4LLUA

Structure of pertuzumab fab with light chain clambda at 2.16a
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRQAPGKGLEWVADVNPNSGGSIYNQRFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUZUMAB FAB Heavy chain
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lluA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lluA01
4XXDA 3ARFC 3FKUS 3ARVA 1NSNL 4NN7B 3GGWB 3MROB 4PYGA 5IBUG 1AFVL 4BFEA 4HF5H 1T1XB 5EZOL 2DF3A 1T20A 4JQIL 3HRPA 4O58H 1A4JA 3HG1D 4S2SB 2DMKA 4PPTA 3HC3H 3G6AA 1RHHA 3ILPA 1VFAA 1PG7L 3FB6A 1X5XA 1SM3H 1PW3A 1MHCB 3KDMA 1ZK9A 1DL7H 1XGTA 4G8GE 3UTSA 2X4OB 1IAIL 3GSOB 3FMGH 3QWRD 1CQKA 1NJ9B 3O3AA 3UTTE 2BVTA 1C5DB 4YHMH 1NGPH 3BE1H 3RDTB 1QA9A 2VN4A 2HN7B 3NTCL 3WS6C 2CD0A 5C0FB 1NMCC 2C3WA 4Y8AA 2ILLA 2KPNA 2NY0C 1YECH 4GS7B 2HRPL 5GRVK 1U3HD 5L7XL 4O02H 4MNQA 4M6NH 1XF5A 4JFPA 3C5JA 1YPZE 3MV8E 1T4KB 2A77H 2YN3A 2CK2A 1DBAH 3G5ZB 2GAZB 4KH2A 1GIGL 1YEHL 1CGUA 3WSQH 3S36L 3TZVA 4ERSH 3VD4A 4IBLT 1KCUH 4DZBA 3FT4B 3O11A 1EGJA 2BCKB 2XKNA 4GAJH 4FP8H 1EO8H 5EBWA 4LLUA 4PG9A 4M4RA 3MLTA 4U0RC 2WUCL 1FZKA 2KDGA 3KYMA 5IHZB 4TQEL 1X5LA 3EJYD 1EHAA 1I1FA 4YBQC 1BLNB 4TTDD 3U6RB 3V7AE 5JO5B 1EFXA 4NGHH 4LSDA 1I8IA 3VRJA 1OW0A 1N0XH 4P9HH 1J0YA 1JF6A 3G04B 5CZXC 1BQHA 3M1BB 5LGHL 3GUTB 3QQ4A 2YK1H 3RWJA 4D9QE 4URTB 3EYQC 1I8LA 3TH2T 5L8LB 1XF2A 2XWBA 5SWZA 3MGTA 4XH2B 4U6HB 5E94A 1J10A 3T0BA 3QPQD 5F70A 2CJUL 4JGUA 1WUNT 3VG0H 5C08E 4F9LC 1YMMA 4S1RL 1I3RA 3DURB 5DEFA 2VXQL 3C2AH 4G8IB 3OKDA 4F8QA 3IGAB 4OGXH 2DI7A 2ICWA 4LAJH 5LQBL 1VKXB 1Y6NR 3HZYA 3V6OA 5J1SC 3GMLA 1U8LB 5EO1B 2ZUSA 2P7TA 1HK6A 3WEXB 4XBEH 4U4BA 3BP4B 3IF1B 2GW5A 4L4TE 4RQQA 4BUHA 4U1SA 5J11B 1IAKA 3MFFB 4MD5A 5AG9A 1UZ8A 3EJZC 1P4IH 3HC3L 5JW4R 4BQ9A 1FFQA 1RFDH 3BJ91 1SM3L 5HHOE 3GM8A 4X0KA 1ADQH 1OP3H 1DL7L 3NOIA 5B3JF 1DUYB 5D1XD 1CL7I 3UTPD 2CSPA 3BVNA 3QIUC 4WHCA 4ETQA 3PGFL 5MI0B 5BO1L 4PY7B 3E6FA 4YHZL 2EE2A 3PWPD 3QEQD 1CU4L 3HAEH 1J1PH 4MMXC 5BS0D 4YHML 2YUZA 3MBEB 3KPQB 2JIXA 3DJ9A 3MA7B 4LMQE 4TUOA 1YC7A 4Y1AE 5DK2B 1A3LH 3F5WA 3W81A 4NNPH 4XRCA 4OZHE 1ZWIA 1YECL 2CO6B 4HGMA 4AM0B 5ILTL 4UU9B 3KPRE 5IBLC 5EU5B 4EVNA 5I66B 1KJMA 2V17H 3C2SA 3AMKA 4HT1L 4GRLC 3T4YB 3RIFF 3QI9D 1DBAL 4OLWH 4X98B 3WSQL 2AXGB 1KLUB 3U1SL 1KCUL 3C5ZD 4H1LA 1XGPA 1JNLL 4GAJL 1PZUB 4FP8L 1XGRA 1EO8L 4ZG1A 3S7GA 3TVMA 3DV6B 5E99H 1N8ZA 5SWZE 1F8TL 4LHUB 1V3LA 3D39A 4QNPE 5I17A 3OXRA 3W2DH 1M7XA 1S9WB 1J8HB 3ALWA 3HZKB 4OZFG 3QO0B 1NCWH 4NQEE 4NGHL 4TSCH 4JN2B 2FEEI 3L1OL 2XN9D 2F8XC 4P9HL 4S11A 3OKNA 3UTQB 4XPFH 1G9NC 5HYQA 2XICA 4KQ3H 5T1MA 4F15C 1S9XA 2NY3C 3VWKC 2BSSB 3THMH 2L0DA 4XB8A 1I1AB 2CMRH 4Y19A 2DWDA 3UC0H 4PJEF 3SKJH 1SYSA 3H3PH 1MCRA 4M61B 1M71A 2BY1A 2VLKD 1S3KH 3QSKB 3MNWB 3CC5B 3PE9A 3GHEH 1HDMB 4JJHA 3C2AL 5T1DH 3MRLB 4GBXD 4P99A 4AY0A 3GMPA 3C09B 5DJ6A 2V2WB 1J18A 4ZO6A 1ZA3B 4OGXL 1U8QB 4F80A 3D5OF 3P4MA 5FDWA 1MWAB 4W4OC 3KYNB 1M4KA 2AEIT 3KYOA 3RWEB 3WS3A 4F9PC 1FLTX 2DKUA 4P5TB 2A74B 2BY3A 4JE4B 1OAYL 1CZ8L 1GGBH 1F97A 2R1WA 3DXAA 2OTWA 5EH1A 5BJTA 4BZ2H 5FYLD 5DJCA 5IQ9A 1IT9H 1CDGA 3ARFA 5CGTA 1MCIA 1SY6H 4KRMB 4XWGH 1QRND 2DD8H 1D5IH 3Q6GH 4U33A 4Z7VB 1OAXL 3O3BA 2YMXL 5HGGS 1K8DB 2DN7A 5DUBB 5I76B 3MO1B 1C12A 4Y5XB 3ZDZF 1KV3A 3V5HB 5D7SH 4R4BB 3TA3D 4PJ8D 2V7HA 2NY1C 2Z4QA 2VYRE 4GAYA 2Q3AA 3UXFA 2JTDA 2ZCKH 4G8FB 4GQ9H 1Q9LB 2MKWA 3RZCD 5GGQH 3EYVB 1AO7A 4MXWH 4GG6E 3B43A 4JFED 2R1YB 3CZJA 4X7DC 4PRHE 4LCIL 1EJ6A 1L7IL 5LAXA 5GGSY 1WT5C 4C56D 3D39E 1MF2H 3VXSE 7CGTA 5DC0A 1ZLUH 3IJYB 4G42A 3GJFA 1YJDH 1JGUL 4PGCA 5IMKB 1A47A 2DYPB 3EZJB 5E6ID 3AY4A 3MRKA 3WS6A 3BP7A 4KTEH 1KBGH 2E5EA 3V5KB 2OSLA 3DNKA 5JMOC 3QXAB 1QO3A 3OX8B 2YKLL 5F9OH 4NO3A 3CSGA 1WAAE 5D96B 5E99L 2VZOA 2ENSA 3RVXD 4M5ZL 1EK3A 3JV6B 1BF2A 4QEGA 1OAZH 1K4CA 4WW2B 4GMSH 1NCWL 5F9JA 3TBSB 3VH8B 5B4MC 5BMFH 5IOPA 2CKBL 5HDQL 2AK4E 4UDTA 3FQRB 2UZXB 3GSWB 4FFZL 3FFCD 1A6AA 4NCC1 5D2LB 5F1OB 3K1DA 3PL6B 2B4CH 2FSEB 2YA0A 1F3DH 4RNRA 3THML 2CMRL 5BRZA 4UOW0 4OM1L 4BSVA 1F6LL 4PJ5D 2GFBA 2Z31C 1S3KL 1W8NA 3W82A 3G6JF 5JHDD 4X7TB 2VZVA 1RU9L 2OMBA 5T1DL 3SGDI 5DK0A 2EIZA 2EDOA 1TJGL 1D6EB 1BEYH 5IMLB 5IESL 1JYNA 2QBWA 1CLOH 3VWJB 4XX1G 1FFRA 1OGAA 4HKZB 2CKBB 1F3JA 3DMMA 3F7VA 4Z5RB 4CVWA 5F9AC 3WNOA 3WN5B 1TZHB 4LCCC 5J3HD 1A8JH 3RVUD 4RFOL 1HHKB 5ICYA 3QCUH 2PO6B 4WDIB 2CDFA 5ISZE 2XZAH 1IT9L 2H32H 1F4YH 1R3IL 2ADGA 4OLXH 3VA2C 1N64H 1SY6L 1R3KB 2VNCA 3VFUA 1TMCB 4W4NA 1LO4H 3QIWD 3QXWA 5B8CB 2DD8L 1FNFA 3MPCA 2PF6A 1HHJB 5CEZE 4HIIB 4OFYD 3BDBA 2EZ0C 1A2YA 4QXTA 1FL3A 3EO9L 8CGTA 4J6RL 3WUWG 3GRWA 1ONQA 3TN0B 4NJAH 1PY9A 5H35B 1SEBB 2DTMH 3QDJB 3HTLX 1MSPA 5LXGH 1EA9C 4GQ9L 2Q86B 4J3TA 4ZOBA 2M26A 3P9LA 3RWCA 2D0FA 3VXUA 5J6GB 1LE9A 3QIUA 5HHNA 3MRGA 4LP4A 2BSRA 3IU3A 5HJ3A 4R7NB 4XXDB 3BQUB 3GIVB 3BISA 1YJDL 1CLCA 1NMAL 3OF6A 3LB6D 5C0DB 4JFOA 2R39A 1J0IA 1U58B 1VB9A 1QLEH 4KTEL 1KBGL 1BIIB 2Q6WA 1N6UA 5KSBF 2GSIB 4JCMA 1CBVH 1NGQH 1Q72H 2BC4A 4GT7A 3LOWA 3UPAA 5A2JH 3AC0A 4HS3A 5T1KD 5DT1H 2YA2A 4OZGF 5IT2L 2CO7B 