4LLQB

Structure of redesigned igg1 first constant and lambda domains (ch1:clambda constant redesign 2 beta, crd2b) at 1.42a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
b'PKAAPSVTLFPPSSEELQANKATLVCAISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAAWSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mutated CH1
molecule tags Immune system
source organism Homo sapiens
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
total genus 17
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llqB00
1DANT 1JRHL 4FQHB 5IW6A 3HAEG 3QWOA 4NKQB 4G9FE 1PY4A 3ECBB 3F7RA 3QAZB 3KXFD 3MBED 3KYNA 1ORQA 1TQCC 2F53B 3RVTC 3DIFA 1HXMA 5MEQB 1YEIL 3IDXH 4IS6B 3E1F1 2VLRA 4CJ1A 5IW3A 3NCBB 3HCVB 3QUYB 3LEVH 4JGMA 4XBEL 2FX9H 4UT9H 4LSDA 1A7QL 1BQLH 2WWMD 2H2PD 4JQXA 1LO4L 3PG2A 1FLRH 1YEFL 2DOCA 4E42A 4P2RE 1X5HA 4M6MH 5EIIB 3P4NA 4L3EE 4CJ0A 1YEHL 1QR1A 4JPIA 5KJRH 2FHBA 4FQCL 2A6JB 4ZOEA 3O6LL 4M5ZH 3CSYB 3PHOA 1S9XB 4I3RL 4K3GA 3V4VL 1FL5B 4GUPB 3VXMB 3RIAF 3KPNB 3GIZL 5JNYA 3FQRB 2NY3C 1YZZA 5E6ZA 2X05A 4LKXA 4ODWB 1QR4A 2IGFH 4LMQE 3MV8A 3V6BR 2XIDA 2VXVH 4L4VB 4P46D 1QSFD 1MCCA 4JFOA 3MBXH 4EN3D 1G6RL 1J18A 2VDRH 5EO9B 3C5SA 4W68A 1FSKC 3G9AB 3KLAB 1EA9C 5DC4B 1KULA 1I9EA 3LHPH 5C2UB 3FONA 5KW9L 5DMKB 3ESVF 4WI2A 4LAQL 2XN9A 4KK5D 4L8SA 4BSJA 5T3ZD 2CO7B 5J6GA 4OIAA 3LKOB 4OCRL 2W9DL 4K3EL 4AIZA 2NY6B 1MRCH 4M5YL 4LLUB 1DZBA 3RVXC 3S36X 4Y2DA 4Q2ZA 3V4PL 4KQ4H 5L2JA 4HUVA 1Q9WA 1GGBL 1AR2A 1PG7L 2VXSH 3OV6A 2R29H 2OZ4L 4WUUD 2AXGB 4YO0B 1S7RB 5FYLE 1FFNA 3SKNB 2QKIA 3U0TA 3AMKA 4NZJA 4AYFA 1CICC 4HEME 1QFUH 2UWEA 4FZ8H 5TH2B 3IVKB 4NRZB 1UXWB 3RTQD 5H94B 1NAMH 5GS0D 5T5NG 3VU2A 1PQZB 1J7VR 2ITDB 1T7ZA 5D7KE 5A2FA 4YHOL 2DI9A 3FOLA 3D0LB 5EA0L 3NACH 4FXLA 4PR5B 2X2YA 5E8PA 1IM9A 4LCIL 1NEZG 2J4WL 2RFXB 3QI9C 2VDOL 1QFUL 3BH8B 1MY7A 4OCXL 1LNUA 2QQKL 1IBGL 5I8CB 1CIDA 1IC4L 3MFFA 3CUPB 4XCCH 1H0DB 4NQDB 3MCLH 5DMKA 4DZBA 5FYLD 4EDWL 1K85A 4BFIA 3QPQD 4BZ2H 2YBRA 2DKSA 3DHJA 3G04A 5TF1H 2BNQE 3ARQA 3QWOB 4TYUA 5GGVH 5ITBL 4ORGA 5F21B 4JJ5A 1P4IH 4RMVA 5BZDA 1T66C 4KROC 1OARL 2HT3C 4M7JH 3ES6B 2Y5EA 3ARGC 4TVPD 1AXIB 5H37G 4LCYA 2E7LC 3WXWL 4K7FB 2XQYG 3AU1A 2VLLA 3ZDZF 1IGJB 3F58H 4K8RH 5CSZA 4YHYB 1EJOH 1UJ3A 1URLA 2KBGA 4I0PA 5T5FH 3ZKNC 1DLFL 3SDCA 3DUUB 1WSST 4GW4B 3U0WL 3V5HB 4YPGB 5IEHB 1ZT7B 4ACPA 5L2KE 4L9LC 1AGEB 5J6HA 4QYOA 1NCCH 1DUZB 3OQ3B 3HFMH 2HWZL 4XNMA 1I1YA 5IGXL 1U3YA 2VUOA 3EYVB 2IGFL 1EBAA 1TCRB 5DZLA 2AJYH 5TDNA 1DVFD 4U6XA 5HI3D 1GC1L 4LPXA 3KPQB 4OUUA 1B9ZA 4RMQA 4HIHB 2EC9T 3HC4H 3K4DA 2DQTL 3PP3H 1HK6A 2A73B 1B0RA 3I6KA 2C3VA 4OF5A 2GTZA 2YZ8A 5C1MB 1BF8A 1IKNA 3RNKB 4H88H 3PWNA 1C5BH 2DQGL 5L0QC 5C2BH 4DKEL 2H1PH 3M45A 4Y16A 4L8SC 4GXVL 2XTLA 3VFTA 1FL3B 3FB8B 3MO1B 2F5AL 4WW2C 1A7QH 1BQLL 5JHDD 3MRRA 5IROC 4O2EA 1JGEA 4HX1B 2ZCLL 4YK4B 2EDOA 1JYNA 1F90L 1BAFH 3MJ9H 5KSBB 5MEPA 5TPWL 3EYSH 5IEKA 5IVXE 4ODXA 2EYSA 1ZLWK 2EDYA 2EDTA 1UM6H 4RA3A 1A6VL 1FC1A 2ADIA 2R15A 3B9DA 3EJYC 5BV7H 1YNKL 4KK8C 4M9PA 2HLAB 5ANMB 5HHMB 3QCUL 2BMKA 4PJ8A 4PJAA 4PRPE 1W72A 3ME0A 3NCMA 1MPAH 1UKTA 1ZV5A 5ENWA 1KPVA 2DWEA 2DB8A 4XTRC 1S7WB 1S7TA 3DRTA 4PJEA 5DJ8B 2DMKA 3RA7L 4PBVC 4A2LA 5ID1B 1SVZA 1OF2B 4HBCH 5BMFH 3C87A 1R6VA 4PJCF 1ZT4A 2CXKA 4LSSL 4PJDB 3SO3C 1Q1JH 5HJ3B 2Q86A 2X1WL 1L4IA 1ZEAL 3ARGD 4ZPTB 3RIFK 4QRPD 3LKRB 4U6XB 4OKDA 3O3EB 1NMCC 1K4CB 3G6JF 1NGQH 2NY1D 4ISVB 3QIWA 1T4KA 2P5EE 4BH7B 3Q0HA 1BZ7A 2IH3B 3O6ML 4U1HB 2IALB 2BZDA 4JAMA 5J4MA 1G9NH 5E1AB 1KOAA 2XACC 1TVHB 5DJXB 4IRZL 3EBAA 3MV8D 5IOPA 4ONOA 2DQDH 4P23A 4TUJA 4DVBB 2QQNH 4XPFH 5DD3L 3QUMH 4OGAD 4HIXL 2BSTB 3O3DB 1U8NA 4UDTB 3VXTB 4OBSA 4M6AA 4MA3B 3T0WA 4F80A 2VN7A 2MJWA 4Z95L 3B9EA 5T3XH 5JW4Q 1DVFC 4RMWA 4ORGB 1ZHNA 4LRIA 1JI1A 3GMLA 3ULUC 5BW7C 2EE6A 4NFBA 2ADJA 4W81A 4ODVH 5I8OH 1G0DA 5IB2B 2JB6A 5ALCH 5TDPA 4TVSa 4Z7VF 2C4FT 4JFFE 1K8IB 4KK9C 4R4FH 3S36H 3T1FA 2CIIA 1U8LB 1JE6A 5KANG 2EEAA 3W39A 3CMGA 5C92A 2EKJA 1K8DB 1EVTC 3O2WL 2GAZA 1R5IB 3U6RA 1WAAF 2YPLB 1EZVY 4Y4FD 2IEPA 4HT1L 4OGYL 4I9WD 4JN1H 4Y5VC 2D7QA 5KS9B 4L4TB 5DVMA 2HTLD 3S34H 3OB8A 5H94A 5TE4L 3E8UL 5ALCL 1I7TA 4O5LL 4Y5VA 4LEOA 2V7NA 1V7NL 3UTOA 1INDH 4NNYA 3U6RB 1YN7A 1D5IH 3NA4A 1NLDH 2GJZB 4WW1A 3SGEI 3WJLC 1LO2H 4D9QE 5I1IH 4NZTH 5DVOA 3T0VA 5T1MA 3KXFA 3MBEA 3ZLQC 4UZGA 5F1NA 1YY9D 3BAEH 3QDJE 3VXRE 2RFXA 1A7OH 3HE7B 4CNIA 3MA7B 5DD6A 4GKZB 5I76B 1DBJH 4ZFFB 1U8MB 3MV7B 5JQ6H 4P9HL 5T1LA 3ZZ1A 3UJIH 3FZUC 5DUBB 2ADGB 4KKAC 1KCVH 2ED8A 3OR6A 3WFBH 4Y4KB 4G9DA 3WHE0 1JHTB 4YHML 1NUDA 4P3DB 5BS0D 3K8LA 1MRFL 1XCQB 3HZMA 4PTTB 2VE6A 3O6MH 2MCPL 5B3JF 2OK0H 3UC0H 4NQVA 1T21B 4PTUA 3DTXA 3G6DL 3JWOH 4ZAKA 4KJWD 4R7NA 3QWQB 3Q1SH 1OTSC 2MKWA 3VE0A 3TNMA 5AD0A 4U4BA 3REVB 4K7FA 1OSZA 4HKXB 3D9AH 4JZJC 5K33A 1E4JA 5BMFL 4PRID 2K9UA 5FGCB 3U4EB 5D7SL 2P4AB 1MLBA 2NTSP 2Y07L 4JFFA 5EBGA 4HHAA 4OLYH 4FQQA 8CGTA 2BSED 1FIEA 4IDJL 2AK4B 2IJ0C 3WFEH 4AT6B 5ESQB 4D8PA 4M3JA 4N8CL 4QY8B 5HD8C 3HHRB 2XZQL 2VC2H 3EO0B 3T3ME 1A6VH 5JXED 1AP2B 3O4OB 3CDGA 3QIUD 2AV7B 3CFIC 3WS6C 2GAZB 