4LLWA

Crystal structure of pertuzumab clambda fab with variable domain redesign (vrd2) at 1.95a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
213
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRYAPGKGLEWVADVNPNSGGSIYNQRFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mutated Pertuzumab Fab heavy chain
molecule tags Immune system
source organism Homo sapiens
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
total genus 46
structure length 213
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llwA01
1YPZF 2ADFL 1QRNE 3ILPB 3BP5A 4APQD 5F70A 3VFTA 1UC6A 3QUZA 3ZHKA 5D6DC 3AAZB 1KOAA 3HI5H 2XWTA 4YAQB 1DDHA 1K4CA 3QDMA 1T1YA 1GRWA 3A6OA 2JTDA 3IFLL 3UC0H 4X5WB 1P6FA 4EI6A 5FGBA 1SYSA 3QIWB 3BDXA 3QBTB 3V6OA 3I02B 1TQCC 1D5IL 2I9LA 4X5WA 3Q6GH 5DMGD 5C0ND 4QHKI 4LLUB 2OK0H 4PGEA 2J6EL 3B9DA 1OP5H 3CFKA 4OF3A 1QSFB 1RVFL 2VISA 3SQBA 1UB5A 3I6LE 3DWTA 4G3YL 2E3VA 5CZVL 4ZFOA 5K9JL 4WO4B 2YZ1A 2VC2H 4NO5B 3VU2A 1ED3B 1DVFC 3WJLC 2Y5EA 3MRLA 5E6YA 3KPMB 4CW1A 5E5MA 4EEEA 1I1AB 4CVXA 2PW1A 4I3SH 3BPNC 1DANT 3V6ZB 2CDEB 1VB9A 2XA3A 2GSGB 3TYFA 4ZYKA 2F9BT 1I1YA 4UU9A 3W0WD 4MGXA 2DQIH 1FH5H 4JM4L 4TTDC 3BIKA 1L0QA 4YQXH 5EBMB 3WV0A 4KK6D 1F4YL 1MFDL 1U58B 4I3SL 3C9NB 1T5XA 2VDNL 4D94A 1KN2H 1NFDE 2BVTA 1X4XA 1A3RL 3KYNA 1FZKB 1TVBB 5FHBH 4YZFE 1MY5A 1WLHA 2E9BA 5KVGH 4WUUD 1S9VA 2VLKA 1MCEA 5CJQL 3ARRA 3KJ4C 1UM5L 3L5JA 3WFDH 3MRPA 3DBXB 4RISL 4RAUB 3ZTJG 3IGAA 3MV8B 3FFCE 5TE7H 1H5BA 3SCMC 4D0DA 5TPWL 3QQ3A 3FFCA 2OP4L 1N5YL 5HYIA 2UY7A 1MQKL 3QXDA 4JZJA 5AUMB 2BY1A 3QEHA 1S7TB 2HKFL 1FNLA 4ZFOL 1CLZH 1T83C 4PJ5A 5BJTB 1RY7B 2D31B 4LDLB 5GGRY 4GUPA 1UADC 4NC1E 3SE3C 4LGPB 3A67L 5B8CA 1UB6A 2W1NA 5JUEH 1GGYA 2IBGA 4F57H 4U49A 1QSVA 1XCQB 4XBPA 1UYWL 3QUYA 2FEDC 4POZD 3FB7B 1VACA 3LN4A 3ULVF 2ZCLH 5CCKL 4MJ5B 1EHLH 2VAAA 1FFPA 3H9SA 2IAMA 2KH2B 2JF1A 