4KQ4H 1OAZL 3O9WD 4NKOA 3U30B 4GMSL 4ZQKB 2FYYA 1IKFH 2BVOA 3AVEA 3UTSB 3RNKA 3T08A 4PGDA 1U3JA 1F45A 1XAUA 2PTVA 1NBVH 1P7HL 3EOAB 1IEAA 1BVLA 3ORJA 1SJHA 3S88L 4HIHB 2P8LA 3DVFA 2X5PA 1FFPA 4LLWB 2J5LC 3ARBC 3CVHH 4XNZB 3FQXB 1ZAGA 1CD1A 5IB3B 3BO8A 3SY0A 1J88A 2HG5B 2HVJB 3ULVD 2VDMH 3NCYP 1W2KT 2QSCL 3EBAA 4HDIA 3MNZA 3KPNA 1NGXA 4LLYB 3VWKA 5FF6A 2ZPKH 1LEKA 1B4RA 4JO3L 4IRSB 1BEYL 4UIKL 4AEFA 2WBJA 2W9EL 3QCTH 3K81A 3O11B 2VXUL 2G5RA 1CLOL 4AEHH 4OZFA 5EBWB 1NCBH 4PG9B 1VFMA 1FH5H 3UJJH 3BH8A 1A6TA 5AUMB 5MEPA 3KYMB 1G9MH 3BW9A 1S7VA 2GTWB 2OYPA 4AMKH 3QCUL 4W4OA 4OCLC 5CS7A 4YZFF 3TO4C 2XZAL 5D7JB 3FRPG 3RWHA 1KCSH 4NRYB 4F9PA 4YHNA 3U7YL 4OLXL 2A83A 2P42B 4PREB 3L3GB 2XT1B 4UDUA 2NW2A 3S4SB 1LO4L 3VXUE 1JN6A 1BFOA 1CDYA 2VXSH 4MAYC 3EFFB 1YDPB 4O51A 4LGPB 4O9HL 5FCSH 3WFHB 1ZHLA 1NCAL 1OB1B 2EDWA 3QXDA 5I2IA 1G6VK 5CUSH 5KSAC 2DTML 3ELAT 4ZNEA 5LXGL 5IJVB 3PGDA 3ZT7A 3VGAC 1EAPA 3B5HA 3PHOA 3VD9A 2PTTB 2PYEB 1VEPA 3BZDA 1P4LB 5K59F 2VABA 5L2KA 5GGRA 1DVFA 2VQUA 4EQ3A 4U1GC 4Y4KB 3N50A 5MEND 4HS8L 2GTZA 3MLWH 2F9BT 5CP3A 5J1TC 4FTVE 3PQYD 3LAFA 4HJ0D 3C9NB 3T8XA 3VXRA 4DK6A 3PP4H 1QLEL 1T0PB 5DK3A 4MD5B 2CRYA 1WT5A 2F8VA 1NBYA 2EKSB 3T0VA 4ONGL 1UZ8B 3Q48A 1Q72L 1RJCA 3MRQB 1FL5A 2LU7A 5I1AA 5DQ9A 5EU3A 3IDYC 4G43B 3GBLA 3LCYA 4U3CA 1KPUA 4KQ4L 5BW7C 2B8OT 3U9UB 3VA6A 3S3SA 4R97B 4CADA 5KN5A 5I1DB 2BRRH 4PJFE 5KVDL 4H88L 5D5MF 4HIXL 5DJ2A 5BXFB 1S7RB 4PJHB 4MA7H 3MV9B 5F1IA 3BZEA 5T5NG 3V9FA 3NA9H 3GSQA 2Z35B 3B9KB 5DHVH 5AD0A 4ALAH 4TUOB 3WDIA 4PRDB 4P9MH 2VDML 4WWKC 3DVGB 2M1KA 4YBLB 4ZOAA 5FHAH 4OD1H 4EVNB 4I4WB 3ZKND 3C6SA 3V2AR 3LKRA 3SDXE 1TVHB 1KIPB 2DJ4A 4L8SB 4F58H 2VDNH 3P4LA 5JW5B 2Z31A 3TWCH 4AEHL 5DS8A 5GXBB 1JWUA 4GSDH 3C8KB 4X99A 1NCBL 3N85H 3ZYJA 1N8ZB 2P5WB 3OXSA 3MUJA 5FYJH 2P5EB 3NPZB 3CU1A 3QHZH 4MQSB 4AMKL 3SEPA 3LPWA 3CIQA 3CSYA 4LDOB 3ULVF 4I3GA 1DUZA 3FO9A 4ZNEE 1EHNA 1TQCB 1YEGH 3O6ML 2IGFH 2ZSVB 4LCCA 4TNVK 5J0BA 1OQOA 5IWLC 2XQBL 1Y6KR 2J8UB 5IHUH 3LMJL 1TCRB 1UCBH 2VXSL 5F7FA 1H15A 1KCLA 1UKSA 3L3IA 2ZOKB 3NMEA 4Y19B 5FKAA 3WIIH 4QHUA 2HT2C 1SYSB 5JW4M 1AY1H 3KLSA 3O8XB 5IMMA 3QCVH 4FQHA 1UEMA 1M71B 5CUSL 3MJ9L 4OGAD 3CDGA 1HIMH 1TETH 3FN3A 1NEZB 5CD3B 1K5NA 1Q0YH 5E5MB 3ROOA 3VXRE 1L9NA 2HFFB 3V6FB 3MZGB 4LLQB 4N5EC 1QOKA 3ULUC 4M8QA 5BZWA 4PRPA 4TUJA 5L6YH 12E8H 2ZOLB 5A2FA 1G7QA 3D25A 4XP6L 2GK2A 5I9QB 3W9EA 3KYOB 4KKAD 3DX8A 5IW6A 2JELH 4Z9KB 3BMWA 1BQSA 1H3TA 2OJEB 3SDDC 5DJAA 1U91A 4XCNA 2G9HA 3DXAB 4FHBD 5DGRA 5ITBL 3MXVH 2OZ4A 3UBXB 2G60L 5D6DC 2R9HC 3O3UN 3CNKA 2P24A 5E1HB 3ZO0A 1MI5B 3SJVE 3NCCB 1ZKAA 1BFSA 1CS6A 3WUWA 3NN8A 3HKFA 1JHKL 1F11B 4EN3C 3QISA 1BBDH 3AS1A 1DTUA 1NBZB 5DYOA 2AK1H 2BRRL 3O3BB 3BPOB 1D5MB 3S5LB 2FNBA 4HJJL 3IXAA 4PJDA 5DVOA 1IGYA 5GS3A 1HQ4B 4KI1A 1DQQB 4M6MH 3NA9L 5KTEH 3IDMA 1HWGB 2GQHA 3N0PB 1QVOB 4ALAL 1N26A 4ODWB 4ZFZA 3MLZL 5DI8A 3RDTD 1KJ2A 1RUAH 2F54A 5LAXB 5GZND 1FVEB 1OTSC 5FHAL 4ZXBD 2P44B 2XFXB 4B7LA 3ME0A 5DVMA 4WFHD 2UUDH 2AJVH 3ARBA 3KNBB 3U7WH 1MFAH 4A6YA 5J9PA 3DX7B 2VDNL 4FXGA 1JPSH 1T7XA 4HC1H 2ZG1A 1VEMA 2BOCB 4U6VL 4HKJA 1QO3B 1CICB 3TWCL 4PJ7F 1WV7T 5IIEA 4GSDL 1O7VA 5F88A 2EDEA 2IPUG 3DRTB 1I9RL 2MKLC 1A0QH 4XCCL 1DBBL 4X6CA 1K4CB 4M1DH 4PJAF 4O2CA 2Y7QB 1I3GH 1TTGA 4H8WH 1CGWA 5IVXA 1YEGL 2YD6A 1ES0A 5HI4C 1J0KA 4WEUD 3WNLA 5DWUH 3QUXB 2MWCA 4P2OC 4LVEA 1UCBL 4KRPB 1OOAA 4N0RA 4UT7H 1YEJH 4JFZH 2OJZH 4KGLA 3RFZC 3QCVL 2GFBB 1JJUA 4YK4B 2MQ0A 4ZOEA 4U7SA 5F9WB 3ARDC 1HIML 4MDJB 4R2GB 1TETL 4B53A 4G6KH 4RGMB 1Q0YL 1X5AA 4G6AC 2UWEE 4ELKB 4PJXB 4MAYA 1KB9J 3B8YA 3S37L 4WFEE 2X4NB 1BGXH 5D7KD 2IALB 4LPYA 5A43C 5HD8C 1AD0A 3PDOB 1ORSA 2X4TA 4IOIB 4JFQB 7FABH 1S7WB 3P30H 5KSAA 1YEFL 2YBRB 3T0EA 2BOBB 1J7VR 3ARRA 1F3JB 2JELL 3DMMB 5JZ7C 4LCUA 3FRPA 5E1AA 3WDHA 5ID1B 1JI2A 1KIQA 5C0AA 5CILH 2I9TB 4KKCD 4KUZH 4JDVB 5C0RH 4JFXB 3NIFF 4HWEL 1G7PA 1BZ7A 2QKIA 2AQ2A 4YHLL 4PD4K 5I1LB 5DRZB 3QP3A 4XAWH 1YEIL 1PBYA 4WUUB 1BBDL 4M93B 2CLRA 2AK1L 4Y89A 3MGOB 2Y9RT 4E42A 4ZDHB 8FABB 4YQXL 1IGTB 4LVOC 1EZVX 2YEZA 4TNVF 5BW7A 5KTEL 3O3EA 3O2DA 4Z6AT 1UYWH 3RNQA 4NQVA 3MBED 5FM4A 4PTUA 1JI1A 1IAOA 4UIMA 1MHEB 2KQMA 3MRGB 3RGVB 3IU3B 4MA1B 4XXCC 2EEBA 4M8VA 3O4LE 4U0QB 3FCTA 3CGTA 1N2RB 5DD5H 2FL5B 3AS0A 3U7WL 5BV7C 1EUUA 4HUKB 4AEIH 3SKNA 3D2UB 4L9LB 4APQD 4HKXA 4WWKA 2HLFD 5GZOD 4NO2B 1NAMH 3AMLA 5HVGB 3NH7L 4ODXA 4PRNB 4OKDA 3JTSA 2VLRD 4CN6A 2ICCA 2Y07H 4Y4FB 3NZ8A 2F53B 4P5KA 2VKXA 1I7ZB 1RZKC 1DLFH 3BIAX 5C0ND 2UYLB 1ZVSA 1A0QL 1EJOH 2UY7A 4MSWA 2VDKL 4X80H 5EC2A 2GJ6A 4LHUD 4YHKH 5I73B 3CMOH 1UB6B 1QLFA 5I1GL 1AXTL 5EDXA 1GYAA 1I3GL 4MJ4A 1YY9D 2XOTA 4YGVA 4GFTB 4ZODA 2H45A 1DQLH 3DYOA 1FNSL 4QRRA 2NY4D 5KS9E 1SJHB 3BKJH 5DWUL 5IG7B 4DEPC 5I75C 2XA8H 4OZ4A 1IZKA 3ULSA 3D3VE 1U8JA 5FYJU 4JFZL 3G5VA 4JFFE 5E9DB 3MLVH 2AERT 3MLYH 4TTGA 1I1AD 5D5ME 4HZLB 4WV1C 1P1ZA 3FN9A 4F7CB 2ZWLT 5IWLA 4Z0XA 4G6KL 5C0AE 2AXHA 2V7NB 4ZUUB 4EUPH 1A1OA 4Y5VC 1FORH 1QFWL 2MPAH 5C0GA 2WBJB 4U6YB 4LF3A 3VXPB 5FOBA 5SWSE 3P30L 4GRWB 4QKXB 