77A 4PV9A 3I75A 3OXRA 4JQVC 2V2WA 4O2EA 1J7VR 5DJ2A 4KRPB 3CCHA 4L29B 3G5VA 4PLNC 1I1YA 1IM3A 4DN4L 1HHIB 2FECI 5J13B 4E9LA 4P59H 5IVZB 1NUNB 4OF5A 3WFBH 2ARJQ 4D9LL 4G6KL 3UPRA 3BE1H 2GTZA 3GKZA 4PJCE 5L7XH 1F5WA 2CLRA 2E7HA 2CR6A 2V2WB 2WUCH 3RNQA 1P7KA 1BOGA 4G8IB 3T4AB 3VXNA 1JGEA 2G75B 1JFQH 5HJ3B 2IWGA 4IRZH 3ARUA 1T1ZA 3PWPD 4UT7L 3H9SA 3GK8H 4B0MM 3QUZA 1MRCL 2I25N 2VDLL 3OKEB 1A1NA 1CR9H 2V5YA 3BZ4B 4HK0B 3MRRA 5L6YH 4NO2A 3UZEA 3O6MH 3GJFB 2F53E 4UDUB 2H9GB 3MLZH 5FA3B 4TVPE 5I17B 1U0QA 2OZ4H 4JFHE 3VA2C 3JWDC 3SDYH 4BSVA 4ZXBB 2NY6D 3IB4A 4MA7H 1MAML 4XVTH 1OB1B 1NMBH 4AG4H 4MNHA 2VISB 4B50A 5C8JA 3QT2A 2RCSL 4GW1B 3J8F7 1WGOA 1KTDA 3AFLA 4KTDL 1I7RA 9CGTA 5J11B 4G7YH 4U1GB 4M4RA 1MFBL 1RIVL 5DQJB 3RX5A 3TPKA 3CVHB 4R3SB 5HHXH 4NQDB 5E8DL 1QHPA 1ETZB 5ALBH 1T2JA 2W9EH 5DK2A 5F1IA 1IC4H 1HXYA 2J88L 4HKXB 1CF8L 5BZDB 1EBAA 2L7JA 2BXYA 2GAZA 4L3EA 4P2YA 3O8XB 4BFEA 1RHFA 4O9HH 1J8KA 4QKXB 1N5AA 2HLAA 1TQBB 4P48A 1S7QA 4X6CF 4RSVA 4WW2A 4Z7UB 4GAYA 3LQZA 2YD1A 3IDIB 4JHWH 1HH6A 1BVZA 3QPQD 3DV4A 5F1NB 1NCDL 2Z93B 2EDOA 3FRUB 2XZAH 1XIWB 2P5WE 4NFBA 1T89C 3MLXH 4KVCH 3BSZH 4NPYB 4OGAD 1A4JA 5DQ9A 5FOBB 4UDTA 3ZMRA 2XIDA 5BRZD 3X13A 4R97B 1FO0L 2YXFA 2NY4D 3O3BB 3P11L 3GSXB 1FORL 3HAEH 4K8RL 2SEBB 1IGMH 1Q9WB 4WWID 3PGCA 2XACC 5FDWA 4XCNB 4TSCL 2P5WD 2HJKB 3QQ9C 3JV6A 1KACB 3W9EB 1E6JH 4RGNB 2ARJA 4KKBC 4NWUH 1UJTA 1KIRA 2MTPA 2ICES 5JOPD 3VD9A 3DO7A 5L88L 4QCIB 2DYPA 4ZYKA 3QQNA 4X9BA 3WO3B 4G8EB 3HZKA 4HWEH 4BELD 4GRLC 3KPSB 5AWNL 5IMLA 5JO5B 4NGHL 2O5XL 4P3DB 3WFHB 1NSNL 1AP2A 5ALBL 1U8NA 2JCCE 2Q6WA 4YWGL 3ROLA 2CGRL 3MLSH 3KYOA 4CU6A 3MRJA 3C60B 4GQ9L 2ZUTA 4KUZH 2IQ9L 3RKDC 4NWTL 4F7TB 3OKNB 5INCA 5IB1A 1ZWIA 4YGAB 1W0VB 1AH1A 4GT7A 2BNRA 3AS2A 3IDNA 5ISZD 2EDYA 5E2JA 3CXHK 3Q3GA 4JY4B 1CQKA 2F58L 3FFDA 3Q6GL 1CXHA 4K9EH 2UYLB 5EU3A 4MAYB 1P4LB 2J6EH 5F7HA 2ADGB 5AZEH 2VWEE 3TBSA 4YDVA 5I66A 3GMLB 1NAMH 3O6LH 3OR7B 4I0PA 4Q9RH 4Y4FD 1MRCH 1MCSA 4KVNL 2FX9H 4OM0L 4GRLB 5HD8C 2HTKD 3VXQB 5EOQH 4PBVC 4JREB 1F8TL 1A7PL 2R2EB 3D25B 1YY9D 4PJDE 3QDMD 4PRDA 3KXFD 4WI6A 1H9VA 3CC5B 4PG9A 1ND0A 4LMQE 2ADGA 5JW4R 4Y2DC 2Z9TA 1OGAD 3LRGA 3MUGB 1QUNA 3MV8A 4NQCA 1KPUB 4JO1H 4ZOAA 1MHCA 4XMPH 5IB5B 2I07B 3L5HA 4K7FB 3WDHA 2YPLD 1HCVA 4R2GC 3ARBA 4JM2F 3MXWL 4LSQH 2NX5D 4JM2D 1OVZA 4U0RC 2HVJB 4HDIB 4MYWB 4ALAH 1UEYA 5F9OL 5D1QA 5CJOL 5BV7H 1CGWA 1KN2H 3MJGX 2R4SL 4ISVB 1JPST 1NEZG 3H9SB 5I1HH 4NKQB 1R3KB 3OR6A 5IJVA 4Z78B 5FYKE 3NIFE 1I75A 1G6RB 1FYTE 3CC5A 1NGYA 4R9HA 2EZ0C 3EBAA 3EGSA 1AD9B 4G8GB 3BWAA 5LWYH 5ITBL 2Q3AA 4H5SA 3UBXA 3GIZH 1JHLH 3OX8A 5ENWA 3T2NL 3UTTE 2GUOA 3F7YA 5JOFA 2NY4B 4KTEL 3BKCL 4ZFFB 5CEZH 5KOMC 5DVNA 3NBNA 5EUKB 2YKLL 4Z7VB 4Y0GA 2PR4L 4BZYA 1HEZA 4KK6C 1HIML 3HUJA 4NKOB 3MYJA 4XBEL 5T1MB 4TQEL 5D5MA 2DM7A 2NTSP 3FN0H 3CVHH 2DWDB 3MXWH 2FATH 2PW2B 3MC0A 4L4TE 1YEJL 3N85H 1K6QL 3KYMB 1LEIA 1DN0B 1F00I 4YFLF 4I1NB 1ZKAA 2COQA 1FNGB 3T0EC 5GJSL 5F7EL 5L2JB 4XVSL 4MQXD 5EWIL 4PRPB 2ZOLA 4EEEA 4J4PC 4MCZB 2NY2C 2OTWB 3DVNB 1D9KB 3IXAB 4BSWB 1Q9OB 3PHOB 1AQKL 1Q1JH 2W1NA 5IB2B 3SGEH 1KPVA 5MI0B 4N0UA 1UM5H 3OB0H 4GG8A 5E8PB 3RZCD 4GAYB 4Z76A 4XBGB 3V6FA 3WJLC 3VXRE 3S7GA 5IQ9A 2VLKD 1QHOA 4M9OA 4QRQB 3RJDA 4R8WH 4U1MA 3BOVA 1R3IL 1UACH 4M43H 4X9HA 5ACZB 1YMHA 5JMOC 2WV3A 4LQFL 2N4IA 5D1ZB 5B8CA 3QEGL 1CICC 1INEH 1R5WB 4NUJB 3ARDC 5J6HB 5DD5L 1X5HA 1R3HB 1NFIB 1X5FA 3FB5A 2BC4B 1CFQB 3QJFA 1DANT 3RVUD 5I1GL 1R24A 1YN6B 3JTTB 4ELMF 2E7MA 1Q38A 3K8LA 3O6KH 3BKYL 4WI8A 5FOJA 4JB9H 4Q0XH 4C83B 1TVBA 1FL6A 2GW5A 4NQVA 4NQCE 2D03L 1G0YR 1UXSB 3E6FB 5E6IC 3QNYA 5HBBA 1S7SA 2BFVH 1ZVHA 4NO2B 4DAGL 3A6OA 1S9WB 4KZEL 3CLFH 3GMPB 1MHHB 1K6QH 4F2MA 3GI9H 3HE7B 4ODXA 3QUXC 1OW0C 4ZOEA 3TA3D 1FAIL 3G5ZA 4ZTPH 1MRDH 4JPVL 3ZDXE 2ZKHL 2C9AA 5FCSH 4OM0H 1ORQA 3QHFH 3TESA 4LRNH 4W6YB 4E41B 3SKUD 1D5BB 2ERJC 5EU6D 3GSWB 3EOBB 4U1LB 1LO5A 1KENH 2W9DH 2XPGB 5CEZL 1EFXD 1QRKA 4O02L 4QF1A 3MRDA 5HHPB 3IKKA 1S7SB 3JVGA 4O2CB 5TFSL 2JKXA 5JW3L 4FXKA 4S1SH 1U92A 3FQRB 1YEKH 3P9LA 4U6VL 3N0PB 2AJZB 4L9DA 4JFXA 3LY6A 3KPNA 2D3VA 3EJYD 2X4PB 3DUSA 3ZKQD 4X6BA 2CGRH 2YD5A 4OLEA 1FPTH 2R0WH 4Y19E 1AO7D 4DGVH 1VADB 4I3SH 3KAAA 4XVSH 5A1AA 1BM3L 1VEMA 4ENEC 3N9GL 5CCKL 2CLVB 1W72B 2FHFA 4ZUUB 3QRGL 1MJ7L 1K3ZA 3V4VL 4KJYA 4LKCA 2CK0H 1LWRA 4R7DB 5MEPB 4DEPC 5ESQB 4MJ2A 3TO2B 1MRFH 1Y0LB 4LHUA 5ICZA 4P2OA 1BBDH 4LHQB 5TF1L 2DQIL 3NFPA 1KB5L 2PYEB 4L3ED 4ORGA 3CU7A 4MJID 4Y19D 5EO9B 5B3JE 2CK2A 4CVZA 1MCJA 5I71C 5CBAA 5JPNA 3UDWA 2KDGA 2XV6B 4G6MH 2B5IC 2YBRB 4XHJD 3UTPD 3QEQD 2DLHA 2HFFB 3RIFK 1WSST 4KI5D 3S3PA 5C1MB 4MDJA 3V0WH 4JR9L 1W8NA 1U93A 4LLMB 4GXUN 2Z8WC 2GK2A 3SDYL 4FFYL 1T2QH 4IMKA 2NX5E 2ZPKL 1G7PB 2F19H 3MCG1 3VXUA 1CDBA 1NGXB 2B39A 4MB3A 