4LLUA

Structure of pertuzumab fab with light chain clambda at 2.16a
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRQAPGKGLEWVADVNPNSGGSIYNQRFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PERTUZUMAB FAB Heavy chain
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lluA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lluA01
1LD9B 3ULUD 35C8L 1XIWC 3GSXA 1CE1L 2KL6A 1KCSH 4PJAE 1K4DA 3F7PC 1ZWIB 4IIQA 4DN3H 2CDEA 4JQIH 1CFTB 5FUZL 1Y0LB 3H42L 5EBWB 4U1JB 4X4ME 1UM4L 5GSVB 1MAML 5DA0B 5ALCL 4LFHD 1AO7B 3ZKMD 1JPST 2V2WA 3ZTNL 4HZLB 2QL1A 1XF3B 4GRWF 5IB2B 3CFBA 4WI6A 2FB4L 2Z8VC 4Q9RL 4UIKH 5KVGH 1AO7D 3MA9H 4Z7WE 1AFVL 5HD8D 1VSCA 3HI5L 4R96B 3MREA 5T1KA 1A2YA 1AR1D 25C8H 3MQIA 5HVFB 3BISA 3H9YA 4KJPD 1JMZA 3C08L 1M71A 1WF5A 2EIZA 4NJAH 3GRWA 3UYRL 5FCUL 4ZD3L 5IW1B 3C5SB 1ZA6B 4HLZG 4K07A 4M1CD 1FH5H 1RUKH 2JJUA 1EEYA 1YJDL 5ICZB 3QCUH 4FTVB 3QEHA 2F19L 4XNMA 1MH5A 3ZE1F 4Z0BH 2CKBL 1JMXA 3RHWF 5CS7A 2VB5A 3BKCH 2F5BH 3O3BA 5DSCB 3KJ6H 2IH3A 5ADOL 1IAKB 2NY2B 1MHCB 1E6JH 3FQUA 2YBRB 4UT9L 3ULVL 2BP3A 1RZKC 3LS4H 4ODSH 3S5LG 1T1YA 3GB7A 1RJYA 1RURL 4K2UH 4NZUH 2PYEB 4AENA 3RVUD 2NY2D 4JPVL 4CVZA 3OG6B 2OZ4L 1FGVH 1UZ6E 1MUJA 4H0HB 4TUJA 4Y8DC 2PYED 5T1MB 2R2EB 1YZZA 2OR9L 3KNBB 3O4OC 3L5WA 4X5LA 1ZHBA 4WWKB 4Y19B 2QR0A 2GJZB 4PRDB 5T1DH 3KPPA 3Q3GB 4F57L 2W1NA 2WINB 2IGFL 5GRVL 1D5ZB 1C16A 3ZMRA 4PY8I 3D9AH 1YEFH 1NJ9A 3NN8A 4JKKA 4PJ8C 4WWKD 4Y19D 5F88B 4LCYB 4WHDA 4GBXB 5ISZA 1PVHA 5A2JH 5CKAA 5J8OA 1A7QL 1R5WA 1RFDL 1R3IH 5DO2C 4LSSL 4GBXD 4E41E 2FX9H 3K4DA 2NXYC 3TVMB 3QO0A 1FYTE 3SGEH 3QCVH 4KQ3L 1MCWW 3CMOH 1I3RB 3HPLA 3VXNB 3HFML 4OQTH 5DUMH 1RVFL 2B1HH 2W38A 4X6EB 1A22B 3TVMD 4LCCB 2QQKH 1U3ZA 5E4EB 3N1PC 1J1PL 5ERWB 5IGXL 1U58A 1EXUB 4D8PA 1BLNB 3EDEA 3WN5B 5K9KA 1LO5B 1EGJL 5J0BA 4BH8A 4M48L 5L8KB 2ERJC 2A0LC 4HS3A 3RX7A 5CJOH 1WISA 4KJWC 5DC9B 2A6KA 3LEVH 2H2SD 4NC0B 4GS7B 2APWA 4N5ED 3S36H 2KH2B 5J56B 3RWJA 4ERSH 4KRPB 1KJ3L 5K93A 1WT5C 4BZYA 4MQTB 3O45A 2VXSH 3OAYK 2JCCA 3I02B 5DK2B 4HEPG 4KRPD 1N7MH 2C26A 1ZHNA 2DQDH 2EH8L 5FUOL 3ULUL 1JHTA 3MUY1 4ZSOB 5FFLA 3IXTB 1HSAA 3FZUD 5F9AC 4XNQB 2CXKA 4RFEA 3ARDC 3BGMB 3V6ZA 1JTOA 5AEAA 5T1LB 1V3LA 3VMPA 5C08A 4AM0A 3X11A 1WCBB 1QFWI 3LKPA 4TVSa 4ZTOL 4NRYA 1XZ0B 4JANA 4NO0B 4HG4K 3H8NA 5T1LD 1I1AB 2DLEA 3VWJB 3HUJB 1QR1B 5DVOA 2DYPA 5TE7H 1HWGB 4K7FA 4U6YA 4PGZA 2EH7L 3G04B 3PWVB 4NO0D 5CMAA 4OCNC 5KG9B 1I1AD 4M7JH 3MRJB 3QJFA 3VWJD 3VMNA 3L5XL 5GRZA 3FB6B 5EU6A 5FYJU 4Z7VE 2BY0A 4BZ1L 4IS6A 3OQ3B 4O2CB 4M43L 2VMFA 1SYSA 2VZTA 2MQCA 4YDIH 3MV7E 3GIZL 1X5XA 3QUKB 3QJHB 2VN7A 5L6YL 4NGHL 4KTYA 4N0CC 3BHBB 1D5IH 3KPLB 1IAOB 5IMKA 1KIUA 5GGTL 2O5YH 3RBSA 4FQXC 1MWAB 1FLRH 2Y72A 2XN9B 4S1QL 2AXGA 4XNYL 2IAMB 2Z92A 4GXUN 3T8XA 1OAYL 1QFHA 4NQDA 3OV6A 2CRMA 1G0DA 2E27L 2BC4B 4PUBL 2XN9D 3CNKA 1QBLL 3H3PL 3MA7A 2IAMD 2EO9A 3RZCB 5IFAH 4WFFD 3MRIA 3O8XB 2FIKA 3RFZC 5I1GL 4GLRH 3CLEH 5CIPA 3I3EA 3WXVH 1JN6A 5DHXB 5IV2A 3PHOA 1EMTH 2HH0L 4XP1H 3RZCD 1S7SA 2DQJL 3O8XD 4U1NB 4QTIL 4A6YA 4UTBL 5ENWB 5D5MF 4PGBA 2GYSA 5CILL 2M8XA 3NIGF 1AHWC 3NPSB 5I75C 2ATKB 4HFWB 2P5WA 4MVBC 5L7XH 4HWNA 4RAUB 2EE2A 4YO0A 3TNMB 4NP4L 4Z7UA 3SCMC 3FOLB 2R1YB 4ONFL 3RGVC 5F7MC 3DX6A 1EO8L 1ES0A 3KYMA 3QUYB 4PLNC 2W65B 3QI9D 2DQHH 5D1ZA 3O9WC 5B38B 3KYOB 1CZ8H 3DUUB 1MY5A 4PJAA 3MGTB 3QUYD 2BRRH 4GH7B 3RTQC 4LVNC 3P4NA 1KTLA 3H9ZA 4UU9A 1PAMA 1T1WA 3L5IA 3TPKA 1TJHH 4MQXD 3S37X 4OFKA 1FZJB 4P2OC 4JKMA 4Q9BA 2V9QA 5JNYB 1JRHH 1D9KC 2PW1B 4HDIB 4PGCB 4X9HA 1WFOA 1OVZA 1CFSB 5L2JB 5L2KB 4IDJL 2VZUA 2Z8RA 4YNYA 4P4RB 3WFZA 1KXVC 1EHLH 1EJ6A 3SDDB 5A2FA 4YUEH 1K6QH 5KN5A 3GSVB 1CR9H 5L2KD 4JO1L 1FFNA 4P57B 4PRAB 1DUYB 3FRUB 4O51B 5E6IA 5JORB 1AGFA 2P45B 3QQ9D 2LVEA 3SDDD 2HFFA 5BZWB 1FV1B 3UX9B 3REWA 2DS4A 3MRRB 5JO5A 4M6NH 5HI5C 1NANI 3I2CL 1RMFH 3BUYB 3MOBL 2A6JA 2WAHA 3VI3F 3BEVB 4DTGL 3S96B 3EFFA 4JREC 1NEZG 5EORL 5I16B 2HVJA 2QLVB 1IGIH 5IR1B 2LU7A 1FIGH 2A9NL 1XR9B 4APQA 4M8QA 3AVEA 4UMGA 5E2UL 3MFFA 1UXWB 1XGUB 2Q3ZA 4P23A 5I66A 5DJ2A 3MRGA 4Y1AA 4YHIB 3SE4C 3LKOB 5ICXA 3RWEA 1ZANH 1AE6H 1G0YR 5B8CB 2BDNH 1I4FA 4F8TA 3O2WL 4HJJH 4F7TA 4OUUB 3VGAB 1S5HB 4BFBD 3PV6B 2B4CL 4HWZA 4HW6A 4YXKH 1DN2A 2W07A 3JTSA 1T3FA 4LSRL 4E5XA 4L4VB 2OI9C 5BOPA 4FFVD 2IMNA 1KSRA 1YNKL 4OD3H 1HXYB 1NMAH 4POYA 1QEWB 4LCUA 1CS6A 4L4VD 5IJVA 3ZKND 1T2XA 3ARFC 1LO2L 1U91A 4MB3A 1R24A 2ICES 5F7EL 5IFJA 5INDB 3MUHL 4G8FB 2GCYA 1UKQA 3MNWB 1C5DB 4JHZA 5E9DB 1KN4L 4I3RH 4E0RA 1A6TA 2AJ3B 4XXDA 1C1EL 4NCC2 4IRSA 4MA3B 4S10A 4ZFZA 5MHSD 5C09A 1MWAL 1HSBB 3T77A 1FYTA 1HKLH 4TUOA 5E9DD 1NUDA 4BK5A 5KVDH 2IQ9H 3SY0A 4OSUH 2J3SA 2J8UB 3PIQB 1Y6KR 4GXVL 4ZFFA 2DM2A 2VSCA 1KC5L 5GXBB 2YD7A 4G5ZH 3F7YB 3BESR 4ZO6A 1WBZB 1ZVSA 2NLJA 4NCDA 4XPFL 1JHKH 2V5YA 1FDLH 1TVHB 3IFNH 2R1WB 4K3JH 5DF0A 5IIEB 3BWAA 2UY6A 1HCFX 2VDRH 5D72L 4MXQC 1IC4L 4Q2ZA 3TBTB 1A9BA 4RSVA 1R3JA 3SGJA 4Y2DA 3EYUL 1EFXA 1B88A 2AW2A 1IAIH 4X7DC 1ZSDB 1TZIB 3OKKB 5D5ME 5GGVY 5GGRA 3OAUH 3NIGE 3U7WL 4OCYH 1BX2A 3M8OH 5JHLH 