4RGNB 3QQ3A 3MOBL 4KI5C 4XPBL 4MJ5A 1E4XI 2E8ZA 3LQAC 1H5BC 3D6GA 5T3XH 3B83A 2EDTA 2YWZA 4KJYA 5CILL 1WZ1L 3FQUB 1S7VB 4KUZL 3B8SA 1I4FA 3L9RA 4PGBB 3SDAB 1GZPB 4Y88A 4OKVB 5CLTA 1WFUA 5IROC 2BVEA 4FMKA 4LPVA 1NGWB 1VACA 3SDDA 3MRCB 1KPVA 5IKCB 4UDUB 5C2BH 1FFNA 4Q74A 1P7KA 1Q9OB 3WIHH 4Y0GA 4O51B 5BVPL 5D6DA 3AFLA 3BPCA 4F7MB 2GHWB 3WV0A 2PTUA 3M45A 3L3KA 1EPFA 1CCZA 2I60H 3PGDB 3FB5B 1UWGL 4UB0H 4DGVH 4Y2DD 4EN3A 1DEDA 2EXWC 4PJ9C 3TEUA 4DFIA 3VXME 3OJDB 4LLVB 3QUYA 1QFUH 3FOMA 4PJCB 4NQCB 4PJIE 4QWWD 5EU6A 4PB9H 1UM4H 3DRQA 3PWUB 1DVFB 1KIRB 3LD8C 5FA3B 4K94H 2R2BA 1HINH 2I9LB 4NDMA 2W0PA 4AEIL 1A6ZA 2JCCA 5C6PB 5CBAB 5JOEA 2D0GA 1KNOB 3ARSA 2DYPD 3TBVB 4MJ6B 1NAML 3QO1A 4O4YH 4LRIC 2Y07L 2ZSWA 5HYJB 4ZUTB 4OIBA 1RQ5A 3ZSTA 1LMKA 4LVHC 5FYKL 3WFZA 1HXMB 5F96L 3CMOL 5KN5B 1JNNH 3A6CL 4X5XA 3L7FB 2Y5TB 4X4XA 1KULA 4Z7NF 3B5GA 4GG8A 3VXOB 3HI5H 2QADB 3BSZH 4YUEL 2MTPA 1CDCA 5ICXB 3PWVB 3EOBA 3BWUC 3CK0L 3F7PC 1ERNA 2OCFD 2XA8L 6FABH 2K7PA 5CZKA 3NPSB 4OFIA 3TYFB 4YFEA 3ARPA 3PL6D 4P46B 4ZO7A 2R2EA 3MLVL 1CE1L 2BNRB 3MLYL 5TFSH 2EYTA 2VQTA 1ZGLP 2AEQL 1XR8A 5DQDL 5GS1C 3CDFA 2PETA 4H25B 4O2FB 5JIIA 2VLJE 3VG9C 2YPLA 1A1MB 2P46B 3PABA 1JTPA 4P2OA 4QHKI 2VAJA 5SWQB 1FORL 1NGYA 4HBCH 4V1DE 1KENH 3VGDA 3I9GL 5GGVH 2X6MA 4OUOA 1JTOA 2IWGA 3DX9B 3SE3A 3VXNA 3ARDA 1JWUB 2QQKL 1EEYB 3CU7A 4HCRA 4J3UA 5DJ0A 1FRGL 1NMBL 1KCRH 3H9SE 2K9UA 3VWJD 1KELH 4Z7WA 4WNQA 3OXSB 4JY4A 2G75B 1JHTB 3S35H 1U8MB 1J1XL 1IEBB 5E00B 1PQZA 3L3HB 4H5SB 5D7LD 4D0BA 3H3KA 1WEJL 3V4PH 5DF0A 1HH6A 4XNMB 5IK3A 5C2BL 5C8JB 5FO7A 5B21A 4UILH 3T4AA 4HUUB 5GSVA 1UA6H 2IH3A 2OP4L 2XPGA 5L2JA 3WNPA 3TLRA 2ZCLL 2Y06H 5FKAB 5L0QB 3MMEB 2EC9U 3DHMA 4JJ5B 5E56A 4HUWB 4D8PA 2BP3A 2ARWA 2I60L 1QSVA 1UQSB 3GHBH 43C9A 4JN1H 3TN0D 4UB0L 5DFTA 4DGVL 1P7QD 3OB0K 2BJMH 3LVEA 3QDJD 4LBEA 2CDGB 4PY8J 4IRJB 3RWDB 4LSSH 1FNHA 1GGIH 3EUUA 2ARJQ 4L8DA 4MNGB 1UM4L 4NQDA 1PKQE 3WFEL 5IVZB 4K94L 2OMNA 1G0DA 1HCFX 2J3SA 4RMQA 2ZCHH 4NO5A 4ODUB 4TPRH 1T3FB 3BQUD 4OUUA 4IHOA 3SO3C 4X7SH 1JGEB 4XI5D 4XXCA 2RHEA 2P24B 4F7PA 1K85A 5ACMA 4F7EB 3UYOD 1S7SA 1KCKA 3OGOE 4OZIA 4TSBL 3T3PF 2H9GA 1AXIB 4TOYH 1U3HC 1BVKB 3P11L 3E2HC 2AV1B 2BY0A 3BGAA 3G9AB 1KCVH 2A9NH 4F57H 3HI5L 1IM9B 2AJXH 2AP2A 1N6VA 3PJSA 2A38A 2HMID 1KB5L 5EBLB 4WEBL 6FABL 3LQMA 1ZMYA 5EIIB 4PRIA 2VC2L 5ANMB 5F7UA 5ERWA 3UCRA 4CMHC 1N7MH 3NCMA 5AAMA 1D5BA 5TFSL 5EPMB 5F7EL 4POZD 4MVBD 1AI1H 2J6EH 1IGIL 1TPXB 4DW2H 4L4VB 4HBCL 4A6YB 1B3JA 3TCLB 4MD0B 4HW6A 3VD5A 1G6RB 1SJEB 1ZHNA 3QFJD 3L6FB 4ESKA 4BH8A 4E41D 4IRSD 4WW2F 1OSZB 4PLJD 4FNLL 2KH2B 4WV1A 4P48A 1KCRL 4JY5L 5F88B 3LKPA 2XNAA 2YD1A 4Y5VA 4NYLA 2FWOA 3D18A 1KB5B 1I7TB 3QPQC 3MRIA 4PJBB 3S35L 3VJ6A 1UB5A 4X9BA 1S9YB 4O2CB 4RFEA 1FN4A 2EIBA 3NFNA 3L3OB 2F5BL 2UVEA 5J89A 2E27H 3KWWB 1KTDB 5F97E 4P2QB 5IVXB 5DRNA 5D7JD 1JMZA 3OHXB 3BP6A 1ES0B 1ORQA 3V4PL 3IDIA 1LO2H 1CIUA 3DX6A 5TPWH 1CGYA 1FCCA 1OY3B 4HGKC 1R24A 3PGCB 5JORB 2Y06L 2H41A 5GHWL 3KLHD 3DPBA 5IROA 4HH9A 2VE6B 3ZE0E 3D0LA 3GHBL 1RZJH 4JN1L 5D2NC 1U3ZA 1A4KA 2BJML 4KTDH 5F3HA 3TIDA 4LSSL 4LL9A 1GGIL 1FO0L 1KGCD 1KSRA 4NBYB 4M3JA 1FAKT 2LAAA 5IJKC 2PYED 2DQTH 3MOAH 4RAUA 3T0EB 4YR6A 1BAFH 3ETBF 5D6CB 3I02B 4PJ9A 1GC1L 4TPRL 3JV4A 2C7UA 3LKOA 1TQBC 3FQNB 1BD2E 1FV1A 4D0DB 4X7SL 1F58H 4O5LH 1UVQB 3QXVA 2OI9B 2AGJL 4YAQB 4YDJA 4JKKA 3GB7B 4OLZH 4XPGH 3T0WA 3RAJL 2BNUA 2Y6SD 3KJ4C 1JFQH 5HVWA 1QLRB 2WP3O 4K3DH 5GIRA 1Q0XH 5I30H 4TOYL 5DMIL 3MR9B 1FO0B 4LRIA 4NC1C 1KCVL 1A6PA 3WIFA 1LGVA 3RY6C 4R3SA 4WO4D 3QI9C 3BEVA 4ZTPH 5HYSG 3MV9D 3C5ZC 4K7FA 2WK2A 2BERA 5JR1L 3MV7E 1N7ML 1E28B 3B9KD 2A73B 1NL0H 2EE3A 1T21A 4PG2C 4ZS6D 2UZYB 2AQ3A 4OFPA 1SYVA 3LEXB 1AIFB 1AI1L 2X10A 3CXDH 1DDHB 4HWBL 1PEWA 2XRAH 2Z93B 3SKNB 5K9KA 4I0CC 4ZFGL 4MQTB 4BSWA 1EGJH 5GS1A 4HJGA 5DJZA 4KJPD 5AYUH 5E8PA 2Z9TA 4P5KB 4P23D 5E8DL 3MREA 2WW8A 2FBOJ 4FFYL 1E4JA 4CJ0A 3NIGF 4Q97A 2O61B 4G3YL 3MCG1 5B22A 4BQCA 3DO3A 1BBJA 2P5ED 4LIQH 1MVUA 1QLFB 4JHBA 3N9GL 4IJ3B 5TDNA 3B3IB 2DDQH 2E27L 1A7PL 4TULH 1KTLB 3HUJE 1IJ9A 4GBXC 3UTZB 1LO2L 4H20L 3SGEH 4HK0A 1IAII 4NRZA 1QSEE 2H2PD 5JOPE 5TPWL 2GJJA 1CFSB 3E8UL 4OZ4B 3V4UL 2IPTH 1WBXA 3OKYA 1MFBL 5CSGA 1RZ8B 1VGKB 3UTTB 2UZIH 3MCLH 4I0KA 5IR1A 2Q20A 2DQGL 3RUGE 4GKZA 4FQCH 1RZJL 3QJFA 3O8XD 1L6ZA 1CDUA 1PKOA 4L8BA 4KTDL 1P69B 5EUKA 3JWOC 1HILA 1JUFA 4LNRB 2DQJL 1I8MB 5JPNB 2NX5B 2W0FA 5KG9B 3MOAL 4R4FH 1Q9KB 4H0GA 4UUJB 1OGTB 2FJFB 3GSRB 2R2HB 2VISA 3BEWA 3HG1A 2AEPH 1VFBA 3MLSH 3O2VL 3OAYH 3NIDF 2PN5A 1RIVL 2W9LA 5DDHA 2IAND 1F58L 4O5LL 3U0WH 3TA3C 1KLGA 4PJ8C 1R5VB 1WFOA 1K4DA 4S0TD 4PGEA 1NANH 1MAJA 4OLZL 1TZIB 4XPGL 1JFQL 4Z78B 1T7WA 1MI5D 4K3DL 1FFNB 5HVHC 3UPRB 3MRRA 5KOVC 3LRGA 1CTOA 5I30L 4HEPG 5E2UH 1RJYA 1U6AL 3QWRA 5I18L 3VRIA 4LPWA 2W65A 1I75A 4GW4A 3EOTH 3TIEA 4PJGE 3EHBC 4Z7QE 2CUIA 4JDZA 1RZIB 4CNIA 3BN9D 3W5MA 1HQRB 1JWMA 5EZJB 1ED3B 4XP4L 1P53A 1QFPA 3P4OB 4KV5F 5C0IA 1DEEA 4ZTPL 5C08B 2N1KA 4QHNA 1U3HA 4TUKL 3QUYB 1RUMH 4MWFA 3U0TA 1NL0L 5EG6C 5B38G 4WI4A 