3QFJB 3HA0A 3QCUH 1UWGL 4K3HA 1BVKA 4PGEB 3DSFH 1UQSA 3UYPA 3RY4A 5C0CD 1J0ZA 4KK8D 3S4SG 4JQVA 3LV3B 4P9ML 1AGCB 1MWAH 3DBXA 3UJIH 2BSTA 3MLPA 3U1SL 4XPHH 4HEPG 1PGRB 1S7XA 4FQJH 2XTJE 2JCCA 1TXKA 2Z8VC 5GJTH 3QG6B 1WLHA 4KK8C 2DF3A 3Q2CA 5F89A 4E41E 3CX2A 1IC4L 1MY7A 2F8XC 5DJAA 2OJZH 4HS3A 3WHXA 3HRPA 1UVQA 3ULUL 2IANE 1O7VA 1CN4A 5EOCL 5MEQB 1MFEL 2ZCKH 4BQBA 2PF6A 4HW6A 3D39D 4JDZA 2OS7A 1D6EB 3V6ZA 4QHUB 3D39B 4PLKD 4K3EH 3HTLX 2QQLL 1H8SA 3PDGA 1MJUH 3VXSB 1W0YT 4MB5A 3Q5YA 1D6VH 1VGEH 2L7UA 3P4NB 1QPXA 1CE6A 3WIFB 5EZOL 3NFSH 4UI2A 1KCUH 2AEPH 2MQ3A 5C08D 3TV3L 4A2MA 1AXIB 4GKSA 2GEEA 1AXTL 1EEQA 4P2RB 5DJ6B 1CZ8H 2R2CA 1IFHH 1FDLL 4Q2ZB 1BREA 4OUOA 4DKEH 3OHXB 2BY3A 2XFXB 4HHAB 2P5WA 4L8CB 4U7KA 4M7KL 1FGVH 3U2SB 4JRYA 4NQED 4U6YB 5SV3A 4UBDC 4F7CB 5DJ0A 2ZUUA 4X83A 1HDMA 1TCRB 5JPMB 1AFVH 2HP4A 3QXAB 3EYQC 4Z7WB 4G8GD 2AXFA 4M8QA 1PKQE 3HAEB 1CFSA 2YUWA 5EPMA 4K2UL 1CD9B 4M1GH 4MAYA 3TJHC 3IFOB 4H0HB 4MX7A 2AJXH 5HYSG 3SJVB 3TF7C 4U3HA 3H42L 4JANA 4PRPE 4ZG1A 1HILB 4JCMA 1RURH 5E8NA 3P4MA 1ZWIB 2YR3A 4GRLA 4Z7VA 3VXQA 5KVEL 1HDMB 4IJ3C 1S7UB 1Z9OA 4F7EB 1NFDE 4XP9H 3WCYA 3EZ8A 5E24E 4ORZC 3BDXA 3KVQA 5ESVA 4HC1A 1M7DA 5BMFH 1I8IA 1F11A 3QG7H 3TIEA 4S1RL 3QNZA 4PG9B 4ODBD 1N2RA 2FR4A 4J12A 1UH3A 5IROA 3L5WA 4LCCC 3QA3B 1Q9KA 3U46B 1QA9A 4NHCL 1NCTA 3B9KD 4PTTA 2OTPA 4CVUA 4DUVA 4D9RE 5AG9A 1I8KB 2IMMA 3T0WA 5A2FA 2HFEA 4KRNA 3WJJC 1G7LB 3NA4A 1YECH 3MPCA 5FEBA 4JFFE 3DROA 2VOTA 5HYJE 1OM3H 2VLKA 4HCRL 5HHVL 4J3SA 4PRBB 1T89A 1G7IB 4YBQD 3TT1H 4JREC 1ZLUH 5JUEH 3MLRH 2FR4B 4HLZH 3QNXB 5J4MA 3B5HA 1Q0YL 2QSVA 5EN2A 2R2HB 3DURA 5HYSA 5F3HA 5TE7L 4NM4H 4KUCF 5JQ6L 1I8KA 1IAIH 4P59L 1QO3B 1NH6A 4LEOA 1QKZL 1AC0A 3VWJC 3IRPX 3MOAL 2VE6A 2VDNH 2PUQT 4H26B 1KBGL 4N8VG 2X4NA 2FB4H 3KYMA 1I1CA 1LEIB 4RDQF 1U36A 12E8H 1UWEL 3H3PH 4AH2B 5K9KB 1XGUB 1A47A 3HE7D 5J8OA 4NKDA 5D7IE 2GCYA 4J23A 4ZXBD 2H41A 4HXAH 4MCZA 2VLLB 2ESVD 4QY8A 1XCQA 4GW4B 4JO3L 3IDIA 2VR4A 1I1AC 5BV7L 4I77L 1MCHA 5D1XB 1DUYA 1WV7T 5JIIA 5J12C 1A3QA 2ZP0T 4RAUA 5DRNA 5HYJD 5I8OH 1NEZA 4HEME 3PL6B 4LCIL 3ZL4L 4WDIA 1IC7H 2CSPA 2K7PA 4JM2C 2QQNL 3GSXA 5KSBF 3SGDH 3LKOA 4M6AA 1FV1A 1ZT7A 5I30L 2P1YA 5F9JB 1NCWL 4ZUSB 2OR7A 2DQJH 4G80B 4OQTH 1OSZA 4JPIA 4L8DA 3U7AA 1RD6A 4ZS6D 4GG6B 4OZ4A 4X80L 5DMKB 3HNVH 3SGJA 4JDVB 5F7NC 2QR0A 2W38A 1P5VA 3X17A 3JWDH 3BP4B 4OLXL 5IP4A 4OTXH 2VL4A 5ISZE 3PWUA 5IM7A 4NQXB 4YZFE 2FD6H 4O2EB 1DBAL 3T09A 2B2XH 5C0ND 4G42B 5T1DH 3VFVB 3H2WA 4IIQA 4YK4B 1FV1B 4K71C 4U1IA 1N4XH 2MJWA 2E9JA 4UT9H 2APTA 5EBMB 1JK8A 2G60L 2KL6A 3OXSA 4U05A 4F9PA 1B0RB 1AD0B 1IGYB 2B7DT 2QQQA 2YN3A 4E41A 3ULUE 2PNDA 3VWJD 4PBXA 3S36X 25C8L 5CJXA 4MD4B 1KJ3H 3BPLB 1LVEA 1MEXL 1FYTD 3RVVC 3UPCA 1R0AH 3HG1E 4U1JB 5BJTB 3QXAA 3W81A 1P7KB 3RX7A 4S11A 4LASL 1PLGH 2DQTL 3KPOA 4JKPH 3G6JF 4D94A 3GRWA 3B9KB 3AU1A 4LCYA 3WUWB 5T1DL 1EGJH 2HT2D 4XCYB 3GIZL 4I18C 3T8XB 1A7QL 1RZIB 2XQBL 4WU5A 3HLAA 3IDGA 2G9HB 5C0RL 1L7IL 3KWWB 4EUPG 1JF5A 4JLRA 5D70H 5IHZA 3D2UB 3GJFA 4UDUA 1U3HA 3MFGB 2YD6A 4TNVF 4YEFA 1YC7A 5IW1B 3C87A 2E27H 1HQRB 3EFFA 3GSQA 1CICB 4ZFOA 4OCYH 3KYOB 4WIQA 1DFBL 1FO0H 3UO1L 4GW1A 2XG5A 4IHOB 1YDPB 4CVZB 5JPNB 4TTDC 2D7TH 4LCIH 4M4PA 3MRQA 5GPRA 2VDOH 3O3AB 2XWTA 2V5RA 1DBJL 5EWIH 5ITFA 3QDAA 4L9LB 1W72H 3M8OH 4JDZB 1YPZE 5IW1A 1BF8A 4JO2L 2WQRA 3KYAA 4Y4FB 1RJLB 4NT6B 2MQCA 5GS0D 1SYVB 3T1FA 1CBVH 4HUWA 2IBGA 3C8KB 4RNRA 3AMLA 4U1KB 3GNMH 4KVNH 4OZHB 5E99H 5EZIH 4Y19A 5E8DH 5KJRH 5IOPB 4NC1E 1WBXB 3OSKA 2VQ1B 3WFDH 4JFOA 4UIKL 4W4NA 2B2XL 5FO9B 3MRKA 3QEQA 4U7MA 1CZ8L 3S4SB 4AM0A 2I9TA 1S7XB 5BCAA 4FA8A 3Q1SH 4JM4L 5GGVL 1BJ8A 1BJ1H 1PY4A 3CMOL 3S96A 1EMTL 5IVXA 3GKWL 3V0VB 1ZHBB 1H3TA 1MJJB 4F58L 2QJDA 5A40E 2OSLB 3C5SA 1F6FB 3GMNB 3CFEA 1VENA 1A6AB 1FFNB 2JF1A 3VD7A 2XZAL 2CRYA 3G5YB 3WHXB 1BBJB 2Y72A 3GM0A 4KMTH 4N0UB 4WEBL 5CBEA 1P2CA 5EB9A 4O51A 4LGSB 3MA7B 2JCCB 4NGHH 1NC2A 5I8KL 2AJXL 2E5EA 1LEKB 4AL8L 4G6JL 1AY1L 5LXGL 1T03H 2MFNA 4XNQB 2H2PD 4XXCA 2GJ6A 3ZSTA 3IS0X 1N64L 4UIMB 5CHNA 1NEZB 3L7FA 1QBLH 4EZMA 2J5LB 2EH8H 4PJAE 4PJEB 3LH2H 3UJTL 1N4XL 5F8RC 5DFVC 5I1LA 1BBJA 1Q0XH 3LIZL 4P2QD 1KV3A 1R24B 5I1EH 5FHBL 1JRHL 1I1YB 5JZ7C 3NACL 4OIIH 2WBJB 1WZ1L 2GT9B 4MQXC 4EOWH 3FOLA 4JHZA 1RJYB 4AT6B 3I3BA 4UTAL 1VGEL 4W6XB 4E5XB 4F8TA 2APWA 3VFGH 1FL5A 1FNHA 1TNMA 3MXVH 4QRRE 1NLBL 4MXQC 8FABA 2R1XB 4LPYA 3UBXG 3TBSB 4X9GA 1T04B 4S1QL 5L2KB 1AC6A 4P46C 1E4WL 1Y18A 1N6QH 1AHWA 5GS0H 3G6AB 3RTQA 4MVBC 2IQ9H 3NCFB 4JQXA 4P46B 2YD9A 1U2HA 5T33H 4JFFB 4G3YL 1A7NH 4F80A 2FHBA 1Q0YH 5DYOB 1GYAA 3JWNC 5MENE 3WSQH 5E5MA 5EUOF 4MWFB 4FQLL 4L1HA 3PWLA 1OLZA 1KIUA 2AJSL 3H3KA 2H26A 5E1HB 2DQHL 4JEGB 2MPAL 5DHYA 5TJWK 3TNNA 1JGVH 4WTZG 1T21A 3FO0H 5ERWA 1QSEE 3QUKA 1MREL 