4LSVL 1KF9B 2VLMD 3QCTH 4KKBD 1QRKA 3ULSB 4OZFA 3WLBB 1M6OB 1WFNA 4KJQD 1N5AA 3NIFE 4OLZL 4LCWB 3WD5H 1Z2KA 4U6XA 3UTOA 1UM6H 2E6QA 3MOQA 1MNUL 1HYSD 3EIFA 4FQCL 4H0IA 1NAMH 1CXIA 1UENA 4LCWD 4OF7A 5LQBH 5MEND 1IGML 3P77A 3RWGA 3QIWA 5HVHB 1IMHC 1I8LC 3V5KA 4NM8H 5GISH 3OJVC 3B9KB 2LFGA 4I4WB 5FGCE 1BZ9A 3UJTH 3MXWH 3D0LA 4G6KL 1ODAA 2JJTA 5IF0B 3BPCB 4LLYA 3BN3B 3B9KD 4RMWA 3MYJA 2YD2A 5LCVL 4PJ8A 1T1ZA 4Z76A 1SJEA 5CP3H 1FN4B 1GPOL 3MV7A 1UJ3B 1LHZA 1TPXB 2B2XL 4YBHA 1F4WL 4JGJA 5IVXE 1UQSB 3QDHA 5L88L 5HGAA 2E7CA 5DVMA 4U1GB 1XH3B 5D2LE 3L3OB 4L3CA 4JRXA 4PRPE 4PS4H 5DEZA 1YY9C 4U7MA 3WFBL 1I1YB 2OYPA 1HHIA 4BSWB 5TDPB 2DTMH 4X7FC 3T4YA 1MHHB 1EUTA 1PKOA 5FO7A 3BRGC 2AEPH 3MACH 3OKYA 3QQ4A 5FIEA 2XKNA 1JF1B 4W68A 3JV6A 4XCNB 5BVPH 4HH9A 1K85A 1LK2A 1UADC 1FRGL 3MRNB 2W0FA 3GMLB 2YPVL 2MCPL 3CFKA 3P9MA 5GS0H 3UTTE 3C2AH 5DURB 1J18A 5E8NA 3VFVB 4WW2F 1H5BC 4JFOB 3AAZA 4OZIB 3D2UA 2VXQL 4TTDC 4M3JA 3I6GA 5DD0H 5EC1A 4JB9H 1A6VH 4BQ8A 5DURD 2CK0H 1G7LB 5C9JA 2BJML 2MQ0A 3C5JB 4NQTA 5E8PA 4G7YH 1IC5H 3L95B 4L5FL 4XPHL 1KIPA 2OP4L 4JO2H 4OCSL 4ZMAT 1TCRA 3U36B 5DJ8A 4N5UA 4G9DA 4PJCF 3CCHB 5EUOF 1GGIL 1SMOA 4QXUL 1KT2B 5C0IA 1AGCA 5IB5A 3ROLB 2YRPA 4O4YL 4PRNB 2NXZB 1G84A 2DMKA 1J86A 4ZUVA 1TITA 1S78C 3GMPA 1HK6A 5F1SA 4ZUUB 2PTVA 3LMJL 3DARA 2GUOB 5B3JE 4MD4B 3CVHH 1G9NC 2NXZD 3U46B 4Z7QF 2PXYB 3DMMA 1FG2B 3L3HA 5J6HA 4JZOB 4JDTL 4IRJB 1INDL 3IJSA 4YLQT 1P4BH 1QNZL 3IU4H 4O5LH 2EYRB 4PJEF 1BQHA 5LAXA 3EYSL 2VWEC 5DVNA 5FM4A 1CD1B 2PXYD 4M8VA 5DJCA 1C08B 5F7DB 2EXWD 5HHPB 1JGEA 3CIQA 4X4XA 3KXFE 3K8LA 4FABL 1YEGH 2Y36H 3F7VB 3LPGA 4PJIB 3HC4H 3JWOH 1GZQA 4TRPL 5SWQA 3KR3H 3MCLL 3LRSB 3VD9A 4X9IA 3FCTA 2F8XC 2VLLA 3WFEL 2EDQA 1AGEB 4KHXH 2JB6A 1K8IB 1A6UH 2X4OB 3S37H 4GAYB 1UCTA 3PNWA 4CMHB 3GJFB 2X89A 3N9GH 4HWUA 1LK3L 5IT2L 4J1UA 3N06B 1FFOA 4ZUWB 3MZTA 1U2CA 3MRBB 4P2RE 4NO3A 1MHPL 4OAWB 1F3DH 4KGLA 4KK6C 4YHKL 3G6JF 3L9RB 2VAAB 4KGJA 1BIIB 1WSST 2CO7B 4KAQL 4LHUG 3W11C 1B2WH 2NPLX 4HCRH 5JW4R 1KIRB 2FO4B 4X6FB 2DOCA 2MKWA 1VFMA 3WDIA 1A1MA 1FNSH 3FO9B 3TBSB 2E6JA 1KB5H 4AEFA 1QO3B 5HJ3A 4ZDHB 1HEZB 1QA9A 3E8UL 4XPTH 5EZIL 4X7EC 4LKXB 5AAWA 4RFNB 3SKUD 1Q0XH 4QEGA 5EU5A 5I15H 5I8KH 5DD1H 3OBAA 4LMQE 1F90H 4R4ND 1J10A 3SE8H 5E5RB 1MIEL 2D7TH 4HHAB 2VL5B 4G8GE 1BOGB 2N7AA 1YC7A 1A3RH 5F7NC 1L7TH 2YMXH 3C6LC 3WFDH 3FO2A 3QDMA 4HWBL 3QT2A 3SKMB 5C0EA 5IMMA 1A1OB 2NYYC 1YEIL 5DHVB 2Q3AA 2AVGA 3PJSA 2APFA 3I6LE 1VADB 4NO2B 1YMHB 4YGVB 4EI5D 2AXFB 1FFPA 4XVTL 4DGVL 4S11A 2F58H 1T22A 3B5GA 4IOFC 2IH1B 2VWEE 1U8LB 1VB9A 4X6DE 2FX7L 2YHGA 4S2SB 4WO4C 2WLYA 2EKJA 2AXJA 4P4KC 1BJ1H 1RZ7H 4I0PB 4ODWA 1FAIL 2HT4D 4PB0L 5IESH 2EDOA 4UDUA 5LKNA 1KCRH 3GSWB 4JN1H 3AREB 4YFDB 4JFHD 2ED8A 2R0KH 4RQQA 4I0PD 1F4HA 2VQ1B 1DQLL 1XCTA 4AIXA 3P3YA 3GK8H 3TBVA 1NUGA 1CXKA 5FO8A 3ARED 5EU3B 4BSVA 3BT2H 3MLYL 4ODHL 1IAMA 5C0JB 1G9EA 5BW7A 4XAKD 4K7PL 2FH8A 4NYLB 1JPFB 5D5MA 3RWHB 4R4BB 5E2JA 4RX4D 3TN0B 2NY0C 4PJHB 1N64H 3PHQB 4TUKH 1E27A 1K9TA 1F6FB 1OQOA 2EIEA 3TN0D 1WVZA 4F3FB 4IM8A 4DOHE 1NBZB 1JWSA 2N4IA 5LXGH 2HLAA 1IAIM 3D18A 2LE9A 3IS0X 3JWDL 3T0EB 5DD3H 5CWSB 1J8HB 5DXWA 5IKCA 2IBZX 5J4MA 2JELH 1OWWA 3LQAL 3HN3A 3T0ED 1PQZA 3EOAA 1J8HD 1NGYB 3BP4A 3JV5A 5MEOB 5GSRB 1TVDA 3DYPA 3HZMA 4KI1A 2HTLC 3BDYL 1TZHB 1NL0L 1PEWA 4NFBA 4RAHA 2ITCB 1LO0H 4EZMA 4FXGB 1KLGA 5JW4N 3VGEA 4NKIH 2C3VB 4Z5RB 5CKGA 3ARFA 3KLDA 2ZJSH 5LGKA 2V5TA 4FOMA 5TPWL 1JYNA 4QTHA 3LRHA 3VH8B 2AJXH 1A7RH 3HB3C 1JGDA 2CQVA 2H1PL 4WFGE 4JPIB 5KSUA 2JJSA 1GIGH 4ELMB 3HG1E 3OR7A 3RUGB 1JPTH 1ZGLP 4AIZA 3HE6A 3WNNA 2VE6B 3S35L 3TP4A 2WUBH 1RUML 4PTUB 3QHZH 3AMLA 3S4SG 5JA8B 3D3VE 1GOHA 3TH2T 4DK3A 3MNZA 2BMKB 3VXSB 2NW2A 2O5ZL 2XFXB 4FXKA 5C0RL 2K7PA 3LB6C 4XXCA 1F45A 3H0TA 4V1DD 4XNXH 5CZVH 5ACMA 3VXSD 3BPOC 3WIHL 5ADPH 1VPOH 4HQQH 2JTDA 1K2DB 1E4XL 3NA9L 2MHAA 4HKBB 1XAUA 5BQ7B 3BSZL 2PCPB 1QLFA 3N85H 4M6ML 4P9HC 3MV9B 1A14H 1NEUA 2X6MA 3FO0L 5I1AB 3KLSA 4OQTA 3QUMH 2SEBB 3UROR 4NNXB 3MCG1 5FYLH 3UEZA 5EO9A 4HMDA 4O9HL 4OGAC 4AEHL 3MV9D 4UT6H 3TNNA 1TNNA 4KDVA 3ZKSD 3HNVL 4K3DH 2H6PA 4OB5L 4JQVA 4MJ5B 1OPGL 4EQ2A 3P4MB 3QXDA 4XBGB 1TTUA 1P7KB 1DSFL 5GS1B 3THML 3J7HA 3K2UH 4WI2A 1NBYB 4M4PA 5CBAB 2DLHA 4V2CB 1N6QH 5KSVA 5EC2A 4HT1L 3IDXH 4M5ZL 4MNGB 3KXFA 3L3IB 5E03A 3BE1H 4GW1A 1QKZL 5DRNA 5TQ2H 3QG6A 5IQ7L 4Y0GA 3K80A 2OK0H 2LQRA 3LKNA 1NGZA 1MFBL 1OTTD 5E5MB 4JFFB 4JY6A 4Y4KB 4NBZB 1KNOB 1BFOB 4JDVB 4HBCH 4PJDB 2ATPB 2BHYA 4DGIL 2Z9TA 5I1IL 1EEQA 3CJJA 1DQQA 4JFFD 4Y4KD 1N3NB 1EAPA 1NDGA 3CXDL 5IMOB 4A2LA 1BBJA 2C7UA 5TFSL 5IJKA 4GW5B 5GGVH 4P2RA 2VLKD 3T4AA 3S3JA 4IOSD 2FGWL 4KVCH 3H9SA 4NUGH 1D5MB 4XBPA 3RVXD 1BAFL 3RY4A 4I18B 4LBEB 3AS1A 2D03L 5TF1L 4R97C 3VW3L 3JVGA 4JO4L 4CU7A 4OT1L 1I7RA 3GIVA 4Y5XA 4ZOAA 5EUKB 4GRLB 3MRMA 5I76A 1TCMA 4YX2L 2VITA 3VD7A 1T5WB 3HMWH 4J3OC 1IGCH 5SWSE 2LV4A 5A43C 2BVQA 4GRLD 1FE8H 4MDJB 4UT7L 2OR7A 1FGNL 2IBGA 4JY5H 3TWCL 3VFGL 1JNNH 4BZ2L 3WL9A 2EEDA 4PGDA 4HIEA 4QRQA 3VXRB 4G8GA 3ZYOA 4YXLL 1TQCC 2PETA 1CLYH 