5INDA 3VFVA 3C09B 3BEWA 3Q5YA 5F3HB 1A6AA 5EO0A 5GS1C 4PJ9A 1P7QA 3MJ6A 4L4VA 1I85C 2ARJA 3D18B 4QTHA 4GG6E 1U42A 1KCLA 1P7KB 4IJ3B 2G2RB 4E41A 5ERWA 3WIIL 2RGSA 1RD6A 2GEEA 5MERB 1NCTA 3W2DH 3JXAA 3PWVB 4F7MA 4FTVB 1TJIL 2WBWB 1E6JH 1CXHA 4ZO6A 3BO8A 5I0DA 2BXYA 4PJFA 2XZAL 2OS7A 4K2UH 1YECL 5BV7B 4MSWA 3IFLH 2P7TA 4X98A 3P4NB 5HYQB 4C4KT 4YPJA 3MLXH 4XGZA 4MXQC 3TM6A 5CD5D 5GSRB 3S5LB 4LHUB 1EO7A 2IH1B 3I9GL 3VFTB 3CCHA 1VGKA 4I3SH 1N6QL 4NJ9H 4PS4L 2XOTA 2ZSWA 3QG6A 3FRUB 1I9RL 4RMSA 2XA8H 5I71B 3SPVA 3PL6D 1MFCH 5HDBE 2ICEB 4K3DH 3U0WH 4PP1C 5ITFB 1KC5L 5CEXA 1CGSL 4HUUA 3HAEH 3F58L 4K8RL 1ORSB 3IJYA 3CSGA 4G8GB 3H9SD 2XWJB 1DN0B 1T22B 4FFYH 1QLFA 2PYEE 3WS3A 4HH9A 5C9JB 2ORBL 4HDIB 3E6FB 3H9ZA 3T4AB 5C6WH 1WITA 4QRSA 1DP0A 5GS0L 1D6EB 3HMXH 4LF3A 4XHJC 3BPOC 3AC0A 4LLYB 4QHUA 4FQIH 4Z0XA 4ELMB 1RPQA 2WWKT 3I75B 2NZIA 4GQ9H 5SWZA 4MXVF 4Z7OE 5I1JL 3MR9B 5D2NA 1CE6B 4LCWB 4K07A 2XTJD 1R5WA 3FQUB 3EDEA 1MIEH 1EXUA 1W0VB 3AU1B 3IU4L 1HXMB 2X4SA 2AEIT 1JGUL 4NT6A 4LSRL 4P99A 4XMPH 1YYLH 5DURD 3SO3B 4TUOB 3FQWB 4PYHA 4XMKL 5I1LB 1F4XL 1J1OH 4FTVD 3I85A 1Z0NA 5KSAB 1KN4L 4CMHB 4LSVL 3ZT6A 1TJGL 4EN3B 1UB6B 2IALA 2VDPH 3QQ4A 1JPTL 2VLKD 4H5SA 1WCBB 1W8OA 3V95A 3N85H 3BPLB 3VMOA 3L9RB 1H0DA 1ZVSB 3B5HA 4FOMA 1IRAY 2AEWA 4CGTA 4LEXH 3F12B 2FIKB 1U92A 4U33A 3UYOD 2ICEA 1LMKA 1J9CT 3BDXA 2V5YA 2R4RH 4LNVA 3VWKB 4OM0L 1G7QB 3NH7L 4G8IB 1K6QL 1P84K 3MJ7A 3MJGX 4RISH 4WUUB 1MQ8A 2BNRD 3W0WE 3RZWA 3I6GA 1D5ZB 1LEKB 5FO8B 3NCYS 3JWNC 2ZOKB 3LD8C 5IK3A 4HS3B 5IHUH 3LS5L 4KJYA 3P0GB 2OMNA 4K3EH 2YA0A 4AEFA 5C0CA 3KS0J 1UB5B 3G5ZA 1AGEA 5AAWA 4X80H 4BH8A 4MB5A 3O6KH 4QRQA 4Y4FA 1CTOA 1Z3GH 1J8HD 1REIA 3FT4A 2BOBB 1CR9L 1QSVA 1IM3A 3UZQA 1U3HB 4BUHA 1XGPA 3NTCH 4MQ7A 2R8SL 2ESVD 4LHJB 1LK2A 2UYLB 3V0AC 3E0GA 5KVEL 1MJUL 1O7SA 3V52H 3F62A 4P0DA 1T89C 5FFLA 2DYPB 1PKQE 4HQQH 5FHBH 3UTSD 1SQ2N 5E1HB 1U6AH 5IV2A 3MXVL 1LK3H 2K3TA 4RFNB 2Q86B 3WFCL 5M94B 4OGXH 3EJZC 4YQXH 1BWMA 3HZVA 2WBJB 1LO0L 1SYVA 3X3FL 3RUGE 5HHVL 2J2ZA 3PQYE 4R26L 5ISZA 2V2WB 2ZSVB 3O6FC 5I76A 5IKCA 2V2TB 3KYOB 2WIIB 4P23D 1W0WB 1XMWA 1JGVL 4XVSH 5A2LH 3IDGB 1VKXA 4L9LA 2Z35B 4HUXA 3PWUB 3RWJB 3CSYA 3PHOB 3G5VB 2P8MB 5IFJB 4AEHL 1FFPB 2FX7H 3D6GA 5IHZA 4G7VH 3QR2A 5IF0B 3P0YH 1NGWB 1NAMA 4WV1A 4ZFGH 4KK9D 1C5CH 3KPMA 1OAYH 4OIBA 1DSFH 4L8CA 4HX1A 4TULH 1X5ZA 4JDTL 5EC1A 4NOBA 4NNXA 4PGJA 4O51A 1U8QA 4YNYA 4KI5D 4GRMB 2Y06H 4BFIB 2YXMA 3WBDA 4M8QA 5HHXL 2P47B 2VZOA 3DVGB 2WBKA 1MI5E 5CJ5A 2OMBA 3K4AA 5FV2A 1P7QB 2FYYB 1A6ZA 4X6CB 1QFPA 1F8TH 3V5DA 1I1FA 3C60D 2I9TA 2BVQA 4MJ5B 5BCAA 3IGAA 4KK6C 1CZ8H 4LRNL 5ANME 5HHME 5KANI 1T5XA 3EYUH 3M1BB 4UV4L 5EBLB 5IW6B 2BHUA 5JDJA 4I18B 4FQXB 1QO3B 2A2QT 3EYOA 3NOIA 2B1AL 1SYSB 2XQBL 4GW5B 3VA2C 4PJIF 1N4XH 3VXNB 5DK0B 2DM3A 4CBPA 3OJ2C 3JV6A 4U1LB 1KPUB 4KWUA 1UWXK 4NFDA 2HRLA 3MO1A 3FFCD 4LHQB 4L4TE 2D9CA 5EU6A 1IKFH 4O2EB 4L8DA 2J3SA 1C5DB 5F7WC 4F9LA 2ZPKL 5E08L 1OP3K 5E24E 3DX8B 3T0EB 1KTLA 1M71A 3MV9A 3JVGA 2NW2A 4M43H 1B0RB 3I6KB 1TVHA 4YHKH 1MCWM 1OTUC 4GMTH 4KROD 3L3HA 3PGDB 4DQOL 3VGFA 4UB0L 2A6JA 4D2NA 4JN2A 1OGAA 2YPKA 4PJAF 3BDBA 5DMYA 5BRZE 5EC1B 1SEBA 1U2HA 1ZHKB 4Z76A 2DLIA 4GMSH 5I1AA 4Q58C 1NC4B 1WBZB 1A7NL 5K59E 1A5FH 1ZT4B 1U3HC 3VW3H 3SOBH 2NW3A 1L9NA 4CVZB 3WNLA 3ARBD 2PO6C 5D1QD 4W6YB 1I1FB 1UVQB 2F15A 5ITFA 1EEYA 1JNHA 2CKBL 4YHIA 1WEJH 5FYJU 3TEUA 1JPST 5TE6L 3L3IA 1XGRB 2MWCA 3MCKA 4P5KA 4WJ5A 3QO1A 3S4SG 4DEPC 3QHZL 5BZDB 1BVLA 3O3AA 2HFFA 2JJSA 1QBMH 2YD6A 1DBKH 1A4KA 4PTTA 1FBIH 3G08A 3QNXA 5K9JH 1EUTA 4EUPA 2IQAA 2DLFL 4LCWD 4X5WA 5IVZB 4ZUTA 1I1AC 1FRGH 3FFCB 1F6LL 1R3LB 1A14H 1HQRA 5LGHH 3CDYA 1M05A 5F1SA 3PWPD 1IEBA 3WV0A 3C6LD 1RJLB 3X11B 3T0ED 2YD7A 5FHAL 2ZP0T 1KLGB 4XP9L 1WFUA 3MREB 1FVEA 4YEEA 2VLKB 3LPWA 5F8QC 3D2UB 1RSFA 3H0TA 4KGLA 3BGAA 1X3DA 4LNRB 3T0BA 4OUUB 3STZA 5ESVB 2FATL 1X5AA 4ODSH 3SKMA 2UZIH 2YPLD 3SGDH 5FYKH 1A0QH 1MJ7L 5BO1H 2W0FB 1UA6H 5GRVL 1X44A 4WTXA 1IAIM 5E03A 3NVQA 4LPUA 2Q8BL 2YPVL 2NX5E 4DQOH 3WLBA 4N1EA 2OL3H 4U6HA 1HI6B 3MLTA 3Q48A 1KACB 1FNFA 1FGVH 1EDQA 1FG2B 4F7EB 1HXYA 3T0EE 4ZG1A 1U8IB 4JFQA 2PETA 4G6JL 1NBVL 5DDHB 4KPHL 1SJHB 3QPXL 1X6LA 4IMKC 5M7QA 3ULVL 5IESL 5D8JH 4AMKL 2A6IB 1N4XL 4N5EC 1JV5A 3HNVL 5LBSH 4YK4C 4JHAH 4DAGH 4UINH 5CIPB 3SJVD 5E9DE 2FO1A 5KAQG 3DECA 3RNQB 4PRPA 4IBLT 4HULB 3MYZA 1CZ8L 2BVOA 3HZVB 5ADOL 2Q1EA 2A77H 1D5XA 4F33B 4JRXB 2G5BA 2EECA 1P69B 1ZANL 1RZKL 3GSXB 4OZGB 1JBJA 4L3AA 3O4LE 5DRWA 4U7MA 4O9HL 3FRUA 3TN0D 1AO7A 1JNLH 3RX7A 5FK9B 1AXTL 4KAQH 4Y5YC 5A2KH 5HHXH 2H41A 1KCRL 3MR9A 5D2NB 3F6IA 4L1HA 1XF3A 3ARTA 3DXAB 2APBA 3HE6A 3I50H 1MCSA 2W65A 2HTLC 3FQTB 4KVCL 2I27N 4XT1C 2FJGA 3V6ZA 1KG0A 3WHXB 1FJ1B 1XCTB 3MRKB 2NY6D 1BOGB 2FX7L 3OKNA 3RWHB 5FCUH 3BUYA 1GOHA 1JZ2A 2BC4A 5K9OA 1N7ML 1FNLA 3HG1E 1CICD 3X12B 2XWJA 4JFDE 3V0VB 1T5WA 1RJYA 1OAQL 1RK1B 3HRZA 4YHIB 2P45B 3HLAB 4ZAKD 2UUDK 1P53A 4I48B 4NDMA 4H20H 3C8DA 5GIRB 5FDWA 1INQB 3EUUA 5ESAA 3QA3A 2E8ZA 1PG7X 4JFPB 3BPOB 3ISWA 5I9QB 5DSCA 2E3VA 3VH8G 4LCCB 3OR7B 3MCG1 4MNHA 4JO3H 3S6CA 3MNVB 