4KRPC 3VGHA 2YN5A 5FCUH 3FB6A 1MIEH 4X8JB 4HDIA 2HVJA 2D31B 3NOIA 4DGYH 2ADIA 3S34H 4PJAF 2Q3ZA 1T83C 4U2ZA 5KS9E 1EAPB 4LKXA 5CIPB 4HBCH 3MRCA 3MBED 4C4KT 1T7WA 4MXVE 4NRXB 1NGPH 1NGYB 3OWEA 2P4AB 4YXKH 1DVFB 3QUZC 3DETD 4HWBL 3QPXH 4XP5H 3O2DA 1KXVC 3C8DA 1JWSB 3QIBD 4EVNB 1U8QA 1DSFL 3MRIA 1TENA 4L4TB 4F2MB 4NNXB 5ICZB 3G9VA 5FKPA 4GQ9H 1HWGB 3QO0A 1FVEB 5EU4A 4JN1H 2E8YA 1J12A 3NA9L 1RFDH 3FRPG 3V7AE 2ESVA 2E9WA 4JDTH 2Q76A 2A6DA 3H42H 2HAZA 4FP8H 4NO5A 4B7LA 1V3KA 1MRDL 4I2XB 4JPVH 4KMQA 5FK9B 3NVQA 2XPGA 2VWEC 4U1NA 4HZAA 3VFWB 4XH2A 3MODH 3IETB 1OP3K 2P46B 3WFBL 1HNFA 1MLBA 5F9DC 3BPNB 5BVPL 4NWUL 4FFZL 2B4CH 2Z92B 3BH8A 4OQ1A 1VGKA 4KMTL 3J7HA 4EI5B 1T7VA 4RA3A 1VFBB 2AS5M 4NZRH 3SDAB 4U1IB 2D7TL 2EC8A 5IMKA 4G9DA 3VG0L 2Q76B 2RAMA 3TYFB 5GQBA 1DBKL 5DVLA 2FL5B 4QWWC 5EZOH 3P4OB 4LF3B 3UTSD 3SGJC 2NTFB 5FYKD 5GRUL 2M26A 1U3YA 2WWMC 1G9ML 3GSOB 3L3KA 5I8EB 3VXMB 4ODTL 2VXTL 5GGQH 4WFGD 3RWDB 5HVHB 3RTQD 4QCIA 4XMKH 4PY8I 5FM8A 5EZIL 3SDAA 1KLGA 3O8XC 1UB5A 2C3XA 5GS1B 5I73C 3PV6A 5K59F 2EEAA 2HN7B 2Z8RA 4JCLA 7CGTA 1IEHA 3QUYC 3RDTC 5ADPH 2FECL 4QTHA 3PL6A 5J1SC 1NCCH 5DRXB 4LAJH 3O2DL 5F88A 1FZMA 4JDTL 3NGBC 2HFGH 4YR6B 1OWWA 3GHBL 3QUXA 4L8SB 3T3PF 3IDNB 3UZVB 5D1XD 5EFIB 3V52H 5KVFL 2P8PB 2SEBA 5FYKL 2KQNA 4M3KB 3WXWL 4GKZA 2V5TA 3CDYA 1QPPA 2Z91A 3CFJA 4XP1L 3I3EA 3MRGB 3VI3E 3C60C 2GQHA 2XRAL 3D9AL 3DWTA 5DD3H 4I0PB 3FCTB 1B4JL 4QOKD 4KKAC 1IBGL 3PIQA 2A83A 4Y1AB 3E2HB 5F8QC 1T7YA 3BGFC 2IBBA 5DC9B 3VFGL 1I9JL 3O3BA 1BMGA 1DTUA 1VERA 3DXAB 4G9FE 4N0YH 4NC1C 1IKNA 2Q87A 3H9SD 1ZTXL 4ZYKB 4FABL 4RDQG 3U48A 2HT3C 6CGTA 1A8JH 4CNIB 4O5LL 1JGVL 3DUHA 1LP9A 3O9WD 2AJYH 1CG9B 4H1LH 4YHLL 3GMOB 1CU4L 1HILA 3C5ZD 4KPHL 3HZVB 4PJFA 1U8MB 1ZGLA 3VG9B 2O26U 2HRLA 5DVOA 3BN9D 2NY3B 1SBBA 3PL6D 4R4BA 1I9IH 3VXSA 2BX5A 5E5MB 5ADOH 2R56L 3QXUA 2GSGB 3FB8B 3B9DA 4JZNA 3E2HC 4LCCA 3CVHL 3V6OA 3MV9B 2XZCL 4HD9A 4R6UA 2G5RA 4O4YH 3VRIB 3MV9D 4Q2ZA 4UT9L 3OKNA 3OX8B 5DLMH 5ENWB 5GGUB 3T0EE 1OAZH 5IKCB 3I50H 5HD8D 2YBRA 1EHAA 4WNQB 1WBZB 4HZLB 4FFYH 2X44D 2NXYC 2IH3B 1FCCA 4OFYA 1XF3B 1ED3B 3DROB 3NN8B 5GRYA 4M8QB 2FO1A 4HSQA 1RHHA 1KENL 3O4LB 3M1BB 2A6KA 1URLA 4XNYH 1K4DA 4XCEB 3Q6GH 5D1XC 3NTCH 3STBA 3WDJA 1FHGA 5LGHL 2CUIA 3UJJH 1H5BB 1OF2B 3ME0A 3IFNH 5E8NB 1QEWB 3RIFF 1JF1A 1II4E 4V1DE 1MFAL 1A1MA 4PJGF 7FABH 4GMTL 4EIGB 1FNAA 3DXAD 1FFRA 4HJGB 5BQ7B 4Y5XB 4E0RB 3MLRL 5HGAB 4ZOCA 4JZJC 1RZ7H 3MRHA 5BS0E 3VI4E 4KV5E 5DA0B 4RBPH 2IC2A 1SHMA 4F58H 3KPQB 4U6VH 4M02A 2ILLA 2CDFA 5C0CE 3NAAL 4OD1H 2W0LA 3FO2B 4NN6B 5HDBE 4O00A 5LCVL 5GGRY 4FZ8L 2FZ3A 4FABH 3RWIA 3NPSC 1NAML 5EO0B 3LRSA 3F12A 1A4KB 5C09B 3MLYH 1HOCB 3A6BL 3T4YB 4YUEL 2O5YH 1UB6B 3MJ6A 3B83A 2NY1D 4GAJH 4X7SL 4B5EA 3ROOB 1D3CA 1MF2H 2C3HA 2R4SH 2VO5A 3LKQB 4IOFD 1VFMA 1EGJL 2EKJA 2BZDA 2HKHL 3DRQB 1M71A 4U0QB 1U8OA 3F7VB 1SMAA 2OTUB 3QZWA 4OZIA 4KU1A 5TE7H 1YJDL 4JO2H 2NR6C 4G6FB 3VJ6A 3DI3B 2LAAA 3S88L 4OLZH 4EI6B 3G5ZB 2PO6A 3HC3L 1ZSDB 4GG8B 1FRGL 5E8PA 4DGIH 3MNWB 4XTRC 1MCOH 2HKFL 1HYSD 4BUGA 4LLVB 4KJPC 4XP4H 4U6TA 2M1KA 3JV4B 4TULH 3THMH 4AZ8A 3E8UL 3CFKB 4J3TA 1LO5B 1OTTD 3P40A 1YMHB 4ERSL 2I9LA 2D7NA 2NW2A 3BPCA 1WEJH 5C0BB 4JY5H 4PJCF 1WWAX 3TCLB 3WIHH 4OCWL 1GC1C 4P5KA 1I9EA 2XI9A 3V6FB 2NNAA 1LO3L 1KYOJ 3LKNA 3AY4C 4E5XA 1HI6A 2ICCA 4OTXL 1FL5B 1LP9F 4KTYA 3P11H 1S7VB 1WWBX 1JYWA 4MSWA 2HMIC 1QACA 2PCPB 2OMBA 2QQLH 2J7LA 3W11D 1WK0A 4M93C 2IF7A 3U0WL 3RAJH 4LP5A 3TN0C 3OB8A 4HUMB 4KK5D 1HXMA 4JJHA 4ODXB 1L9MA 2DDQH 4P2OB 4C83A 2F54A 2NW3B 4I48B 1MWAB 2PYEA 4HX1B 5GRWA 4XNZB 1BIHA 2ITCA 2J8UA 2YD4A 2DS4A 4HKZA 1YNTB 2J8UF 1KJ3L 2YOCA 4MWFA 1C7TA 2VLRD 1KPRA 2Z35A 2EICA 1RK1B 1RV6X 2HRPH 4UTBH 2AKRB 2CLZB 1DEEA 1N5YL 1QOKA 2K1MA 3CXDL 3D2UA 4KQ3H 5GGSA 4I77H 4HLJA 3GMRA 3LKSB 1JWSA 5FYLL 1D5XA 4NN5C 3WKML 4MMZC 2NXZD 3PWJB 4KKCD 5IWLC 3CNKA 1TTGA 4DVRL 1LNUA 2X4QA 3X14A 2AJZA 1OARH 4X6FA 1OP3H 3TV3H 1UCTA 1NGWB 2ADFL 3BJ91 4JQIH 1NBZA 2JJTA 4PJ9B 1RK1A 2FBJH 3OL2A 2X4SB 4PV9B 4PJHA 5GHWL 3DBXB 4G8FB 1JNNL 3MACL 1MUJA 4YHPA 2PYFB 2OJEB 2ZUWA 4FTVA 4JN2B 3QQ4A 4PJ8D 5F6HJ 2L4OA 5HHMD 3BP7B 4EOWL 4J3UA 1CLOH 1RZ8A 1BD2B 4HJ0D 5D9SA 5KSUB 1Z9MA 3S37L 3AROA 4NUGL 3QDJD 5JHLH 5IFAH 3N06B 1CIDA 4PBWD 3QEHB 2HG5A 2PYED 3PGDA 5JZ7D 4BFGA 5EZJB 1LE5B 1F58L 5T3ZH 1KEMH 3LMJL 4KGJA 4L3AA 4LL9A 4NKIH 3JWOL 4U4BA 4UB0L 3MGOB 2VR9A 3PGFH 4OSUL 4NP4L 2J2ZA 4R0LB 4HUKB 4M62L 4JJ5A 2B20A 1CL7H 2FX8L 5JHDD 2ICEA 4ZNEE 4PV8A 1DVFD 2G2RB 4HV8A 3KXFE 5T1KD 1MAKA 1AO7B 2ZNWA 1ZHKB 3BXNA 3VRLF 3HFML 3O9WB 4PRAA 1BVLB 1CICA 2ESVE 4Q9RL 4J8RA 5IBUB 5MENB 2CMRH 1TTUA 1IL1B 4OFDA 2MQ0A 1S9YA 2VDML 4WTXA 1AGEA 4TNWK 1CDJA 4MA8L 3MUHL 1OSPH 4WWKD 1FSKC 5EO0A 2DIBA 2P43B 1KELL 4GO6B 1QKZH 2OL3H 3X12B 2C3GA 