3UDWC 3BZ4B 5D1QD 2JK5A 3DRQB 3RVXC 1S7UB 1FIEA 3ZKXB 3CXDL 4P4RA 4YPJA 4YHOH 3HR5A 2AJ3A 3OKEB 5F1SA 3BD3A 4PJEA 1YEEL 4F2MB 5CSZA 1RZ7L 3INUH 2Z8SA 3QEHA 5CSBA 1EGJL 4H1LH 3L95A 1CLZH 2NZ9D 4L4TB 3CZFA 2HKHH 5AYUL 1CICD 3RJDA 3EO0B 1KT2B 4R7DA 1EX0A 3PHQB 1EEZA 2YD3A 4LIQL 5J6HB 3H0TA 4X4XB 1J1OL 4X7FC 3RIAF 5HHOB 1AP2A 2DDQL 2MJWA 1F6AB 4TULL 2AXFB 4ZNCD 1MY7A 4P5MA 5DMKA 1KJVA 3IS1X 1B88A 3QEGH 1XGYL 5I1KH 1T1YA 3QUXD 2PKDA 1FNEA 2UZIL 3EGSA 1AGEB 3MCLL 1CE6B 2ORBH 5JDSB 1LEGA 1IM3A 2BFVH 2DQHL 2R1XA 3OL2A 3QRGH 4N0UA 4FQCL 4XHQA 2W38A 4F7TA 5J3HC 1A3RH 1TFHA 3RVUC 1NCUA 1INQA 1H3WM 4R2GD 3KPRB 1G9MC 1BVZA 4RIRA 1YY8B 4NNYA 2VJXA 4QRTA 1OVZA 4L3CA 3BRGC 2I5YH 5F6IC 4R4FL 5DJ0B 1LO5A 2WINA 3TM6A 3SOBH 3WO4C 3MX0A 3R1GH 5C0BE 3ZHLA 5GPRA 4R26H 3MLSL 3A6BH 3X11B 2J8UF 5IJKA 4E9LA 1I1YA 5HGAA 3QIBD 1X5YA 5GGTA 1WBZB 1X5KA 4U2YA 2HT4D 3VE0A 1YZZA 4IOFD 3LPFA 2J7LA 5D1XA 5E24E 4NQEB 4HPOH 4DZ8A 4M6AA 4WHDA 4LCYB 2IH3B 5E2UL 1HNGA 1UEYA 1T7VA 3KAAA 3DOSA 2ITCA 1K3IA 4XNUL 1M6OA 4WUUD 1UXSA 3EOTL 4X4YB 5FUCE 3QEQA 3CX2A 3UP1A 4EKXA 5BS0A 5I19H 2EKJA 4PS4H 4KHTH 1U95A 1U8KB 3LB6C 43C9B 4ZUVB 5DZLA 4YDKH 5F89B 1IQDA 2NTSP 5CIPB 5JPMB 3OMZA 1G9EA 3HMXL 4G7VH 1MOEA 2CDEB 3G9VA 1J11A 3HCVA 5DO2C 3IAPA 4HXAL 5CEZH 3LS5L 1Z3GL 3ZZ1A 3RY6A 3WL9A 4ZFOA 4KRNA 2HFEA 3QI9A 5FV1L 4I48B 1E0OB 3GMOB 4Z95L 4DKFH 4YHOL 3RGVD 4OAWB 4HIJA 3GJFH 3C5ZA 1QKZH 4PB0H 5T3ZH 3GSNA 5JLZB 4IHOB 3H2WA 3INUL 3IFOB 5K9QI 1V8HA 3D2UD 3GSUA 2NW3B 4NUJA 5JW4Q 2HKHL 3LV3B 1OAKH 5HI5C 1S7SB 4Y4FD 2F53D 1M05B 1U93B 1UCTA 2IQ9H 4U1LA 3VXTA 3ULVC 5A16B 43CAB 1XCQA 2XN9A 1PX3A 1OF2B 5HYSA 5GS2H 4YX2H 1U9KA 4NFDA 2BMKA 4PLNC 3MC0A 5ETUA 1MFDH 4MQ7B 3QEGL 5J1AA 1T0MA 4GKSA 5DVKA 2YRZA 2VLKA 1S78D 2OL3A 4JPVH 1SQ2N 4Q6IC 1C7SA 4LSVH 5D2NE 2X1WL 5ID0B 1FZJB 3DYMA 4C4KO 4GBXA 5F8QC 5H2BA 1P6FA 3QRGL 1CWVA 4GG6B 4JZNB 1BIHA 1A3RL 4CN1A 4PRHB 1LE5A 1Q9WA 2AJUL 1QSFD 3VXSB 5IGXL 1YUHB 4BQ6A 4FQIH 2B2XL 4Z7OF 4L9DA 1X44A 4YHIA 5FGBC 1HEZB 3R1GL 4RGND 2QHRH 4LSPL 32C2B 1U8PA 4CVUA 2FWOB 2HAZA 5L88L 3MNVB 3MRIB 4UNVA 4NPYB 1A21A 4RFEB 5E4EC 2WWKT 4RISH 3MRDA 2DL2A 2NLJA 1N6QH 1DLHA 3RL1A 1QRNA 3T0AA 2HT3C 2PYFA 5AEAA 3SDAD 4M7ZB 3V7MA 4YE4H 4ZSOE 2ARJB 1E6OH 2D7TL 3W0WE 3CFEB 2VZ1A 3HPLA 3L3DA 4HPOL 2GJZB 5KSBA 4NC1E 3IVKA 2AK4B 4WHTB 4JDTH 3MUZ1 3TA3A 1R24B 5HHME 4PJ8A 3V5DB 3AAZA 1T1WA 4ONHB 4R8WH 3T2PA 4OZGA 4MX7B 4KHTL 3GRWH 3OR7B 2Q8BH 3RZCA 4NZJA 1NKRA 2R8SH 4YDKL 4HJ0C 4JFEA 3DLQR 5C07E 4QOKB 3I6KB 4C56A 4CVZA 4Q9CA 4X5LA 1OARH 5EN2A 5CEZL 1B6DA 4LSUH 4JFHE 1LK2B 1ZHKB 4XZUA 4NQCD 4KZDL 2CH8A 4DKFL 3QULB 5DURB 3HNSH 3NAAH 1F2XK 4PV9A 4P57A 1HHHB 3DV4B 4PB0L 4NP4L 1QR1B 5C9JB 5LJYH 1WF5A 4WFGD 3ZE1F 2VDQL 4K23H 3UDWA 4QXUH 4MAUH 4YDJB 5CFHA 4Z77B 5I8EA 2G2RA 3TT3H 1U92B 3MTRA 5CJOH 5ISZB 1WIOA 1WCBA 2FECL 1DBKL 1Z9OA 5J57B 4RDQF 4CU8A 2AVGA 2PNDA 4POUB 2FIRT 2OTPA 3PV7A 4P3DB 3FFCA 2DAVA 4L8CA 3BGMB 3ZKNC 4XCEA 1ZLSH 4GH7B 3MRPA 2VITA 2XACC 2ICEA 2VXVH 4ELME 5K33A 1ZV5A 5DMJB 4P2RE 2M2DA 5B38A 1MFDL 5AYQA 3AU1A 3EYOB 3C08H 5I1HH 4PJ5A 4X8XA 1UJTA 3MJ7B 3PV6B 2W60B 5JHDA 4J8RB 5CMAA 4BKLA 4N9GA 2X1QA 3QDGE 3BZFA 2I07A 4P46D 1T66D 2RAMA 2ATKA 2BNRD 1YN7B 4CDGC 1G9NH 1MQKH 1U8IA 5IB1A 3NFPA 3RKDC 2R15A 4R0LC 5KSVB 2NTFB 3NCEB 4BZYA 4FQIL 3PNWB 5FYKD 1CLYH 2H3NA 4OZFH 5DJZB 5E8PB 1IC7L 1NCDH 4ZYKB 3WHXA 5DMYA 5FUZH 1NGZB 3CPLA 3QH3A 1XCTB 4XC1H 2XTJE 4ORGB 5FAAA 4RISL 1F4WH 1N6QL 4OGAC 3X13A 5EUOE 3K1KC 4PGJA 1ZLWH 1BFTA 1B0RA 3ESVF 5I8KH 3W9DA 4TSAH 1AJ7L 4N8CH 3VDAA 4WTZG 2X1OA 1GGYA 1F5WA 3QR2A 1DE4A 2R23B 1WIUA 4KKAC 4EOWL 4R8WL 4NN6C 1H8SA 1UZ6F 1A64A 4WY7H 2R8SL 1R6VA 4U1NA 4NN7C 3O41A 1V05A 1DQDH 4G9FD 3LKQB 4M6OH 2EEDA 5HDLA 3C5SA 1JNHA 3S3JA 1H3PL 3U4EA 1OARL 5TF1L 4IRJD 1MJ8H 4DGYH 1GGCL 4NQSB 1MIEH 5DJXB 3RBGA 1PJ9A 4QRPE 2YN5A 3HNSL 3QNYB 4IDJH 4NKDB 4JCLA 4YEFA 3BEWB 4Y16B 2Q7YA 1RAMA 2E7CA 3HG1B 5CP3H 2VDLH 4OFVA 1XIWB 4JFYA 2IBZX 4LASH 5C09D 3SE8L 1XZ0A 5T1KA 3MRJB 1K4DB 4OF7A 2DM3A 4UOW1 3TT3L 2VLLB 3O9WA 5FKPA 3UJTL 4J3SA 4N0FB 4K7PL 3W11C 4ODSL 4Z76A 1RSFA 1MIML 3MRRB 1RJZA 4UT9H 3RDTC 5DQJA 3V6ZA 5GZNC 3BUYB 3N1FC 3GMQB 4GS7C 2E6JA 5INDA 4PJCF 1OCWH 2VXVL 1N5AB 4FXKA 1IM9D 2P49B 5E8EA 3QDME 4E5XA 4WJ5A 1ND0A 3MQIA 4K3JL 3C08L 3ES6A 2Z8VC 5I1HL 1HOCB 1JZ4A 2LU4A 3BXNA 1A5FH 4S10A 1URLA 4LKXB 4RZCA 5EFIA 3GIZH 4MWFB 3U0TB 4DAGH 2EDBA 1ZT1A 3VFTA 5DRXB 1JZ6A 3E6HB 1C5CL 3KS0J 1G9NL 4JPKH 1MQKL 3HR5B 4AYFA 5FCUH 5ALBL 1FZMB 3V0WH 4JO1H 4WFFD 4YNYA 4QHMB 4Q6IA 3SDCB 4L4VD 1MY5A 3GKWH 2FO1A 4M5YH 2PCPA 1GHFH 4LARH 3QEHB 4FTVB 3L95B 1CLYL 4UQ3A 2D7QA 5F21B 5DEGB 4GLRH 2FH6A 4OB5L 4POYA 3GMNB 4NSKB 3WXWH 5F3BB 1NCDL 2HP4A 5FUZL 1NAKL 2H6PA 5F7WC 1WK0A 3VFPA 3QUKB 1ZOXA 5C0CE 2DS4A 3FRUB 4XC1L 4L29A 1MLCB 1F4WL 1ODAA 5FGBA 2IQAA 1V7NH 1EBPA 2B39A 2EDHA 5FK9A 4QRUA 2Z0BA 3O45A 2ADIB 5I8KL 1KPRB 1ZSDA 3U4BH 1S5HB 1KJVB 4PP1D 4P2QD 4TSAL 4JAMB 3VGBA 1HXYB 4AL8H 3TT1H 1YN6B 3NGBB 4LCWE 1G7LA 3BMVA 1QEWA 3CDYA 2J12B 1IM3B 3OWEA 1JV5A 2VLMD 