4U1IA 4ZFOL 5DJYB 3VRLF 2ADIB 1WCBA 1OGAD 4JM2D 1H15B 1S9YA 1I1YB 1X5XA 1WWWX 3L7FA 4NBXB 3MUGA 4HIEA 5IJVA 3BKCH 5D1ZC 4FQQB 1CL7I 4KMTL 3CX5J 5JW3H 4J3SA 1MWAB 3B2VH 4NFCA 1T2QH 1RURH 2IWGA 5F7LB 5DVNA 3LKPA 4OD1H 2VNCA 4GBXA 1Q0YH 4UIKH 3LEYL 4Z7WE 5F7EH 2D3VA 1G9MC 3NA9L 1PG7W 3C8KB 1BD2E 2ZG2A 2ZCKH 1XZ0B 4PJ9B 2BCKB 3VFSB 3BVNB 4XC3L 2ZOLB 3L6FB 5IHUL 3H3BC 4RCAA 1HNGA 1CD8A 5HD8D 4B41A 2R2EB 4FMFA 2Z31D 4X6DE 2AABL 3FAWA 3RJQB 2HKHL 3ARUA 4FQLH 4URTB 3U0PA 4X7TB 1LGVA 1ZHKA 4YHZH 4E42B 4PY7B 3LS4H 5IM7B 1UWEL 4YFLI 2ID5A 2OL3B 1QFWI 4ZMAT 2CJUL 4QRRD 4KROB 3IFNL 1RHHA 1JTOA 4LLWB 1YMMD 3TCXA 4WI5A 4UI2A 5JMOC 1X9QA 4PJ5B 1KN2L 1PKQA 2EEDA 5GGRY 5T3ZL 1T7VA 4FQLL 4M1CC 3UPAA 4WW2F 3I2CH 1PX3A 4Y4FB 3U7WH 2KL6A 5I18L 5SWQA 1NEUA 1G6VK 4HWEH 1EV2E 4U6TA 3ZKXB 32C2B 1I9JH 1TJGH 5IVOA 4Q9CA 2AJSL 1UFUA 2R4SL 3O2DL 1A4KB 3F7YB 2R56H 1YYLL 5ADPH 1CFSA 3G04B 4LVHC 5HYSA 5C0BE 3GSUB 3QULA 3IF1B 3ARDD 3VWJB 4PJ7B 1DQLH 3O41A 1F6FB 3S5LG 2C1OB 1MCLA 3HAEB 4S1SL 1S9VB 3STLA 1KLGA 3C5ZD 3JV5A 2JCCB 2PUQT 2OQJA 1GCFA 2X70B 1MIMH 3QIWD 3ZKMD 3T1WA 3MXWL 3BE1H 4UBDD 4KUCF 5I1GH 4EUPB 1UKQA 4MA7L 4PGBB 3L3DA 3SE3A 1IGIL 4KJQD 4C54A 5B8CC 1IC5L 1MFCL 1FG9C 3MLUH 2UV3A 1NGWA 3HPLA 4N1CA 1QRNE 4GRLB 1I8MA 2BSTA 5HVHC 1WAAE 2YR3A 2I24N 1OLZA 4POZC 1JPFB 3HG1B 4AH2B 1J8HB 3UYPA 4UAOC 1E27B 1YUHB 3G5YA 3CVHB 1QFWH 4GUPA 1NMAL 3VJ6B 2W60B 4DOHE 2NW3B 2GSIA 1BEYL 4YHPB 4RNRB 2HH0L 3GI8H 3LDBC 5A2JH 5IKCB 2V2TA 5C0CD 2KZ1B 3K80A 3RDTA 4B50A 1GHFL 3NCJH 4NZRH 3WNKA 1DQQA 2GJ6A 5HHQB 3A67L 4OLVH 4ZFZA 3K8MA 4QXGH 2ZUUA 4IOIA 3I6GB 1BECA 2R0WH 5CZVH 4FFZH 3ZO0A 1ZVYA 3QDMA 3AREC 3CVHH 3IDYB 5I66B 1LQSR 3HCVA 3GUTA 3MV7E 4KV5F 3K1KC 1EUUA 3ARFD 1F4YL 1MUJB 3QEHA 3ARPA 4P5TD 4AL8H 1AHWC 3AREA 5ADOH 1W72B 2EDEA 4MXVE 1R3KB 5MEOB 1PD6A 4JY6B 3ECBA 3C8HA 1EO5A 3MA9L 3MJ8A 5EPMA 5FUCC 1NCNA 5C71A 4XVJH 3CGTA 4MXWL 4JM4L 3HNVH 5LBSL 3GNMH 2OP4L 3J8F7 4JB9H 4H5SB 3QFJB 4PJXB 4NNYB 1UACH 3AVEA 3HMXA 4H25A 4G6JH 2QADD 1ACYL 4JDZA 3OAUL 1W8NA 4PBWD 4RIRA 4JKPL 4OUOA 5I6XC 4UUJB 4P59H 3NCCB 4KJQC 5ECJE 5CJOL 5JO5A 1G0XA 1P7KA 2FR4A 1M4KA 2JB5L 3MUY1 2X9XA 2C3VB 3TWCL 2IPTL 3BRGC 1VB9A 2OK0L 3OAYH 4ODSL 4RDQF 3QUMA 3TV3H 1K5NB 1WC7B 3DO7A 2J5LC 3BZFA 2G60L 3NFNB 3QDMD 5TFSL 2PO6B 2Q6WA 4AMKH 4JPVH 1T6VN 4AIZB 2CKBA 4HCRH 2GIYA 3GHBH 4Q6YA 1VDGA 5I15L 4BK4A 1CD1A 3UJIL 2VIRB 1NBVH 3FFCA 4JY4A 4D0DB 3B8YA 3SDAA 1EHLL 4GG8B 3ARDC 2I60L 1IQWH 4FFVC 4MZ2A 2BY3A 3RWGA 1F58H 4YHPA 3HZKA 1A1OB 2Q76B 2XTJB 4JFOB 5CEZD 3U7YL 2BSRB 1MAMH 2CIKA 1NLDL 4F37F 1DR9A 2BSSA 2Z8RA 3ZKSD 2XPGA 3E3QE 3FB6A 1NCAH 1YEDA 5TE4H 3T2NL 3RWGB 3VXPA 5IQ7L 3I3BA 2AEPH 2D7NA 4XAKD 2F9BT 4HIEB 3P9MB 2CSPA 4R6UA 2Q87A 4OGYH 5E8OB 4S1RH 1OD9A 2WBJA 4JPIB 4J3UA 5HHNA 1BFVL 3TGXA 5HHOA 3KPSB 4GRLC 4ZDHB 4DGYL 3T09A 3BH9A 4P2OC 2VZUA 4NQCE 4HF5L 4XNMB 3EYOB 5F88B 1WV7T 4HK0A 2WM0A 3WO4B 5D6DC 1BFVH 1U93B 4KQ3H 4QT5A 2UYLA 2GYSA 2X40A 3S36L 4YBLC 4NZUL 3I02B 4Z8FH 1IGCH 4KK8D 4EVNB 3PXJA 2R0ZH 3PGCB 3DURB 5BOZG 1PY9A 1HINH 1QBML 4U1NB 1T5WB 3ELAT 3BIKB 4JR9H 1T3FA 3DX8A 1JNNH 1I3RB 1RK1A 2DKMA 4NWTH 3DYMA 1IZKA 1I3GH 4CN1A 2F53A 2VLME 5T3XL 1AD0B 1FGNH 2AEPL 1RMFL 4M43L 4O51B 5E8EB 3RQ3A 2A6DB 3CFKA 2DIJA 1FFOA 1IAKB 5D71L 3JV4B 2J88H 3BUYB 1RVFL 5H35A 1VFUA 1QSEA 2NY1C 2QV2A 1HYSC 4P2RA 2X4RA 3ULSB 2DLGA 5J06A 1HZHH 3GJEA 1JVKA 2FBJL 4JM2C 1S9VA 3S97C 3STLB 3WUZA 3S98A 2E27H 5FUZH 1FVDA 2CIIB 4OQTL 4Y2DD 3VDAA 3O81A 5DT1L 3C9NA 4P4RB 5HYJE 3VDCA 3AGVA 2X42A 5BS0A 5IR1B 5HDLA 2OR9L 4YHKL 4ONHA 1SBSL 2PYFB 3VFUA 4CVXA 1CL7L 1EERB 5IMOA 2YS4A 2OI9C 4UNTA 4M61A 4OV6F 1OTUD 5DUPH 2LU7A 5C0IB 2Z31A 2W59A 4QYOB 1IKFL 3IFPA 5LWYL 5SX5K 3RWIB 1YEEL 4TSBL 1Y6MR 1BBDL 1UACL 3VXPB 3T0EA 1MHCA 1S3KL 1PBYA 1V05A 2RJMA 4OLZL 5LGJB 3FQRA 1E28B 3FB7A 1MCJA 1JPFA 1M7DA 5IP4A 4LL9A 1E4KA 4HK3N 1KTDA 4N0FA 4M7KL 1HWHB 3NGBC 1B3JA 3QXWA 4OFPA 5TF0A 3BD5A 3MRNB 3JV6B 4U1LA 5DR5L 4LRNH 2BVPA 4K71C 5E95B 1EHXA 4U0RB 5J11C 3L7FB 5KN5B 2A6DA 1QHPA 3BZ4B 5I1AB 4GRLD 4F7MB 3OKEB 1J0HA 3LAFA 4M9OA 5HY9B 2F5AH 4KJYB 1NGXA 2OCFD 4X5XA 2F58L 2HFEA 4FFZL 4NQDE 4HS8L 5CZVL 1VA9A 1G1CA 2QKIB 3U0TB 4YR6B 3DX6A 5GZNC 1OF2A 4LVNB 1INEH 4L4TD 3JWDH 1G7QA 2N7BA 4JDTH 1JYWA 2BOCB 3TYFB 3GRWH 4X4XA 2D31B 1AY1L 1XGPB 2ZSWB 3QG6B 5FEBA 2E7MA 4ZOAA 5ANMA 2BVTA 5HYSG 1KELH 1NMAH 1GGCL 1RHFA 2BMKB 3MZTA 4PJ7A 4MNGA 3GKWL 2GK0A 5D6DA 5L8LB 3OKMB 4Z9KB 2OLDA 4ALAL 3RZCD 4ZUTB 4L4JA 3MV7D 1QR1B 2AERT 2OJEB 3UP1A 1YQVH 1EJOL 3BKYH 2Q7YA 4L4TA 1WF5A 4N8PA 4HWUA 1H8OA 1MHEA 4L5FL 3EZJB 3LEXA 1AQDA 1Z9LA 1NUGA 3ZYZA 3O2VH 1FNGA 1J8KA 1MCKA 3OMZA 5KVMC 3BYTA 4KTDL 4KJWC 3BEWB 4K8RC 3TT1L 2F19H 3ZTNH 1BFTA 3DYPA 5DEGA 2NLJB 3ROLA 3L3OB 4LASL 1IARB 2PKDA 5KVEH 2B4CH 4PJ7F 3AS2A 1CE1H 3W0WB 1HKLH 1BIHA 3L3GB 5E99H 3K4ZA 4XB8A 3KPQA 3GMRB 1GIGL 1MVUA 2VXUL 4PLJD 4XZUB 1S78C 2QQKH 3OKKA 5D1ZA 5DUBA 4JM2B 3D39D 3UPCA 4ZQKB 3MRKA 3U4EA 1MELA 3LRSB 1DCLA 2HA1A 2QHLA 1Q94A 4YXLH 4UOW0 3MRMB 3FN0L 4R90H 1RZKC 4EQ2A 4JFED 3WSQL 2PW2B 1T83C 4P49A 1X5IA 2HAZA 3PGDA 