3HS0A 5FO8B 1EFXB 1AQDA 4KI5E 1UCBL 3O0RL 5IF0A 2RGSA 3CFDA 3CH1B 3NCEB 3ZHLA 1KIPA 4X98B 4P2RD 1FL3B 3P0YH 1NJ9A 5AAWA 3P9MB 5BW7C 1LO3H 4APQD 4ZSOA 5AUMA 5DI8B 1RU9H 2ZCLL 3GRWH 1IEBB 4YH6A 3MV9A 3HC4L 4DTGL 4FFZH 5ICYB 4KZDH 4YHKL 3MRGA 2ADJB 3C08H 1GZQB 3CXDH 1GIGH 3W9EA 1C12A 1A14H 4OZGE 5AEAA 3OQ3B 5D7KE 1YYLH 2AI0L 4HKJB 3K2UL 4PJ7F 2Y06L 5CKGA 3SHSA 4GBXB 4O2FB 4TSBL 1FNSL 2DIJA 1MPAH 4WU7B 5GS1C 5I73B 4MA1B 1IQWL 2RBLA 4JRXA 4P9HL 2HT3D 2Z91B 4MA3A 1BJMA 1JCKA 2A6KB 3IDXL 2XY2A 1IFHL 2RCSH 1KOAA 2NX5A 5B22A 1DQDH 5GZNC 1QA9B 3CVIH 4NBYB 3UYRH 3QPXL 4XP5L 4FQXC 1MCNA 3QH3A 5T5FL 2Y07L 3FQXA 4RFNB 3DXAA 4W4OC 2PW2A 5D1QC 3VA6A 1YMMB 2KQMA 4YXLL 4I8DA 5KANI 2WZPD 1X9QA 4KVCL 5F7WC 1IAII 1CE6B 5T3ZD 4MXVF 3RL2B 5KVMC 2AXFB 1KSRA 1T1WB 4ZAKB 2FEDC 4L4JA 4V2CB 3CFCL 3IGAA 4GOSA 1R3IH 1SVZA 1T1YA 1CG9A 1EVTC 1WF5A 4K8RC 4U1HB 4LCCB 3QAZC 5MERB 1PX3A 5DRWA 3IXTA 4KDTA 3RPIA 3JTSA 3ZKMD 3WIHA 3FJTA 4PS4H 1OY3B 1EDQA 1JNHB 2ARJB 3SE3C 1S7TA 3BPNC 4F7MA 3QAZB 4KRLB 1NUGA 3B6SA 1AFVL 3AAZA 2F8OA 1ED3A 4X9FA 2VITA 1QTYT 1A7NL 3DX7B 5K33A 5IMLB 5A2IH 1CFVH 3CU1A 3LEYH 1MQKH 2VMFA 1UA6H 2R9HC 4RFNC 2D4DA 5MERA 3B3IB 4FQXB 2EE3A 2GHWB 1ZA6A 3T0VA 5I1DB 3OMZA 4FQCH 1MIML 4KMLB 4L3CA 4NKDB 1HCFX 2VISA 3AAZB 2UZXB 2Q20A 1FIGL 4ISVA 4LNRA 5DK0B 1JL8A 3BESR 4QRUB 3QXVA 5FK9A 3P0VL 3Q5OA 1GRWA 3LKPB 2YZ1A 5EO1B 1L4IA 5H35B 5D8JL 1JE6A 3C2AL 4QHLB 1G9NH 5DK2B 5HI4C 4KI1A 1G7QB 1OD9A 4JHAL 2R23B 1BZ9B 4HF5L 4B41A 1JPTH 4PTTB 1KCRH 1IT9H 3U0TB 5K9OB 5ESAA 3LKOB 1UEMA 5IEHA 4KQ3L 5IMMB 2LU4A 4HPOH 4X4ZA 3HE6D 1XCTA 3BW9A 3ARED 3LS4H 4WW2B 3L7EA 3MRFB 1MHEA 2AK1H 1QSVA 4GRMB 5MP6L 5DUMH 1BGXH 2ZJSH 5DMKA 3P4OA 4QLRA 3QRFM 2HA1A 4WCYH 2AK1L 4FFWD 3FONA 15C8H 2GJ6B 1GGCL 2DKMA 1JWMA 2EDEA 3B2VL 1LQSR 3WLWD 1MJ8L 4X99B 4ZOBA 2VAJA 2UUDK 5AYQA 5CEYB 2I07A 5CD5D 5I16B 4NQXA 3MACH 2R0ZH 1UFUA 5EU5A 1TIUA 3TH3T 5LQBL 3RWJB 4IDLA 5DMJB 1CGUA 2X4PA 5C8JB 1KB9K 1ZXQA 4NKMA 4IMLA 5I9QB 1U42A 5GS1A 4NSKA 1JRHI 1EZVY 2DLIA 3ARQA 1A6UL 5CZXD 1HK6A 12E8L 5DUPL 1F4XH 2H9GA 3EHBC 5FA3A 1BEYH 2Z35B 4XT1C 5F1IB 5C0IA 5I1HL 3QYCA 2R39A 1XGQB 3S5LA 3TIDB 4AEHL 4RGOL 4ZDHA 4Y2DD 4PLJD 3D9AH 4ZXBC 2Q8BH 5F9WC 5F3BB 3RUGF 3EDEA 5CBAB 1LDPL 2ZG2A 3OTTA 4TVPH 4AJ0A 3EDKA 4Z7UA 1D5MB 4OCSL 2BVPA 4LK4A 3ARGB 2HKFH 3ARTA 4RAVB 3I3DA 1GZQA 1IC1A 4LF3A 4U31A 5E2VH 1GAFH 5DR5H 1HXYB 4M1DL 1V3JA 3BKML 1MCBA 4QRPD 4M6OL 3X3FL 1CXLA 2OR9H 2BCKB 5HI5C 1H0DB 5I18L 5B4MC 2Q8BL 2X4UA 3OB0K 3CK0L 3VXUE 3Q1SL 4JM4H 4KK5C 5HYJB 3B4NA 1NDMB 1FFPA 1T5WB 2AV7B 3O11A 1ZA3A 4HXBH 1CGSH 4IOFC 3CPLB 3AC0A 5LBSH 2C3VA 4HXBL 2UWEE 1IGCL 3RNKB 3RWEA 3X13B 4JKLA 3QCTL 1KIRB 1TTFA 4JKMA 3RIAK 4MQ7B 4V2BA 5LCVH 4BZ2H 3KNBA 4QHMA 1I7UA 5D6CA 3KJ4B 4AIXA 1FAIH 1BD2E 2YXMA 1UA6L 3R8BB 2G2RA 4NWTH 4QT5A 1P6AB 2OBGA 3H7LA 2IEPA 1AO7A 3FN9A 5FF6B 2UY6A 3OGCB 1D9KC 5JDSA 1KJ2A 3EYFB 4HUWB 2WBWB 4PGJA 5F1KC 4NC2B 2ZOKA 5TPWH 3BDYL 4Y16B 3RZCC 2N7AA 2J4WH 1GGYA 3QBTB 4LIQE 3OKKA 2QL1A 3NZ8A 3M45A 1PDKA 3QNYB 3ULUD 5JR1H 4XBPA 3EHBD 4GQPH 4WI3A 2YMXL 3HI1B 4JZOA 2A2QT 1NPUA 4CDGC 4HPOL 3WMSA 1XF5B 3VE0A 3DX6A 2RR3A 5GGRB 5KSUA 3S35X 4PLJC 4N0RA 4NQEE 1CFNA 2R1YA 5JMRA 4Y5YB 4YBHA 4MD0A 5DUPH 4G43B 2OSLA 1NFKA 4ACPA 1HHGB 3V7AG 2P47B 4G6AC 4E42B 1VPOL 5GS2D 3SDDD 3I6KA 5DF0A 5IMOB 3ARFC 1P2CB 4LLMA 4F9LC 5SWSD 2HJLA 3BP7A 1JHTA 1QRNA 5HHOE 1T4KA 3PHSA 4X80H 5EZLA 4Y88A 2DWEB 3ZKND 4O2FA 4LRIA 3DX6B 1PLGL 5F9AC 3MGTB 1YNLH 3CAFA 1WAAE 5CWSA 4JFHD 1FFOB 2IAMD 3U79A 1L7TH 1GAFL 4UNTA 4RNRB 4U6HA 2CDFB 3MBXL 4XWGL 4IRSA 3VFRB 1ZVSB 4M5YH 3MJ9A 1HKLH 1T5XA 4TTGA 4Y7MA 5I8OL 4KY1H 3CUPB 5F6HI 2VL5A 3FT3A 4LFHG 1Q94A 2BRRH 5FO9A 4BK4A 4OB5H 4HT1H 4DZBA 5D72H 1IKNC 2DWEA 1VA9A 4OT1H 1BX2B 4HIIA 4Q9QH 5HHMB 4GW5B 2D4FA 5IVXB 5EO9A 3T2NH 3VXTA 4JPWH 5A3IC 3ARDB 1MCDA 3DSFL 3BD5A 1TJIL 4N0YL 1CFQA 1OSPL 5F7MC 1NLBH 1RIHH 1ZSDA 3CDFA 1ITBB 2GJZB 4LIQH 3MA7A 2Z8SA 4JFDD 4D8PB 4HH9A 5HYQB 1AI1L 3P77B 1QRND 1F3DH 1W0WB 1X5KA 3I6GB 3SCMB 3B2VH 5ID0B 3LN5B 5EU6B 3SCMD 5HGHA 4YHOL 1JN6B 2B1AL 2DI7A 3ULUH 1KGCD 4M7LL 3QUYA 5FHBH 3KPQA 1JPGB 5FYKH 2NY2B 3ESUF 1WICA 4Z7WE 4ZDHB 3U82B 4TSAL 2E7LC 3FT4B 3WLBB 4NKOA 1IMHC 4BQCA 3ZE0F 3L6FA 3G5XB 1KEGL 2X1XR 3ULVF 5HDOA 5C09A 4RZCB 4G6AD 4PJ8B 3GMMB 3LEXA 4LHJB 4ENED 5FO7B 4G5ZH 4QRQA 1D5BA 1VFUA 4ODWA 2NR6D 4O58L 5CHNB 4LOUC 2B1AH 1Q72L 5GSVB 3CZJA 1UM6H 3F6LA 3PWVA 1FPTL 2R0WL 3ZKNC 2EECA 1U8OB 2OP4L 4WO4B 1JF6A 2PXYB 4BSWA 1UWGH 5J6HA 1DJSA 4QTIH 1R3HA 2DM4A 4H0IA 1MNUH 4M5ZH 4ODTH 1QVOB 1P1ZB 1PAMA 1BZ9A 1RZJC 2ZNXA 3QJFB 4YJZL 1FLTX 1RZJL 4XPTL 1H8NA 3KPRE 1ADQH 1A3LH 4POYA 1MCWM 1GXEA 2XRAH 4IIQC 1TVBB 1M4KA 3DUSB 1WWCA 4RAUB 4NM4L 1U8PB 1FG2B 1KB5A 2VDKH 2CUHA 4NHUA 5IG7B 4LLWA 1CD8A 4ZTOH 