4L9LC 4XVJH 1DBAL 1VACA 3OL2A 4JFZL 1W2KT 3KPRB 4L3EB 5IBLC 3DVIA 5A16A 2IADA 4JM2B 3ILPB 1JRHI 3VXRD 5J12B 3I84A 1BVLA 1DFBH 1OD9A 2R0LH 3FQTA 3D25B 3L7EA 1KEGL 2IQAB 3TCLB 1KENL 1QZ1A 3CFJB 3KPRD 4L3ED 2WWMD 4RZCB 1GC1H 4JM2D 2QQLH 3BPNB 5ESVB 2IBBA 1A6ZA 4UDTB 3RHWK 1WJ3A 3CLFH 1DDHA 4X6DA 1V7MH 1OM3L 4HXAL 1YQ2A 4M7KH 3RNKA 1DQDH 3F7RA 4JCLA 3T0DA 2V17L 2VDQH 1A1NA 1A4KA 4LRIA 4O02H 1UACH 4RBPH 1IQDB 5J3HC 4H1LH 2Q87A 1S7VA 4YDLC 1CDCA 2XZAL 5D2NC 1NKRA 2DI7A 2R69L 3C6SA 3FQNA 3RJQB 4FQ2L 4NQSB 3CFDA 2APTA 4EBQH 1MCQA 2ITDA 5JR1L 1CDJA 1LVEA 2Y07L 3NZ8B 4PTTB 1HDMA 3B6SA 1FL3B 4XCCH 1NH6A 4KJYB 3DI2B 4WW2A 3TO2B 5HI4D 3FKUS 2YC1B 4D0CB 4M7ZB 3GJEB 2UUDH 3PL6B 2IPUG 2CH8A 4OFYD 3V6FA 1IT9L 4X9GA 2XTLA 4UQ3A 3QWRD 1J5OH 4LOUD 3VWKB 4PJCA 4DZBA 3V52H 3C5ZB 4YHYC 1JJUA 1V05A 5DRXB 3S97C 2Z31C 4DVBB 1CCZA 5K9QG 5LGJB 2UY7A 3WMSA 4PGEA 4KMTL 3WIIH 3VWKD 3C5ZD 1G7JA 3EYFB 4K94H 4PJGE 3SOBH 2WIIB 1GGBL 4LQFL 2R4RH 2Y5EA 3WJLC 4BQCA 4MLIA 2BFVL 3QPXH 3CK0H 3O0RH 3GI8H 3WJJA 1NCAH 3V5HB 3CFEA 4FQ1L 5I8EA 4P3DB 4UINL 3VXMB 3IF1A 3HAEB 3ETBF 2HTKC 4MXWH 2OTUA 5BRZD 5AD0B 1RU9H 4ZS7H 2HT3D 3WFCL 1A4JA 3QH3B 5C2UB 3VXMD 3IJYB 5E00B 4PR5A 1B0RA 3B5TA 3SJVB 5FYKU 3OKNB 1FNFA 1TENA 5I1HH 5C0BE 3O6FD 5DI8B 2AI0H 3MLVH 3RU8L 3FOMA 3FMGH 4AMKL 1KLFA 3PWJB 3SJVD 3WE6B 2GK2A 5C0FA 5JOPE 3W82A 4TTGA 4FNLL 2B7DT 3HG1A 3KDMB 4X99B 2HG5A 3SQOL 3KYNA 5C0ND 4E42B 4AH2A 2HRPL 4QF1A 4GMTL 4X7CC 3D3VA 3VFNB 2X4SA 3VGGA 3R8QA 2YWYA 3BI9X 2X5PA 4WFHD 4C56B 4FG6C 1NLBL 4JY4A 4MWFA 1Q9WA 2CPCA 3ES6B 1N2RB 4WY7H 2R9HD 1XGYL 3CFCL 5IQ9A 3ARWA 1MY7A 1QFUL 5FKPB 1WUNT 5D2NE 4C56D 1IAII 1H3WM 3ARGB 2DKUA 3QNZB 2BRQA 2P5EE 4PJXB 1MJ7L 4WDIA 3V6OC 4Y2OA 4LFHG 2NR6D 3LKRA 1NDMB 3VFMB 4EUPB 1FO0A 1IM3A 4FQLL 4HIIA 3ARGD 5AG9A 3LRGA 1U8PA 5EA0H 2YZ1A 4HIHB 3O6KH 5M7QA 1KN2H 4ZXBC 4WFEE 4XVSL 3P73B 4LAQL 3NZHH 4W4NA 3F7QA 3QG7H 4JRYA 3W0WE 5B39A 1J05B 1ND0A 3U4BL 3AXLB 1AP2B 1QG3A 1V5JA 1RSFA 1UA6L 2YZ8A 3SQBA 4PBWD 4NHUA 1GH7A 2BY3A 4YDJA 5A40E 1U8NB 4FRWA 5I1DA 3CZJA 5FDWB 3MJ7B 1XF5A 4WHCA 1T4KA 1M7DA 2ADGB 4UB0H 4OD1L 4M03A 2VXVH 1BZQK 2G9HA 2VABB 3D85A 1RZJH 3O6ML 4QT5A 5HYJA 4JFEB 1A9EA 2CLVA 1FL5B 1OAQL 2DJSA 1OAKL 4JZJB 4ZO8A 1O5DT 3EJZD 3U2SA 4GG6B 4X5XB 5JPNA 1P5UA 3BGAA 1E4WL 2UVFA 2HT2D 2ZOKA 1I8MA 4JFED 4R0LB 2Y6SD 3IDGB 2QHLA 3OB8A 1EPFA 2DBLL 4D0BB 2P49B 4NQEB 5I8CA 1J8KA 1CGSH 3QEQD 4KHTH 3EUUA 4O00A 5K59F 5ICYA 3VFPB 5TE6L 3VRJA 4NQED 5JZ7D 4HKXB 3CH1B 3A6BL 3CZFA 2ADIA 5I2IA 1A64A 4BYHA 4Z95H 4N8PA 5JXED 2X4TB 1JGVH 3T0BA 3LZFH 1LEIB 5JHDE 1AXSA 3KVQA 1EHAA 1AJ7L 3VFOA 1F3JB 2DQUH 2EICA 4WI8A 2NY5L 5B4MD 5IBTL 5MEQA 1OP5H 3DURB 3BKML 5CP3A 1CDUA 4OLXH 4U33A 1DBKL 3TT1L 3GSXB 1JYWA 1NLDL 3W81A 3MR9A 1RUAH 15C8L 1K4DB 2R29H 4DGYH 3A6CL 3D6GA 3TJHD 4IIQB 2GI7A 5E2TL 2RQ8A 2EKSA 1FL6A 1UWGH 2W0LA 4WEMB 2V2WB 1MCPL 2J8UF 4PP2A 2DD8H 4CUCA 3VMOA 3CFBB 2J8OA 4W6WB 2F15A 4R90L 4XAWL 3LDBC 1CXLA 1SM3H 3EGSA 3V5DA 5T1KB 3MREB 4PJ5D 1A2YB 4JR9H 4XPGH 4OFDA 4AIOA 3DECA 1M71B 1MI5B 2EIZB 2NNAA 5AYQA 5T1KD 2BZDA 5LG1A 1NCUA 5EZOL 4P3WA 1AXTL 1EEYB 3V4UH 4XHJD 3SKJH 3QEHB 1MI5D 4OUOA 3FHQA 5E0QA 1T7WA 5FYLE 2RCSL 1MH5B 4XNMB 5HYFA 4TNWF 2NX5E 2NTFA 3LIZL 3O3BB 2APXA 12E8H 2IH3B 5SWZD 3TT3L 4TOYL 4PBVC 2P7TA 3FQUB 4KK8D 2ICCA 3V0WL 4OZ4B 1T1YB 3CVHA 3EHBD 1RJYB 1J1XH 3GB7B 4AENB 4L8SC 1H3UA 2L4OA 3TC9A 5A3ID 4Q9CA 4CVZB 2Z93A 1T89C 1OAUL 3CFIC 1KG0A 2CIIA 4P2YA 1MUJB 3FB5A 4Z7OE 1IGYA 1DVFC 4TUJB 1F4YH 1ZWIA 3AS0A 3UMTA 2GJJA 3L5WB 4OFPA 1ZHBB 3RDTC 4HLJA 2QR0B 5T5FH 1SYVA 4YHML 3KPPB 3MTRA 1C16B 2Q76A 1JF6A 1NJ9B 3NN8B 1IQWH 3HNTH 4QWWD 3CDFA 5AYUL 3VD5A 2WP3T 5EU7E 4F7MA 1KOAA 1MCNA 5ISZB 4MAYC 4G6AD 2C3HA 2P8MA 1EJOL 5IBUB 1R5WB 2CIKA 4WI7A 4RIRA 3HR5B 1AGDA 4IMKC 4QRPD 5ISZD 5K33A 3BVNA 1CBVL 3QO0B 3QZWA 4X9FA 1DLFH 1ZA6A 4FQHA 3HPLB 1RK1A 5DMKA 2ORBL 3T2NH 4TSCL 2UWEF 1MQKH 4KUCD 4HCRA 3QB7C 3U9UB 4EDWL 3WNMA 1PX4A 4ZOEA 1U58B 1OTUD 4D8PB 1INEL 5K9KB 3F62A 1IBGL 1S9KC 1IM9A 5ACZA 4BH8B 2WBWB 4XBEL 4NZTH 4HS3B 1GGYA 2AJYL 2D0GA 2A6KB 4K94C 1A6AA 3CVIH 1ZT4A 4ODXB 1JBJA 5DFTA 2BNQE 3EO0A 3RWJB 3K0WA 1NMCC 2Q6WA 3QA3A 2H8PA 5DFWH 1G1CA 3QDAA 4MNHA 1VFBA 3O45B 2JCCB 3MUGB 3LOWA 5CFHA 4RGNC 1ZHNB 1JHTB 2DQGH 3TESA 4QHKJ 35C8H 1CE1H 5C7XL 3UTQA 4RFEB 3V6ZB 5CEZD 2DQCL 4POUB 3QRGH 4N0YH 5B38G 1HHGA 5C08B 4AM0B 3X11B 3ARSA 4O2FA 5FUZH 3LKPB 3H42H 4PJ9A 4U2ZA 5HYIA 1UM4H 2X4UA 4LASH 4NRYB 2P5EA 4P5MA 1MAMH 4HUMB 1OGAB 3OKEA 3QDJD 2FHCA 3DNKA 4YAQA 5C08D 2DYPB 4QNPE 3UXFA 4K7FB 4U6YB 1I7TA 1N6VA 1BZ7A 4NN7B 1YYLL 4OV6F 1MJ8L 5CMAB 1TETL 1RJLA 2XY2A 4M00A 1OGAD 2CUHA 1RK0A 3R4DA 4XNZB 3W0WA 3QJFB 4F15C 4ZPTA 3BKYH 1YQVH 2DYPD 2DIJA 1WZKA 1AFVH 1MAJA 5EU6B 2RB8A 4PJIF 2PR4H 2BK8A 2ENSA 4MA1B 3K4ZA 4JFPA 4IS6B 5LGHH 1ZGLA 5BV7H 1WWBX 3C08H 4WCYL 5D7LE 4OCRH 3RI5K 3DROA 2ADFH 5D8JL 1EXUA 5EU6D 3UYRH 2M26A 1MFAL 3H7LA 1QVOA 3BH8A 5IMKB 2VC2L 3W9EA 1YJDH 3GRWL 5J13B 1RUPL 4Y4HA 1CVRA 2AXGB 5KJRL 2F19H 2X2YA 4MB4A 2VDKH 3BD4A 5EBLA 2Z92B 1MFEH 