5CJXC 4ZPVA 3UTQB 4CU8A 5EA0H 1QA9B 3X17A 3MUHL 4YHOH 5D1XC 5E4IA 1RJYB 1CFTB 3FN9A 3G5XB 4GKNB 3WKMH 4OCSH 2NYYD 3HNSL 4LEOB 2EXWC 2APTA 2GTWB 3QXVA 4KK6D 1OAXL 3IFNH 3QIUA 4OV5B 4JFDB 5HHQA 4PRPD 3I2CL 4OZ4B 3HUJB 5DWUH 4WNQA 2X89D 4GQPH 4FQIL 4AEEA 3T0AA 3V4PH 5FOBB 1RZIA 3P40A 2Z8SA 3PWNB 3ARED 5CJBA 2NLJA 5DHYA 5DC0A 3QEHB 1J86A 1RUAL 1JYXA 4HLZH 3QIBC 1OGTB 2V6HA 3L3KB 3OJVC 3I84A 4BFGA 1CD9B 5EIVA 2I9LA 1JGUH 3ZE0F 3ARGB 1GZQA 3BOVA 5DUMH 3MC0A 1UXWA 3DX7B 5K9OB 1G6RH 5CUSH 2PF6A 3G6AA 2VSDA 1P5UA 2VTFA 4XC3H 4FQHA 2VDLL 2WMPA 4XCNA 3ZDXF 2EH7H 3I9GH 5SWQB 4XNQB 3IS0X 3HMWH 1YMHA 2X7LA 4RFEA 3TH4T 2GY7B 1F3JA 2PYEA 1YQVL 4XHJD 2HTKD 1MEXH 4KMLB 4NKIH 3U36B 3V4VH 3BFOA 5I73B 1KB5A 3U7AA 4PJGB 3BKCL 3KYOA 4WFHE 4X6DB 2A6KB 2ICWB 1K2DB 4I13B 1CGSH 1GPOH 5J1AA 1MHPH 2FL5B 3QULB 1ADQH 1KXTB 2J5LB 3TBYA 4I2XA 1FLRL 1YEFH 2BNQD 3QUKA 1OAQH 3QXUA 4MB3A 3MRGB 1BD2B 5T1KA 5LQBL 4G43A 3ULUH 4NHCH 1TCRA 4F7TB 1JZ8A 4EI5B 3RAJH 1KSRA 3WFDL 3QP3A 5I8KL 4K9EH 2VKWA 4JRXE 3K2UL 3BKYL 2EEBA 1ODAA 5I17A 3IDXL 4KDWA 3DETC 1JV5B 4G8EB 5DYOA 5F1NB 1MH5A 5HYEA 1E6JL 2C7UB 3IJHB 1T89A 4RWYH 3W2DL 2BOBA 2EIBA 2JK5B 3H9SE 3S37L 1FC2D 5FKAA 1KELL 5A16A 3RTQA 2EDQA 1RZJC 5L6YH 4KMQA 2H8PA 4W6XB 4PJFE 3V7AE 4GG8A 5C0EB 2VUYA 1QO3A 4KVCH 1FN4A 1HE7A 1B0WA 4X6DF 1QFOA 1XCQA 3DMMC 3IS1X 4OM1H 4U6VL 3WLBB 3C09C 2HKFL 1L9MA 4NRYA 4CRPA 4K23H 4RSVA 4KKBD 5DJZB 4V1DA 4HS8H 5LWYH 4HUUB 4PIRF 1N8ZB 4RFNC 1U8MA 1BWWA 3GJFK 1Q9WB 3MV9E 3WDHA 1MRFH 1RZKH 5FB8A 4I0KA 3IJSA 3SDCC 1Y0LB 2EXWD 1CL7H 4X7DC 2NY0B 4KKCC 1FO0A 5E8NB 5D8JL 5IESH 2W9EH 1AC6A 1AR1C 4FQJL 1JZ3A 3MLPA 4P9HH 3DJ9A 4AM0B 4YDLB 4JQIL 1S9WA 2X7LB 2J6EL 5T33L 5HHOB 3DXAE 1HH6B 4IHOA 5F9JB 3C5ZC 3HR5A 3JWDC 2DAVA 5I1EH 1IEHA 2DRUA 3BAEL 2FBJH 4P46B 2VAAB 2OZ4A 2CDEA 1QFHA 1IM9D 3JTSB 4NZTL 5GZOC 1A3RL 1T2XA 1WFOA 3D2UD 4LKCB 5E4EB 5F7MC 3VXQB 3GEWB 2RAMA 5I1KL 5B3NA 1V7NH 5BRZD 1JK8A 2HRPL 3P73A 5ALBH 1UVQA 2V2XA 1NJ9B 5C7XL 4XPTL 4MS8D 3KJ4C 4HAGA 3U79A 1L6ZA 1VPOH 4NNPL 3WIFB 3R8QA 4DKDC 5HI3C 1HNFA 3IKCB 3TO4C 1P4LB 4I0PD 4F33A 2FBOJ 4V1DD 4G9DB 3L5HA 3DGGA 4L3ED 2Y36H 4KI1A 3UYRH 3MODL 3B2UD 4XX1E 2FDBP 4JPKH 1A14L 1JWMA 4R97B 2H9GA 1KJ2L 4HS6A 3G9VA 4JE4B 2DLFH 1CDHA 1XR8B 4GKSA 4XP9H 1HILB 1NMCB 5IT2H 3GB7A 4KQ3L 1INDL 1MLBB 4JFFB 5FA4A 5FHAH 5L7XH 43C9A 2DLEA 2ICCA 1V8HA 1G7LB 4HIIB 5DMGD 3S34L 1T0MB 4JO4H 1AGFA 1FGNL 1IGJA 5CSZB 1XGTA 1ZAGA 2DF3A 3FO2B 3N9GH 4NC1E 4TQEL 3FOLB 3BEVA 2ZNWA 3P0VL 5E9DD 4FXGB 5ISZD 3DX9B 3SE4A 1UB5A 1FBIL 3G5ZB 4JO4L 2UWEE 5HYJB 1MNUH 1OW0A 1QYGL 3CFEB 4JRXD 1NFDF 2FJHB 4P46A 3V79C 5HYQA 4WGVB 4JRYA 5DHVB 4AQ1B 3D0VB 2X4PA 4AEIL 2CLRA 4NZUH 3TVMA 3KLHD 4LGPB 1T20B 4ERSH 1JPGA 3IDIB 1ZLVK 3PE9A 4W4OA 5FGCE 3SCMD 3KPSD 3W9EA 5EU4A 1OLLA 5DFWH 3W5MA 2IADB 4J8RB 3WL9A 2Z91B 4DZ8A 3PABA 3QHFL 4MD5B 3H2WA 4LCCA 4WHYH 4OKVB 4S1RL 2DWDA 3RWDA 1M6OB 4Y16B 4C59B 2CDGB 3CFBA 2ZUWA 1G7HA 4MCYB 3EZ8A 3W9EB 2HFTA 3D85D 4JFDA 4A6YB 1I8LA 2ZPKH 1KEGL 1FN4B 1UB6A 4NGHH 4HMCA 2JJVA 2BRQA 1MAML 5IB5A 4MJ4A 4D0CB 4TSAL 1G7IA 4J3VA 4MXQD 1H3PL 1T3FB 1G9NL 4HG4K 2EH8L 2UWEB 4FN0A 1EXUB 1W0VA 4K94H 5I19L 2AGJL 1EHLH 2C3HA 4DCQA 4N9GA 1OGTA 3L3KA 2VDQL 1LP9E 5EOQL 2X9WA 1PKQB 1JRHI 1G9MH 4QT5B 4JPVL 2NY2B 5CHNB 5F9WC 3HE7C 1C7TA 4TUKL 1PZ5B 4TSCL 4Q9QL 3FO9B 1YY8A 3H9YA 4TTDC 1NBZB 1SY6H 4HS6B 3OF6D 1HILA 2VZ3A 3RI5K 3L9RA 4M6NH 2JB5H 2ILLA 3OJMB 1CXKA 3FHAA 1A8JH 2P8PB 3LV3B 3UDWC 1NC2D 2XY2A 1AGCA 2MFNA 3SHSA 3W11D 3MFFB 1UKSA 3RUGB 3X14B 5ILTL 3C9NB 4P4RA 3TVMC 4R2GC 2VYRE 1BVLB 3O3AB 2CRYA 5B38B 4U6YA 1K4DA 3LN4B 2OBGA 5E6IA 2Y06L 4XNUH 5BOPA 1F90H 3GNML 4JB9L 2IBZY 1A9BB 1OAUH 1NCUA 1YJDL 4X6FA 4EIGB 4X99A 2YEZB 1JPGB 3FFDA 2LU4A 3Q6FA 4NSKA 2EDLA 3RIAK 5EUKA 1R3IH 4MQXD 3D1MC 1G7PB 4BH8B 1J1PL 3RPIB 1HSAA 1U8PA 5C2BL 4R7DB 1QFWL 4PV9B 3K2UH 4JVWA 4R97C 4X4ME 5DLML 1DE4A 3X3FH 3WFDH 4NKOA 4RGNC 3TZVA 2I9LB 1OOAA 5KZCD 1VSCA 2XKSA 3WYRA 4ZNEE 3V6FA 3GIVA 4KH2A 3WFHA 2LE9A 5MEOA 1A6TA 5C70A 2R1XA 5DQ9A 3UBXB 4IS6A 1AGFB 1L7TH 3D3VB 3FMGH 1MJUH 3OKLB 4NQSB 1LO0H 3KPRA 4QOKB 1R24B 3C2AL 1CGTA 3MX0A 3NCFB 4M8VA 4QHMB 3GIVB 4MA7H 2WQ8A 1X5LA 4XRCA 4XCYA 3WFCH 2MQ3A 1WICA 4YLQT 1JF1B 1QQDB 4QRPA 1R5VB 2FECI 5KG9B 1AKJB 4JFXA 2FB4L 1Z3GL 3WXWH 2YSSB 3GSNL 1T20A 1T22A 3WHXA 2XZCH 2BVPB 5GS1B 3PDOB 3QUXD 2EH7L 3QXAA 1KT2A 4PJDE 3SDDB 3RL1B 5KVDH 2VDLH 5DA0B 4LPWA 4U3CA 2LVCA 2JE8A 3PQYB 4GLRH 3OPZL 2GK0B 1U8JA 3E6HA 4KUZL 1IGIH 2B8OT 3C6LA 4F37K 2YUZA 4KVNL 5E8DL 2Y6SD 3QFDB 5DRXB 2P49B 3WNMA 3QCTL 2I9TB 2NY0C 4C55A 3ULUE 2QL1A 2JCCF 4HGWA 1CE6A 4LCWA 4LBEA 4HJJH 1H3UA 2EXYD 3BE1L 1E6OH 3S88H 3IDJB 1MIML 1UGNA 2Y4SA 4KI5C 3U7WL 3E6FA 4HDIA 1JIBA 4IRSA 2VXQH 5GZND 4S10A 3DGGB 4MJ6B 3KYAA 3NMEA 1DQLL 1PDKA 5DJYA 5EBWB 1HEZA 3VGEA 1ONQB 1VEPA 3N85L 4UTBH 4OT1L 4NO2B 4JY5H 5CBEB 3GBMH 4Q0XL 1UH4A 1JPTH 1EX0A 5DZOA 3VFOA 4Y88A 1NAML 4BSWB 1EFXA 1S8DB 3ARFC 3MRCB 4OF8A 3LD8B 4YHZL 3ULVE 1BZ9A 1VFAA 4HKXA 2R2HA 1W0WA 2NZ9D 3MV01 1FLTX 4L3EB 4O02L 4QXUL 1KJ2B 4LSQH 3CMOH 3O8XC 3LSOA 4MX7B 3FOMB 4ZODA 