4D0CB 2BC4A 2R2BA 3RPIB 3KNBB 2Y7QB 4QHMB 4W4OA 3WIHL 4CBPA 4X99A 1NSNH 1QFHA 5DC4B 4FQXA 5FM5M 1IRAY 3SDAD 4OLUH 3ZO0A 4PRID 4ERSH 4YFDB 1I8MB 1FZOB 1DQLH 1GSMA 1EIBA 1YJDC 5JHDA 3NPZB 4PJCA 1I9RH 4V1DA 4WO4D 1MCEA 2ZUSA 4GXUM 2PYEE 1B9ZA 1BQHA 3BP6B 3BDYH 4YDIL 4Y4KC 2CJUH 1G7IA 2VXSL 3S88H 2BNQA 4KFZC 5D2LE 3BN3B 4M8VA 4PRNA 5C0IB 4IIQB 2O93L 1LK3L 1ZMYA 3LB6C 2DICA 5SX5K 3TBWB 1N0XH 5HYSB 4OGYH 3VI3F 5DJYB 4DQOL 3U9UB 4KJQD 1QFOA 2OL3L 5HHOD 1INQA 4U49A 4YBQC 4NRYB 3RY6C 1FGNL 1QD0A 2X4TA 3A6CH 5DD6A 3WEXA 1PQZA 3QFJE 5EBWA 3V0AC 5JORB 2P24A 2P7TA 3TNMA 3MMEB 2WW8A 3VD4A 1E28B 2EDRA 5E0QA 3MR9B 2VLJB 3NIFF 4M48L 5FDYA 3GNML 4PRNB 3NAAH 4OD1L 3RDTB 1F3JB 5D7LA 2VDQL 1K9TA 4OGZA 4U3CA 3TZVB 5EU4B 2GCYB 5F21B 5IHBA 1KTRL 1NUDA 5KOVC 2P8PA 1FH5H 1TNNA 4RAHA 1NC4B 1A5FL 2R69H 5T5NF 3OPZL 4YC2C 4LASH 1S7QB 4NKIL 1NMAL 4N1CA 2RQ8A 1DUYB 1RFDL 1YN7B 3P3YA 4P3CL 3QFJD 4DKDC 4X6DE 3MZTA 2A9NH 4XVUC 3FMGL 1A4JB 2JJUA 5CEYA 2QHRH 2P5EB 1A6TA 1EUTA 1CLOL 2EYSB 3D39E 3PWPB 5LGHH 3SJVE 2H2SC 5DI8A 5TH2B 3QCTH 4P23A 2C4FU 4GKSB 5I71B 4K3EL 1RIHL 2YKLH 2VZSA 4X6EB 2EXYD 3A6BH 5GGSY 1X5AA 3ZKSD 1A6UH 1KIQA 2VE6B 4LLDB 1NCNA 3UTTD 4CRPA 5E2TL 1BECA 3QDGB 4JFZH 5EBLB 5IBTL 3V0WL 3MGOA 3FO9B 4QHKJ 3ZDYE 4HKJA 2VLRE 5FCUL 5LJYH 5DJ0B 2DLGA 1OT2A 3QPQC 5DJCA 4CGTA 1ZGLP 3P30H 1RUQL 4M00A 5DD0L 5EFIA 3K4AA 5TF1H 4J8RB 5DVKA 1UWXH 4RFOL 1ZLSL 4JE4B 2A74B 4X5WB 3SJVD 4NOFA 3WFHA 3VD5A 1J18A 4UTBL 5E95B 2HN7A 1R0AL 2NY3D 4WWKB 4OV5B 1GJIA 2NY6B 4OF8A 3FHAA 5I76A 1U3ZA 4RGMC 4YHZH 4FOMA 1A3RH 2YPVH 3KDMB 1W8OA 3RFZC 4WEBH 3U7YH 4RX4A 1C5DA 1EBPA 4LU5H 4MNQA 1A1OB 4Z5RA 5I8CB 1SMOA 2K7QA 4P57A 4KHTH 2M2DA 3P9MA 1NAMA 1A7OH 2R0LH 1VDGA 1BEYL 3LQZB 4TRPH 3ROLB 2L0DA 4R4NC 1HINH 2VABB 2VZUA 3H8NA 1RUKL 4G9FA 2C5DC 2H32H 2X42A 5E5UB 4UOJA 1MHPH 1NFDA 1N6VA 1KN4H 4ZD3H 1U6AH 3BP5B 3WXVH 1S7TB 1U8LA 4F7MB 1A6VL 1I9JH 5I1EL 4QHNA 4PJHB 1JTTA 2WBKA 5LQBH 1G7LA 1IBGH 3IDMA 3D5OF 5D2NA 4YHMH 1ZLVK 4GJTB 1EJOH 3EO9H 2OX5A 2ENSA 4MX7B 1TVHB 4F33B 4TULL 3THML 4OKVB 5I1LB 1BGXL 2ZJSL 5CJQL 4J6RL 2X5PA 5H2BA 1U8IB 5C3TA 4BQ8A 4TUOB 4ZO7A 4LP4A 3K80A 1W72L 2AV1B 3KLAA 3QDJE 4RMUA 4E42A 5ICXA 3VFOB 2ICWA 3ZKMC 3D18A 3L5XH 2VXUH 4MNQD 2WQ8A 4WVRA 2Y5EA 4I9WE 3U4BH 3SE9L 5EOTA 2DKSA 1ZHKA 3IFNL 1J05A 1FG9C 1RUAH 4GUPB 3EOAA 4K23L 3O6FD 1O7SA 1AE6H 2Y36H 1B6DA 1M71B 3E1F1 4JFEB 5FV2A 4X4YB 3CMGA 2QBWA 1E6OH 4UUJA 5D7IB 3BWUC 3RBGA 4Z0XA 2VDRL 3ARGD 4IJ3B 2IAND 2IADB 3HNVL 4HS8H 4I0KA 2IANB 4GUPA 5DO2C 1FVDB 4DAGH 2MKWA 2FYYA 3IU3B 4O4YL 3HN3A 3JV5A 3FFCA 1BOGB 1SJEB 2R56H 3VXPB 3DTXB 2PN5A 3DX9A 4L8BB 2AEQL 3VFUB 1EERB 3L9RA 5DUML 3VXSE 3KLSA 5ITFB 4IOIA 1SJVA 1MFAH 3MA9L 1OP5H 5CLTA 3MJ8B 1F97A 3MCLL 4Z7UE 3OKEA 3ULVH 2Q7YB 2XKUA 5FUZL 1QQDB 1M1SA 2ZCLH 2VXQH 3T0ED 3VGAB 4PREB 5ID0A 3EZJB 1ODAA 2FYYB 1RUQH 2XN9E 2Y23A 3F65A 2EDFA 1GVIA 4OZHA 3TYGL 2NXYD 3EFDL 4KTDH 3F7VA 3HPLA 4TYUA 3TVMB 2R15A 4MCYA 4XTRD 1FLRL 2IALA 3O4OB 4M3JA 3VFUA 3SDCC 1OGTB 3L9RB 3VW3L 1LO0L 1RUAL 1ZLWH 3MRKB 3QEQB 4XMLL 5DQDL 2F54B 2NW3A 4I3RL 4OGYL 3NIDE 1J11A 1UJ3B 4LSPH 2VZ3A 5CJOH 3VFTA 1YEDB 2BRQA 2BNQE 3FFCD 3S34L 3O6FB 1JUFA 3EDDA 2AK4D 1NCWH 4XNXL 4Y5XC 1IQWH 4P9HH 4OZIB 3L3GB 2GAZB 1M6OB 1AXSB 5IHUL 3MV7E 2DLFL 1N6UA 3CSPA 3HG1B 1QFPA 1OGTA 1S9WA 1H3GA 1BLNB 3ZE0E 1NC2B 2AJSH 4NN5B 3T1WA 3OF6A 1UZ6E 3CSYB 4YHKH 2N1KA 4P46D 3IYLW 5GJTL 3M07A 5T3ZE 1H15A 1SEQL 3FQTB 3QWOB 3DYMA 5FGCB 4ZFOL 2YUVA 3K4DA 5C0EB 3P0YL 2E7LA 1JHLL 5GGTL 4G80A 5D2LF 5SV4A 1B0WA 3H3PL 1ADQL 2JCCF 2D31A 2BY0A 3GB7B 5CD3A 1OAQH 1HI6B 4PJGE 3V8CA 1DQQA 3N1FC 1C08A 3MNVA 1NFDB 1AD0A 1IGYA 3QFDB 1P7HL 1OP9A 4RFEA 1MFCL 1XR8B 2QQNH 3IDMB 1R3JA 3W11C 2F53B 5FYJU 3PP4L 2R23A 1J1OH 4KWUA 2OLDA 2DI8A 5KSVB 1G6RH 1CLCA 5A3ID 4WW1A 3ZZ1A 1FYHB 1HHJA 1SYSA 3ESVF 1B0GA 2CXKA 5C0JA 4OB5L 3SBWC 1BZQK 2YK1H 4I3GA 2QSCL 4QXGH 2FJFB 4G6FD 4FQPA 2QADC 3C60A 5CEZD 1AO7E 3QI9D 3SDCD 2BNUB 3L7EB 1U8IA 4HULB 2HRPL 3TJEL 3ZKXC 1G7HA 1DQJA 4HBQA 2ERJB 1XZ0A 5DWUH 1B90A 1MCLA 2H2PC 4DW2L 3CFCH 1JV5A 4NHCH 3EAKA 4XCCH 5DJYA 3ZYOA 3F7PC 3RDTA 3WIIL 3ARXA 4TSCH 4NCDA 3HB3D 8CGTA 3UBXB 3V8OA 2IQAA 2FWOB 2ZOKB 3IJYB 3GSVB 3ULUF 3NFSL 2AJ3B 1A64A 4ZQKA 4NKMB 5JORA 1QLRA 2FLRT 5AYUL 3G5YA 5IT2H 2FGWH 1NBQA 3L3IA 4IM8A 2FJHB 2UZYB 1F4YL 1AKJD 1A21A 1Q0XL 5D5MB 2EDNA 2WIIA 1QBML 1BFVH 1BAFL 1C5CH 5GRJL 3CSBA 3HRZA 5CMAA 3LQMA 5BVPH 2XKNA 3FO0L 3MREB 3SKNA 5I1KL 1RQ5A 5JR1L 3U9PH 3BPOB 1NL0L 5IB5A 4GS7C 5K9QG 5L2JA 1D5ZA 2P42B 2DL9A 2DJ4A 5MEND 3VGDA 4ODVH 1D5MA 2FIRT 2Q86A 2VABA 4CAGA 2J88H 4UB0H 1OGAA 5DURB 3N9GH 5CCKH 3GMQB 4PGZA 5DURD 4XNXH 3MLVL 3FQUA 4XBGA 4M61B 5E6ID 1P5UA 3DVFA 5JXEA 2BHUA 5D2NB 1U3HD 1YNKL 1EMTH 2CKBA 2W59A 5ISZA 3SY0A 1C16B 4GMSL 5T1LD 