3BW9B 4P5TC 2F58L 2P8PA 4HDIA 4MHHG 5I1CL 1G9ML 3L3JA 3KPSB 5IMOB 3QDGD 2KZ1B 1S7QB 5FXCH 2J88L 5KG9A 1V5JA 1I8IA 3DMMD 4N90D 1KG0B 4WEBL 5I1EH 1TENA 1W72H 4JRXB 5I6XB 3PIQA 3CFCL 5IFJA 4K71C 5CILH 1DQLH 4M7JL 1EJ6A 2FBOJ 2DIBA 1II4E 4IOIA 4MA3B 4RGNC 1WWCA 3QI9C 1VCAA 4ONHA 1WFNA 5EBWA 3ARFC 3QDJA 5CAYB 1MUJB 5IV2A 2Z92B 2FZ3B 1F6LL 5IT2L 1IGTA 1Q8MA 1G7PB 2VSCA 3OXSB 5FKPB 3O9WA 2VLME 3MLRL 5JTWA 4PJ5B 3HE7D 1IQDA 5BZDA 1T89C 2ESVE 3TO2B 4R7NB 5DHYA 5D2LA 3QIBD 1ZLUH 1CGSL 1AKJB 3DYMA 6CGTA 2ZKHH 4XP1L 4OF0A 3C09C 4H8WH 5C0GB 2DLEA 2DQDH 3QUXA 4WI8A 1M6OB 2Q6WB 2X4SA 3ECBA 1OY3B 5HI4C 1PVHA 2WK2A 4FABL 4U1IA 2VDRH 2GJ6E 4Y5YB 4PRPD 5EUOE 1MFAH 3L95B 1ZV5A 5IHUL 4G8FB 3QXDB 3MLSL 3D3VA 4RZCB 2H26A 4WUUB 3RWJA 3MV8A 3BEWB 3S4SB 4NC2B 1T04B 4N0YL 1S7WA 2QQKL 2FX8L 3BE1H 3EJZC 3TBTA 1OT1A 1T2JA 3TO4D 1RU9L 1FL3B 1GL4B 2VZSA 3CX2A 1Y0LA 5IB3A 3VGBA 1T1WA 2HFFA 2VLJD 2XWTB 4G6FB 2WIIB 1ZA3B 2VLLA 1S78D 3QXTA 4R90H 3RUGF 1WAAF 5I9QB 1I9JL 1EEZB 5B22A 3MBED 3HNSH 5GGVY 2Z31C 4RAVB 3VXMB 1EERB 3VG0H 4L8CB 4G6MH 1LK2A 1T7YA 1CDGA 4LEXL 2BSRB 4N0UA 2AQ3A 4P2OA 3B4NA 3BIKB 5A2LH 3C8DA 1I9RH 1SEQL 1PG7H 4BZ1L 2IH3B 5LBSH 2QADD 4LVOC 4XWGH 3T0WA 1BHGA 1G9EA 4ZFOB 4HEPG 5GRUH 4JPKH 1NEZB 43CAA 5IBLD 3KPQB 3KYAA 4P2YA 3VG0L 4IDJH 5DFVD 4QTHB 4E5XA 4H20H 4KRPD 4LSUL 2R0LH 5DHVH 5JIPA 3W9DB 2ADFH 2EKJA 3SEPA 4BZ1H 2GEEA 3NIGE 5DJXA 3A0OA 4I18B 2APFA 4OFPA 1BAFL 1T66C 1AXIB 4CMMA 1KCVH 1MJUH 3GJFA 4FTVA 4PTTA 5K59F 4P2QD 2VLMD 4V1DB 3WNLA 4BQ9A 1J88A 4U3CA 1QHOA 5FM4A 3L3DB 3MXVL 4OIAA 1A22B 5DFTA 1CFQA 1RIHL 5K59E 1Q1JH 3QWRD 2XZAH 4HCRH 1PQZA 5J06A 5D1QD 4KK6C 4O5LL 3DX7A 1NJ9B 4PJGF 3TBSB 4FZEL 4N1HB 4ALAH 2P48B 5I18L 5MI0B 2M8XA 3QJHA 1A9EA 2E8YA 4XH2A 2YRZA 4DCQB 1CCZA 1P53A 4PJXB 5ICZB 1MREH 3FO9A 4MJ5A 2Z9TA 3KPLA 5DEFA 2DM3A 4U3XA 4Y19B 3VFPB 1HKFA 3ARGD 1I7ZB 3C5ZB 3NIFE 