4YHLH 3T8XB 1ZLWH 3DSFL 5DK0A 1MJUL 1J0JA 3MA7B 3ULVH 5DK2A 3TEUA 4D9QE 3MRIB 5DZLA 2FIKB 3RA7H 2AQ2A 4JPVH 3QQ3B 5CIPB 5BO1L 3JV4A 1JN6B 4NWTL 2OZ4H 5IV2B 3PHOB 4NBXB 1A0QH 4U1HA 5T1LA 4A6YB 2ZPKL 2VL4A 1X5KA 4D9RD 2FJGA 4PY7A 4MHHI 1MCHA 4NSKA 4DN4H 4UAOC 3KLAA 4FQQA 2HLFD 2ICEA 2P5WB 3CSGA 4F57H 1FBIL 1P84J 4YO0B 5JHDA 5TDOA 5KS9E 5I6XC 4Z7UB 2OBGA 3BD5A 5C07E 4Q97A 3VXUD 3ZHKA 3DX6B 1ES0B 3KYMB 5HXMA 5D1ZB 2VDNL 4PJBF 1E28A 4G6MH 2I25N 3P4OA 4HK0B 1HIMH 4PJAB 1A7QH 3GKZA 3BO8A 4EN3C 2VXUL 4NFCA 4O2CA 1DBBL 5C2BH 3QUXC 3P4NB 1KTLB 4UU9B 5D1ZD 1S7RA 1T1WB 2FATH 4KK5D 3CC5A 5ECJE 4EOWL 2K7QA 2Y06L 2O5XL 3BDBA 2B39A 3JUYA 3VFWA 4BJLA 4YNYB 4HG4J 4A2MA 3VXOA 4JFXB 5E2VH 5J11B 1F02I 1BECA 5DMGD 1CK0L 4Z7WB 5KN5B 1EGJH 4QRRE 2HRLA 3UZVB 4YK4B 2D3VA 1DANU 4YHPA 4KZEH 1OQXA 1FFNB 3C8HA 4F2MA 2UWEE 5E6IB 1H3PH 1AGFB 4QY8A 2EYSA 1RJZA 4I77L 5IWLA 5I73B 1UM5L 5LBSL 2HFFB 4QXWA 4HWEH 3REWB 2P8LA 4BH7A 5E6ID 2IJ0C 3I9GH 5CGYC 1ZEAL 3SKOA 1BFVH 2A6JB 5HTSA 3GM8A 3CXHJ 3EFFB 1G1YA 1QTYT 3QUMA 2EH8H 5CBEB 3VGHA 2HVJB 2YA1A 1NUNB 2ZUXA 4GT7A 5GRUL 2NX5A 2IPKA 1PGRB 4HK3J 3S6CA 4APQB 4M8QB 1F97A 3QI9A 1RIUL 3PP4H 4FZ8L 4ZYKA 5IFHH 3IB4A 3MFFB 2H32H 4YC2B 4P23B 4BSJA 4TULL 3RPKA 1TQBC 5DJ2B 4Y1AB 5I8OH 4ZTOH 3SGDH 4NOBA 5ICXB 3RWEB 1OP3H 2ARJQ 3SPVA 3HZKA 1RI8A 1I4FB 4F7TB 4P23D 4Z78A 3C09C 3I50L 1AY1L 4Y1AD 2EH7H 3JTSB 1T3FB 4F58L 5HDOA 4E5XB 1CXEA 3X3GL 3L5XH 3AY4A 5GS2H 5FHAL 2D7OA 2PW1A 2ZUWA 1F5WA 3MUZ1 2XTJE 1FNLA 4BZ1H 4YHZL 3VI4E 5L2JA 2FYYA 3DSNA 3HA0A 1CICA 1EO7A 4LCUB 1T20A 5IJVB 2HN7A 4NGHH 1U91B 1R24B 5IFJB 3GHBL 3RKDD 2GCYB 5CP7A 3QPQC 4MXVF 5JW3H 1QACA 4E0RB 3UDWC 1A6TB 3MLUL 4R2GB 3F8UB 1BF8A 4XNYH 4XXDB 1DUZA 4IRSB 5F97E 4ZFZB 5C09B 3T77B 1FV1A 4GXUM 1FYTB 3ZT6A 4TUOB 4ELMF 2Q8AL 3DRQA 1BD2E 2E27H 1QFWL 4X83A 3SY0B 5BCAA 4E41D 1QBLH 4IRSD 4ZFFB 1FYTD 2C3WA 3U9PH 3K8MA 5I1GH 1C5BH 1ZVSB 2NLJB 1T66C 2WIMA 1UH4A 1JGLH 3D1MC 1A7PL 3QIUA 3E6FA 3BWAB 4NKOA 4UTBH 4P46C 4OM1H 3KPSA 2PTTA 2X42A 3DHMA 4Q2ZB 3TJEL 1SBSL 3G9VA 2BNQA 1A9BB 2VXTL 4A6YL 3U83A 4ODVL 1R3JB 4Y2DB 5CZXC 5CCKH 5B8CA 2VLRE 5L9DL 3MRHA 5HGHA 1EFXB 3BAEL 1WBYB 5HSFA 1Q9OA 4K9EL 4EXPX 1RZIA 3M1BA 2OM5A 4MCZA 1C5CL 4ONFH 1BX2B 4R8WL 4JE4B 1EO8H 5F6HI 1E4KC 3V7AG 1EFXD 2WQRA 3FB7B 4OZFB 5EFIA 3RVTC 3PGFH 1N5AB 4E9LA 2EE9A 4U6XB 5IEKA 3DO7A 4ONHA 4OCLC 7FABH 4UV7H 3VFUA 2W60A 3BP7A 3HE7C 1QYGH 4K8RH 2VH5L 3P77B 3RWGB 3QIWB 5F96H 1T89A 3BP6A 2ZWLT 2OMNA 3MNWA 3ARBC 4U1IA 3V5KB 4U6TA 2H26A 3CSYA 1EHNA 5SX4H 4IDJH 1JL8A 4HX1A 4TQEH 2EDHA 5T33L 3QIWD 1BZ9B 1JV5A 3UTPD 3D0LB 5GZND 2FJHA 5ITBH 1AQKL 1EBAA 4LLVA 4WUUE 3VGBA 4Y16C 4N1EA 5H37H 1U8QB 1BPVA 3PF2A 4JO1H 3H2WA 4B7LA 3BMWA 2J8UA 4LDLB 4H1LA 3MYJB 5C0DA 4PJ8B 1T1ZB 4Z76B 1SJEB 4YGAB 3MV7B 3T65A 4XI5C 3MODH 2XKSA 5HGAB 1XGPA 2P44B 1YEEL 5JIPA 4PJ8D 3QUZA 4JRXB 5F72S 3I2CH 4DQOH 3MV7D 4UOW0 5EORH 1HHIB 3I85A 1I3GL 3NGBC 4I3SH 2CUMA 3T4YB 4KFZC 2A9NH 2HA1A 3PWPE 1CXHA 5FO7B 3QQ4B 1NBVL 4XP5H 3OKKA 2XKNB 4X6CF 1NFIA 1P4LA 3NH7H 3AUVA 3JV6B 4FFYL 1T0NA 4WW1A 2BCKA 4QRSA 1LK2B 4Z8FL 1NFDE 5IVZA 2W0FB 1N0XL 3CFKB 1VGKA 4F37F 3P9MB 2ZUVA 5I18L 2ZKHH 3O2WH 3OJDA 5MENA 2R8SL 1YJDC 5GJTH 5D1XA 1EVTC 3AAZB 5HHOA 3D2UB 1U93A 3U1SL 3I6GB 5EC1B 4KROC 4FFWD 1CGUA 2PO6C 1YEHL 3IFLL 5C9JB 3O4LE 4LSRH 3SE9L 1N4XL 1KCVH 3D2UD 1KIPB 4LNVA 1G7HA 3RAJL 1PLGL 3NFSL 1A7OL 5KS9A 2QSCH 1TCRB 3ULVC 2YK1L 3AS3A 5DJ8B 4G9DB 4KQ4L 3GO1L 1FCGA 5C0IB 1AGCB 5IB5B 3P0VH 5F7EH 4KY1L 5J9PB 4CN4A 4ZUVB 4HAGA 3GMPB 3IRZA 1IJ9A 5MERA 4JM2F 1YEDA 5TDNA 5D7JC 4P9ML 3KPOA 1QSFA 1FN4A 4WWID 3ZSTA 3V8CA 4MD5A 1MFDH 3DMMB 3TM6A 3L3HB 3ARDD 2EXYD 5J6HB 2AEQH 3IJSB 5FYJL 4KUZL 4K7PX 3WXWL 3U4AA 3FN0L 5LAXB 1BQHB 5ILTL 3T0VA 5DUBA 3DMMD 3P11L 5DJCB 3MRCA 1IGFH 6FABH 1WEJL 1JGEB 4X4XB 4HXBH 4U1KA 4QRRA 5HHQB 1GZQB 5KSAA 3WO4C 5SWQB 2J88L 1HHKA 5DMIL 2UWEA 1MCWM 1NKOA 3BYYA 3R06A 3FCTB 5D72H 3K2MC 2VLLB 5C0AE 1IC4H 3DO3A 2JB6B 3UBXA 1ZLUH 3ALPA 2FL5A 3PNWB 4PJFF 4OZGE 5CJQH 4N90E 1G6RH 3WSQL 4K71B 4GMSH 4FQXB 1G0XA 1P1ZA 4J1UB 1FFOB 4Y8AA 3U7WH 4JFQA 5DUPH 2W9EH 4NN5C 4Z7NF 2ICWI 1GGCL 5L0QC 3R0MA 2X89D 4OLYH 4FQXD 4R4FL 4AEIL 4KDTA 2AAVA 3E0GA 2NY3C 2OX5A 1JWMA 5BZDA 3O6LL 5EB9A 1A1MB 4H8WC 5HJ3B 1Z3GH 1QA9B 4FMKA 4ZUUA 3NCFB 5AZEL 3WKNA 5GIRA 2GHWB 4PJ7F 3ULUC 1AHWB 3GBMH 1FC1A 5I75B 2F8VA 2Z4QA 3AB0C 3L6FA 4G6KH 3S35X 4JZOA 4J3WA 3RVWD 3L7FA 2BSED 3GBNL 5I1JL 3ULVE 5LCVH 5GPRA 5HHPA 1MRDH 4ZUTA 2ICWA 3F65A 5AZ2L 3SHSA 4NKDA 3ZKMC 4DAGL 1CLZH 3FO2B 5IMMB 5C0EB 3ELAT 1SEQH 1U95A 4ZPVA 3UPCA 3WFBH 4LVNB 3MV11 3QUXA 5F9OL 3PJSB 3N1QC 2R4SH 4OLVH 1MF2L 5EIQA 3VH8G 3LS5L 1FFPB 2VLJA 5KTEH 4CNIA 4P5TA 1FZMB 1MCBA 1T22B 3B9EA 1AR1C 4Y5VC 3DIFA 1AI1L 1BD2A 5F70A 2F53E 2IG2L 3MYZA 5HHXL 5IMLA 5CGMA 3HNSH 2GTWA 2MTPA 3GDBA 5EWIH 4MLSA 3Q1SL 4M1CC 4UDUB 1Q1JH 4KXZI 3MCKA 4X7SL 2AJVL 4D9LL 4Q74A 4X6CE 4G6JL 1TZGL 4RQQB 1VCAA 2VXQH 3UZEA 4D3CL 4LLUA 1X7QA 3T1FA 3TBVB 4JQXC 1HN1A 2ZCHH 4WGVB 1C8PA 2FHFA 4PJXF 5FO8B 4BSVB 4WEUD 2GIYA 4ZDHA 2OP4H 