4JLRA 3NCJH 5C6TH 5DFWH 4F7TB 3RL2A 1DANT 3MLXL 4KKCC 1WTGT 2G5BA 2GIYA 3IDNA 5J11C 3I6LD 5JQ6H 1LK3H 1MJ8L 5E2JA 5C0EA 4MNHB 5MENA 3FQWB 1J05B 4JPWL 3VI4F 1MIEL 4P2CG 3WFBH 3SDXB 5KJRH 2DLEA 2IBBA 1S7QB 3TPUB 3PQYA 2BRQA 4HUVB 3CLFH 4MHHI 1ZT4A 1EUTA 4Q0XH 1S9KC 4IDJL 1JGDA 1A6WH 4OGZA 5I15L 1JWSB 1LD9B 3CJJA 2FCBA 3MRNB 1JGLH 2VDLL 4P3CH 3K2UH 5D93B 4LASL 2OZ4H 2K1MA 1YNTA 3EDKA 1V3MA 4U1JB 3GJEB 5MI0C 3IDJB 1NFDA 3ABZA 4C57C 1XF3A 2BNQE 2FBJH 2K3TA 4I2XE 1I1CA 3TFKD 1QZ1A 5D1XB 3MBEC 4PJ7A 2PW1B 3MRFB 1ACZA 4LHUG 3OQ3B 3PWPB 3HA0A 3QEQB 1W72B 2H2SD 3S9DB 4K8RL 1MJ7H 3G5XA 3MRBA 1KB9K 1AQKH 4PJAA 4QF1A 4NHCL 1TCMA 2FATH 3DO7A 2N7BA 2HLFC 5GZOC 5EU7C 3GIZL 2P45B 1DR9A 4DAGL 1KJ2H 3EO1B 5FYJE 1HSAB 3Q3GB 2H8PB 4OT1L 3VFNB 5C0NC 3RU8H 1EEUA 3QUMB 4X8JB 4JPKL 1NBQA 1H3XA 1A7OH 2VL4A 5FCUL 5E8NB 2ESVE 3MLUL 3V0WL 1CD8A 2JJUA 3RPIA 1YY9C 1G7MB 4MCYB 2GK0A 1SHMA 3B6SA 3G6JB 2XZQH 3BI9X 1S5IH 5GQBA 1GHFL 1DBJL 2B1HL 3H6JA 4X6DE 4LARL 5E6YA 2PW2B 5CJBA 1IILE 3GO1H 2VWEE 5DFVD 4HULB 1AKJA 3WXWL 4QGTA 4R0LA 2GUOA 3VXTB 3VFWA 3SJVB 1S7TA 4D9LH 1I1AC 4GJTB 4ONFH 4KMTH 3EYFA 5IV2B 3M17B 2FX7H 1CD0A 2EYRB 3U4BL 2Z91A 5ETUB 4NQXB 4AL8L 3PWJA 1CDIA 1T0MB 4G8GD 3C09C 4GKSB 3S37X 5JNYA 4XPTH 1NFIB 3QHFL 3UTTD 3O3DB 2YD5A 5I8CA 5C6TL 3FN0H 4P5TC 2C26A 3QAZB 5JW4N 3PP3H 5GGSA 4NHUB 3IFPA 2D4DA 2O5ZH 2X4UA 4KVNL 3TYGL 2FR4A 1PYWB 4PJBF 3SKOA 5JQ6L 4TRPH 1RZGB 1R0AH 3WFBL 1NFDE 3GBNH 3MV8D 3MROA 3ZDYE 2RR3A 4S1QL 3DSFH 3ZL4L 4DWHA 1A6WL 4BFBD 1T1XA 3P0VL 4KJWD 1J0HA 4WTZA 1VGEL 1FC1A 4S2SA 2OZ4L 3RWIB 4Y5XC 4ACPA 3OGCB 1A7RH 1QRNB 4FABH 3S34H 3GDBA 1PSKH 2P47B 1AC6A 4XCFH 1NLDL 4G6FB 4RMSA 1MHCA 3DVIA 4UV7L 1F4XH 1D5XB 2X05A 4A2LA 4QWWC 2X4OA 5E08H 3GSOA 1MNUH 1KF9B 3TBTB 3TNNB 4D9QD 1C5DA 1EMTH 3RZCB 2R29L 4JFEB 2LTQB 3EZ8A 3RDTA 3ZKSD 2ICES 1NC4B 2FATL 4PRBB 1A1NB 1AR1C 5C0FA 1W0WB 4MJIE 1B6UA 3O2DH 5C08D 4WU5B 3T2NH 2UWEB 5DJYB 1CDBA 5I0DA 4JANB 3H9YA 3WFCH 3F58H 4NZTH 5E6IB 3LS4L 3RU8L 1T4KA 5D96C 1C16B 2DQDL 3K4ZA 4M9OA 4J7RA 3G5ZA 2GAZA 1JYXA 4Y5YB 3MFGB 4WW2C 3FT4A 2EH8H 2BCKA 2XZQL 3VFGL 5I1CL 3ZKQD 1JZ3A 5DR5L 4A2MA 4BK4A 3GO1L 3PDDA 2NXZB 1FIGL 1K8IB 4OD3H 1N5YH 4L4TD 5D7IE 1WCBB 5IHZA 4KDTC 1WFTA 1G0YR 3PL6C 3WO3B 1BLNA 1I8KB 2XZCL 5ESQB 3U6RA 1JYWA 4BJLA 5J8OA 4FQXB 5JO5A 3FFCB 4L8CB 5HXMA 2VZ3A 4XCEB 3G04A 3M1BA 4JG1L 2VITB 5HHOD 3GUTA 4M62H 5B38B 3G6DH 2Y36L 3AU1B 4U6HA 3ROLB 1KUMA 3PUCA 4XAKE 3O6FB 3U79A 3VWJC 3L7EB 5HI3D 3DURA 1F4AA 2CRMA 1UENA 3NFPB 3WN5C 4ZUWB 4Y1AD 3IGAA 2B7DT 4LAQL 5TH2B 4O2EB 1VKXA 3O4LB 3KPRD 1W0VA 2JB6A 2PO6C 3EYUH 1RMFH 1A9BB 1U8LA 5CKAA 5EO1A 3A67L 3GBNL 5CEYB 3U0PB 1CT8B 2HRLA 5IB2B 4ODHH 1BJ8A 3BP4A 3IF1A 5B8CC 2VOTA 4KMLB 3T09A 3MFFA 2VL5B 4JKLA 4ZMAT 1KFAL 3ULUH 3VXQB 4BFIB 3OKKB 2R0KL 1RIHH 3A0OA 3QIWB 4UTAH 5SWZD 2C4XA 1MCHA 3TN0C 3SQOL 4FABL 1FZOB 3S34L 4DN3L 4M7LH 3LH2L 1PSKL 2XXMB 1YQVH 4JB9L 1J5OH 3KYKL 1D6VL 2DLIA 5HHXL 4JPIA 3D1MC 4HG4J 5DJDB 4G5ZH 5E08L 1DUYA 5JA9A 4NQED 2MOVA 5KS9B 3ISWA 1G1YA 4K07A 1YPZF 1ZEAH 2M8XA 4KXZI 5JUEH 4WTWA 4PY7A 1EMTL 4NKQB 3D3VB 1P84J 5CINH 2FEDD 2W1NA 3BQUC 4JFFB 3O41B 3MBEA 3KPQA 2C5DC 3MA7A 4HMEA 5D5MB 1LO0L 5DK2A 3VGFA 4XI5C 4AM0A 3CFBB 3T2NL 4UU9A 2HJLA 1G84A 4LDEB 3G08B 1QFWI 5I66A 1UM6H 3MA9H 4W81A 2YWYA 4KAQL 3T4YA 5SWSB 4APQA 4DKAA 3HZVB 3QDAA 5CJ8A 4ZUSA 4X98A 2AXGA 1RURH 1KLUA 3U30C 2VLRA 3B2VH 3V79C 3QG6B 2EH8L 4I8DA 4ZPVB 5KVFL 3O9WB 4LHUA 5FKPB 3VD3A 2NMSA 4OD3L 1N5YL 4L1HA 1S9WA 1J8HA 3HZKA 4NN5B 5E03A 1LP9E 2ED9A 4XNZC 2FJHB 1TVDA 4ZAKB 4POZC 4JN2A 4MVBC 4OIIH 1L4IA 1IGMH 3UTQA 3RA7L 4M62L 5E8EB 1ZE3C 5IB4B 1DBML 4E5XB 2BSSA 3BXNB 3IDGB 1I1AA 4IRSC 4PLJC 3AB0B 3S4SG 5GGRY 4M61A 5T3XE 1X5FA 5C0JB 4S0SD 2CLVB 3MNWA 2FB4H 3CC5A 4I3SL 1HDMA 4JREB 3VXMB 1NDGB 3MRLA 1OTTD 2RBLA 1EH9A 4YDIH 3CDCA 1ZA3A 2A6KB 1JL8A 4PRHD 3CH1B 1MWAA 3KYNA 5D7JC 2PCPB 3L5WB 4M48L 3D39D 4YXHH 2V2TA 3VXSD 3RWEA 4LQFL 4NZRH 3UYPA 1MUJA 2XQYG 4HCRH 2A74A 3TBWB 4ODHL 4UTBH 3TJEL 3LIZL 3KLHC 3EDEA 5IW3A 3MZTA 2Y1VA 4QTIH 3IFLH 1D5ZB 4UTAL 1MCNA 4NJ9H 3KPOB 3O45B 1YQVL 1J5OL 4AQ1B 3K8LA 4K55A 4LSRH 1QD0A 2OR9H 3ARQA 2QHLA 4HK3J 4OZHF 3FT3B 1K8DA 5I76A 5DUBA 1SEQH 3RJQB 3MO1A 1GCFA 4Y5XA 2ADJB 1UWEH 2AK4D 4UINH 5ABDE 3V5HA 3V6OC 4R4BA 5JUEL 3TNMB 4CL7A 4Y4KC 4G8FA 4P59H 4RBPK 3RL2B 1Q9LA 2YA1A 5EU7E 2BVPB 4Q2ZA 3EYVA 3OTTA 3NACL 2G5BB 5C2UB 1K2DB 4DUXA 4J3OC 5EOQL 5C0EB 5F7NC 2VXTH 4KMQA 1OM3H 1VEOA 2Y6SC 3TO2B 1UM6L 4QNPF 5T1LB 2UV3A 1T7ZA 4V1DB 1J8HE 2AKRB 3KPSE 5IMKA 1JGDB 3WLBA 4U05A 2DYPA 3KLDA 1ZHBB 1S7XB 1UWXK 1RURL 3VMNA 3ARFD 3B2VL 1I7RB 4R97C 3H9SB 4XMPH 3QXAA 3OX8A 2WSKA 3ZKMC 4WO4C 2K7QA 5GISH 4X4MA 1S9VA 2MCPL 3JV6A 1XF3B 1UKQA 5JMRA 5BV7H 4WW2A 1A22B 4PJ7B 5ISZD 3B9KC 1HYSC 1CFTB 3TBSA 5F44A 4ZS6C 4GMTH 3EKCA 3DUSB 4HFUH 2DM4A 2DLGA 3SGDH 1FYTE 5F6HJ 4YBLC 3GSWA 3G5XB 5IMOB 4M1CD 4XP1L 3V95A 3DETD 1RZKH 4KDWA 5D2LA 4KDTA 3TPKA 5CEZD 5EZIH 4ZTOH 4L5FL 3PL6A 2FSEA 3CMGA 3DO7B 2DQEH 3MCKB 1HCVA 1CGSL 4JQVC 4L8SC 3FT2B 4JRYE 1HI6A 4OJFH 4PBVC 