4QO1A 5ALBL 3WJLA 1KFAL 2Z8SA 3RWCB 1JCKA 3MA7B 1NCDL 3QRGL 3OKDB 4XVTH 5ALCH 1AR2A 3VWJA 2DD8H 5C70A 5GGSY 5HSFA 4YHIA 1H15A 3HE7A 2QL1A 3U48A 2YD1A 5EWIL 1RJYB 2P47B 4NYLA 4P49A 4N9GB 5C07B 4NOFA 5IMLB 1NCCL 4MJIB 1Q9LA 4DKDC 5DHXB 5FHBL 4PJDB 4JFFB 4P3DA 3MUY1 1IZJA 2CDGB 3T77B 3U7YH 1L7TH 2V2XA 4NUGL 5KVGL 4TVPL 3WKNA 3CH1B 1UA6H 3SO3C 5I1KL 1QLRA 4Z95L 2J8UB 1IC1A 1CFNB 3B5HA 3UC0L 5D8JH 4RFEA 1NAKL 3VFWA 4NKDA 2PXYB 1P7QA 1NANH 5JO5B 2E9IA 4X6FB 4S0SD 3S35H 2RB8A 3O4LD 5DEZA 3K8MA 1ZMYA 3QIBC 1RUPH 3R06A 1AGEA 4OAWA 2HFTA 3ET9F 3CJJA 1JN6A 1HI6A 4FNLH 4QHLA 5ICYB 1PAMA 1NAKH 4LGRB 4KRNA 7CGTA 4HS6A 5EOCJ 4FFZH 2Q86B 4RMWA 2ORBL 4OJFL 5FYKD 4XBGB 1T4KB 4GLRI 1DEEA 5FYLL 3OR7B 3H3BC 2BNUA 1D5ZB 5GRXG 1EPFA 1RUAL 3JWDC 4KUCD 1QYGL 4JHBA 4YPJA 1OP3K 5KS9B 1CDYA 1WK0A 1JTOA 2X1WL 4X6EA 3UZVB 2CQVA 3DETD 2VDML 1MFDH 5KANI 5HYJE 4NN7B 1BQLL 1JHLL 4QLRA 4G8IB 1GC1L 3KLDA 3CFCH 4PJCF 3Q5YA 1A6VL 1A6UL 4NQUA 1YYLH 4Y4KA 3MBXL 3F6LA 1W0VB 5D7IB 4BQ8A 4HZLA 4N1CA 4O58H 2NYYC 3JUYA 3C6LD 2QHRH 1XZ0A 4PUBH 1QA9A 2VKXA 3VI3F 4ONHB 1TJIH 3LDBB 3BZFA 3NPSB 4MCYB 3KPOB 4XC3L 3SGJC 2R2BA 4OCRL 1UZ6E 2BVQA 1NSNL 5CINH 3QRFM 1FJ1B 1QFWH 3MCG1 3UP1A 4CN1A 4L1DA 2KQNA 3G5ZA 4MQ7B 5EU5B 4Y19D 1IEAA 1ZGLP 2B2XH 4J8RB 1DQJB 2C3VB 4G6JH 1KN4L 4X98A 5C0AD 3MLSH 1GPOL 4LARH 3LN9A 3QUMH 3D0VB 2OSLA 1KYOK 5DJ6B 1QPXA 5ITBH 4XCFL 2VO5A 1Q0XL 4ZDHA 1HYSD 4M7ZB 3OAUL 4LSQL 4GRLC 2XTJE 4CMMB 5E8OA 1UB6B 4LSVH 4IM8A 5IM7A 3N0PB 4JY4B 1KC5H 12E8H 4WEMB 4JJ5B 2VOTA 1I1RA 1LE5A 1EEUA 4QRTB 4BFIB 1C5CH 4X8JB 1KB5H 4XMLL 4L4TA 4LARL 5EIVA 1G7HA 4M7KL 4M6NH 1WC7B 3T8XA 3EO1A 5I1GH 5E4EB 5FGCB 3K46A 5T1KD 4XX1G 5KS9E 1TPXB 4LSRH 1I9RL 1SEQH 4CDGC 5IF0A 4WHCA 1KB9K 1ZT1B 1UXSA 4JFDA 1I9IL 4ONFH 4FQXB 4UDUA 4FFVC 3IFNH 3GMOB 5IR1B 4FS0A 1Q9KB 3QEHB 3HRPA 5D70L 1OAUH 4DUVA 1JYXA 2X4UA 2LVCA 3P73A 4X6BB 5IFHH 