1OB1A 3SBWC 1B0GA 3LVEA 4R90L 3D69A 3ARWA 1S7VB 4ZFOB 1W0YT 3RDTC 3MGTA 4FABH 1LWRA 2H32H 1YEGL 5EZLB 1DTUA 3D85A 4JFDD 3QQ3B 2PCPB 3GJFA 5E9DB 1ZHBB 1RURL 2V5RA 5C0BB 2VXUH 1B88A 1PEZA 4JFZL 4U05A 5IMKA 3NIDF 4ZUVA 2NXZB 2C7UA 3SJVA 4QOKE 3WUWA 1HKLL 4PV8B 4ETYA 4OFKA 2ARJB 4QTHB 4Y2DB 1DQMH 1ZMYA 2B4CL 1ZGLB 3L5XH 2HT2C 4GRWH 2IMMA 4Q74A 3TO4D 3QQ9C 5TDPB 2JJTC 3DTXB 4U1GC 1WJ3A 2C26A 2F19L 5EZLA 4WNQB 3ZTNL 5EN2A 2VOTA 2CLRB 3K2MC 3EO9H 1RIHH 4HPOL 1YN7B 4RZCA 5ABDE 5E8OA 4PJDF 2ZUSA 3SKOA 4NKOB 4YJZL 1X4ZA 4PBXA 4PRIB 5I1DB 4ZTPL 3TBYB 4K3DL 4NRZA 4WFFD 1FAIL 1GAFL 4K8RD 3CVIL 2BCKA 3VFSA 1XH3A 4K2UL 4GKZA 3KDMA 3O6LH 1FL6A 3GMNB 1JHLH 4G5ZH 4FQCH 5L8JB 3VFMA 5KJRL 3WEXB 3VFNB 4PREA 3DUUA 3V5HA 5IEHA 5E2TH 5AG8A 3PGCA 5F70A 4Z0XB 5LAXA 5K9QG 3WN5A 3NIFE 3MRPB 5SWZB 2XZAH 2BY0A 4LSUH 4ODHL 4OZFB 3CZFB 5KOVC 5D72H 3KDMB 1IMHC 1TJIH 2DQEL 4W6WB 3BISA 3IFPB 4HH9B 3BZEA 3NZ8B 1P4LA 1DJSA 1QLRA 3QI9A 1Z5LB 3PP4H 4Z7QF 3ARGA 1KJVA 3FO1B 1I8LC 4WUUA 4NRXB 3FO0L 2ESVB 1DBAL 3OR6B 5JIPA 3S8WA 4JANB 1QPXA 5CKAA 2X1XR 1JK8B 1PYWB 2ERJB 3P73B 1N7MH 3SE4C 1A1NB 1RUKL 1CFTA 3K1DA 5JO5B 1ZOXA 3MV8B 2NCMA 4TOYL 5JLZB 5JUEH 1LE9A 4PJ8C 3SQOL 3RPKA 1IL1A 3QJHA 5CP3A 3QJFB 1Q94B 2PCPA 2CGRH 3GJFB 1H3VA 4ODXB 4LLQA 4W4OC 5GJSH 4D0BA 3MLVH 1K3IA 2CLZA 3DMMA 4FG6D 3JV0A 1JNLL 5FA3B 2X6MA 1SYSA 4LCCC 4MAYB 3P9LA 4WEUD 4ENED 2X4TB 1RJZB 3QDME 4EI6B 1I8IB 4CMMA 4ZD3H 5DQDL 4NKMA 3MV11 4ODTH 5MHSE 4OLWL 3VI4F 1QUNA 3OKLA 1SEQL 3S37X 3FRPG 5FYKL 1UXSB 4LDLB 1JF5A 3CH1B 4JG1H 2C1OA 3MOAL 5SWSE 3EW3B 5JOPE 4NCDA 3TBWA 1U3JA 2F54A 1QLRB 3QI9B 1LO2L 3TZVB 3ARXA 3UCRA 2W0LA 5CEZE 3DOSA 1AGBB 4YGVB 1FNSH 3DARA 2P48B 2B0SL 4Y2DC 4QF1B 1SBBA 4YBQD 3O4LB 3MLZH 2NXYB 2Z35A 4HUXB 3VFWA 4LOUD 1U91B 4OI8A 5ICYB 1FDLH 1VHPA 1RMFH 1WT5A 4R4NC 4F8QA 1WISA 3IDMB 4XMLL 3HE6B 4ZS7H 3LH2L 4JKKA 4IIQA 4FQXD 2MQCA 1FNEB 4Y4KC 3UO1H 1ZTXH 1JMZA 2Q7NA 1JNHB 4X6CE 2F74A 1KUMA 5I74B 1PJ9A 1IGML 4OZGA 2ESVA 1NBQA 4XBPA 4FP8L 1YC8A 5E2UL 3GRWA 4HT1H 1NH6A 5IV2B 2A1WH 4K7PY 4JVPA 4PRPB 3MLRH 1H3GA 3O2WH 4AM0A 4JO1L 3BJLA 1ZTXL 5C8JA 3U1SH 5GRJH 4XI5D 2VL5A 1KIUA 2OQJB 3IXAA 3GMPA 4XPBL 1D5MB 4JFPA 3T04D 1CFBA 2JJWA 4S1QH 4QHKJ 1T03L 1FDLL 3OGOE 5J3HD 3C8KA 5FM8A 3KVQA 1BGXH 4XWGL 1ORQB 3FT4B 3QUML 3MRHA 1ADQA 2WBJC 3X12A 2W1NA 2VISA 3TZVD 4QY8A 5F3BA 5J89A 4HD9A 4OZHE 1RJZA 4LLAA 1A4JB 4Z5RB 4Y5VB 3ET9F 3RWHA 4Z0BL 4A6YA 5GGTL 3PWPE 5CJQH 3QFJA 3BXNA 3U9PH 3I6LE 2C1PA 3FKUS 3HS0A 1A7NH 1GRWA 1P6FA 1A02N 1Q0XL 2Y5TA 1ZEAH 3SGEH 1I75A 1IAOA 1RI8A 3HPJB 3C08L 4WI9A 1FVEB 1F5WA 5L2JB 5FYJD 1ZGLA 4NUJA 2BVQB 4MJ5A 4PJ9D 1OY3B 2GTZB 3HA0A 3TO2A 1LE5B 3U2SB 2VKXA 2AP2A 1MCBA 3CNKA 1X7QA 1FNHA 3O8XB 3RNKA 4EKXA 3F12A 5B38A 4LLMB 1ZLWH 3EYUL 4WFFE 2ZUQC 5E5RB 1I7RB 3OG4B 1TETH 5SWSB 5CJOH 1CFNA 1TFHA 4XVTH 1IEAB 3BZ4A 3VG9C 3VGBA 2ICES 4OLXH 2HMIC 2NX5A 4Y4HA 4EDXB 3QT2A 3CUPA 2ZOLA 3L6FA 4OFYA 3QDGD 1ERNA 3R1GL 3QFJE 1U3ZA 2HFFB 3A6CL 1MAJA 4JRWA 4M93B 3SKNA 4PB0H 5E56A 1NMBH 3ZE0E 1HQ4A 4PGCA 4Y5XB 5D7JD 4RAUB 2GCYA 2V7HA 4AJ0A 1DBAH 5E8PB 4ODUB 5LAXB 1A1OA 1DQJB 1IAMA 2X4RB 4BELD 3KPLA 1PLGL 4LSTH 4DKEH 1U93A 3MJ9L 3H7BB 3QEGL 5EOCJ 2VL5B 5L9DH 3TBTB 4ZPTA 4ODHH 5E2WH 5CFHA 1S7XB 3VXUD 3R06A 1H5BA 4MJ2A 3C6LC 1CLZL 1RUQH 1XFPA 4GXVH 4XRCB 1NC2B 3ARZA 3ILQD 4BSVB 4LP5A 1C5BL 2DQGH 5DJDA 3GSRB 3H42H 3SE8L 2JCCA 1F3DJ 3GSNA 3CK0H 3GSVA 3MRDA 3R0MA 1T0NA 3NCJL 1OAYL 1AQDB 4KHXH 1HYSD 3CVIH 12E8H 3PWPA 1LK3L 1KB5B 1DDHB 1U6AL 3P0YL 1OT1A 5DVKA 5EU6B 5DD0H 5JOFA 3GI9H 5C0FA 5C0BA 4DUWA 4OLEA 1C5DA 4B53A 4N0RA 2DQCL 4MAUL 4NNXB 4PR5A 5EC2A 1T83A 2H2SD 2AS5M 4RIRB 1OHQA 3NIGE 4X9GA 3EO9L 4KK5C 4PJFB 1EO8L 1I7ZA 4UAOB 5E6ID 3T2QA 2ZZUT 3DRQB 3S3SA 3OTTA 1CFSB 1K3ZA 2FNBA 2DN7A 2F8VA 4PJ9C 1RZ8A 5HHVH 2W0FA 4Y5XC 2HFGH 3VFRB 35C8H 4H26A 2GK2A 1L0XA 2JJTA 4X6BA 3V6OA 4JFZH 4JLRA 3MCLL 1BJ8A 4OGXL 2HT2D 1IC4H 2CDGA 5F3HA 3TCLA 1IBGH 1DUYA 3W39B 4HUNB 1JP5A 2R0LH 2CKNA 2DL9A 3FT3A 4YIQA 5AZEL 1G1YA 5F8RC 3TYFA 4RGMC 1RZJH 5I1CL 4HXAH 4KY1L 2VLJA 3BIBX 5TF1L 3VFOB 3ZYOA 4LCUA 5GQBA 4G43B 1DBML 4PGEA 4OZIB 4L29B 1K6QH 4HZAA 3VXUB 4Q6IA 2APVA 1QNZL 3LIZL 4GLRI 1AGBA 5EIIA 1W72H 4P3WA 4ZSOA 3GSQB 2P8LB 4NO3B 1EEZB 2HVJA 5KSUB 3HE7D 3P9MA 4N5ED 4MQ7B 2R56L 1JZ4A 1NJ9A 3BRDA 4FZ8L 3LKQA 3RRQA 3O3BA 1W72L 3VFMB 4DUXA 4YFDB 4GAJL 5EU6D 5JNYB 2BNQB 3EO1B 3JTTA 5I18H 5HYJD 1KN4H 4CMHC 3OX8A 3AAZA 5CGTA 4CL7A 1B4JH 3DUHA 4L4VD 4XMKH 4UNUA 4H25B 4YDJB 3O0RL 4ENEC 1SYVB 3L7EA 5CMAB 5AZEH 2DBJA 4C56A 2DYPD 4PJXF 3HR5B 1MSPA 5I8EA 4P3DA 1NGYA 3B4NA 3M07A 3NZ8A 3L1OH 2ICWI 1UWEH 2NY3B 2UWEF 4U1GB 5HXMA 1OP5K 1VFBB 4L8BA 4JFXB 5EPMB 2HKHH 5JPNB 5D2LF 4KVNH 3OHXB 5DJCA 3IETA 1NBZA 4TPRH 2HLFD 3TJHD 1FH5H 3OKYA 3BH8A 4Y16D 3E3QC 5DD5L 4MJIA 1XF1A 3BP5A 1JN6A 4KRMB 2W9DH 1YDPB 5C09D 3HAEA 5DEFA 2M8XA 2PW1B 2ENYA 2YN3A 4FXKB 5BS0E 3GSNH 4NN6B 3CX5K 4CMMB 3IXTB 4WUUE 2HVKA 2J8UE 4K94C 4Z77B 2DKUA 4YHNB 3GI9L 4MS8C 3VFPB 2O5ZL 5SV4A 2O61B 2XA8L 4I77L 2YN5A 4HHAB 2FO4B 2VXVL 4WENB 3V7AG 1PGRB 1CDCA 2A83A 3QH3B 1WZ1L 3TYGH 