4YXKL 2X1WL 2W91A 3F7YB 3OF6D 1GZPA 2EIZA 3DMMB 5IVOA 1DBKH 1KIQB 3SQBA 2Q86B 4P2RA 5DJ6A 1FC1A 4OKVA 5J7CC 2EXWD 1BIIA 5JDJA 4XVJH 4QXWA 1JNHA 3W0WE 1SBSL 1NANI 5CUSH 1U8KB 5IB1B 5JIPA 4TNWF 3HI6L 3L5IA 4NZUH 3D85B 4UDTB 4MQ7A 3VWKD 3MLTB 2ZKHH 3CK0H 5D1ZD 3OAUH 5IV2A 3MRHB 5EA0H 3I02A 2XQYG 1KCVL 4DN3H 2P5ED 4XWOC 43CAA 4Y5VC 1M05A 2WBJD 5JLZB 3GEWB 4YFLI 1JI1A 5CGYC 5D72L 4XCNA 5SX4I 1KB5H 3QR2A 1RZ7L 4DWHA 4NZDA 3QIBB 1PKQB 3BGMB 3MYZA 5GRZA 3HMWH 1U2CA 2VLMD 4JRXE 1N5YH 1FRGH 3SCMC 5BVJB 1NLDL 3SE8L 4GG6F 1VESA 4Z9KB 3V5KA 3L3JA 5E6YA 2ED7A 3BDBA 5F1OB 1VEOA 3QI9B 4PJDA 3DO7B 5I8CA 4Z7WA 1UCBH 3O0RH 4WJ5A 5HY9A 1R5VB 3GM8A 1N3NA 4D0BB 4CL7A 2GSGA 3FB8A 5ACZA 4ZAKA 4L4VE 1WC7B 2VUOA 3TJHD 1AP2B 1B2WL 3RWCA 4MQTB 4AIOA 3C5ZA 2CH8A 3BGMA 1TVHA 4LLAA 4F33A 3G04B 1FJ1B 5KG9B 1O0VA 5K9OA 4TN9A 4Y5VB 4NO3B 3LHPH 5JHDB 3WS6C 1BQLL 4OLXH 2J12B 3L95A 4ONGL 4L4VD 5KANG 3BUYA 4XI5D 4POZD 3RU8L 4OI8A 1XT5A 3TGXA 4KHTL 3GJFK 3MQIA 5F44A 3O45B 2PXYD 2EXYC 2EDTA 4L4TD 1NKRA 1P7QD 4JY5L 4APQB 1FC2D 3L5WB 4F8QA 3KPPA 4H8WC 3LPGA 3RVWC 1OTSC 1T21B 2B0SL 3C2SA 3EYSL 4OM1H 3VRJB 5I1DA 1U8MA 3EO0B 3FTGA 4G6KH 4PJIF 5HXMA 1QFWM 4N5EC 1JTPA 2E6QA 3EOTL 5HYFA 3WYRA 3BUYB 4JRWA 3JVGC 5E5RB 5GISL 1ZT1B 5E70A 1IT9L 1JNNH 5EO1A 3D3VD 1A1NB 3KXFB 3UO1H 3GSOA 1PZUB 1QR4A 4FMFA 5JXAL 4W68A 4MJ5B 1C5BH 1W2KT 4G8IA 1NMCB 1Q8MA 3O6LL 5ESAB 1I8MA 4ZXBA 3P2TA 2EEBA 3WL9B 1S7UA 2DQDL 2FJGA 4LVNC 1QSFD 4LEOB 3DRTA 5CIPA 1DQML 2VLLA 1YY8B 1UB5B 4HGKC 1LILA 3T65A 2EH8L 3H9SE 1PZ5A 5HYEA 4OCWH 4QHLA 4HK0A 1QFUL 4AEIH 3PL6C 1P7QA 2BNQB 1N2RB 3SE9H 4P2QE 5KAQG 4OLYL 3D85D 3QA3A 3TH4T 3GMRB 2BSSA 3L5XL 2OMNA 4IRJD 3MLSL 1RVFH 5CP7A 1NAKH 5DJAB 4ZFZA 3G5XA 1Z9LA 2VUYA 3N1MC 3TYFA 3U0WH 3PF2A 3STZB 3CVHA 2YD8A 3UPRB 5IK3B 4OGAC 3PE9A 2PTUA 1HKFA 3QNXA 2AERT 4D2NA 1VPOH 3SBWA 5K9JH 4AIZB 1C1EH 5C0BA 4Y89A 3T4AA 3VRLE 1MCPH 4UNVA 5LBSL 3VXUB 1HHKB 1ZV5A 5EU7C 4KTEH 2CKBB 5ISZB 4U1SA 2E7BA 2X1QA 1U58B 3HR5B 4Q97A 3TVMC 2J6EA 2BVYA 3UMTA 5E99L 1F90L 1UB6A 3HR6A 1XIWA 2FO4B 3QQ3A 3LV3A 3MRRB 5I74B 3T2QA 3HKFA 3U2SA 1MLCB 3QWRD 4OZIF 4NQTA 4RGMB 4S1DC 3FMGH 1FG2A 3I50L 1KB5B 1UYWL 2DQEL 4U1LA 5C0CA 5F7DB 3OG4B 5IB3A 5F89B 1OTUC 3HMWL 3BZFA 15C8L 1K2DB 3ES6B 3NCYS 2D03H 3LD8C 3B9KC 5BV7C 3ZYJA 3HZYB 2Y06H 3JV6B 4P2OD 1YNTA 2JK5A 4HKZB 3C6SB 4OZGF 2P45B 2FATL 4FRWA 2HT4C 5I1KH 5KSAD 1V5JA 1EO5A 3VCLB 4MJ4A 1T22A 4MD4A 1MI5A 3NABL 1IAKA 3GUTA 3RVVD 5F7DA 3RU8H 2DQFA 1H0DA 2NY3C 4N8CH 4R7NA 2AJYL 4YIQB 4F9PC 3IKCB 2X4RB 1I7UB 3ULVC 2H32B 3SE3A 2H6PB 5JQHC 4R7DA 5BW7A 5C9JB 1VSCA 3HE7A 4AG4L 3QJHB 1HQRA 2OK0H 3O4LE 3DV4B 4HFWA 5L0QC 5TQ2L 4TNVK 5C0AE 4L8CA 3NZHH 4JZJA 4JKKA 4AEEA 1A7RH 5FA4A 3ZYIA 2GYSA 3RUGB 3HHRB 1FN4A 3PWNB 4FTVB 4JN2A 3ZLQC 2NY0D 1Q72H 1EO7A 4XBPB 4EIZC 1OL0A 5FAAA 3PNWA 4KUZL 1B0GB 1G7PA 3RPKA 3U4EB 2Y1VA 3I85A 1DQLL 1YA5A 2V9RA 2OXHA 2I5YH 1FQ9C 2X7LB 4NNPH 4HGMA 4G43A 1BP3B 4AQ1B 3E6HB 3O4LD 1N8ZB 4RBPK 3MRQB 3FO2A 1CU4H 4YE4H 5DEGA 4NJAH 1C5CL 4Y19B 1VADA 3S37X 4HKBB 2XA3A 1SJHB 4JVUA 4NQCD 1XGYH 4M9PA 5JA9A 2BNQD 3FFCE 1JGLL 1HYRC 5GSRB 2ED8A 4K94L 3KPOB 3BEVA 5F1SA 3RQ3A 1H3PH 5MEPA 1BOYA 4CN6A 2BSED 3MXVL 3BT2H 3RWFA 4U6HB 3KHQA 4HUUA 1UVQB 1XF3A 5E7FA 3T8XA 4JFQB 1AGDA 4OLWL 4HKBA 5IQ7L 1OAKH 1CGYA 1T66D 1OARL 2DMKA 5E1AB 2V7NB 4UZGA 1HSBA 1YNKH 3MV11 4JY4A 5HGGS 2Z4QA 5D93C 2YUXA 3T65B 3OKLA 5FYJH 2O5ZH 4D9RD 4XB8A 4XX1G 2FX8H 4GKOA 1JFQL 2IPKA 1MCFA 2CR3A 3SDDB 2H1PH 1BFOA 2B4CL 5D7JC 4WDIB 5LKNA 3RGHA 3MGAA 3DURB 4HWUA 1NBVH 4FQJL 4JG1H 4UT6L 2IMNA 1EJ6A 4OCRH 1UM4L 4RRPA 1CQYA 4N1HB 5IFAL 4PGBA 1T0MB 1QR1B 3W9DA 4JG0L 1YZZA 4FXGB 5EORH 4LPVA 4WI4A 1TETH 3HI6H 3STZA 1U91A 3IJHA 4Z5RB 1AI1H 4Y16C 3MUZ1 2F74B 4FQHA 5ALCL 4LGPB 3T3PE 4MA3B 3MFFA 1OAYH 1B4JH 3RUGE 3GKWH 4P4RA 5BMFL 4AIZA 1SJEA 35C8L 1LO0H 3PUCA 2FZ3B 4UAOC 3NH7L 3JUZA 1MJUL 4Z76B 1LK3H 3MZGB 5DJXB 1YN6A 2BVQB 3OR6B 5IJVB 1ZGLM 4C59B 3NMEA 5IROC 5L6YL 2EYTB 3DECA 2FO4A 2DQGH 3DRQA 3NABH 4K94C 1JWMB 3K7UA 4LLVA 3QHFL 4WI7A 4JG0H 5HY9B 3MX0A 2GUOB 1DQTA 2PKDA 2DBLH 4K3JH 1R5WA 4DKFH 2HTLC 2N7BA 5BRZA 1YC8A 4YHYC 4PRHB 1L0XA 5LGJB 1ZLVH 3FOMB 2NCMA 4P4KB 3PP3H 4MJ5A 4M6NL 4P5KB 4PTUA 4FQLH 3QUXD 5D5ME 1UXWA 3TWCL 5IBUG 4PY8J 4GG6A 1U3HC 5ICXB 2A6JB 1FSKB 2IG2H 1XR9B 2BVOB 4NUGH 4HPYL 1UYWH 1G7JA 4WFED 3H9YA 4HK3J 2AXGB 5I1GH 3OR7A 1PSKL 4BZ1L 1PG7W 3GSRB 5DD5H 1X3DA 2G5BA 1U8JB 1ZT4A 4KK9D 2CIKA 4I0PD 3FQXB 1WZKA 3D25A 1JK8B 4ZUTB 4DUXA 2GJJA 3MRCB 5F71A 1M7XA 2AGJL 3FB7A 5HDBF 1CI5A 1NCBH 2VTFA 4TSBH 3MROA 4L4VA 2X1OA 4Y4KB 3K2UH 4JG1L 4UT6H 5BJTA 4ODSL 5CZVL 1CFBA 3G08B 2VKWA 2VKXA 1U8JA 1ZT4B 1EHXA 1ZS8B 5TDNB 4X6DA 1RK0B 1I3GH 1G6RL 1YQVL 1E4JA 4FN0A 3QRGH 3MO1B 4QY8B 1JZ3A 1T20B 3U36A 3GBNH 4LARL 