4PGJA 1PW3A 1I7UA 1XH3A 1X3DA 4ELKA 2OCFD 3EJJX 4HIXL 3HZYA 4U7KA 2UYLA 4M1CC 5CBAA 2C7UA 3PGDB 1J7VR 1MCDA 1ZT4B 3NGBB 3IFNL 4MA7L 1U3YA 1IT9H 2X4NB 3PGDA 2C7UB 3BN3B 5D70H 1YNLH 1VENA 3BKML 3C60D 1WQVT 2CJUL 4MNQD 1ZHBA 4UAOC 4YHOL 3R06B 2AJUL 2C1PB 4F7TA 1BD2D 2XA8L 3U9UA 4HCRL 1M7IB 2G5RA 3D39B 4OZIE 2WBJC 4C83A 2FSEB 1HKLH 5F6IC 3VFVB 3IAPA 1S9XA 1P7QB 3QCUH 2E9JA 5INDA 3BDYH 2RFXB 4U0RC 3RY5A 2YR3A 3ROOB 3EYUL 3NAAH 1I9JH 1QSFA 1Q9OB 2R2EB 5C9KA 4Y5VA 3MQIA 2ZNXA 5FO8B 1ZLWK 4F33B 5AZ2H 4LPUA 1SJXA 1KJVB 4PGBB 4TNVF 3EHBC 3BVNB 1ERNA 5ALCL 2EXYD 5GS0L 1OF2B 2JB6B 1PLGL 2ZP0T 4NRZB 3HE7B 2APVA 3EGSA 4F37F 5GJSH 5AD0A 3DIFA 2ADJB 2QEJA 4JFPA 1WT5A 4M6AA 4FQCL 2HTKC 3U4BL 3BD4A 1GZQA 1YEFH 3LS4L 4LMQE 3T2OA 1OGAD 1KENL 4F2MA 4G80B 1CG9B 1PYWB 4NM8L 3V5DA 3FB5A 5LKNA 5KZCD 2NY0C 2QTEA 4JCMA 1QA9B 4NJAL 1FCGA 3IFOB 2P5WA 3TNNA 5I71B 3SGKC 5F21B 4Z0BH 2GK2A 1UVQB 2HJFB 3MXVH 3G08B 2NYYD 3GSVA 5IFAL 2VTFA 4I9WD 2O26U 5E2VH 4G5ZH 3HTLX 3KYKL 3HAEA 1ETZB 1YEIH 3OGCB 1XZ0B 3X14A 5HVHC 1S9KC 1YC7A 1RUKL 1RZIA 1MRFH 1MCFA 4HZLB 4ZSOE 5TQ2H 3SDXF 3RJQB 4M62L 3OHXB 4J3XA 4CBPA 2NTFA 1ZEAH 4PRNA 2AI0H 3KYKH 3T4AA 4LRIC 1GGBH 1QFWM 1MAJA 1A64A 3C09B 3CDCA 3X13A 5HI5D 1WCQA 2BHYA 4K3EL 3PABB 4FG6D 1QYGH 2IPKB 1U3HD 5TQ0H 3F12B 3VMNA 3UTQA 4TYUA 3HKFA 3NIDE 4JGJA 1HHHB 3REVB 1YEJH 3WKML 1RZJL 3OQ3B 4PJFB 3VXMD 4FQIL 3E3QE 2GITA 4N8PA 3V6OE 2K1MA 1SM3H 4OZ4A 2CKNA 2OQJB 2IGFH 5C07E 1A2YA 4NBXB 1YYLL 4OZ4B 1IGYA 5A1AA 1CZ8H 3I6GB 3QDME 4JO4L 4NHUB 3O3AB 1ULVA 4H1LA 5I16B 4HJGA 5D8JL 1RK1A 2XZZA 2HFFB 2D7PA 3LEYL 3LB6D 5HHNA 1SM3L 3BP4B 4OCNC 2VNCA 1T03L 2C9AA 4P5TB 3N1GC 2MWCA 1XGYH 1Q9LB 2X1XR 5IB1B 3S96A 4OD2A 2EDNA 1MHHB 2A6JA 5IMLA 3HUJF 3O4LE 4U6VL 4CKVX 1RJLA 5K9KA 4PJBF 4PV9A 4WHDA 3RVXC 2MKWA 5DMIL 1C5BH 5GXBB 4M8QA 1G9NH 4Z76A 4PLOB 3BGAA 3HE7C 1MFBH 4YDJA 5FUOH 4S1QL 