2VLRA 3OXSA 5D5MB 1D5BA 2UZYB 2B8OT 1PG7L 2NY2C 4PFEA 1TLKA 4OGYL 4PD4J 4QXUH 5HI5D 5E8DL 4QOKE 1HHHA 3SE3C 1MJJA 4ETQA 2VDOL 1XF4A 2ID5A 1E27B 3LMJH 5DA4A 3QEUB 1ZA3A 4J6RH 1A5FH 5HHME 5DT1L 4HS6A 1INQA 4PJBA 1JWSB 5DC0A 1U3HA 2HLAB 3D18B 4FMFA 4EI5A 3HRPA 4XX1E 4WWKC 5IKCB 3MLPA 3ULUE 3DTXA 5FGCB 4B7IA 1PQZB 1G9ML 3BP4B 1O7SA 3VA2C 3ZYZA 2QADB 1CN4A 3EJJX 2NY6B 4FS0A 3KPNA 4GO6B 3HZMB 4L9DA 4TRPH 2R23A 4GAJL 3MCLH 1KV3A 2EE6A 3WFEH 1KLGB 2QADD 4KI5C 2NY6D 1CDYA 3ARFB 5IVXB 1WZLA 1I85A 4QTHB 3TVMC 2ZCLL 1JGDB 3PWLA 3ARFD 2CLRA 5SV3A 1K3IA 5KSUB 4OKVA 3WKML 1MHPH 3OR7B 4PJFE 4PRPD 1WZ1H 3BMVA 3HE6B 4LCCC 1KB9K 2AK4E 2XQBH 3GZKA 4YHKH 5E4EC 3MV8E 4M7LH 1X5AA 4LRNL 4KAQH 3MXVL 3JV0A 4L4TA 4ZNEE 3LPFA 2ZG2A 4Z7NE 3MNZB 4R4BA 3HE6D 2NW2B 4ORGB 4DKEH 5ALBH 4FXKB 5JDJA 4Q9QL 2YUWA 4EDXA 1T04A 3E8UH 1BM3L 3H0TB 4KRPC 1F4XL 1H3GA 3INUL 1RULH 3B2UC 3ZDZE 2UZIH 4AZ8A 1QLEH 1ZOXA 3WDHA 2MHAB 3MLTA 3FQRA 4FTVE 4TSAH 4U0RB 1LDSA 1QLFB 3ZDXF 1P69B 4NHCL 1S7WB 4PJ7E 2YEZA 3CGTA 1CGVA 4WV1A 4QHKI 1DQJB 5FUCE 2OCFD 5EO9B 4UNUA 4OZHE 4HJ0C 3HC3L 3TNNB 3ZT7A 4M7LT 1UWEL 3L5JA 1GVIA 4HWBH 1JFQL 2VZ3A 1YEIH 2BX5A 4HKZA 2J4WH 1MVFA 2JB5L 2I9LA 3QXDB 1SMAA 1I1AC 4HULB 1YNLH 3H7BA 2B4CC 2E6PA 3VWJC 4XVTH 3G5ZA 4DGVH 3L3DA 5CUSH 2V2XA 1Q72L 1MFCL 1LO4H 1D7FA 2DJUA 5KSVB 1UC6A 2FX7H 2HJFA 5EC2B 3DX7A 4WJ5B 4DVRL 3IFPA 1FAIH 3KXFB 4PB0H 4ELMA 2XA8L 4GW1B 5DRNB 1T21A 1X6NA 4YIQA 3QG6B 3BQUA 1KIQA 3LKNB 1NGZB 3KXFD 1OTSD 4WHTA 1IEAA 4V1DA 1KCSL 3U6RA 5C0AA 1MCCA 4KI5E 4JY6B 5JMOC 4M5YL 3V2AR 3O3UN 4XPAL 4ZO9A 4OZGA 1NMBL 4OGXL 4DN3L 4JQIL 2IAMC 2DICA 1DQQB 5F6IC 3ZDYF 1EAPB 1R3LA 1NDGB 1BBJB 1YDPA 2C7UB 4S1DD 3WBDA 4P2RB 1WAAF 3T4AB 1ZAGA 4M93B 2BVEA 4XH2A 3RZCC 3AS2A 4M1DH 3A0OA 4LVHB 3O8XC 4UIKL 5KVGL 1DLHA 3H9SB 3MA9L 4P2RD 1QPXA 3DUSA 1O7VA 3C9NA 3RBGA 5CJBA 25C8L 1S7TB 3EYQD 2ZNWA 1T7XA 3H9SD 3IU3A 4XWGH 1I7RB 1BBDH 3G6DH 3NABL 4RMRA 3GIVB 4Y5XB 3NPSC 4NJAL 3MRMB 5I76B 4QCIA 1YNTA 2VR5A 2VITB 1FH5L 4K3EL 4KUCF 4RBPK 3QCUL 2BVQB 3BW9A 3NCJH 3TZVA 3QUYC 1VFAA 3EJYC 4ZSOE 2FECI 3BDYH 4Z0BL 4X8XA 3C60A 2PTUA 5JW4M 4MQXC 4PGDB 4HIEB 4QRQB 1FVEA 4G8GB 3HAEG 1FFRA 2RIKA 3HI6H 4AL8L 5EZJA 3LS4L 1VACB 4ZS6D 2XA3A 2BSRA 2H3NA 2OZ4A 5A16B 4K2UL 2IADB 4BK4A 4CVXA 3BH9A 2UUDK 3KHOA 4KPHH 4G8GD 4MMZC 1BVLB 3FQTB 2H1PH 3L7EB 1FGVL 4JDVA 3U30B 3S35H 2VLKA 1A6ZB 1RUMH 5CGTA 3QQ9C 3I6LD 1DDHB 1IEHA 2GSGA 3SDDC 4X6DB 1VEMA 1MCDA 5EOQH 5TGBA 2BVPA 4TNVK 5KZCB 4J2XA 1KCUH 1YEFL 3D9AL 1S8DA 1X4XA 1A1NB 2DRUA 5C0RH 1A4KB 4UBDD 2YD9A 1QLRA 5JUEH 1S7VB 1OARL 4NJ9H 2B0SH 4X6CA 5DWUL 3T1WA 4D2NA 5KZCD 3C6SB 3WIHH 3FQNB 4MJIE 1ZV5A 3T08A 3RP1A 3CFDB 3OZ9H 4WTWA 3STLA 2X4PA 2ITDB 3CSPA 1R3IL 1HDMB 2XN9E 3B6SB 2MNUA 3FO0H 3ZHLA 2XZCH 2EDXA 3X14A 3QCVL 3UO1H 3CMOL 5AWNL 4L8BA 4EUPG 4O9HH 4OQTL 5DUML 2Z35A 2B1HL 4YZFE 3V6FB 2RGSA 3ZDXE 3PUCA 4QOKA 1VENA 5K9JL 3SGDI 3QRFM 3WUWG 2EC9T 1DBJL 2P47B 4BFEA 5ID0B 5T3ZH 1OPGH 4DZBB 1JTTA 5FOJA 1T1XA 2CSPA 5IB3A 1DSFH 4DOHB 3THMH 4PGEB 3W11D 1S3KH 4L3EA 3W9DA 3S36L 4HS8H 4JM2A 1G7JB 1RZKH 5F8RC 5GRYA 4M3KB 2BNRE 4MMXC 5GGQH 4HF5H 3ZKNC 4HT1H 4M5ZH 1EERB 4LF3A 2IQAA 5J7CC 4W6YB 3ZE2E 3K81A 1ONQA 1LE9A 1OOAA 1N7ML 4JG0L 5ESVA 2DQDL 3IF1B 4X0KA 3ROOA 1EEZA 1OSZA 2OTUB 3TV3H 3LN4A 3BGFB 2H32A 5E2WL 1A4JB 1JNHA 1IEBA 1VHPA 1B0RB 3C6LB 1IRAY 2DL9A 4DGIH 3FL7A 3SDCC 2HAZA 1WWCA 2DDQL 5FECA 3CXDH 2V9RA 2IWGA 4RWYH 5TFSH 3C6LD 1KUMA 1EV2E 2IMMA 4HBQA 2NYYD 3HG1B 4PJFA 4K55A 2AK4A 4J3TA 3IETA 3MNVA 2HG5B 4Y5VA 3KYNB 4UIMB 2FGWH 4AH2B 3MV8A 4WFGD 4QF1B 2A6IA 1UWXH 3ZDYE 1Q94A 3D3VB 2X4SB 1I1RA 5KANI 3NAAL 4YXHL 3E1F1 1BAFH 3HG1D 4NDMA 2D03H 4JY4B 4MWFB 4Y4FA 1T83A 2DWDA 1XEDA 4LKCA 4OT1H 1U8OA 3WUZA 5ABDE 3D3VD 4YDIL 4CMMA 3KPMA 1FC2D 2L0DA 3WFHA 3GEWB 4BFIA 4N68A 1D5IL 3NTCL 4KKBC 4B0MM 5A1AA 2O5YL 1A3LL 4R26H 4WDIB 2IANE 4KJQC 3LKRB 1CL7H 1FO0B 4UT7H 3IS1X 1IM3B 4HIIB 1FGNH 4ZOBA 3EYFA 1HYSC 1U8PB 3ARQA 5F9WB 2MJWA 4PJ7A 4BZ2H 1L9NA 3CAFA 3EYOA 5BRZA 5IROA 2VZSA 4JRYB 5B39B 2EDLA 2E9WA 1ND0B 2NY0B 1BFTA 1QFOA 3QR2A 4OZHA 3EBAA 2XZZA 4Z7WF 4JFZH 3SDXF 3HZVA 4NHUB 4JRYD 2MKLC 3CLEL 4YDJB 2NY0D 3WXVL 3ALXA 3O6FA 3LKSA 4JN2A 3RY6A 1OP9A 3QH3A 4XP1L 5HVHC 4OCWH 4W4OC 5I1DB 5BJTA 1XF5B 2VOTA 1M7DB 3B9KC 5ESAA 2CXGA 4WI4A 3V0VA 2G9HB 1OP5K 2CDFA 3D85B 4KWUA 5EH1A 4QT5B 5HYJB 1A9EB 2CLVB 3WNLA 2O61A 4HXAH 5L7XL 3MGOA 2AV1A 3CDCA 3U2SB 2DAVA 5JPNB 3T04D 2VKXA 2V17H 3D85D 1LP9F 2ZOKB 1I8MB 1ED3A 1HILA 1UJ3C 1XT5A 3BX7C 1TPXC 2DQHL 1JE6A 5DYOA 2LTQC 3ZL4H 1CZ8L 5FHBL 4Z6AT 4U1GC 4F9LA 4FQ2H 5I8CB 4IJ3B 2GFBA 4TPRH 1VEPA 1LO3H 4U3CA 5ICYB 1UZ6F 1TJHL 4G8EA 3VRJB 4OJFL 4W6XB 3CZFB 2FLRT 4IDLA 2ADIB 5I2IB 1JRHL 1TNMA 1D6VH 3UPAA 5FGBC 5IOPA 4HUVA 1UB5A 2HVKA 1NCCH 5DJDA 1AXSB 5JMRA 3FRPA 4NQUA 3IXAA 3VFOB 4LLQA 5GQBA 4YHOH 1EHLL 1X5HA 4QYOA 4YUEL 1K6QL 5MEQB 3WUWA 2AS5M 4XP9L 4CAGA 1CWVA 5H2BA 4FZEL 5E70A 3MR9B 4KMTH 5CAYB 4NO5A 3MRQB 3RIAK 3WS3A 3OKOA 4LQFH 4M62L 4M6NL 2EKSB 1RMFL 5IBUG 4CBPA 5I1EL 4GG8A 3LB6D 2AERT 5HI3D 5JLZA 