3HI1B 2C9AA 2FB4L 4X7TA 4N8PA 4PRAA 4XPHL 4AT6B 1Z6JT 3NABH 4YDIL 4MHHG 1OT2A 2DQUH 3LSOB 3JWDC 1D6EA 1PKQB 4JRXE 5I8OL 5IMLA 2GK0B 1NEZG 2O5XH 4LPUA 4N68A 3VWJA 3MODH 5IQ7L 4HKZA 2CKBA 4NZRL 1TQCC 4Z5RA 4HCRL 2H2PC 2OTUB 5KAQF 4HXBH 3WN5A 4Z7VE 1TZHA 5CEXB 2WUBH 5D7LA 3TBYB 1HHKA 1GOHA 2GUOB 2X1PA 1FDLH 2PO6A 4WDIA 2NXYB 3VFRB 4QTIL 1E27B 3ESUF 3IFLL 1MFCH 4RAHA 3O8XC 3VFOB 4NJ9L 1U3YA 1R3KA 1R3HB 1RK0B 3LQAH 3UBXG 2N56A 4GG6F 2OR9L 1HHJA 1R5WB 4HIIA 5E2WH 3MJGX 4EI6B 5DEZA 2HWZH 2ID5A 5BOPA 3P3YA 3HS0B 4U7MA 4UINL 3EYQD 5ADPH 3TN0A 3R8BB 1Q38A 3FL7A 4N0YH 5H35A 1HHIB 1P7QA 1WC7B 2EE6A 3QDJA 5I9QC 4R90H 5ESVB 3S5LG 2Q86A 2DQFB 1Z9LA 4RA0C 5GGSB 5FUOH 4OGYH 4BZ1H 3KXFE 3K8MA 4IMKC 4RMUA 2VXTL 1OM3L 1WAAF 3FONB 3OAZK 4R7NA 3LKSB 5TE4L 2AI0L 3RWGB 3BQUA 3CFJB 3GIVA 4XWOD 5C0DA 1F3DJ 2YSSB 1U58A 4XMPL 4P4KB 4LU5H 4Y16D 1BIIA 3WJLC 2GSIA 3SO5A 3BPOC 1QQDB 3BN9C 1LDSA 1JZ7A 4C55A 1XIWD 1WTLA 5T5FL 5D2LE 2RIKA 3S6CA 1NUDA 3BGFB 4JG0H 4DJMA 4ETYA 5BV7L 5K9OB 3PG2A 4ZQKA 1KIUA 4F3FB 4QCIB 4EI5B 4UV4H 4GMTL 3QG7L 4HWNA 1T1ZA 1MRDL 5D1QC 3FB8B 3GZKA 2EH7H 1VPOH 3EOAA 3PIQA 2XXCB 4R4NC 2HFTA 4HIHA 5EZIL 3VXUD 4ZTOL 3QIUD 4S1DC 5CWSB 4LLWA 2BDNL 5SX4I 3FQXA 3AY4C 5EO0B 1AGCA 4ZXBB 5IB3A 4FZEL 5M95B 1OLZA 2HG5A 2HVJA 1B0GA 5IF0B 2NZ9C 4OJFL 1YNKH 1CICC 4U6TA 2VAAA 4X6FB 5CJXC 3EW3B 4U6XB 4RWYH 3K74B 1T5XB 4LLYA 1L7TL 3BAEL 3QFJA 4JFDE 4E41A 1KYOJ 4IRSA 3KPLB 5L9DL 1RK1B 2O5XL 4GRLD 1FL6B 3SDCD 1BD2B 3CAFA 1MLBB 4HXBL 4FTVD 5AUMA 2FH8A 3ILQD 2X9YA 35C8H 4KY1L 1OAUH 2DICA 3QUXC 3CD4A 2GTWA 4KRPC 3JUYA 5D7JA 5EOCH 1P5VA 4NRYA 5J12B 1IL1B 4MXVE 4YHPB 5EWIL 4PREA 3L3GA 4YK4C 2R0WH 2X2YA 5F9WC 5HY9B 2X4PB 4XP9L 1MPAH 3S4SA 3LQAL 4R2GC 4Z7UE 3H9ZA 1T2JA 4RGMC 2YUWA 1WFNA 4L3EE 3EFFA 1YDPA 1IARB 2QQNH 3ZTNL 1Y18B 3WFHA 1X4ZA 4JRWA 1NUGA 1OB1A 2XWJB 5ADPL 4LDLB 3FB7B 4N0YL 3X14A 3VWKD 3FO0L 1MAKA 3DMMC 5IJVA 4LOUC 1A7BA 4M7KL 1QPPA 3MV7B 3EOYG 4EEEA 2PTTA 2YC1B 2PYEA 1G7HB 4XMLL 1P4LA 4JO4H 4X5WB 3K2MC 4BZ1L 1W0VB 2JB6B 1KN2H 4I0PB 2H26B 3QQNA 2HT4C 3QJHA 4OLVH 3AS2A 4Y4KA 2O93L 4IOFC 1FYHB 3IYLW 1AGDA 4XGZB 4HF5L 3C9NA 3UTSE 1G1CA 4O58L 3HN3A 4M93C 4YGAB 2EKSA 1NCNA 3T0DA 1MAMH 3X3GH 3MRQA 5EULV 5C71A 1AC0A 5F1KC 2APFA 2DJUA 2NR6D 1OWWA 4LLMB 4G43A 5TDPA 4NKMA 3U9UA 1IC5H 4JG0L 5ALCH 4JPIB 1H0DA 3HUJB 5I1DA 3FQTB 4MNQE 5BOZG 3WHE1 3FMGL 4WO4A 1QSEB 2Y5EA 5BXFA 2EH7L 1S7RA 2XIDA 3C60B 4PJHA 3RGVC 1JF1B 4MA1C 3HHRB 3MV9A 1G7IB 2QL1A 1NGPL 3BE1L 2Z35A 3B9KA 4MZ3A 3H3BC 4L9LC 4PRDA 2GY7B 3DVGA 2HJLB 4K3HA 4O02L 4M6NL 1P4BH 2E9IA 1GPOH 4Y4FC 2A77L 4I4WA 3VXRD 4LIQE 4APQB 1OD7A 4G6MH 2IBGA 4ZUSB 1TVHA 1KIPA 3IJSB 5IM7B 4JQVA 4ERSL 4L8SA 2VLRB 4ODVH 5JW5A 1TZGH 5I73C 4WW1B 2E6QA 4DTGH 2XYCA 1WBYB 4EJ1C 3C8KA 2D31B 1RUKH 4JGMA 2L4OA 1R3JB 2P5WA 3VRLE 1MCKA 2P5EA 1S78C 2VQ1B 4K8RD 3EYSH 3IT8D 2LABA 1YMME 3BD5A 3PF2A 3SPVB 3RVVC 3SJVD 2NY4B 5HGDB 1A7QH 2ZSVA 1N0XL 2R0WL 2ZUQB 1JTTA 1H3VA 2YK1L 5IEHB 3LRSB 4HLJA 2J8UA 1TCRA 5FV2A 1BMGA 4FG6C 3V6OE 2ZOKA 2WBJC 3VG0L 1P5UA 1HH9B 3O8XA 3OR6B 1B0WA 4NC2B 4PV8B 3IJHB 4RGNC 4HFWB 2IADB 1NEZA 5CD3A 1WLHA 5E5MA 3CFKA 5JOFB 1VFUA 1FPTH 2HFFA 3V6FA 4LLQA 4JO4L 2ZOLA 4NNXB 3STLB 2V2TB 4OLVL 3SDAC 1MUJB 4Z0BH 2OJEA 2X4SB 4XBEL 2R0LH 2IANA 3HPJB 5JTWA 4LMQI 4MQXD 1CI5A 4PJFF 4X9HA 3UBXA 3BX7C 4IMKA 1BQLH 4PJHE 4F33B 4KK8D 1P4IL 3WNMA 1MI5A 5FGRA 5GGTH 2ZUVA 4NZDA 3DI3B 3V4VH 1RFDL 3MJ9A 2KL6A 4IS6B 1ADQL 1F11A 4DN4H 4Y2OA 1NBZA 3WJLA 4G6FD 4WRLA 3LDBB 1D5MA 3S5LA 1Y6MR 3SGEI 2YD2A 2Q8AH 5JQHC 4Y2DB 5I74B 1DVFC 1HQ4A 1J1PL 3SDXF 1DQQA 1CFQB 2VTFA 5TGBA 3FO2A 5DMGC 5IB5B 3DIFB 4Q2ZB 1QVOA 3BRFA 4HK3N 4ODWA 5M94B 5DD0H 1A3LL 3FOLB 3UROR 5LVEA 4NNPL 5D1QA 1NC4D 4N1CA 1B90A 1FVEA 5MERB 2P5WE 1P4BL 3ZMRA 2Z8RA 2JJVA 2V17L 3P77B 2XFXA 2RFXB 1T03H 4WFED 3KNBA 3WLBB 1T22A 5HHVH 4Q9QH 4FQJH 4OLWL 3U2SB 5DRWB 3OKOA 3DX7A 3OKMB 4ODVL 2BOCA 3GSNH 5FECB 1CICA 4DTGL 4XT1C 4TVPE 5C0BB 5CJXA 1A9EB 3VMPA 3K0WA 2QADC 4JM2B 3LHPH 3DRTA 4LEXH 1S9VB 4PIRF 5D9SB 3TJHD 3W2DL 1MCJA 3HAEB 1WJ3A 5EO9B 4Y19E 2NXZD 1IGFH 3QXUA 3EYSL 5GRVL 2Y7QA 3NPSC 3KR3H 5HHPB 3LKNB 4P46C 4TSCL 1FVCB 9CGTA 2F74B 4FQXD 4XPFL 3KLAB 4K9EC 5E5RB 3QUXA 4GXUM 4C83B 4KQ3L 2A6DB 3ECBB 2AAVA 2IMMA 1U8HB 4GO6B 3UC0L 1T0NA 2B5IB 3SKJL 2OL3H 3H3PL 1HI6B 5EU4B 3SCMB 3ARBD 3GHEL 4MDJA 4PRAB 3O6FD 3ZSSA 1OSPH 5FGSA 2W9DH 3DXAE 2ATPB 2A6IB 3BH9B 5EORH 4ELKA 4PJXA 1F42A 5FFLA 2EDKA 2IH1B 2X4NA 5AWNH 1T5WB 2IALA 4RMTA 4NRXB 1HKLH 3PDOA 4IOIA 4JFQA 3FJTA 5JIPA 1S7WA 1QBLH 4J3VA 2YBRA 4HS6A 2BOBA 3SE4C 3BIKA 3O4LD 1F13A 3QA3B 4FQQB 5IP4A 5ID1A 1GGBL 2JKXA 2FGWH 1AR2A 2GCYA 2DIBA 3JWOH 5FYLH 5D7LB 2I9TA 4BZ2L 3QIBA 3CXHK 2YPKA 3J7HA 4J1UB 4JDVA 1BQLL 2VDRH 4JFXA 5MP6H 5L0QC 1KN4H 4JO2H 4RGOH 3V4VL 4PY8I 1X3DA 4XWGL 3TO4D 5I1LA 5DRZA 1AO7E 4HUMB 1D5IL 1HZHH 3Q6GL 3RVTC 4WUUA 4DN4L 4IRJC 3MGOA 5EBMB 5D7SL 4QT5B 4ZDHA 8FABA 1P7QB 1IGTA 1YEKH 5T3ZE 2ZCKL 3HNVH 3BP5B 3D3VD 5GGQL 5BCAA 5HHQB 4MXWL 1KXQE 4JFFD 2LQRA 4XVSH 5HYEA 4GRMB 4NZUH 3DGGB 1MHEA 2OR8A 