5FUCE 4XRCB 3SDXF 4OLYH 4PJ9A 4C56A 5B21A 2G60H 2JB6A 1BHGA 4P5MB 3T0BA 1YNLL 2B4CC 4Y4HD 4BZ2L 1E28A 4MD5B 4CADB 1XH3A 4ZPVA 1SVCP 5J11C 3PWJA 1INEL 1AQDB 1VGKB 5I8EA 5IVXE 3R1GH 1S78D 2RB8A 4R90H 2LAGB 1ZS8A 3MLYL 4L3CB 5JW3H 3VXNB 3AXLA 4JY6A 1CR9L 4PJEE 2FJFA 4YDLC 4WFFE 5E00A 4XI5C 4LVEA 1PYWA 4XXCC 1NC4A 5D7SH 2FEEL 3Q6FA 4GFTB 1Z9SA 3WNLA 4JM2A 4HG4J 1LE5A 1K4CA 1QSZA 2PXYC 2CDGB 4Y4HB 3UAJD 3LKPA 1OPGL 1S5IH 3FRUA 4HAGA 2VXUL 3PP3K 3TT3L 3SE4A 4YQXH 2V7NA 4H88L 5D9SB 3RWDA 1G0XA 4QTHB 5K9KA 1INDL 4MXQD 4LCUA 3MV8E 4LSRH 3D3VE 5BXFA 3QDGD 4BSVB 3W2DL 5BZWA 1P69B 4BQ6A 1OB1A 1NAMB 4HK3N 1C16A 3CZFA 1J0HA 2X70A 4PJIA 3IAPA 3W2DH 1GZPB 5AZ2L 1K8DB 3ULSA 4CVXB 4OZGA 1QR1A 1JI2A 4YHLH 3TBTB 4HV8B 3UTZA 4OLVH 4TOYH 4ZFGH 5GGTA 2FGZA 3PHQB 5I1AB 2JLLA 3BXNB 5SWQB 3RUGA 1Y6NR 4LCUB 3CFDB 3F5WA 3HZKB 3WNNA 5TFSH 5B38B 4ZUWB 4A6YA 3DIFB 3GHEL 5ITBH 1FLRH 1ZHBA 4NFDA 1D5ZB 5DEFA 3MFFB 1K5NA 1S9YB 4U1HA 2J6EL 3U4EA 5CD3B 1IEBA 1DN2A 3WFDL 1T5XB 4PJ7E 3MTRA 3IAGC 1FBIL 2P5WB 4ONHB 3V5KB 2P8MB 4ALAL 2J1KA 5FGSA 1J8HD 4N90D 1IAKB 3DUUA 3WXWH 1BX2A 4HIIB 4PB0L 2OR9L 4UU9A 5T1LB 5GZND 1A22B 1BFSA 1CFSB 4HUXB 2A73B 4UIMA 2CKBH 5EPMB 3EYVA 3VWKC 4JFPA 4JVWA 2GK0B 1TITA 5I75C 3WS3B 1YJDH 3ULVE 5IR1B 4NQSA 2CDEA 4P23D 3KLHC 4RGND 3EOBA 1EHLL 4UBDD 5JA8B 4H8WL 4MAYD 2J8UE 1EJOL 1FZMB 4I2XE 2X4RA 2X40A 1CDGA 1FBIH 4Z7NF 3SPVB 5C08A 4JZOB 5E2TH 1QYGH 2V9TA 4OAWA 1WZLA 1U92B 5T5NG 5JLZA 1VFOA 2BSRB 2XICA 2O5YL 3F7QA 5SWZA 4LQFH 2Z31A 1CDIA 4ODHL 2FB4L 3KG5A 1WTGT 3SDDA 4I9WD 4F15C 2H8PB 1DR9A 4BH7B 2WP3T 3CPLA 4NNXA 2XZQL 3QCVL 1HINL 1AHWB 5C7XH 4XP1H 1BJ1J 2D7PA 1CBVL 3U4BL 5J9PB 2ZUVA 1DL7L 3QEQE 2R8SL 2LU7A 1EO8L 4HPYH 5HSFA 4PD4J 1RIUH 4LLUA 4X6DF 2HJLB 1NCDH 3S36H 3L3DA 2DQTH 1UT9A 3SO3B 2XZCH 3LVEA 2CJUL 3HCVA 3EJZC 1U9KA 5TGBA 2EYRB 5AZ2H 2Q7YA 1XGTA 5HTSA 2CUMA 4HC1L 3SKNB 4RMWA 3HPJB 5CZVH 4EXKA 3RNQB 4CN4A 4BH7A 1JGDA 1Z0MA 4JRYB 5B3JF 1UKQA 1KCVH 3PQYA 1TJGH 3QDMA 4JFED 3UTOA 3S6CA 4HJGA 1IE5A 4KQ4H 1AGDB 4OF6A 3O3AA 4Q6IA 1JZ5A 4QOKE 4MLIA 4X7TB 4XNYL 1F4YH 4R4ND 1P7QB 3F62A 4HLZG 5HPOA 4S1RH 4YAQB 3LKQA 4Y4FA 1VKXB 4YO0A 3F58H 3SGKC 4KAQL 4LSVL 4M1CC 1M6OA 2VERN 3AVEA 4XCFH 2ITDA 1S3KL 5KVEH 4FFWC 4LSSL 2FDBP 4BFIA 2C3WA 4PJGB 3U6RB 1WT5C 1Z2KA 3MV7B 5BOZG 1GGBL 2EO1A 1F3DJ 5I30H 1R3KA 5CD5C 5AD0A 5J6GB 1KCKA 2AK4B 2IADA 5EORL 3RI5K 1G1CA 4HIJA 3MJ8A 4JRYD 3HFMH 4NQEA 5FYLE 3GBNL 1RAMA 3LEYL 4XCEA 5IFHL 1KT2B 3HZMB 1VKXA 2MPAH 4YO0B 1NLDH 3HG1D 3SE8H 5FXCH 3U0PB 2DJUA 3HMXA 1HHKA 4XP6L 3MRNA 5IW6B 3TVMA 3MRFA 3W0WD 3VJ6B 4BFIB 1A7PH 2IPTL 3LQAL 5HYJA 5FYLD 3TH2T 2A0LD 4FTVD 4Y2DB 1X5XA 3GMMA 4O5LH 5SWZD 3DYPA 3VWJA 1CVSC 1DQQB 3X11A 2BMKA 4Y1AD 4M03A 3JV4A 1JTOA 2RHEA 1N3NB 1AHWC 5D7KD 5TE4L 5ACLA 3MLWL 3BIBX 3ETBF 1S7VA 3LS5H 1CXIA 2UV3A 4EDXA 1RZJH 3RGVA 3K74B 4AENB 1XR8A 1C7SA 3P4LA 5ALCH 1T66C 2K9UA 1AXSA 4K9EL 6FABL 3P0GB 3AS0A 5C09D 5KG9A 3BO8B 4QT5B 3T0EB 1J88A 4DCQB 4FQ1L 1IKFH 3K8KA 4WI9A 3DYOA 2G75A 2VDPL 4PR5B 4TPRL 5IK3A 2NY5H 4UT7H 3ZL4H 4FQ2L 5H37G 4D3CL 3V52L 4JKWA 1V3LA 2EDBA 3LQAH 1XGQA 1CL7L 2IPTH 1RURL 1RUPH 1SEQH 2JIXD 4PB9H 2P5EA 4QRRB 5C0FA 1MPAL 1Z6JT 5D1ZA 5B8CB 2YEZA 3JWOH 1OHQA 4WUUB 2EZ0D 4G42A 4KPHH 4OIAA 2XNAA 3ILQC 4ZUVA 1V7NL 3QO1A 1JGUH 2H32A 3T77A 4EJ1C 4Z7OF 4ZNCD 5J1AA 1CDCA 5GRVL 1YYML 1D5XB 5FYJL 3QHZL 2MNUA 5IHUH 5D1XA 2XOTA 3OXSB 4HIEB 4PJBA 2YRZA 4QO1A 1MH5A 2CQVA 5LGKA 1MCIA 2CDEB 3RWEB 1A7RL 5INCB 3BQUB 1RIUL 4DN4H 4MMXC 1Z0NA 4WHTA 1Y6MR 2ZUQB 4PIRF 5SWZE 3E6FA 3BQUD 5HI3C 3VXOA 5B39B 3QIUB 3RIAF 3MJ9L 1ZEAH 2CRMA 5D2NE 4CW1A 2XWBA 3RWGB 5CEXA 2EC9U 1MAMH 4XVTL 2W0FB 1T5WA 2AV7A 1OW0A 4WFGE 4HQQL 4WW2F 3TA3B 4X6DB 4LCYB 3WUWA 1NKOA 1YEFH 3ULUC 1ORQB 5FM5O 1MNUL 5M94B 3LB6D 2DQCH 1PZ5B 1J86A 4YE4L 1MFEH 4XC3H 2O61A 3GSUB 2O5XH 3LKRA 2R2BB 4IRZL 4NBZB 4C58B 5EN2B 1OT1A 2YA0A 3GI9L 3VGFA 4E0RA 4O9HL 3VU2A 1QNZL 1KJ2B 5I1CH 2DBJA 1GGUA 5BO1L 1NDGB 1BM3H 5SWSB 4IHOA 1GGBH 5GGUA 5IKCA 1NC2D 2FWOA 4G3YH 1G6VK 2BDNH 1LDSA 4TTDD 1JGDB 1JHKL 3RL1B 4KRMB 2V9QA 1YEGL 1X4XA 1K4CB 4MA1C 3O3DB 4U1JA 4H1LB 1ACYH 4JFDA 5GGVY 3NN8A 1KUMA 3D2UD 4QRPB 3T4YA 2DN7A 4TUJB 1XF4B 3D85A 4HFUH 5F88B 2V2TB 3IU4L 5J13C 3QUXB 4L8SA 1G6RA 2UUDH 5IF0B 3ALXA 4MNHB 5C0BE 5GS0C 5JO5A 3VFMB 1HZHL 4KHXL 3VGEA 4OF0A 1EEZB 1QYGL 4FXLA 4L5FL 4JR9H 1QLEL 2DJSA 1TMCB 4WHCA 1JNLL 5AAMA 1UM6L 3T2PA 5L9DH 3R0NA 3V79C 4CMHB 1WEJL 4P0DA 2AQ1A 1K8DA 2NY1B 4RISH 5EU7E 4F7TA 3DV6B 3MR9A 3ARFB 3SDXE 1WCQA 5KTEL 3GSNL 1AQKH 1J8HA 1DUZA 1I1FA 5TDOB 5BXFB 1S7WA 4X98A 1DP0A 2DQIH 4K7PY 1MSPA 3QI9C 5HGDA 3FFDB 1FVCA 3HC3H 3WN5A 3QXDB 3MCKB 4JN1L 4FZEH 3SY0B 3PDDA 2A74A 1OSZB 3SDAC 3S36L 2EH7H 4AL8H 3TFKC 5I0ZA 1OAKL 3FQUB 1KCUL 2WSKA 4GRWF 4F7CA 3REVA 1QFUH 