1IGIL 4TYUA 4PP2B 5HDBF 3W5MA 1KELH 3MJ8A 3EGSB 2EECA 3BN9D 1P2CA 3V5DB 3JWDC 4MA7H 4R0LA 4RRPA 4X6BA 2PXYC 3QEQA 3UP1A 1RIVH 3RU8H 2EXWC 4JHWH 1ZANL 1AE6L 4IRJC 4CKVX 1B3JA 3TO4A 2BDNL 2NNAB 5GS0D 3LQAC 4HJJL 1QHOA 4P59L 4Y5YA 5ETUA 5GHWL 2XOTA 3EFDH 4GMTH 5J1AA 1X5LA 5KVEL 2V9TA 3LCYA 4J4PC 4UTAH 2NTFB 4OD3L 3G6AA 5E99H 2CGRL 5KAQF 1NMAL 2RBLA 4H20L 1B6DA 2P7TB 2DKSA 2BVYA 1F3JA 1QFUH 4TVPL 2J6EA 5EOCH 1FCCA 3CVHB 1A8JH 1FHGA 4CMHC 4YJZL 4MJIA 2XPGA 5H94A 4LLMA 2Z93B 4I3RL 3MO1A 1KG0B 2CIIB 3FB5B 1IGYB 5FM5M 2VAJA 1TDQA 3HR6A 1HKLL 4ZAKA 1FO0L 1F8TH 4XVSH 4LAQH 2CJUL 5KVDL 4XPBL 3VJ6A 2IQ9L 2Y7QA 4OSUL 5E24E 4LU5H 3GSQA 1KEML 1SYVB 1NCBH 1SY6A 1UA6H 4G5ZL 1VDGA 2XZQH 2Q76B 4Z7VF 1FNEA 3C8DA 4XWOD 4PJ5A 5EULV 1JHKL 3LQMA 1FDLL 4K3JL 1PFCA 4F7MB 2NW3A 5GZOD 1YEJH 3SDXE 1K5NA 1ZLSH 2VDRL 2P8MB 1I9IL 1JUFA 3SGKC 1BWMA 1ROWA 4IHOA 1ZTXL 4FQIH 4R4NC 4RFNC 1G6RA 2CIKB 4LL9A 3O6MH 4PJGB 4RIRB 1AGDB 2EDYA 3G5XB 1KACB 2BNRA 3BVNB 5CINH 2NY4B 2A38A 1OAKH 1MI5A 2D9CA 3I3BA 1IAIL 1I75A 3QZWB 1E4WH 3AROA 4LGPB 4X8JA 4FQHB 1PKQA 3U7AA 1RK1B 2DL2A 3KYAA 4RCAA 5DMKB 4WNQA 5JHLL 2XRAH 3HMXA 2NY4D 3QCTL 3F58L 5SWZA 4KZDH 1DEEA 1T2JA 1BQUA 5DK3A 4LGSB 3WD5L 1CU4H 4LLDA 2D0FA 1IM9B 1LP9E 2D31A 5ACZB 3GKWH 4UUJA 4PLKD 2VSDA 2J2ZA 2ZNXA 1RAMA 4FP8H 4NQCA 1A3QA 1A6AB 1ZT4B 5LQBL 5JW5A 1YEKH 3OKLA 4OZ4A 1IM9D 2C4FT 2HT4C 1CD9B 3EO0B 4JLRA 5HYSA 3ARUA 1KPUB 4MAUH 4NM8L 2Q6WB 2Z8WC 3QA3B 2H8PB 4MNHB 1VFBB 4I0PC 3UJTL 3HRZA 3MXWL 1D5XA 4DKAA 1RJCA 4LK4A 2XWTA 4NC2B 3O3DA 5I0DA 4XC3H 5JOPD 1JK8A 1SBBA 3BKMH 1WAAA 3B5HA 3AREC 4PG2C 1DBKH 1BQLH 2A74A 3TT1H 4ACPA 1NLDH 3UTQB 15C8H 4YDLB 1OW0C 3RL1A 3B3IA 1CGTA 1HHGB 1ZLWK 2YA0A 3P30H 6CGTA 1T03L 2JIXA 4O2FB 1IFHL 4QRPA 4PJ9B 4ZG1A 2X4UB 5J3HD 2P5EB 3NVQA 4P5MB 3LV3A 2IANA 4LAJH 3OKEB 1A6WH 5E94A 3GNML 1OSPH 4YAQB 4LEXH 3TN0C 1AXIB 5JPMA 2DTML 3REVA 3HR5A 1I7TB 4PJ9D 1BZ7B 4MJ6A 2P5ED 1RJLB 3CDGA 3TYGL 3ET9F 1RK0B 2AEPL 3MACL 3W0WB 5KSBE 4ZPTB 3HS0A 3SDAC 7CGTA 1ZVHA 2WANA 3G5VA 4ALAH 5BVPL 1CIUA 1T0MA 4B53A 4JFPB 2IPUK 4WFED 1ZGLB 5HDBE 1NBQA 3W0WD 5GS0L 3U9UA 3C2AL 3DROB 4G7VH 4YHYB 3T0EC 2EEBA 1HH6A 2YPKA 2QSVA 5GRVK 3SDYL 1QVOB 3BH8B 1J1OL 3W9EB 4JB9L 1A6VL 4UOW1 2KDGA 4Y4HB 3UYPA 2CK0L 3I6KA 4ODXA 3PABA 4G7YL 4NM4H 4H8WL 1IC5L 5EBLB 4WTXA 4JO2L 5HVGB 4G9FA 3MRLA 5FYKL 3VG9C 4Y4HD 5DK0B 3MUGA 2ADJA 4F37K 5T3ZE 5GJSH 2PF6A 5IW6A 5D7KE 3JV4B 3CVHL 2HTKD 4ZUSB 3OGCA 4PRIE 1FNAA 3T0WA 4U1HB 1OWRM 5C9KA 3SDCA 1EZVX 3QDJA 2FJGB 4PY7B 1P4BL 1H8OA 4NSKB 4O5LL 2B5IB 5F7YC 3KLAB 4FQQB 5GGUA 2ICEB 1OGAA 1I1FA 3RQ3A 3CSBA 4J23A 3TA3A 3FONA 5JHDB 5TDOB 5KOVC 1S9XA 5E56A 3VU2A 2Y36L 4N0FA 5AYUH 3HC4L 3JWOL 5CSZA 3KR3L 1E28B 5JHDD 2IFFH 3P4OB 4I13B 3P9WB 3BO8B 4KHXL 1WLHA 1OL0A 4Q58C 1S7RB 3RWIA 4DK6A 5C6PB 3CC5B 1TJGH 4KC3B 3N9GL 3VFTA 5DD5H 2ORBH 5HDLA 1EVUA 4PJHE 5D93B 5E8EA 2Y4SA 1UT9A 3VFWB 2M1KA 4NNYA 1OP3K 2FNBA 3VXOB 2HP4A 1B2WL 1VA9A 4HCRL 4KTEL 4I0KA 3G5YA 4YHPB 4F2MB 4XBEH 1T6WA 3FQWA 2AJYH 3O2VL 1FNSL 4QY8B 2EYSB 1RJZB 5DJYA 5K9QI 5GS1C 1NCDH 3T0EE 4OM0H 4XPTL 2LU4A 3QQ3A 2P8LB 3BP5A 4BH7B 1M7IA 3WS6C 2FWOA 3SKOB 2D7NA 2YKLH 1Q0XL 4N8VA 3L3JB 1G9NH 3QUMB 2DM7A 5I15L 5I8KL 3IDUA 5DD1L 3U4EA 1F90L 3FO1A 3NCBB 2NX5B 3LD8B 4OQ1A 3VXUA 2IPKB 4ISVA 5C7XH 5H35A 1ORQA 3SE8L 3QI9B 3PP3H 2AKRA 2D7TL 2H45A 4LP5A 4WHYG 1RZ8A 4ZYKB 3NIFF 3OHXA 4Y4KC 4HWBA 5FYLD 2DQCH 4PRHE 4PPTA 1A3RL 1L7TL 2NX5D 4OZFG 3TBYA 5KAQG 4PIRF 1IKNA 4W81A 5IHUL 2X1QA 5TE4H 2ZP0T 3SPVB 3HZKB 1KJMA 4HK0A 3K8KA 2ZG1A 4N9OB 1YECL 5E08L 1QRNE 3AC0A 5DQ9A 4UI2A 4Z78B 4Q6IC 1P9MA 3RVXC 3B83A 2DI8A 2F58L 5E1HB 3PV7A 2NCMA 4X4MA 1VFUA 4OLWH 3DGGA 4OF5A 3MBEA 5D6DA 1B9ZA 4I18C 3VXSE 5EIIA 2NY7H 3KWWB 2FYYB 1CICB 4WCYH 1KCRL 1T20B 3CX2A 2ARWA 5D8JH 2HN7B 4JFXA 3U0TA 4JN1L 4GRLC 4Z7WA 5IVXF 2R0KL 1NGXA 4XC1H 4H25A 1HYRC 5CP7B 3SDXA 2VC2H 1ZXQA 1CICD 5D2LF 3GK8L 2G5RA 2HFTA 4MD0A 5T5NF 1PDKA 5D96B 2OSLA 1FZOA 2E9BA 5KJRH 3BT2L 1DUZB 4UQ2A 4H26A 3QEGH 1ACYL 4F80A 3DRQB 2J5LC 3DSFH 3NACH 1SVZA 4DUXA 1N64L 2DM4A 5CBEA 1CI5A 1X3DA 4TUKL 2WWMC 2ZOLA 3NA4A 1O0VA 1VEOA 5J12C 5I1CH 2KUTA 1LP9A 3B2VH 4XCFL 3RZWA 3QAZC 5CJXC 3QIUB 3E6FB 1VESA 4NKOB 2ZPKH 3KPSB 3QXVA 2PTTB 3BPNC 3DHJA 3GMOA 5DD3L 2BNQB 1Z9MA 1HQ4A 3QIUD 4C55A 1FBIH 3MRHB 5HGHB 4MNGE 1Q9OB 5KVFL 3SBWA 1RZIB 3KPSD 3M1BB 4MCZB 4M6AA 2BNQD 1S9WA 1FSKB 1MLBA 4QHNA 3WHE0 4NKMA 1KGCE 4GRMA 5EFIB 3MRKA 1LO0L 5IEKB 3DO7B 2VXUH 4NKIL 3BZDA 4OF6A 4ONHB 4WUKH 1UKSA 5B3JF 3VFUB 3B9AA 1Z9SA 1I9EA 2W60B 4PJDE 5HHVH 3BP7B 3MRDB 2AJXL 5EO1A 1A7RL 1XIWA 2ZSWA 3MLZL 1NCTA 3BP6B 4M7ZC 4GFTB 3PL6C 4U1IB 3D69A 2H26B 1GIGL 1OY3B 3CSYB 1F11B 1XMWA 1FG9C 4E41A 1JPTL 2AQ3A 4HX1B 2NY5C 4OLEA 2WLZA 1JV5B 1NSNH 1T7VA 2WUBL 3RDTB 3TCXA 1BQHG 2FJHB 3QHZL 5CD5D 5KSBA 4LLVB 2EYTA 3VWKC 4OCXL 4MJ4A 4PGJA 3C5ZC 5F7UA 4H1LB 2D0HA 1J0ZA 3RGHA 5C0DB 3RDTD 5CLWA 5IM7A 2GSIA 4YFLF 4GQ9H 3T65B 3WIHA 5MP6H 4LIQH 4XNXL 1UKTA 3NOIA 5J1SC 1XGPB 4LNRB 3GM0A 5ADPL 3U48A 3QUZB 1ZEAH 5E6YA 1B0GA 3V4VL 2HT3C 5DQJA 