1RUML 3MLXL 3EJYD 4YE4H 4UDUA 4HEPG 4WO4D 2YEZA 4RFOL 4RRPA 2R1YB 1DL7H 1UYWL 4X4ZA 1UJ3C 3VH8B 1GGUA 4I3RH 4YDIH 5JOFB 2X9YA 1I8MB 3RX8A 1FL6B 1RZIB 4XXCA 1I9IH 5DEZA 4X9HA 3W9DA 4NO3A 1J1PH 5C6TH 3TT3L 4NO0A 5EU6E 2V9QA 3WIIH 2NTFA 3DSFH 1X5JA 4WWKA 1MJJA 3Q5OA 2IQ9L 2AJ3A 1J0IA 1HWGB 1OAUL 4ZFZB 4PB0L 4ELME 1MCNA 3FQNB 5F97E 5FO7A 1UH2A 2VLMD 5KN5A 5FCUL 4JRYD 3R1GH 1FVCB 4I4WB 5CHNA 1DBBH 3KPOB 2XZQH 1E27A 2CIKB 4G8GD 5AWNL 5ILTH 4JHWH 4ODUA 2PYEB 1BZQK 4Z7WB 5IMKB 4GG6F 1N2RA 1RUPH 5DJ2B 5EUOA 3SDDC 4DFHA 2PW2A 1CQKA 5D70H 1BFOB 3B6SB 1JRHH 3EOTL 1N6UA 1KT2B 3UTSE 2ITDA 3VD4A 4MCZB 4O58H 2A9MH 3THML 5HI5C 3CU7A 4EJ1C 4OCWH 4NC2B 3N1QC 1MJ8H 3TFKC 1HHHA 1MCRA 4NQCD 1HEZB 1SY6L 3GSQA 4PJFF 3RVWC 5T3ZE 4TNVK 4TSCH 1EEUA 3C08H 3ZT5A 1H3TA 4MNQD 1BD2A 1I3RA 1EAJA 4U2ZA 4C83B 2F53E 3G6DH 3JWOL 5AZ2L 4R8WL 4TNWK 1IAII 1KPRA 3CFBB 2IBGA 2J8HA 2GQHA 4UINL 2EH8H 2BJMH 3EDDA 4WRLA 3KPPB 2X89A 2AXHA 3T65A 1HKFA 1CLYL 2KUTA 4XPHH 4JHZA 1LHZA 1TJHH 5C0GA 1DE4B 4P2RB 1H5BB 5HGGS 3MRBB 5K59F 1RAMA 2MMXA 3VRIA 1MAKA 3QNZA 1E0OB 2F5BL 4PRHB 2VO5A 4YDLC 5DK0A 2D2OA 3P11L 4P5TB 4CVWA 1IAKA 5IEKB 4KDVA 4PRBB 5C09E 5I1IL 1PVHA 4EN3A 4XPBH 3PWVA 1T1WA 4H8WC 5C0GB 1BD2D 2DIAA 3PWPB 4ZYKB 2UZIL 3BMVA 2CK0H 4LMQI 2RCSH 3ZKXC 2O5XH 1R5IA 5F96H 1I7UB 4G9FB 2PN5A 3AXLA 4HIJB 5E6IB 2DI7A 3CFJB 4DN3H 3VD9A 4Y4FC 1KCVL 4BQ6A 4FP8H 1N8ZA 1EMTH 3MRMA 4WDIA 3FB5B 4JN1L 2DM2A 5JQ6L 1FYHB 3IDUA 4UTAH 1CXIA 2CUMA 2VLJE 4PJ5D 1NGXB 4X5XB 3SQBA 4NQCB 3BD3A 4XCEB 1MNUL 2A9NL 2HT4D 3VRLE 1AFVH 4NN7B 3FQXB 4P4KD 3FFCE 3REWA 2E7LA 1NL0H 1JUFB 2J12B 1IGYB 2O93L 2FD6H 3AROA 3ZDYF 1FIGL 4GXUN 1NDGA 4WIQA 2I07B 1CIUA 1XZ0A 5IMMB 2NXYD 3HI5L 1AGDB 3BP6B 4DKFL 5CGYD 3VH8A 1FFRA 5LGJA 1JZ7A 1F42A 2FD6L 3RKDD 4PGCB 4Y5XA 3DV4A 3QHZH 1YUHA 3CCHB 3G5YB 3L5JA 2DD8L 5KS9E 4GAGH 5ACZA 4NYLB 1VFOA 3WE6A 4TUJB 3E2HC 2AJXL 2XT1B 1YNTA 2CKBH 2XKNB 1IAIH 5CBAA 4AENA 4OSUH 2BRRL 1PSKH 3HI1A 3ZKND 2Q7YB 4F15B 3VXRB 2NX5B 1SEQH 4Y4HB 2OXGA 3TFKD 2VISB 1EMTL 4ODTL 4JM2A 5C07A 2DQUL 4R4FL 3BHBB 5DQDH 4KI5E 4DN3L 5BZWA 5EIQA 4ZFFA 2FGWL 3CFDB 3CXDH 5D2LA 3NFNA 4CNIB 3KR3L 3EDKA 3X3GL 1BF2A 1DQDL 3UTTE 1PEWA 1IM9B 1A3RH 2VLKA 3J7HA 4G6AC 5FF6A 3ROOA 4MJIE 4N0UA 5FM5M 2GUOB 2D31A 3LB6C 1J11A 1ZVSA 4X4MA 2F8OA 1CLOL 1R0AL 3N1MC 5BZWB 5I1EL 3W0WD 4JLRB 1P6AB 1CWVA 3WO3B 5K9KA 1HDMB 5HGHB 1SM3L 1NGYB 2LFGA 3R06B 2QQNL 1UM5H 1TJHL 1TPXB 3KPMB 4JGJA 4MAYA 4XPHL 4GOSA 3M8OH 2H2SC 3CFEA 1P7QD 5JHLH 3GHEH 4LFHG 5GS2D 2XWBA 2EYTA 1S78D 3TIEA 4JFEB 4YZFF 5DI8A 5HGHA 2OSLA 1DFBL 4GW1A 5JIKA 3DV4B 1IL1B 4L9DA 1OWWA 3SY0B 5ERWB 3TLRA 1QVOA 3SDXE 3EHBC 1C7SA 1PSKL 4IMKA 3H9SA 4OM1L 5SX4I 1JUFA 1GOFA 5HVHB 5BQ7A 2X4QB 1B6DA 2NX5D 1DVFB 4PLJC 4Y4HD 5D1XA 1NCBH 2A9ML 4LIQH 1RY7B 5JR1H 1VADA 3RWFA 5B39A 1MPAL 2YUWA 3UAJD 5J8OA 3FONB 9CGTA 4RQQB 5I6XB 1MQKH 4GRWE 4M02A 3KLHC 4PJIA 1DBBL 4HC1A 2Z31C 1MRDH 1NL0L 4IOSD 1J0ZA 1YPZA 1TTGA 5KSBE 3BW9A 4IRSC 1N59B 1M71B 2AJYL 4P2OD 4JG0H 4EXPX 4KZEL 1FYTE 3O3BB 2X41A 3ULUL 3UJTL 1XT5A 4HIIA 2P42B 4UT6H 1I1CA 3TA3D 2HT4C 1EFQA 3UDWA 3LB6D 4RBPH 4QRQB 1U8HB 3AS0A 5C3LD 5C6TL 3BKMH 2NY4D 2P8LA 4D3CH 1RIUL 3L5XL 4KRNA 5IB3B 1I9IL 1TZGL 5I1DA 4XWOD 1JMXA 4KKNA 5IQ9A 2W38A 1A7RH 1TIUA 2MHAA 2HVKB 4X4YA 3VWJC 2Q6WB 1PAMA 3CSBA 4NKIL 1FO0B 3HC4L 2HYMA 4MYWB 5T3XD 3RGHA 1G9EA 1GC1H 4QRRB 4RFOH 3U83A 3RI5F 4RA0C 2JCCE 4PPTA 4FABL 3QRFM 4E5XA 1MCWW 4RAHA 1WZ1H 3TYGL 5F93C 3NN8A 4L4VE 3RZCA 4PRDA 1NKRA 5EU3A 1HSBB 2ATPA 1JN6B 1WFNA 1ZT1A 5L2KB 1C16B 2CDFB 1X4YA 1NLBL 3VXQA 5IBUB 4WGWB 4GBXC 3KYNB 4LSQL 5FA3A 1CLYH 2UUDH 5J3HC 5FV1L 2AXFB 1NEZA 4NHUA 3LN9A 1XCTA 1OP5H 5KVGL 4YUEL 3VG0H 3LKNA 3VGAB 1OARH 3IDGA 2NNAA 4Q0XH 2ADFL 4IRJB 3IJHA 4JY5L 3QIBA 2X4SB 5EBMA 3VD7A 2H3NB 4APQB 3T65B 1MI5A 2M2DA 4TVPH 4S0SD 4MDIB 4G80A 3KHQA 3SEPA 1MJ8L 4X6CA 3MNWA 4KU1A 5I71C 5L88L 3TN0A 1CT8A 4DTGL 4OCXH 1NFIA 1AIFA 3CLEH 4QF1A 2NY4B 1GH7A 4ODBD 2AK4E 3S35H 2EICA 5AYQA 4LEXL 1B6UA 2FJFB 3HNSH 4G8FB 1LILA 5HHOE 4K71B 4OCSL 3RU8L 1BX2B 1E4XL 3OGCB 5EG6C 4KKAD 2VDKH 4U3XA 4KUZH 4OQTA 4KQ4L 1BJ1J 3EJZD 1AIFB 3T08A 4LCUB 3WSQH 5HHPB 1RV6X 4PRDB 4LARH 4WDIB 5FM5O 2OJZL 4P4KA 4LAQH 2V2XB 1U8IA 2FB4H 4R2GB 3S96B 2DTMH 3DSFL 1KTLB 1GGIL 2YK1L 3NFPB 3WFHB 5GJTH 4K3JH 4X4YB 1IILE 5GSVA 3PWJA 5ID0B 4R96B 3JTSA 1CE1L 3QYCA 4QOKD 4K7PH 5C0EA 3DMMD 4QRUB 2YKLL 4RZCB 1U8OB 5IJVB 4V2CB 2P1YA 5MEPB 5I1CH 5C0DA 3HMXL 5CZKA 5D7IF 2R0LL 4PJXE 4IM8A 4B5EA 5SV3A 4KTDH 4I1NB 4HJ0C 4OD3H 4I18A 4JZJB 1NPUA 5T1LD 4DW2L 1G7HB 4FA8A 3MSPA 5DHYB 5EUOF 1OP3H 1KLUA 1T2JA 1WWAX 2CQVA 2HN7B 2WLYA 3B43A 5DRWB 3BI9X 5HDBF 1IEBB 4WI8A 1NANI 3T2PA 3OXRB 4L8BB 3QZWA 3E2HB 4CU6A 5D5MA 2OJZH 2I26N 5HDQH 5C07B 1ZK9A 2GJ6D 4N68A 3KJ6H 1A1MB 4KZEH 5EU7C 4GRMA 1VEOA 4R3SB 4XNXL 5IQ9B 1GGCH 4Z6AT 1KCKA 5CGYC 3HC3L 5IBTH 2WUBH 4HJGB 3TH2T 1BQUA 12E8L 1ITCA 4UU9B 5FYLL 3B5GA 3PWUA 4J23A 3A6BL 4R0LC 4J7RA 1SY6A 5HPMB 3SBWA 4XAWH 2F53D 1KCUL 3PWLB 5TDOB 4EUPH 3REVA 2GSIB 5DJXA 4WO4B 4MWFA 2QTEA 4M6ML 4BQBA 1WLHA 1HXYB 1TENA 4GKSB 3EOBB 1J87A 1VEMA 