4AEIL 3PWUB 5IM7B 2LFGA 2ZSWA 2WAHA 4X7SH 4OFYD 4A6YB 3MUGA 4TVSa 1CD0A 3DX8B 5KBNC 1GPOL 5FYJD 1AGFA 1F4WH 3MLWH 1YMME 4HJ0C 3UAJC 2B5IB 4LPCA 4U6XA 4GRWH 3CFJB 3EOYG 3RGVB 4UINL 1EVUA 4DOHE 3GK8L 2QKIB 1WFOA 4X4XA 1UG9A 5C6PB 3WUZA 3VXRB 2WANA 2C26A 1I4FB 1S78C 3CH1A 3EGSB 1RZGB 1GGCH 4UOW0 3AREB 3CGTA 3P4NA 2VN7A 4Z78A 2R1XA 5CIPH 3V2AR 1MQ8A 1WC7A 2J4WL 5C0FB 3QUML 1LDPH 2JELL 4NM8L 3IXTB 1H3UA 4WUUA 4QRPE 3TBWA 4WI5A 3B3IA 4TQEH 2VYRE 1F2QA 4CKVX 3QI9A 1RJZA 4RRPG 4X7DC 5DJZA 4NO3A 1IC5H 1JPTL 4U3XA 3NZHL 4X8JA 3VDAA 1SJHA 2F8VA 4HIEA 4PJBB 3WEXB 3KS0H 4NBXB 5CJXC 4HIXH 2BY2A 2FX9L 3AM8C 4U1GC 3INUL 4X7CC 5LWYL 4XPBL 4N90E 3MJ7A 5BRZB 3UX9B 4YX2H 1MUJB 4GAJL 2R9HD 5LGJA 3QEGH 3RDTD 5F96H 3S97C 3S3JA 1G7QA 4O2CA 2BP3A 3KPLA 4OCXH 5E6IA 1BLNA 4BZ1H 1QBLL 3P4MB 4YNYB 4XAKE 5K9JL 3BRFA 3DGGB 3FOLB 3HE6A 3L3HA 3TO4B 1JZ4A 3AREC 2HJFB 4HIHA 4N0CC 5T3XL 4CN1A 1E4KA 1UM5L 4KKAD 3WBDA 2ZG1A 2ATPB 2HH0L 3FQWA 4XP4L 4M6OH 3X3FH 2EH7L 5HHOB 1DVFA 2JJWA 3IVKB 1I9IL 4P5TC 4MD5A 5HI4D 3D3VB 4XZUA 4KJYB 1EPFA 4RGNC 1MVFA 4K3DH 4KC3B 5IESL 2GJ6E 3B43A 4WENB 3WFCH 4P46A 1ZAGA 4PRAB 4JB9L 4Q0XL 3P30L 1FO0B 2X4QB 5DO2D 3X14B 5MENA 2I60H 3AS3A 4PJGA 3U6RA 4FXGA 2D7OA 5CGYD 2XKSA 3WJJA 4Y4KD 4IRJC 2KPNA 5JOEA 4NQDE 5CINH 4G8FA 3T0XA 2WWMD 4GRLD 5CGMA 4J3VA 4H20L 3OKMB 4EXPX 2Y36L 3G6JA 2AQ3A 3IU4H 2X9XA 2V17L 2XTJC 1IQDB 1A6ZB 5CP7B 5AUMB 4O51B 1T1ZB 5CAYB 3RWIB 5DJXA 1UQSB 1OAZL 2WMPA 2OQJA 4BH8B 1AR2A 1KGCE 4PYHA 1B4RA 1AIFA 1S7RA 1UJ3C 3LZFH 5IW3A 1XEDA 3U0PA 2FBOJ 5AWNH 1A0QL 2ZOLB 2DYPD 5F7YC 4AYFA 1NBVL 3O9WA 1NUFA 4S2SA 2XY1A 3DX9B 4L8BA 2I24N 4J2XA 5DZLA 1A2YB 3QXTA 4S1DD 1HXMB 4X6BB 1KTDB 3SDCA 1CGVA 3BO8A 5TQ0L 4EI6A 4DZ8A 2DQGL 3O41B 2NY4C 4MAUL 3W39A 3KPNB 3EO1B 5C2BL 4ZS7L 2VXTH 4ONHA 2OXGA 2YPLA 3C2AH 3CFKA 3GHEH 5H37H 5IQ7H 5C07A 4ZS6C 4N5ED 4GMSH 1OAUL 4MCYB 4Z0BH 3CZFB 1KNOB 4PJIB 3VG0H 3LEVL 4JFYA 3ZTJH 2IG2L 3O11B 4DZ8B 3O41A 5FF6A 2VH5L 4NQVB 3NFPB 1H3PL 4ORGB 3VFNB 2IGFH 4CU8A 1JMXA 2VDLH 3OKDB 5IR1A 3H7BA 5KS9B 3SE4C 1PEZA 4WCYL 3VXRA 2GSIA 4ODVL 1G7MA 1CS6A 4OCRL 5D93B 5C07B 1CDHA 3MRBA 2YSSA 3S9DB 5MI0C 3B9VA 1U93B 2BSRA 2H6PA 1CLZH 2IFGA 5DD0H 5IJKA 4JO3H 4JRYE 4EQ2A 5IEKB 5L88H 2EDJA 4J3WA 4PJFB 1YDPA 4XPGH 3WNOA 4HXAL 5EC1A 4XPFL 1DSFH 2UWEA 1BQLH 4XNUH 1MY5A 5I74C 2AKRA 2CLZA 3REWB 3MRDB 5HHPA 4UUJB 5D7IA 1ZEAL 4XVJL 2JIXB 2NYYC 2NY0C 4L9LA 4RMSA 1I1AB 1S3KH 1B2WH 2AAVA 5IJKC 4EBQL 2F19L 3HCVB 5I75B 4PJ9C 1NDMA 1EEYA 3SGEI 3MGTA 3H0TB 5MHSE 3RZWA 1KC5L 1H5BA 3PJSB 2KKQA 4IMKC 3QDMB 4OIBA 4XXDB 3I9GH 1JHKH 1CFVL 1YYMH 4M7LT 1RMFL 2X05A 3VH8A 5E8EB 4LQ1A 1U8HB 4PY7B 2N56A 4LBEA 1FNSH 2I9TB 1F6LL 5E08H 4P49A 1A5FH 2R69L 3RI5F 3VI4F 4OI7A 4K2UH 4KY1L 1FFOA 1S8DB 1X5GA 5GRXG 4H5SB 5H2BB 4WFHD 5EOQL 1OWRM 5GXBB 3C5ZB 3EOAB 3JSSA 5KSAC 3MV7D 2IAMB 3JWOC 5I16A 1TCMA 4LDEB 5D71H 2ITDB 2BY1A 4R96A 4ETQA 1QLEH 3OKOB 5KSAB 2JE8A 4TVPD 2QKIA 4OZGB 3RA7L 5I1JH 5IBLD 3MSPA 5IFJB 4NDMB 1RI8A 1YEFL 1LO2L 5H8DA 4MZ2A 1QBAA 1A4KA 3P9WB 1KCSL 4S1SL 3V95A 1QZ1A 2EYRA 3OJ2C 3L1OH 2UVFA 4ZUWA 3DIFA 3T2OA 1KCSH 1YEDA 2HT4D 2CO7B 2V7HA 1FVCB 3WN5B 4LCWB 2Y5TB 3V6BR 3FZUD 4PRHA 5IEHB 3WKMH 4N8CL 2EKSA 1VHPA 2BDNL 3MRMB 5KVDH 4YWGH 3I6KB 1WUNT 1CD1B 5TQ0H 3ULVD 5JTWA 3ARGA 4M6MH 3G6DL 1N59A 4J4PD 2NY1C 4PJFE 5HGDB 5I19L 4KH2A 1DLHB 1AD9A 4G8GA 1FL3A 3IU3A 4G8GE 3DX8A 4HUVB 3EIFA 4UV4L 1OF2A 3D0VA 4WHYH 3TN0B 3QUMB 2IGFL 2AXGA 5L2KE 4Q7DA 2DTML 5D1ZC 1N26A 5EC2B 2HFEB 1HEZB 5DHVA 3U7WL 3DRTB 1ZT7B 5F9JA 1QVOA 4X4XB 3SDXA 5E6IB 1FZKA 4QHUA 3MNWA 4XMLH 1WIUA 4OZFB 4M61A 2A9MH 2HKHH 3TBVB 1DN0A 2CIIA 43C9A 4QXUH 3DX7A 4OCXL 1FNGA 1IAOB 4LOUD 1T2QL 1HN1A 4JO4L 5M95B 2EO9A 1ORSB 3QO1B 3T77B 4UILL 1C1EL 3FOMA 5LG1A 2NLJB 3QDHA 4XNUL 1ZA6B 4R8WL 2NY7L 4HGWB 3BPOC 3KGRA 2VR5A 4WW1B 5C6TL 3MBEB 5D7JB 4PRPD 4ZAKC 2EYTA 1VACB 3L95B 3ARDD 1T7XA 3RGVD 2UY7A 3AREA 4NHUB 5IG7A 1HQ4A 5JW5A 1IAOA 2ZSVA 4ODUB 2CK0L 2OL3A 1RUPL 2YD3A 3KPPB 4TSAH 5E4EB 4NFCA 2DLFH 4YPJA 4G8EA 1XF2A 5HVWA 4TVPL 4FG6C 3BKJL 3JTSB 3U0TA 3ARWA 2R1WA 3FZUC 1FVEA 5D2LB 1KLUB 5DK3A 4WY7L 2E27L 5JW4M 6FABH 5C6WH 1TDQA 1HIMH 1BQUA 4LIQL 4NNYB 4ODWB 4FG6D 4HH8A 1PQZB 2VZ1A 4KAQH 4LSVH 3VFSB 4D9QD 3QNZB 5FM4A 4ODUA 4YX2L 3HC0A 5IB4A 5GGVH 4XH2B 1RZKH 4Y4KA 3RWCB 2GI7A 3INUH 1P1ZA 1RUKH 5BZDA 3B5TA 5FGBA 2MMXA 1X7QA 5EIIB 4OLVL 1AGBB 4TOYL 2XN9A 2IPUK 4JFEE 4ZUTA 2VXQL 5I2IB 3FB7B 3ZDZF 4XHQA 1MI5E 3MO1A 5C9KA 4R0LC 5JXEC 1MRFL 2YMXH 1U8PA 5L8KB 4Q6IC 4QRUA 1DQJB 3EOTH 3FRPA 3TNMB 3VXMD 1X44A 1VB9A 3VFSA 2ID5A 1JPSH 1XMWA 1RZFH 1CYGA 2NTFA 3BEWB 4OCSH 4KZEH 3G08A 3WJLA 5I8KH 1XIWC 4CW1B 5D7LB 4ZSOE 4PRHD 3FHQA 1I1RA 4ONFH 4FQQA 1S9VA 1WAAF 2AJUH 3PABA 5HHNA 5E94B 4NO0B 5KW9L 4OD2B 2P5EE 1HSAA 5D96B 5E00B