4MAYD 3N85L 4X9BA 4JKPH 1JNLL 3FFDA 3QDGE 3QUZD 4YBQC 3QUML 1NC2A 5FYLL 1WBYA 2B1AH 2I5YH 3DX9B 4MA8H 4EIGB 3RX5A 3LKQA 1NFIB 1P4LB 1YYML 4KRLB 4GUPA 1PSKH 1T0NB 3DV4A 4WW1B 4UT6L 2BCKB 4QRSB 3ZTJG 3BZ4A 4K3DL 5IVZB 3PXHA 3FB7A 1VGKB 3OMZA 4RMTA 3LEYH 1JYXA 5C0NC 4WU7A 1I3UA 3OJDB 5MENB 1RD6A 4PRIA 5D1XB 4D9QD 5HHOB 3I50H 1AY1H 1MCLA 1U8HA 2Z0BA 4I2XE 1H3TA 1U93B 4V2BA 3UPRA 3K2UL 3O41A 1R3HA 3ZYIA 1EEUA 3GGWA 1N6QL 5D1XD 1V7NL 2R9HC 5HHOD 1G7HB 3IDXL 3MLXH 1CFBA 4LSTL 3GBLA 5CZKA 3RVVD 5JOEA 5KS9B 2CDGA 1ZLUK 3MJ6A 3IT8D 5F9JA 5D71H 5CJ8A 2VDML 3QISA 3ZKXB 1Y6NR 2OK0L 2NR6C 2X41A 3GHBH 1U8QA 3ARGC 3UTZA 3NCEB 4U1MA 1CL7I 5C07D 5MERB 4Z7VA 1YEDB 5TDNB 4X4YA 3MLUH 3KPOB 1QSFB 4HBCL 4P49A 5DDHA 1ZS8B 4MD5B 4EVNA 1U8KB 3MJ9L 4NNPH 4HLZH 5D1QC 4OIBA 2DQFA 2E7LC 3IYLW 3RI5F 1QFWH 1QSFD 5GGVL 3DVFA 4PB9H 4HC1H 5DUBB 1PG7X 3MRCB 4NIKB 4X6DF 2YR3A 4JO3H 4U05A 1MCOH 3BIAX 4Q0XH 4F9PC 4P9HH 4QRRB 4U1KB 3T2PA 3WV0A 5KSAB 1HHKB 1TJIH 2UWEB 5EOTA 3QFJE 3WLWC 5D70L 4NRZA 3R06B 3GMRA 2E8YA 5LWYL 2FBJH 4GKOA 3K3QA 1S9YA 1HOCA 4QRRD 3UBXB 1SBSH 4NWUL 5KSAD 1RIHL 1PBYA 5JQHC 2HT2C 3DGCR 2FL5B 4OTXL 2Y6SC 3HMWL 5JXAL 4JZJC 1P1ZB 1IGCL 4J8RB 3V95A 2X10A 1FE8L 4JFQB 1JZ4A 1VGEL 1ZVYA 4IOIA 4S0TD 3UJJL 1N26A 2PW2B 1WT5A 2VDLH 4N9GA 3NBNA 4HGWA 4KVNH 5JZ7C 1FPTH 5DVKA 4LEOA 1JWMB 4F33A 5FOBB 5BZDB 5JXEC 4YPGA 1IKFH 3LVEA 2XIDA 4J3VA 2VH5H 5J9PA 2I60L 2FEDD 3ARDA 1QRNA 2WSKA 1EBPA 1FZKA 5GIRB 1GC1L 2QJDA 2QQLL 1J0IA 5MI0B 3D87B 4ODTL 2Z4QB 3L6FB 1AQKH 3PG2A 2Z91A 4OLUH 3L7FB 5J57B 1V7ML 2FD6H 3RRQA 5F1NA 3TJHC 2KZ1B 1DQDL 5I6XB 2XTJB 5B22A 1XGQA 3DOSA 2VDQL 1AIFA 3OJ2C 4ZUTB 4DEPC 4O02L 2ICWB 1UACL 4OKDA 4NKDB 1ORSA 4IIQC 2XTJD 5HHQA 5MEPA 2VR9A 3O11A 3IKCA 1U95B 2VZVA 4NZRH 4ZPVB 4EBQL 2XXCB 1F2XK 3QUXB 3V79C 1I3GH 4XCCL 3VRIA 2ED7A 2VLJB 5ACLA 3MLWH 3I75A 4CNIB 4P5TB 5BMFL 2QKIA 3DIFB 3Q5OA 1BD2B 1R5IA 3QUXD 1NBVH 2IBZY 5IMLB 4FQXA 1F3DJ 4JPKH 2VLJD 2V7NA 2X9YA 4KKLD 2GTWB 4N8CH 4P5TD 1BD2D 4M1GL 1N0XH 1J5OL 3T2QA 1LEGA 3MCKB 4XNUL 2GT9A 5I18H 3V52L 4XHJC 1UXSA 3BEWA 2R8SH 4C4KO 1G7MA 2NZ9C 4RISH 3U1SH 4NZJA 4LLUB 2HFGH 1X7QB 3WIIL 3T1FB 3W2DH 4ZODA 4XMLL 3TIEA 2YN5A 1F58H 4JFEE 3SE9H 3SOBL 1N4XH 1ZT1A 1ETZB 4KK8C 2VLRB 5DEFB 2R4RL 2WV3A 3LSOA 1PLGH 3OXSB 3QPXL 4GG6E 1A7OH 3O0RL 1WZMA 1D5BB 5AAMA 1NANH 2V5RA 1AHWA 5A3IC 3ESVF 3BPLB 2VLRD 1I8IA 1YN6B 1HHHB 1OCWH 1RU9L 2NQCA 4ZS7L 5IEHA 1MJJB 3ARPA 4ETQB 1XF4B 5DHYA 2OL3H 5FDYA 4OIIH 1ZA3B 3SCMA 3DRTA 4P9MH 4HS6B 1EH9A 3RGVA 2QSTA 1PEZA 1S9VA 1INQB 4PJBB 4KH2A 5I1HL 1U3HB 2YOCA 3O9WA 2AI0L 4NPYA 1SJXA 5FYJH 3FMGL 4EI5B 3WXWH 3FN0H 3RL2A 1YN7A 3RTQA 1OF2A 3C09B 3P11H 4QWWC 1U3HD 3JBG7 5D9SA 4U6VH 3DTXB 4G6AC 2DLGA 43C9B 4NRXA 2E7HA 4P2OA 1BGXH 1KPRA 4WUUB 1FZMA 1BJ1J 3KPNB 4LSUH 1D9KA 1QBMH 2A1WL 1MLCA 2R23B 4WI9A 5CEXA 2PYFA 1UCBH 1DN0A 1NGPL 3Q0HA 2X40A 4C83B 4Z0XA 4WUUD 4JDZA 1T7YA 1EX0A 4WTZA 4QHMA 1YMME 3DX8A 2OXHA 3WSQH 5C8JA 3PWLB 3IKKA 5BXFA 2DN7A 2CLRB 3DI3B 2OQJA 4OKVB 2WWKT 1GGCH 2Z8SA 3CH8A 3QDGA 3O6KL 2AK1H 2AGJH 3NZHL 3QG7L 5GGSY 2D7QA 3LPWA 4CGTA 2DTSA 4L4TB 2G75B 1IL1A 3O6LH 1SEBB 2BY1A 3PWPD 2MPAH 1NFDB 4HPYH 4L4TD 5CLTA 4EDXB 1T04B 2P24A 3TFKD 1WWWX 3QEUA 4CJ1A 4UB0L 4I2XA 5A2LH 2VXVL 3T3ME 3N1GC 1T66D 4UNVA 3MLTB 3FQRB 3SE4A 2A73B 1RZJL 3O4LB 2YUVA 3K1KC 4DKDC 1J0KA 2KQNA 2AV7A 2JJWA 2YEZB 4WV1B 3O4LD 2ZZUT 5CZXD 4GRWH 4AQOA 3S34L 3DETD 1RY7B 3R1GL 4F7EA 4EQ3A 1NCWH 4HKZB 2XWJA 5K9OA 2I9LB 5F9OH 4UNTA 4KHTL 3H7BB 3E3QC 4DFIA 5IVXA 3B43A 3G5ZB 3SGEI 3L3DB 4XZUA 4NN7C 1U2HA 1AI1H 2V2XB 1DZBA 5D2LA 3ARBB 4PRPA 1X5FA 4I9WE 4XNZC 4P2CG 1FLTX 5I1LA 2HJFB 4ZFOA 5I1KH 3DX7B 3LZFL 2X1OA 3IFPB 1Z9LA 3HHRB 4U1LA 4MA1C 3LH2H 3ARBD 5EPMB 2GTZB 1T21B 1GJIA 3GSUA 4YIQB 4YPJA 2AJVH 4OD2A 1G6VK 5HDQH 2A77H 3BQUB 1KIQB 4G6JH 4OLXL 1B4JL 3QFJA 2FEEI 2P8PA 3P0YH 4WHTB 1Z9OA 2VDPH 1IEAB 4V1DB 3U6RB 5C0AB 1LWRA 3FAXA 3LAFA 4Y16D 3VXPA 1HZHH 1RUAL 2R29L 3HLAA 5J13C 4ORGA 3BQUD 1ADQH 1MRFH 3UTTA 4OZGB 5DEGA 3RWCA 5I19H 4R3SA 1T2QH 5HGDA 5C0AD 2R0WL 1UWGL 1RHFA 1R3LB 1YDPB 4XI5D 1S7QA 4J7RA 3RPIA 2V7HA 1MVUA 4OGYH 4ODBD 5I9QB 2DD8L 4NN6B 4XH2B 3M45A 5D7SH 1ZLVK 2QTEA 3NFNB 5FA4A 3LQZA 4RGMB 1CGYA 1NGWA 2NMSA 1DLHB 3P9LA 1HINL 4FHBD 1S7WA 3DUSB 3ZLQC 2X4QA 5GRWA 1ITCA 1DQJA 4AG4H 5BV7B 5I30H 4YFLI 3C9NB 2BNUA 1KB9J 1U6AH 2HLFC 4JR9L 4LIQE 3BZEA 4XPGL 2KBGA 3IU3B 1I7UA 2XWBA 4FQJH 1JWUA 2C3XA 2QEJA 3JUZA 1HH9A 4K9EC 1UYWH 1X5ZA 3MBXH 1YNTB 4QCIB 2FSEA 4PJGF 2GJ6E 4RNRA 4LCIL 2JCCE 3WHXA 1G9MH 4GAGL 3BW9B 3TZVB 1NPUA 2VZOA 2Y9RT 4GKSB 3MX0A 1I8LA 3EAKA 5JTWA 3C2SA 5E1AA 1VFAB 4GAJH 5D1ZC 4KROD 4YWGL 2DLFL 3C60B 3G08A 4C54A 4G3YL 3B9DA 3TZVD 4RA0C 4WJ5A 1FVEB 5KOMC 4KTDH 5EZJB 3EO9L 2HKHL 2BSRB 4DUVA 3ULVD 2H3NB 3C60D 4CVXB 3BH9B 2FX8L 1B0WA 2WUCL 3FFCE 1BMGA 2HMID 3E3QE 5DMGC 1W0YT 2ZUUA 1F4YL 1G7PA 2E7LA 2FGZA 2EDRA 2VLKB 3RX8A 3OKDA 4LMQI 2BXZA 3MXVH 2GSGB 5J11C 2W0KA 5T5FL 4YK4C 5TGBB 3FJTA 3MRFA 3UAJD 2BVPB 2DLTA 2E8ZA 5E6IC 3OX8B 1S8DB 4GLRI 2NY1B 1U92A 5I73C 3FTGB 1QLRB 1X44A 