1GPOH 5LQBL 5C6TL 5CBEB 4O2FA 5I1AB 2DQHH 2ZOKA 3FO0L 3HAEB 4LCIL 3NFPB 5JQ6L 1DN2A 3UO1H 1ORQB 2VR5A 4HWNA 1LGVA 4D9RE 1B90A 1JPTH 4DFHA 1IGTB 3K74B 1S9XB 4R3SA 2ILLA 4E42A 4HGKC 5I1JL 4U6HA 1A3QA 2DQCL 2X41A 4X4ME 4OF6A 4GKZA 3QDGB 2XOTA 1G1YA 4X99B 1I1FA 4HPYL 1Z6JT 4KDWA 5ICZA 1EGJH 1HHHA 5IP4A 3WFEL 3WUWA 2DLHA 5IEHB 3MGAA 1V7NH 4GW4A 4YBHA 4XB7A 3FZUD 4WO4C 1LO4H 3DMMA 2NCMA 1KPUB 2OZ4A 5T5FH 1T20A 5C71A 5D7SL 4HSQA 3QDHA 3H7BA 2CK0H 4UV4H 1F4XL 4KK8C 2ADGA 2X4RA 5KSAA 1MRDL 1Q9KA 2D7NA 5IJKC 3KYOA 3GSOA 3MNWA 1MCPL 3KPQA 4MX7B 1MIEL 3RWIA 3VXQA 2V7NA 4WV1B 2ARWA 2VXUH 4MLIA 4PY7B 3AB0B 5DTFA 2NY6B 2PYEE 4MA8H 3QA3B 5LWYH 5F44A 2JJWA 4JY5H 4HT1L 4JDVA 4MXVF 3QXUA 4LFHG 4H1LG 4MAYD 3VXRB 2FYYA 4P5TD 4JRWA 3ZTNH 2BNQA 2FX7H 4EVNB 3MLYL 3VMPA 2EDLA 3VW3H 4KMQA 3MV7E 5EU3A 3AROA 1IEBB 3NPZB 4OZHE 1VKXB 2IH3A 4EI5C 1R3HA 1OLZA 4RIRB 2GJ6D 4X83A 1JZ2A 4HUUA 4BJLA 1CBVH 1ZT4A 2YUXA 4I3RL 3WUZA 5FUCE 2I9TA 4PLKC 4K23L 5AZ2L 5EOCL 2ZUXA 4ODVH 4K8RH 1UH2A 5FYJU 4OGAC 5D1XC 1RURH 2CGRL 5IBTL 3V4UH 2GQHA 1DBAL 1QRNB 2DQGH 2XQYG 2HJLA 4L3ED 1OF2A 5JPMA 3T65A 4PJDF 3MLWH 1B9ZA 4LHJB 3RTQA 3RX5A 4AMKL 4RA0C 4S2SB 2XZCL 2RIKA 2W0LA 1U8PA 1N2RA 1TJGH 3C6LB 1RUMH 1IARB 1PG7W 3IAGC 2WUBH 1TITA 1O7VA 4OFDA 4U6HB 5GS2H 4OB5L 4HGWB 1IE5A 2MOVA 3OXRA 2X4SB 3VDBA 3MOBH 1XFPA 1F02I 4U1MA 3B83A 3ULSB 1F2XK 1HHGB 2A74A 1KNOB 4R26H 3MV8E 2J5LB 3DGGB 5D5MB 1XMWA 3EOAA 1CFVL 5DJDA 1ORSA 4MAUL 4IRSD 2OZ4H 4PV8A 5H8DA 2EDBA 1JHKL 2R56L 4OCYH 4Y2DB 1A4JB 3RGVD 3SKNA 4R97C 3DROB 1CL7I 5L7XL 4P2QA 1JNNH 3S37H 5B3NA 1HHKA 4N0FB 1X5GA 5CD5D 1YN7B 1QRNA 3R0NA 2QADB 2EO1A 2GJZA 4R9HA 2YD4A 4G8GE 5D1QA 5A16B 4H8WC 4F58H 5I75B 4LKCA 5DGRA 5DJYB 2IWGA 4FTVE 2XTLA 1IC5L 3ESUF 3MNZB 1YMHA 1VPOL 2VERN 4GO6B 3CGTA 1FG9C 4GAYB 1FFPB 5F9WB 1KCLA 4KDTA 3MFFB 4QOKD 2MSPA 2R29H 4JFFE 4X9GA 5HHVL 5C86A 1IC7L 