3RGVA 1ETZB 2FO4B 1MF2L 4NUGH 5C0AD 1CXHA 4ZFOL 1T03L 1OAQH 1N2RA 3GMMB 4FFVC 5DTFB 2FL5A 4BSJA 5HHVL 2VZSA 4FQJL 4Q9QL 2C1OB 4M00A 3C6LB 3D2UA 4L9LA 3T1FB 5SWSD 3GSNL 1MREH 3LZFH 4NO2A 1BWWA 5F9OL 4PRNA 4V2CB 2FJGA 4Y4FA 4FS0A 2F53A 3LHPL 1I7ZA 4LEXL 2HJFA 3RVWD 2UYLA 5AG8A 3OZ9H 2WWMC 5BRZE 4NM8H 4HUXB 1IGFL 2VSCA 5EZLB 1UB6A 5JHLH 3X12B 1OPGH 4MA3B 2V5YA 5BMFL 1T1ZB 3W5NA 3W0WB 4BYHA 1RULH 2D9CA 4ZAKD 3PIQB 2UWEF 4NWTH 5HHMB 2X7LB 5IG7A 4AJ0A 2B4CL 1VHPA 1TPXC 1AGCB 3U82B 1KG0B 3LEVH 1OGAE 5E9DA 1B0GB 1OD9A 2OL3L 5C07B 2AEWA 4MDIB 5F1NA 3VFSB 4HZLA 2VAAB 1WIPA 5HGBB 4F7CA 3QT2A 5KBNC 4Y4HB 2W9DL 3W39B 3MRHB 2V7NA 4ZUUA 3VXMD 5GS0C 3QFJB 5AWNL 1YYLH 4E41B 4X9GA 3OAUH 4YHYB 2EE9A 4U6YA 4AH2B 5FA4B 4UMGA 3VXPA 3BOVA 2CUMA 1DQJB 3IETA 3IAGC 3AXLB 3O6LH 4PP1C 3HNTH 5HPMB 1JE6A 4DUVA 2FGWL 2QV2A 2YRLA 5E0QA 1KXTB 3JWOL 4S1SH 3FQUA 4BQBA 3EFDH 4NQTA 4LGRB 1MCWM 3BD4A 3HRZB 4PGBA 4LSTH 3SDAA 1GZPA 4OKVA 2ADFH 5ENWB 1F4YL 1QG3A 2FECI 2MHAB 1N64L 1NGWA 3V6BR 3MRCA 5IKCA 4RGOL 1XT5A 4CVXB 1DQMH 1HZHL 1Q9OA 1MRCH 3BKMH 2GT9B 3JSSA 5HSFA 5MHSE 1C1EH 4F7MA 4ELMB 4P2RB 4K71C 4M7JH 4NJAL 4G7YH 3X14B 3D0VB 5JIKA 1YEKL 4LRNH 1MHPH 3T0EC 4X6BB 3I6GB 5I1IH 1RUPH 3FB5A 2BVQB 3H9HB 2HT2D 3HNVL 3PXHA 1OLLA 4Q7DA 3QDGB 3OJDA 2FDBP 4LLVA 4PP2A 4XVSL 4PJCA 4NQCA 1A3QA 3QJHB 3PWUA 2OI9C 5HDOA 3AGVA 4XHJD 1KIRA 2VLJD 5FA3A 4N5ED 4NUGL 1OAQL 2I9LA 2JLLA 2QJDA 1AGDB 1I1RA 3TESA 4K7PX 5T1LD 4V1DD 1LEIB 1CG9A 1Q94B 5CBAA 2VMFA 1TDQA 1KNOA 3TBVA 1V5JA 3UAJD 2C3VA 4MJ6A 1CBVL 3LZFL 4WI6A 3EDJA 1NCCH 1NGQL 3H9SD 5HYJA 3GBMH 5KS9F 3HMWH 4ZUTA 2XTJB 2Z92B 5DT1L 5TDPB 1BX2A 1XMWA 2R9HD 4EDWH 5IW1A 1M7IB 4NKMB 2E8YA 1HXMA 3F12B 4NM8L 5EUOB 3P9MB 5E9DE 1H0DB 1IKFL 2N7AA 1GC1C 4LNVA 5JHLL 1OPGL 3L7FA 2Y5TA 5H94B 1AD9A 2VB5A 2V6HA 4WO4B 3VXOA 1UGNA 1GJIA 2RQ8A 4HAGA 1NBVL 3K3QA 4NWTL 5ICXA 2X70B 3PWVA 4OLEA 2ZUWA 4TYUA 1EHLH 4DKEH 3CVHL 2IEPA 3ZDXE 3TYFA 3MJ8B 4HEME 3L3JB 3ULVH 4P46A 2BNRA 3HE6D 2APWA 5INCB 4EBQH 3WKMH 4H25A 5DA0B 4O2FA 3F7QA 4D94A 1A1MA 4JVUA 1AXSB 5SWQA 2ZPKL 4HGWB 2X9WA 1OTSD 5AZ2H 1UACH 2CK0H 2EIDA 3QCTL 3X3FH 1PLGH 3DX9A 4QRPB 4NT6B 1NQBA 4YXKH 3SKMB 4P23B 1ITBB 4IJ3C 1EEYA 1LDPH 3O6LL 1FH5L 3UJJL 4KKLD 3U7AA 2G75A 4MXQD 1JHTA 1U8MA 4HV8B 3LRHA 4JM4H 4S1SL 1G9ML 3EFDL 3AREB 1OP5K 1BOGB 1CFNB 1IEBA 2J4WH 5E00A 5IEKB 4OM0H 3OBAA 1NH6A 3CVHB 5DHXB 1NUFA 3L3HA 4H5SA 1KCSL 4LSTL 4WEMB 3SE4A 3DSNA 2C1PA 4I18B 2NXYD 4WENB 3B9AA 4M4PA 2HJKA 4X6EB 4XNMA 1OT1A 3RWFB 3CUPB 3HI6H 5C8JA 5GRWA 4HUUA 3WNKA 5GSRA 3SE9H 5L2KE 1C7TA 1BJ1H 3LQZB 3MMEA 4PJIF 4JJ5A 4HUWA 4KK9C 3V7AG 4G7YL 4LRNL 1UQSA 1CN4A 3FO1B 1RUPL 5EC1B 3U83A 3ZE2E 5F72S 3CFKB 1LWRA 3L5XH 2Y25A 4KJWC 2CDGA 3B9VA 2WQRA 2AJZB 4IRJA 3RWDA 4BH7A 3MRMB 1HWHB 4MNGA 4XTRD 5HYJE 2V5RA 1MH5B 5IVZA 1ZT7B 2VR4A 5BZDB 4HD9A 1EDQA 4ODUA 5HD8D 4N0CD 3MLWL 3CVIH 2IANB 2WP3T 5LBSH 4G8EB 1T3FA 4YC2B 3PP4L 5JZ7D 5A1AA 1FE8H 1MJJB 4IMLB 1HHGB 4OCSH 1JGEA 4QRQB 3QEUA 1XGQA 4P4KD 5C0CB 1OHQA 4ISVB 3GBML 4F7EA 3HMWL 5ESAB 3R8QA 1ZGLB 3GSXB 4R9HA 3OKLB 4MD4B 3H7BB 2NYYD 3RP1A 5FIEA 1JGVH 4I9WE 4LLDB 1T2QH 1QP1A 1X6LA 1XGUB 1BVKA 2AV1A 3QUYC 1IM9A 4LKCB 2XA3A 4EI5D 4MA7L 4GW5B 3ZKXC 5EBLA 5TGBB 1I7UB 3FO2B 1EHLL 3CCHB 4DKEL 3NZHH 1UXWA 1DN0B 5EIIA 5ANMA 3ULVL 5D1QB 4P9ML 1FVDB 2EDNA 4JR9H 4UBDD 1FAIH 2X89D 5EPMA 4AIZB 4YXLH 4OD1L 4X9FA 4EBQL 2CR3A 3KPMB 4K2UH 1A14H 1EVUA 5KOMC 1T22B 4RFNC 4L4VA 1UACL 3TCLA 4LPCA 4MD0A 3OKOB 4F58L 2VERN 1G6RA 1SJEA 3L6FA 2B1AH 4YXKL 1OSZA 3FHAA 1N59B 1S8DB 3ZYZA 3QUZB 1AQDB 3ZHDA 5LWYH 3N85L 3MV11 3SGJC 5FYJL 1FG2B 1FNGB 1KB5A 1I7TA 4PJBA 1BD2D 3QHZL 1S9YA 2ZNXA 4OM0L 2JB5H 2EYSA 5DHVB 3L3OA 2BNQB 3KWWA 5HI3C 1KTDA 4I2XB 4P2QA 4QHLB 2IGFL 1ZA6A 3OHXA 2ITDB 4XX1E 4X83A 2FHFA 5EBGA 3HI6L 5IHUL 4LP5A 4PRPE 3D85D 4MNGE 5JXAH 3PGCA 5JORA 3WIIL 1T0NB 5DD1H 1AY1L 4Y8DC 3SE3C 2VE6A 1WVZA 1TJHH 1ZVHA 3T77B 1L0QA 4JZOB 3OB8A 4OF0A 3QFDB 3BT2H 2F8OA 3TF7C 3D9AH 4IRZH 4XNXH 3HE7B 3MV7D 2CIIB 5TE7H 5L6YL 4U3HA 12E8L 3QDHA 3DROB 4W70A 2ESVB 4HS6B 3BIKB 5AZEH 2QR0B 3MBXH 4I0PD 1JPGB 5D6CA 3RX5A 3I02A 3CVIL 3ZLQC 2GCYB 4X6DB 5LBSL 1IZJA 3FQNA 4D0DA 3G5YB 3MXVL 5GJSH 3QIBB 4PJDE 2YPKB 3QNXB 1UVQA 2VIRB 4OFDA 3MUGB 4OCSL 2EC8A 4YAQA 1CXEA 2BHUA 2CRIA 2FEDC 3GB7A 1SVCP 1QLRA 4M02A 3ARUA 5CBEB 1T2QL 2F54E 3MR9A 1DN2A 1X5GA 2VDOH 5DVNA 1FO0A 1YEDB 1AGBA 1AE6H 3ARGB 1MCLA 3REVB 4N8VG 2J8OA 3CFCH 3P0YH 1QSED 1UT9A 5LCVH 5JOPD 1XF4B 3C60D 4M6ML 3VCLB 3NZHL 5CJQH 1NSNH 1AFVH 1WITA 3RY5A 1RUAL 1E28A 4HZAA 5EZOH 2A73A 2V2XB 1FAIL 4JQIH 3LEXA 4W6WB 4ZO8A 1C08B 1AIFA 2IPKB 4X6CE 4K2UL 1DDHA 1A14L 2AJVL 3QWOB 1R5IB 4YWGH 1MFAL 2Z93A 1VA9A 3HC0B 1Z9SA 2HTKC 1JPSL 4H1LG 4HC1L 5SX5H 3ALPA 5IVXE 3K7UA 2FJGB 5ICZB 1IAIH 1MJUH 2HJFB 1P2CB 3BPLB 5C6WH 2BVYA 2O61A 4E0RB 4M1DL 3B2UC 4I77H 5CHNB 2WLZA 3B5TA 2Q3ZA 4H8WL 3ZE0F 5MEOA 3B3IA 1P84K 3Q5TA 4MA8H 1KLFA 1KTLA 1DQTA 1OTTC 2R2CA 3UTZA 4I1NB 1U8NB 4G8GA 1N3NB 1CFSA 4HWBA 4UT7L 5JXAL 3UTTA 1JK8B 1RZ8A 1VGKA 1YEJL 1ULVA 3AUVA 3T0EE 2OJZL 