3WO4B 4X6CB 4MSWA 3KS0J 1BWWA 3INUH 3JTTA 2NY1D 1AH1A 2VTFA 3STLB 2X4PB 5FAAA 1JPGA 1S7TA 5JQ6H 4NHCH 5EG6C 1H5BA 3X14B 2X70A 4NQDE 4APQC 4L8BB 4OV5A 1LDPL 5F3HA 3QXWA 3BIKA 4OFIA 1IC7L 3T2NL 4NBYB 2Z35B 1MQKL 1W0WA 2P4AB 4QOKB 1YPZF 4YC2C 5C0CE 1UWEH 4P23C 2A9ML 2D9QB 3PQYE 5B39G 1KCKA 1Q0YH 5A2IH 1OAXL 5HHMB 5DMJB 5CJ5A 1T1XB 4QOKD 5IB3B 4NZTL 2YD8A 3H9HA 4MS8D 2W9DH 3CVIL 1R0AL 2DMCA 1UWXK 3W9DB 5F7LB 1TXKA 5HHMD 2WP3O 3D48R 2P5WE 5EIVA 4DVRH 4LF3B 3RKDC 3QFDA 1ONQB 1LE9B 1WITA 5DFVD 4RA3A 4X0KB 3ROOB 1EEZB 2C1PB 1OSZB 2DQGL 1F6AB 3LN4B 2H32B 4H5SA 4HFUL 4UILH 5IK3A 4AT6A 1JNHB 1IEBB 4PP1D 4M5YH 1DL7H 4MX7A 3PGCA 2GK0A 3QRGL 4XPAH 2X7LA 1OB1A 1YMMA 4R2GC 5F6HJ 3U0WL 4N0YL 1NMBH 4IRSC 4OGXH 1EO5A 1CGWA 4WI3A 4B50A 3VRLE 2P42B 1VKXA 4LASL 5FECB 4AJ0A 2I26N 3ILQD 1MQ8A 5E7FA 3GHEH 4LPTA 4RFOH 4PJFB 4OCMC 2AK4B 3MNVB 3IETB 4X80L 4Y5VB 1PYWA 2WBKA 1DQTA 2YA2A 3MV8B 3BKJL 2A6IB 2VUOA 4BQBA 1Q94B 1MRCH 3BKYL 1YQVL 1CF8L 2PR4L 4NDMB 2AK4D 4LHJB 4Y4FB 5GS2D 2DWDB 1ZGLM 3MV8D 4LKCB 5LGHL 1U8OB 5BV7L 4CMMB 3NABH 3KPMB 1HNGA 2OMBA 4OCRL 2ADFL 3WFHB 2AJUL 3UC0L 5ID0A 1AD9A 4JHAH 4BFIB 3SGJC 4Y2DC 4Y4FD 5DJZA 1LE5A 5DZNA 3HI1A 2W91A 2GW5A 1RZGA 4JPWL 4K3EH 2QHRH 1CFVH 5F93C 5BVJA 1GHFH 1RHHA 2LAAA 2VDKL 5DLML 1MFEL 2XNAA 4BUHA 4YHLL 1E6OL 4PJ7B 1MCIA 1G7IA 3EYOB 3Q6GH 3U79A 4FTVD 5BRZB 5C6WH 1I9RH 4QRUA 1AQDA 4AL8H 5IP4A 4OZHB 1M4KA 1W72H 2DI9A 3NCMA 3QHFH 1NGQL 2AJZA 3RA7L 3HZVB 4Y1AE 2WQ8A 1X4YA 1GAFL 3O3AA 3QIWC 4YH6A 3O6FB 3LKSB 4JN2B 4RMUA 5GZNC 2Q86A 1OAZH 3ZE0E 1A0QL 2YUZA 3CU7A 1LNUA 1EA9C 5BJTB 4CDGC 2OR8A 4H0GA 3C6LA 3O2DH 5ESAB 3V0VB 2CDFB 1UH3A 4DN4L 1T6VN 3JSSA 4L4JA 2JJTC 2O61B 3MGOB 2AV1B 5ESQA 2DM3A 4ZOCA 2I07A 2R0ZH 1IILE 3C8KB 4PLJC 3OPZH 4QXGL 1A7NH 1GRWA 1ED3B 1M05A 4UIMA 1HILB 3KYKL 2CO6B 1OARH 3KJ4B 5DWUH 4G6ML 4WO4A 5DYOB 3KLHD 2QQNH 1RV6X 4P4KA 1HIML 2FECL 2GFBB 2YD1A 1E0OB 3GMQA 5C2BL 1QOKA 1NAKH 2FATL 5FYJE 4DCQA 4P3CL 5C09E 4G8EB 4NKQB 4Z7OF 3OKMA 3IDNA 1UH2A 4KI5D 5AWNH 1WTLA 2CMRL 4HIXH 4JVWA 3PXJA 4HJGA 5IOPB 4K8RD 1KBGH 2F5AH 4HUVB 5E95B 1IZJA 1UB5B 2HVKB 2ZG3A 4FFZL 5BS0E 3DXAE 1H9VA 5C92A 4LVOC 5DJDB 5K9JH 1S5IH 2Q20A 1DBJH 3IXAB 4LLQB 3RWFA 5E2VL 3B8YA 4QYOB 3AGVA 4FFWC 4KK9C 2X4NA 3WUWB 4KZEL 5H2BB 1FJ1A 4JGMA 1H3PL 1YPZE 1P84K 2R2BA 4HWEL 4NO5B 3STZA 4XP4L 3WS3B 3OKOB 1CLCA 5DD6A 5SV4A 2GJ6A 4JZNA 3OG4B 3I9GL 4GAFB 4G6FB 1BFVL 4GG8B 3FB8B 1MIMH 4TSBH 1QBBA 4JG0H 3RJDA 5HGGS 4UOJA 5JLZB 3B2UD 4G6FD 3QZWG 1ZHKA 4HUUB 2A83A 1JCKA 1P4IL 5E2WH 1IZKA 3PP4L 3UJIH 5IFHL 2EXYC 3MJ8B 3F12A 1P2CB 1Q8MA 2ICWJ 3MLRH 4LSQL 4J3XA 4NQXA 4X6BB 4KKCC 2CRZA 3DMMC 3QEQB 5I8OL 2DDQH 5F7KC 5CD3A 4LSPL 3UTPE 4HJ0D 3TO4B 3IDIB 3FFCA 3FN9A 1NAMA 4Y5YB 5ETUB 1HCVA 4HGKC 1G9MC 4S1RH 5D6CA 1KFAH 3FT2A 5EN2B 1Z5LA 4KU1A 4YE4L 3TO4D 2J8HA 5J1AB 2CRYA 3F5WA 3NAAH 2DLIA 4YXHH 5HGBA 1LQSR 2YPLE 4GRWE 3E2HB 1BJMA 4KKAC 3G6AB 5SX5H 1S7XA 3PWNA 3X13A 3CXHK 2EDJA 3ZO0A 1A02N 2KPNA 4K23L 3NTCH 2EEAA 1WTGT 2YD3A 4JRXE 4MJIB 5JW3L 2XPGB 4K71C 5H94B 1A3LH 3S88H 1QD0A 4LLMB 3EDKA 3MO1B 2ED9A 2DB8A 4IBLT 4XMPL 1OLLA 3TBWA 3MRQA 4MJID 4QNPF 4ZAKB 5F6IB 3PGDA 4HC1A 3VJ6B 2Y7QB 4UV4H 5SWSA 3V6OE 2XG5A 3MOAH 3GSQB 3GSNH 3K46A 3SO3B 3U9PL 4ZAKD 5C0CA 3ZE1E 5J06A 1QSZA 5KBNC 1KCLA 1C5BL 3PQYA 1FNEB 2F54E 4PJ5B 3S5LA 4DKFH 3MMEA 4JJ5A 2NW3B 1JGLL 1SJVA 3C87A 3QBTB 1EFQA 3RVWC 1K5NB 3VG0L 1JUFB 4K3GA 4OM1L 5T3XH 3U7YL 4IHOB 4PLOB 4CADA 1G6RB 1JZ2A 3QNYA 3S9DB 2R1XA 4ZFGH 5C0GA 2BNRB 5CCKL 4JFYA 3PDGA 1KJ2H 2AJSH 4X8JB 1PKQB 2G2RA 4YHNA 4WNQB 2GAZA 2BNRD 2D7PA 3EKCA 1U8IB 4ENEC 5SWZB 5GRJH 1DEEB 1K3ZA 5FHBH 4XCYA 3PGFL 4LVEA 5DJ6B 4XCEA 5D7IF 4I0CC 5I71B 4LLDB 2D31B 4JG1H 3EJYD 7FABL 3QQNA 32C2A 4UV7L 2E7BA 4UUJB 3EYVA 4RGOH 2WBJC 4TNVF 4NQCB 5DVLA 1QYGL 4K8RL 1H3XA 4OJFH 5JW5B 3OKLB 2N7BA 5CHNA 5F96L 2Q7YB 1M1SA 4JLRB 2FZ3A 5HYSB 2GEEA 1OGTA 2H9GA 4NQCD 4U7SA 2BOBA 1U9KA 3X3FH 1L0XA 4TQEL 4G43A 5INCA 3HRZB 1D5XB 5KS9F 2XWTB 5ITBL 3O3DB 4LPWA 1PZ5A 2RFXA 3WHE1 4XP9H 1JK8B 5HPMA 2A74B 3S3PA 3IGAA 1UEYA 5DJXB 4FZEH 1PW3A 3OF6A 2V5MA 1I9JL 1ERNA 2JJVA 3H3BC 3RL1B 3B3IB 1JGUH 3MODL 1X5YA 2JIXB 4ZQKA 4M62H 4QRPB 3ZHDA 4DQOL 5BW7C 5I1EH 5JA9A 1X5JA 1AGBA 3LV3B 2IANB 1I7ZA 4HPOL 3W5NA 2BSSB 2Q8BH 5E94B 3EZJB 1FORH 4I3SL 2JIXD 3REVB 5JPMB 2JKXA 2Y23A 4PJGA 5TQ0H 3G5XA 1KULA 2Y25A 5JDSA 2WMPA 4MJ6B 5C86A 3CDGB 2IAND 2R56H 3D39E 4G80A 4XP5L 3HS0B 3NH7L 2KKQA 3SO5A 3G5VB 2UZXB 2FLBT 1C7TA 1T0MB 2DQTH 4I5BA 4MHHG 1RQ5A 3V9FA 4GKNA 1JHLH 4GSDL 2ZKHL 4OI9A 2YPKB 1HH6B 4P59H 4L9LA 5GJTL 3HCVA 1KB5A 4WEBH 5GHWH 1MPAH 2CR3A 3VXQA 5C0BA 3OR6A 1CFNA 3I6KB 4PG9A 2QADC 3PABB 5KVEH 1KCVL 5I17A 2NY6C 3GSRA 5F8QC 3ORJA 1KPUA 1X5IA 4G9FB 2QSCL 3MRLB 2CGRH 4R7DA 4H20H 4N1CA 5F9DC 2CRIA 3EOBA 4TVPH 2ADJB 4POZD 2OL3A 4Z18A 2ILLA 3P0VL 2VIRA 5I74B 2MOVA 4G9FD 3A67L 3QDME 1PX3A 3CUPA 2ZUTA 5IW6B 2J6EL 1QFPA 4OGZA 5EU4A 3OGCB 4U2YA 2JJSC 5JIHA 1MFDL 3SDCB 5C3TA 5D2NA 3FT3A 3QDJB 1FO0H 3HE6C 2AEQL 1SJHA 3V7MA 2CJUH 4XPBH 5JIKA 2OJZL 1MCKA 2IPTL 5GGUB