2AQ2A 2H32A 2NNAB 4Q6IB 1A0QH 1RQ5A 1HYSC 5LGKA 3ARPA 4PJ9A 1UACL 1KYOJ 4NNPH 4BSWB 4IRSC 2D31A 3TT1L 1BQSA 3MLUH 3EYQC 2AERT 3U36B 3IU3B 3BSZH 2A9NL 3VMOA 1UH3A 1D5MA 1YEHL 5HHVH 2VABB 5J89A 3EYFB 4JFZL 4H26B 1CGYA 1AGBB 3VGAB 3T0XA 2HFEB 1NC4B 2BNRE 4IJ3C 3MLZH 5BRZB 4UT6H 5DD6A 4AEIL 3E2HC 3K4DA 4OGYH 5B39B 4R2GC 4EDXA 3O2WH 5DJCA 3ZLQC 5KSAC 1FL6A 1CICA 3VFOB 3C5ZD 4RFOH 4C4KT 3ARGB 4PRDB 4HXBL 2EO9A 1FNSL 2PTTA 4YBLC 5AZEL 4LVOB 5I2IB 1BWMA 3CX5K 2R0WL 3QAZB 3WBDA 4OGYL 4X6FA 1JV5A 3G08A 3C87A 4NKDB 4NM4L 4XMPL 5F7HA 1AGFB 3KXFB 1R3JA 3L1OL 1LO2H 2CXGA 4PJGA 2A83B 1VADA 3O9WC 5TF1H 4QNPE 1R5IB 3VXME 3G6AA 4OLVL 2EE6A 1WFOA 4P3DB 3O3EB 4HLZH 4QRSB 4QY8A 3S4SA 3GMQA 1DSFH 1CFTB 5FF6A 1I3GL 1EUUA 5J11B 3TJEH 1FO0H 1L4IA 4OM1H 2AJ3A 3BXNB 3VA2C 1W72A 1B0RB 3LKRB 2EDWA 1F4YH 5TF1L 3JV4B 5FYKU 5L88H 5C0GA 2AK4E 1HXMB 5F7NC 2PYEA 2X44D 3RTQC 4DVRH 2FATH 4LLQB 1AXTH 2R0KL 2RAMA 1ACYL 4HGMA 1PSKH 5EO0B 5CSZA 1DE4B 1N8ZA 1JGUL 1J8HA 1EAJA 2A6IB 1FGVH 3H9HB 3IJSB 1QRND 4R4FL 3AU1B 3IF1A 4MCZA 3PE9A 1IGYB 4F7EB 1YN6B 1V3MA 2H6PB 3HCVA 5B38A 1SEBA 3FMGL 1AGDA 3EW3B 3O3BB 3IU4L 1ZANL 1V7ML 3FHQA 2J2ZA 2L0DA 4YIQB 2IPTL 4RGNB 4U1LB 3IJYA 4BZ2H 5FHAL 4OUUA 3WJJA 5FECA 4WW2F 4NQCE 1JNLH 1WBZB 4APQC 1FL6B 3ULUF 1U8OB 4GKNA 3DX6A 5FAAA 5MENB 3CDYA 5FGBC 5I71C 3MRKB 1K8IB 4J3WA 3DHMA 4I0PB 3QFDB 4EOWL 4W81A 3MR9A 1PEZA 4YDVB 4HD9A 3S37X 3L7EB 2X4TA 3GFUA 1SMOA 4OIIL 3T0EB 4E5XB 3MSPA 1AKJD 3QNYB 4XAWL 2Y06L 2Q20A 3MLWL 3VGFA 4Y5YC 5D93C 4ELMA 2ZNWA 5ERWB 3QHZH 3CVHL 1F42A 1JI1A 2DYPA 4WI4A 5I74B 1R3KB 3WHXB 4JKLA 4UINL 2HLFD 3GSOB 1CGWA 2EDDA 1QHPA 4HH9A 2WUBL 2VQ1A 1SQ2N 4F7PB 4EQ3A 4Y4FC 1T1ZA 4NWTH 4G8EA 3MV9B 4NZRH 2AEQL 5GRWA 1S5IL 5GGTA 4JQXA 5GQBA 4KVNL 1JPST 2R1XB 4N8VG 1EXUA 2J8UE 3NFSL 5FYKH 3S4SG 3CVHH 1NMBL 1AHWC 4GRWH 2OI9C 1JGEA 2DQJL 3WS6A 1EFQA 3KNBA 5TGBB 4F2MB 