1GIGH 4J23A 1TJHL 1YEHH 5F1NB 5F7MC 4YH6A 1JPFA 1F00I 1QSFB 2A0LD 4MJIB 5CD5C 5A3ID 4IRZL 1BGXL 2WUCH 4LNRA 3LN9A 3MV8A 1I8MA 5JPNA 3IXTB 2NX5A 4TQEH 5KG9A 7FABL 2YD9A 4OF5A 1Q9KA 3IETB 4UUJA 5AZEL 3MBXL 1OGTA 2FJFA 3GSRA 2R2HA 4ZFFB 4M7ZC 5HGHB 5LGJA 4U1KB 1LNUB 3GK8H 4ZPTB 3RTQB 2IG2H 3RX7A 2F19H 2NY6B 3LEYH 5C0RL 1R5VA 1AHWB 2HTLC 5D7IB 4UI2A 1EZVY 3MXWH 1TZIA 1D9KB 2ED8A 4Z78A 4XAWL 1QHOA 3UPRA 1BFVH 4OQTA 2VXQH 4OV5B 3K4AA 1UJ3B 1RZIA 3F65A 5LQBH 1HQRA 5EZJA 1OP3K 3QPXH 1ED3A 2W92A 3CFCL 3P0YL 3P4OA 3VFVB 4KU1A 5C08A 5CJQL 3H42H 4KI5F 1UYWL 3AM8C 4PP2B 2MCG1 2GITB 4WI2A 2GEEA 1UH2A 2Q7NA 3BZ4A 4KROB 3T65B 1U36A 1S7UA 2ZG2A 4GAFB 2EEAA 3OKEA 2GJ6E 5DD5L 1L9MA 4IOSD 2EO9A 3P0GB 2Z8WC 4YWGL 2BSED 1CG9B 2KUTA 4YDLB 4RA3A 5ECJE 4F2MA 2C3VB 5FO9B 2DI8A 4KUCD 3HUJF 4M1CC 4L4TA 3DETC 4QRRE 4CMMB 3BESR 1MJUL 1YMHA 4KVCH 5C0BD 1DLFL 3PGFH 1BX2B 3KVQA 2DBLH 4DFHA 3EO0A 1EJOL 4JM2D 5IW1B 5BO1H 4X80L 1KT2A 3PHQA 2DQCH 4I77L 4YHKL 4YHZH 1CU4H 1UH3A 2ICWJ 5J6HA 3JZ7A 5F7LB 1AD9B 3IB4A 4MCZB 5HHOA 4MA8L 2VRAA 3N06B 1UADC 3RUGF 1F6AA 3SGJA 1TTFA 1U8OA 4C4KT 2AXFA 5C9KA 1DQLL 1SJVA 5ILTH 5CGYD 3BKJL 3F7YA 3FFDB 4IDLA 4HT1H 2NX5E 4AENB 3GM0A 1AGEA 1CE6A 5JDSA 4YDVB 4TNWK 1PZ5B 1NAMB 4L3AA 4PLOB 3U1SH 1JNLH 4Y1AA 3SCMD 4OZHA 3ULUE 3S96B 3U46B 4U1IA 3KPRA 2MPAL 1F8TH 5JXED 1YY8A 3WYRA 3VGHA 3ZYIA 4WU7B 2AXJA 4J2XA 1AGFB 1MWAH 2QQLH 1FG9C 1B2WH 5T3XL 3L1OH 3F7RA 3GK8L 4XBGB 2IG2L 2F19L 3ARWA 3I75B 3LEYL 3X11A 4PJGF 4Z7QF 3VFMB 1T83C 2C1PB 1WBZA 1W0YT 3MXWL 1B4JH 1BF8A 1LP9B 2IMNA 2HJKB 3ET9F 3F8UB 4NQEA 1BFVL 2A2QT 3NCBB 3WIHL 4LCYA 5CP7A 5GSRB 4M9PA 4EUPB 5EU6E 4DUWA 2ZKHH 3DUUB 1JCKA 4X4YA 4LVNB 1QFOA 3VI3E 2PXYB 4XWOC 3QPXL 4G9FB 1U8KA 1OP9A 5FGCB 4ZUVA 5F89A 4WI7A 5CIPA 2JCCE 5JPMA 3H42L 3P73B 2CDEA 4Y16C 4BH7B 3HR6A 5ACZB 3I84A 1OAYH 1CZ8H 1QFUL 5JDJA 1XIWC 4P3WA 1YYMH 1KEMH 4PB9L 4XNQB 2DB8A 3JTTB 4I48A 3GMOA 1HINL 4DVBA 1QBMH 3V8OA 4OAWA 4G6JH 4U7KA 1GZQB 5B39B 1ZTXH 3P4NB 3STZB 3KPPB 5C09B 1CVRA 5JLZA 3MGAA 1AH1A 1ZLUK 5KSUA 4ENED 3C8HA 3IFOA 3C6LD 3QEUB 3KJ6H 4O4YL 2NW3A 1OAXH 1XGQB 4CW1A 2YMXH 2ZUTA 1NLBH 1GOGA 3LV3A 2E9BA 4KVCL 2DBLL 1CR9H 3QZWG 3ZTJG 5GRZA 2DQCL 1M05A 1U93A 4N8VA 43CAA 3HMXA 5A16A 1JNNL 3DBXB 4KJQD 1OF2A 3BSZL 2YPLE 4DCQB 4N5UA 4ZD3H 5FEBA 4LCIH 1L7IH 1XH3A 3Q0HA 3W0WD 2XY2A 4MQ7A 4QRSB 3MUHL 5E2VH 4EDXB 1UXWB 4HMCA 5HHMD 1BZ9B 5AAWA 1JGUH 2JJTC 5DUMH 3SDCC 3IRZA 4KUCF 3EDFA 1C5BH 1FZJA 2BSTB 4DOHE 5ID0A 3V0VB 4Z7WE 2AV7A 5DD3H 4GG6A 3ILQC 4JZNA 2P8PB 1X7QB 2YKLH 3L5HA 5C07D 4PRHA 4WI8A 4MB5A 3EJYC 4JM2F 4HPYH 4JKMA 1UG9A 4Y4HD 4TTDC 3LN4B 5I6XB 4KRLB 1KENL 4M5ZH 3VXSA 5GGVL 4XCYA 1YUHA 5CKGA 3QNZB 2KZWA 4JFHD 1QNZH 3KPSB 3WLWD 5E8OB 1PD6A 1MWAL 1FFOB 1NCTA 3GSVB 4OLUH 1HEZA 2QQLL 2MNUA 1KELL 1B2WL 2CKBH 1GGTA 4IIQB 4QTHB 5HDQH 2A6JB 32C2A 4D9RE 2SEBB 3MNVA 4KK6D 5I0ZA 3V52H 4FFZH 5TQ2H 4NPYA 3GI9H 1WAAA 2EYSB 2ZG3A 3NGBC 1DJSA 3HZMB 2HH0H 2WANA 1ZA6B 1XF1A 1B4JL 2R69H 1LO3H 4OM1H 4NOFA 4V2BA 2HVKB 2ARJA 4OI7A 3CFEA 4UILL 3N1GC 2GJZA 1RU9H 2FHBA 4RMWA 1UA6L 2AK4A 1L0XA 1FYTB 4WHTA 3V5DA 2ZKHL 3F6IA 4NQDE 5TDOB 4ONHA 4HIEB 1PVHA 1TJGH 4LQ1A 2P8MB 4MX7A 3OR7A 4KC3B 5IESH 4P2RD 1KYOK 2NY2B 4LPTA 4JRYB 4QOKA 3I6KA 5FB8B 4TNWF 4K71B 3QDGD 3PWNB 1YYML 1KEML 4RFOH 5D93C 2NR6C 4QYOB 1LK2A 1A02N 3E1F1 1ZHKA 3WE6B 4JZJB 4OZIE 3QULA 1QBML 4JRXB 2ZCHL 4G6JL 1T80A 1J86A 1ZTXL 1PG7X 1R3IH 5A40E 1HHHA 3DV4A 3U9PH 3JV5A 1QR1A 3AM8A 5C9JA 3LN5B 5D1XC 5IFJB 4HAFA 4Z18A 3KJ6L 4G80B 3RIAK 3B4NA 1TJIH 1JPST 1NLBL 4Z77A 3EO9H 3OB0H 1U92A 1R3LB 4HX1B 2I26N 4J6RH 4MJ2A 5ISZA 2A9MH 3RHWK 1CR9L 4PRIE 3IKCB 2WZPD 4WHYG 4PTTB 2XTJD 3UX9B 4P3DA 1AGBB 2A9NL 4F57L 2AJXL 3BGMA 2ZUXA 1E6JH 4ZD3L 3EYOA 2D7NA 3EHBD 5ITFB 1HN1A 5E2VL 2APTA 2FD6H 4RX4D 3MJ7A 1NMAH 3PV6A 2W60A 2IAMB 4J8RA 5DUML 3S36X 4NBXB 1QBBA 4NO0B 1C5BL 4DKDC 5D1ZB 5BQ7B 2C3GA 5DD3L 5GGUB 3FTGB 2OX5A 1YN7A 2J6EL 3DVNB 4K8RC 1QTYT 3KXFB 4HPYL 4DW2L 1IBGH 5KSVA 2NTFA 4KI5E 5IT2H 4ORZC 2J88H 4LLAA 3FAXA 1QNZL 5HVFB 4KPHH 3Q6FB 1FGVH 3PNWA 4OLUL 4QRPD 5LKNA 2X4RB 4ZYKA 1NGZA 3V52L 5I1EH 5TQ2L 1XCTA 3GI9L 5E4IA 1XR9B 2GSGB 3PDGA 1NDMB 1ZS8B 3R06A 4FZ8H 4ORGA 3S88H 1RJLB 1QBAA 2EC9T 3ARED 2HH0L 2DWEB 4DVRH 5MEOB 4XVUD 4JY6B 2R69L 1LO3L 3BKCH 1TNNA 2WIIB 4QOKE 4G8GB 2QSCH 5J06A 3QAZC 4UAOB 4YIQA 2YPVH 2R23A 4IM8A 2ZUUA 1CQYA 3BPNB 5J7CC 4I3RH 1T83A 4C58B 4JO3H 4UIKH 5DZNA 2W9EH 4F9LA 2CIKB 1JPFB 5DJ8A 2VXUH 1WWAX 3QDMD 4D2NA 1O0VA 1ZXQA 3BWAB 1FSKB 4MQXC 3LKQA 3B9DA 4U1MB 3NVQA 2HLAB 2DOCA 4KK8C 1YPZB 3MV8B 4LEOB 1FC2D 4NQSA 5DSCB 3D69B 2QQQA 3MLRH 2DQTL 3IDUA 2Q76B 4JFDB 2EDLA 1BAFL 5DJXA 1I9JH 3QNYA 3U7YH 5LGJB 4NKDA 5KANI 4Y16A 3U9PL 4U1HB 4LPXA 1XIWA 4GOSA 5F7DA 1JMXA 4R96B 1RIUH 1VERA 2XY1A 3MRJA 3BHBB 1Z5LB 4O9HH 2W59A 1TJIL 4ELMF 2VLLA 1NCAH 1EVTC 4N0FA 4YPGB 2FIKB 3RZCC 1F3RB 2A9ML 5C0CD 3Q5OA 1Q0XL 2LTQC 3GMRB 4YBHA 2O26U 2XKUA 4GKNB 1TXKA 3BUYA 1M7DB 4Z7UB 3GMQA 4OCRH 4UZGA 1E6JL 2OXGA 3PWLB 4L3EB 3DTXB 3OV6A 2VZUA 1N5AA 5SV4A 5E6IC 4AEEA 2X44D