4A6YH 3C60A 1QRNB 1B4JL 4MHHG 3SGJA 5J6GB 5FA4B 3SDAB 4KTYA 1MREL 4Y19D 2ZKHL 4KI5F 3QB7C 3QEGH 4D94A 3HZYA 3BGFC 5EWIH 2PO6D 5D1QC 5IFHH 3SDXB 4XCEA 1IJ9A 2LTQC 3OKKB 5F7HA 1N5YL 3OXSB 1N5AA 2YC1A 4M7KH 4U1JB 4ZNEA 5IB1B 1Z9SA 5IR1A 2YRZA 4K94L 2A74A 5I19H 3HI1B 3W9DB 2AQ1A 4IDJH 2BDNL 1NCWH 1BQSA 2P5WB 4NO0B 5A43C 5J13C 2BVEA 2NR6D 5B4MC 3AXLB 4HIJA 4MDIA 4OLYL 2B20A 3A6CH 3GMOB 3GO1L 3NZHL 2OTWA 1UM5L 4NUJB 4XB7A 1KJMA 2PR4H 3NBNA 4O4YH 1J8HA 1MFNA 1DBMH 4WW1B 4OZIE 5DUPL 3B9KC 4GSDL 1SM3H 4ZYKA 3D85B 1QFWM 2AQ2A 3QXAB 4M7ZB 1HN1A 1OTTD 3DROA 4PG2C 1R0AH 4G6AD 5I8EB 2W07A 3REWB 5DHVA 1S9WB 5T1DH 5F6HJ 1S7QA 3MRBA 4OQTH 3T77B 3UTTB 3ALPA 3X3GH 4XCYB 5EOCH 1A7RL 1N0LA 1NCDH 1S9KC 1R5VA 4YHMH 3P77B 1WIPA 3BKML 4MD0B 3T8XA 4PUBH 4GXUM 3QUYA 4WUKH 1SMOA 3QDHA 4Y19A 1Y0LA 2NY2D 1MUJA 1IGFH 6CGTA 1A6ZB 2J88L 4ELMA 4N0UB 3DX6B 1NDGB 4OSUL 1CGVA 1IAIL 2CR6A 5BVPH 4F2MB 4ETQA 5DD0L 5CBEA 5EU5B 1RZ8B 2IF7A 2MHAB 2KQMA 3RHWF 3MOBH 4OGZA 1AHWB 1BGXL 4XWGH 4HH8A 2QSVA 3BPLC 1MQKL 4PJGF 5KSAA 3ARFA 3NGBB 5DHXB 3F7YA 3C5ZB 5L7XL 4M6OL 3SDCB 3K0WA 1IGCL 1T03H 3ROLB 3K46A 3FT3B 4YIQB 2W65B 1RUQL 5IWLC 1KJ2H 1U8NB 2DLHA 3CLFH 5SWSD 5JOPD 2AXGA 5CD3B 2X4OA 2EDNA 3MQIA 2DDQL 5F7KC 2HT3D 5BXFB 3WXVH 1PLGH 4KKLD 2VB5A 3LDBB 5GGVY 4PP2A 4G6FD 1KIPA 2HVJB 3F8UB 3MRGA 5KSUA 3RWCB 3QSKB 5IQ7H 4XPGL 3T2NH 2H9GB 4JKLA 4NQEA 2P8PA 5D7JB 3X13A 1VADB 2F54B 5E0QA 4X0KA 1SEBB 5FGRA 2VIRA 5I1KH 4NCC2 2QR0B 3RWEA 3BN9D 3ARSA 3QUZA 4ZUUB 1ZLSH 3UAJC 4QOKA 1J0YA 2O5YL 1QVOB 5DRZA 4MWFB 1XGYL 2VH5H 2FEEL 5INCA 1F58L 1NGPL 2VITB 1IQWL 1I1AA 2D03H 3ZTJG 4J3XA 1YMHB 4LDEB 2YUVA 2WP3O 3V0VA 2GITB 5J9PA 1F3JB 4FQJH 4ZAKB 1JZ6A 1GOGA 4U6HB 3P3YA 2RR3A 5B8CA 4CADB 4X7CC 4Y1AD 5FO7B 2X4PB 2HLAA 1DQDH 2CR3A 3UTPE 1UZ8B 1EAPB 2P5WE 3ARFB 4XWOC 3CSPA 2E9IA 5F7NC 2P43B 4F58H 3QJFA 5D5MF 4RMUA 5F9JA 5AZ2H 3ZYIA 1SJEB 5DXWA 3QO0B 5JTWA 1QQDA 3UPRA 1A7PL 3BQUD 4OKVA 4F58L 3VGAC 2OTWB 2WK2A 1KLUB 4Z0BH 3X11A 1RU9H 5EH1A 1ACYH 2J1KA 1AI1L 1VESA 4HBCL 2AXJA 2Y6SC 1XR8A 3V7MA 1Q9OB 1ZSDB 3KPTA 1BREA 4J1UA 4HWZB 2HG5B 2OI9B 5D5ME 5FYJL 4JDVA 4XVJL 1V3LA 3HI5H 4TVPE 5CMAA 4DKFH 3CDFA 4ZDHA 4OLUL 2I5YL 3O2DA 1FIGH 1YNKH 5CBAB 4HGMA 1A4JA 1FHGA 5AUMB 3MMEB 1YQ2A 3P4OA 3BSZH 3MV7A 3MNZB 4RAVA 4UT7H 2B1HH 4QLRA 5CZXD 5TPWH 3CZFA 4P23B 1XF5B 2WUCL 4LU5L 2H3NA 4XPGH 3KPNA 3MLRL 2PXYB 4I18C 2Y5TB 2VXTL 5D1XD 1Q72H 3SE9L 3AY4C 2Y72A 1ADQL 4P2YA 3MNZA 1IGMH 4XAKE 1MHPL 4JEGB 4MJID 1BVKB 3QCVH 3GMPB 4ZS6D 5C0AA 4H88L 2AJVH 3QG7L 4PJEF 4AY0A 1YMMA 2DDQH 2O5XL 4NHUB 5KOMC 3T0DA 1QLEL 2VDMH 3V8CA 1KENH 2P5EB 4NN5B 1G7JB 4LSUL 5GGTA 4LGRB 3LH2H 5EBLA 2JJUA 1MEXL 5HVGB 4HPYL 4M61B 4OFVA 5HYFA 4MCYA 2X70A 3QA3B 2X4QA 5E2VL 1QRND 5C86A 2ZUVA 4OJFH 3WD5L 4DN4H 3HFML 2K7QA 2WW8A 3EOBA 1NCCL 3MNWB 2NPLX 1ND0A 2IANA 4I77H 2A6IA 5DQ9B 3UBXA 5ICXA 1GAFH 3TJEH 2X4TA 2JIXD 4OI7A 3ZTJH 5BVPL 4KC3B 2YUXA 4F7EA 4PV9A 3PHQB 2VDNL 3QHTC 5HHNB 3JZ7A 3QIWB 1MCQA 3SGJC 1JGEB 2BK8A 1U8OA 1ZA3A 4TPRL 4Z5RA 4E41B 2FCBA 2GSGA 4S1SH 2YD9A 3NCEB 2EDDA 1BHGA 3F5WB 4G9FD 4QXWA 4EDWH 1TXKA 2PXYD 4IOFC 1UWGL 5IOPB 2VLJD 4HJ0D 5CEZH 2D0HA 2ZCHL 5JW5A 1CU4H 3AREB 4NDMB 2HN7A 1OAKL 5ICYA 1T80A 3RUGA 2FZ3B 1D5XB 3F7PC 4ESKA 3O4LA 4MGXA 5AWNH 4FS0A 5GISH 4BH7A 4QRSB 5D2LB 3OKEA 5CJ8A 2PR4L 4TOYH 4WHDA 2WSKA 5JOEA 4HMEA 3GSOA 1FYTA 1RUKH 4YC2C 4N9OB 1X4XA 3QDGE 1WBXA 5DRNA 4G7YH 3WHE1 3KPLB 5IF0A 1T1XA 3LPFA 3HNTL 3U48A 4HV8B 3WEXA 4XNZC 3GBML 1AKJD 5ENWB 4WFGE 5B39G 5I74C 5IFHL 3T4YA 3LRGA 4UILH 1RIVH 1ZGLM 5CINH 2ZKHH 4FNLH 1K4DB 5F7YC 4ZUWB 1FZOB 1QPPA 2R29L 3SDDD 4WEBH 3W11C 4XNZB 2VXSL 4JANA 5DJDB 5T5NF 3U82B 2EIEA 4Y7MA 1TQCB 5B39B 4NBZB 4EI5A 4N5UA 4RRPG 1G7MA 5EU7E 3INUL 4CVXB 4U0RC 3O3EA 4YE4L 4GAFB 1ZLUH 3PP3K 5K93A 5ESVA 3VXSE 3SDXA 2XG4A 4ONHB 3NIGF 4FQXA 3R8BB 3U2SA 35C8L 3QFJD 1G6RB 4UIKL 4XVUD 5MENE 3W82A 1R3JA 1E4XI 3DO7B 5JW5B 4ZTPH 2OTUA 3CH1A 5T1MB 2XV6B 3T3PE 3MBXL 4IEFB 5GGSY 5DEGB 3QEUB 3BGMA 2EKSA 3MRJB 2R1XB 2KPNA 3QEQB 1CQYA 2HJKB 4PJ8D 4OB5L 1V3KA 2F54D 4FFWC 1MI5B 4LAJH 3MZGB 5D96C 4J4PA 3H7LA 2DQCH 2Y23A 1I7TB 4WCYL 3BXNB 3KAAA 4IOIB 3EYQC 4M00A 2IG2H 2XWTA 1XIWB 4XCNB 4C56E 1DEEB 5E6IC 5KSBA 1BQHB 1LEGA 1P4BH 1AD9B 4PJGE 4GW5A 4YDVA 3L1OL 3MJ7B 3RWJA 1L7TL 1INEL 4Z7UB 5LXGH 5IHZB 1I1AB 4MVBD 3INUH 1NSNH 3NIFF 4RGOL 1NAKL 1GXEA 1JFQL 4KKLC 2AQ3A 3VWJD 5J56B 3OHXA 5DJCB 5EUOE 3QDJD 4EVNA 1J1XH 5DK2A 4WFED 2NY7L 3LKOA 2EZ0C 3KLSA 4KTEL 3BH9B 5DR5H 3OWEA 3HZMB 2NQCA 2BNRE 5EO1B 3S4SB 2YPKB 1XGQA 4G8GE 2X44D 3TIDA 4EI5C 2AEQL 4NQDA 1RK0A 4G7YL 2BFVL 1NMBL 4XNUL 4H0IA 4HFWB 3OX8B 1LK2B 1XR9A 4R0LA 2FHCA 4I3GA 3WLWC 1R5WB 3FQUA 4QRPE 4AG4L 3QFDA 3HUJF 3KLDA 4L9LB 3IAGC 1WAAA 1EK3A 2YD4A 3RU8H 2VXQL 2Z93A 5SX4H 3N1PC 5GRUH 4XVTL 4R4BA 2A77L 3S35L 5E1AA 4P5MA 3PL6B 3TNMB 3QQ3A 2QSQA 1WBYB 2P44B 3WMSA 5CS7A 4CDGC 2ATKA 3C5JA 4YBLB 4D0DA 5DT1H 4CDHA 5L88H 5D1QA 1AHWA 5I16A 5IBLD 3K74B 3Q5TA 4NO5B 5AUMA 1SHMA 2EXYC 3UTPD 2BHYA 4JPWL 5D2NE 1OCWH 4U1IB 4F9LC 1OB1B 3DI3B 2XG5A 2BY1A 2E9BA 4MMZC 2D7TL 4DGVH 1G9ML 4QXTA 1P84J 3OPZH 5CSBA 3ZL4L 1LNUB 3SKMB 3GMMB 3GFUA 2VDQH 5EOQH 1E4WH 2AV1B 4QNPE 4OGAC 4WWKC 1MFEL 3MRLB 3ZKMC 4K7PX 3O8XA 4HGKC 3HI6L 3QDJB 4X6DA 4R9HA 1S7UA 5IMLB 1ZVHA 1CTNA 4ZUVB 3IETB 4RX4A 3TH3T 3T3MF 1S7SA 1V7ML 1N26A 2I25N 1NLBH 5EZOL 4NWTL 1NBYA 3D48R 2FWOA 3KWWB 4QCIB 3CK0L 4QO1A 3OG6B 1MWAL 2XWBB 3D69B 5L0QB 4D9RE 3H3PL 3D3VE 3AB0C 4Z8FL 1ZGLP 3G6JB 4X99B 4FTVA 4OBRA 3UTTD 3MTRA 3GKZA 1NBYB 3NFPA 4NOFA 4XHQA 3QHFH 2IC2A 1CLCA 4RGNB 5E2WL 1UENA 5JORA 4V1DE 4XP1H 1JGDA 1MH5B 5JXAL 3ZSTA 1TZGH 4JY6A 3F6LA 2KZWA 4PJBB 5KBNC 2VLRB 4LSTL 4ERSL 2IAMC 2VZVA 1D5BA 5CLWA 4XH2A 1T1ZA 5CZXC 4JAMB 2H32A 5JIHA 3SDDA 4UT6L 3TP4A 3P77A 2AI0L 1DBKL 3QUYD 4OTXL 4IRJC 3IB4A 2HJLA 2IPUK 4OCYH 5D7LB 3VMNA 3NFSH 4YDKL 4ORZC 2CKBB 3P0VH 2WINA 3VGGA 3B8SA 3MLYH 1CYGA 3U0PB 2JELH 2JJSC 3U7YH 4MVBC 4GS7C 4LSPL 3WCYA 1WEJL 2XKUA 1BOYA 1Y6NR 3ULVD 3WS3B 3DGCR 2Q20A 3KPRD 1YMMB 5IVNA 1EFXD 4JFEE 4YXKL 3WFZA 4LPVA 1WBYA 3BPNC 4PRHE 4JZOA 2I60H 1FZJA 3P30H 1TETL 4FMKA 5JPMA 4S2SB 4RFEB 1KB5L 1M7IA 4Q9RH 5TFSH 4POZD 4HJGA 3C6LB 3EDJA 5C0IA 2CUHA 4TUKH 3RY6A 5JDSB 2M26A 4KHTL 3TWCH 1KLFA 1RK0B 3OAZH 4D9LL 2R69L 4OF7A 5C0CE 1Z5LA 3P4MB 4ZSOB 4UMGA 4HKJB 5I2IA 1NDMB 2XN9E 2PTVA 2AK1H 3U4BL 2IMNA 4RGND 2BVUA 3JUZA 3PF2A 5C0AE 3QWRD 1OTTC 2OTUB 5IB4B 1VGEH 1IM3B 3UPRB 1ZLVH 3VXOA 1FZMB 3LQMA 5FDWB 3D18A 2CGRL 4LRIC 4NKMB 1KPRB 2ED7A 2XQBH 4JJHA 4UDUB 1MCOL 1A6AB 3LEXB 2GJZA 5C0DB 4X6BB 1B2WL 3QH3A 4PP1D 2ZUXA 3PV7A 4C56B 4OIIL 2EE9A 1GJIA 5CGMA 1BBJB 1WT5C 1BM3H 2FJHA 2FH8A 5SWZD 4AENB 1TLKA 3O3DA 2NY6C 4JO1H 3MRNA 1NGZA 1OW0C 1MHHA 2NY0D 3AUVA 2VAJA 5C0JB 1ZXQA 3FO0H 1KG0B 2E7CA 3CVHL 3JTTB 4KRPB 4BA8A 1KTDB 4N0FB 1ZHLA 1TVDA 4PJCE 4X8XA 3OXRA 5FO9B 5C3TA 4NQEE 2Q8AL 3EFDH 1YYML 4BZ1H 4MNQE 4OLVL 2UVFA 5LJYH 2YA2A 4XP5H 5EZJB 5KTEH 1N59A 2OR7A 1T0PB 3D87B 1L0YA 3RGVC 2DQEH 3CH8A 1F6AB 1HOCA 1H8SA 4J12A 2FEDC 3HRPA 3OGCA 4HK0B 3DBXA 1JGLH 5D7KD 4XMLH 1U0QA 2YBRB 4P3CL 1T04B 3TVMB 3S37H 2R2EA 4QHNA 2PYFA 1C1EH 5IVXF 3ZE2E 3O45A 4G5ZL 4P48A 1G7JA 2G5RA 2L0DA 4NP4H 3ZSSA 1F6AA 1HOCB 2AJZA 5IT2L 3MYJB 1Z6JT 4WY7H 2XKNA 1FNSL 5CIPA 2XQYK 3MOBL 3PQYD 3VGDA 3QUXC 5I30L 4OZFA 5D1ZD 3ARBC 5GRVK 5C09B 2X4OB 3ZYJA 1FVDB 2CLVB 4YX2L 5DFVD 1AFVL 1DLHA 4N9GB 5FGBA 4I0PB 1U3HA 4R4BB 4JG1L 2G9HB 4C57C 3ESUF 1I8KB 1T6WA 4X6EB 5F1OB 3DO3A 4EBQH 1RIHL 2VABA 4HPOH 4YQXL 1DQTA 4UTAL 5I1GL 1QSED 3I3EA 1H9VA 5FUCE 4OLWH 3U9UB 3MXWH 4MZ3A 4XI5C 2GHWB 3ALWA 4PUBL 4HFWA 2XNAB 5F96L 1GL4B 2XYCA 1RULL 3EYFB 2UY7A 2V5TA 3NTCL 4RGMB 1X5YA 4O2CA 4XBGB 3GSWA 1PZUB 5FCSH 3WIHA 4LNRA 3MLVL 3HMWL 1T0MA 3P11H 4EEEA 4FQ2L 4JQIH 1NFKA 3GSWB 3HPJA 5CUSL 5BV7C 4HLZG 3BQUC 3T77A 3GO1H 3UTSB 2VWEC 4LLDA 1HHHB 4NQTA 4ONFH 2WBJD 4HKJA 2V7NB 5I2IB 1Y6KR 3VI3F 1J5OL 3KNBB 1U8PB 4OM0H 5ACLA 1MFBL 4R8WH 4JRYB 1BVZA 1N6VA 4KDTC 5CILH 1CI5A 1FO0H 2CJUH 3MJ9A 4K23L 4M4PA 4HC1L 5EWIL 3U30C 1ZWIB 5GGSB 1MCHA 1KIRB 4WI4A 4X7SH 2AABH 4A6YL 4NWUL 4XPAH 1TITA 4OCWL 3TESA 4LKCA 3WJJA 2I07A 3W81A 4ZXBD 1D9KD 2XFXA 3GSRA 4PJIE 1QP1A 4WVRA 4DWHA 5E2TL 1OPGL 1RFDL 4NC0B 1N5AB 2AJZB 2YC1B 4Y2OA 3BQUA 1J1OL 4GAYB 4JHWL 4JGUA 1MJJB 1IT9H 5D7LA 4G6KL 3H7BA 5E8DH 3IU4H 1Q0YL 3JSSA 5IBLC 5I8CA 3TBTA 4OD1L 3TBWB 3BPNB 2NY1B 4O00A 3D39B 5I8KH 5ICZA 4MCZA 5DD1H 2XY1A 1T2QL 1RZ7L 2FECL 3BDYL 2YMXL 2WNGA 4NQSA 1F4HA 4Y1AA 5BXFA 2E9WA 5GS3A 4TNVF 4Y19B 2EDJA 2IQ9H 5JHDE 2NW2B 4PG9A 5MEQA 5EBMB 2C1PB 3HS0B 2YD1A 5A1AA 3WLWD 3CAFA 4UUJA 5CWSB 3RZCC 1YPZB 2V2WA 2ZSVA 5TE7L 1GIGH 1CDBA 4LHUA 2X10A 4PRBA 4POYA 2BC4B 2Z92B 3C2AH 3KNBA 4PJHE 3RUGF 3LN5A 4F7TA 5E7FA 3ZDYE 3UBXG 4DZBB 4LASH 4S1DC 1Y18A 2X4UB 5EORL 5DTFA 4LLMA 4Z78A 5IFJA 1I9RH 1J8HE 1RUMH 3EAKA 3GBLA 3ETBF 3OSKA 4PD4K 2FL5A 3MREA 3OR7A 1OQXA 3H0TB 4MNHB 3O6FB 5TQ0L 5KSAD 3ZMRA 1UT9A 3IT8D 2NMSA 4NIKB 4NKDA 4HSQA 4IRJD 5DUML 2YK1H 1VENA 3KS0H 1R3IL 3DVGA 1NUFA 2ZWLT 1OT2A 4BJLA 4E5XB 2QADC 5HSFA 4HUKB 3DXAD 4GW1B 4N0YH 3EO0A 2C5DC 1J12A 3TIEB 3RP1A 5F9OH 2AV7A 3UMTA 1KIPB 3RWCA 2IAMD 5IIEB 2FO4A 3EYFA 3KYKH 2IANE 5ID0A 3D0VA 1ACZA 2YRLA 1BP3B 3VWKD 1AY1H 1D6VH 2ATKB 3C5JB 3AAZB 1HSAB 1YEKL 4BM7A 3DUSB 2DBLH 2JK5A 5F3BB 3R0NA 5D1QB 2EDHA 2Z0BA 4P2QA 5ACZB 4PJ7E 2QSCL 4HKZB 2K1MA 1WK0A 3VJ6A 1PFCA 2GT9A 3MRIA 15C8H 1BZ9B 3B3IA 4L3EA 3RIFF 1OAXH 5A3IC 1EGJA 4H1LG 4MNQA 2RB8A 3ARYA 4HJJL 3DUSA 4EOWL 4M62L 43C9B 1WZMA 1F97A 4FTVE 3GSNB 3IDNB 3QCTH 3VRJA 3HPLB 3EGSB 4HKBB 4Y1AE 3QUZD 4Q6IB 2G5BB 3VXMD 5JHDA 3RJDA 1BMGA 2ED9A 3FO1A 1OGAB 1LO3L 4YHLL 2LABA 4Q9BA 3EDFA 4FRWA 3L7EB 4C58B 4TRPL 4YGAB 4JN2B 2CH8A 2APXA 2V17H 3EGSA 2IFGA 3Q1SL 3MA7A 5DD6B 2DL2A 3U4AA 4PJBA 4FFWD 2F74B 5ISZE 3OL2A 4TSAH 1BIIA 1YEEH 4TSBH 2A6KA 3QRGL 5C0RL 2DICA 1UA6L 4NGHL 1MHEB 1J05B 2NXYC 1FL5A 1RULH 4QHLA 3MPCA 1FE8L 2C3WA 4KY1H 3GM0A 5HYSB 5C08E 3ES6A 1R3HB 2H45A 1SJVA 4HUMB 3TT1H 3TO4A 2EYRA 3VXRA 3LQAL 4MQSB 4Y16C 3RDTD 3SN6N 3V5KB 4YHYC 4JZNB 2WANA 4YAQA 2MKLC 4EBQL 1A6WH 3V0WL 1QKZL 1IE5A 5E8EA 1H3XA 3MLWL 4P9ML 1A7OL 3GMRA 2PYED 1OM3H 2AK4D 5DO2C 4P2QD 3M1BA 5D5MB 3FO2A 1FRGL 1T66D 4RX4D 3VWKA 3OB0K