1FL3A 5H37H 4PS4L 3ZMRA 5H2BA 3EDEA 5DJ6A 2JJSA 3MV7A 1KG0A 1A4JA 4WUUA 4NKQB 3RWJB 3VW3L 3RA7H 1I7UB 3QFJA 4DTGH 1AQDB 4FABH 3GIZL 2LE9A 1FIGL 5GS1C 3RAJL 4A6YB 3C60A 3WS3B 1RZKH 1YQVL 5ICXA 5F7KC 1CBVL 3IF1B 3MODL 1KLGA 3SGJA 1YPZA 3GBML 1MHPL 4JFDB 1BD2E 5MHSD 1DN0A 3DVNB 3FQXA 2CDEA 2ZG3A 2Q3AA 3ARFB 3VI3E 3VWKD 4OFYD 3MRJB 4ERSL 4Y1AB 4ZPTA 2LU4A 1YMMD 1S9YA 5GZOD 1KULA 3WLBB 1NUFA 1WCBA 2XYCA 4KJYA 1KIQA 4GBXC 2FJGB 1G9MC 1TQBB 1A7NH 3I85A 3ZE0F 2NZ9C 2AJ3B 1L6XA 3H9SD 3MJ9L 1BOYA 1OSPL 4P57A 4FG6C 1H5BC 4G42A 3PGFL 4XNYH 2FL5A 3SCMA 3MZGB 3HI5L 3ZZ1A 4DQOH 3K80A 4WFEE 1U9KA 2Q1EA 4LCUA 3RUGE 2YRPA 4M9PA 1FN4A 4FXGA 3TO4A 5DA0B 1EJOH 1CT8A 4JO3L 4M3JA 5ISZE 4XP9H 5GSVB 3DO7B 4U6XB 43C9B 3PGFH 3OJDA 2J6EH 2Q8AH 1LEIA 1EEYB 5JW3L 4OM0L 3DRTB 1D9KD 4G3YH 5CZVH 5DDHA 3I50H 3C2AL 4Y8AA 4UDUB 5D2NC 1MCWW 3NN8A 1QD0A 3BYTA 1J1PL 3GM0A 3CLFL 4IDLA 1CLYH 2VITA 1KTLA 4NN5B 3QXAB 7FABL 2ICCA 4ZUSA 4X5LA 3MRFB 1KCUL 1DVFD 3MUJA 3F8UB 2EZ0C 3UBXB 4W6WB 4OZHA 3RIFK 2D7TL 4L3CA 4F37K 3NTCL 5CGYC 4NO5A 1UJ3A 1SY6L 4JFEA 2YKLH 4XVSH 3PF2A 5DTFB 3LKNA 3VFRB 4NBZB 4O51B 3T1FB 4DEPB 3I6KA 1C1EL 2VN7A 3QDJB 4OI9A 4PRPA 1XIWC 4LDOB 4PGEB 4BYHA 2BX5A 3SDAC 1KFAH 3KWWA 5KVMC 3I9GL 4HHAB 1GOGA 3VD9A 4JCLA 1A4KA 5GS1B 3KYNB 1R24B 1OAZH 5IB4A 4UDTA 4OUUB 5CWSB 5CJBA 3UTPE 4GQ9L 2VC2L 2VDQH 4PD4J 3GSQB 4BSJA 1Q72H 1N5AA 4GRMB 5J1SC 1U8QA 4B5EA 3MV01 1DBKL 1RPQA 4PJCB 4GKNB 4FXLA 2W9DH 3ZE2E 2EEBA 3MRGB 1D9KC 1I1YB 3CSGA 2UUDH 1GIGL 1T3FA 2Y9RT 1OP3H 5C2UB 1X5AA 3SKMB 3PWNB 4XRCB 1FE8H 3FN9A 4NQEE 1UA6L 2OTWB 2H41A 1PSKL 5L0QC 3MRLB 3RDTB 5GGVL 1JZ6A 1NC2D 3HNVH 5BRZE 4GUPB 1ZWIB 2EH7L 2JCCA 2GJZB 4OF7A 1MI5A 5IVXE 5J13C 1UCBL 2B20A 4HKXB 4FQ2H 4ZXBD 4JN2A 4GRWE 2UWEA 4Z7VB 3DX7B 3VRLF 4R96A 4JDZA 4PP2B 1GSMA 1QVOB 4G6AD 3VH8B 2A1WL 2DLFH 4RWYL 4ZOEA 4OFYA 4RISH 1BVKB 1G6RL 3D48R 2BY0A 2A6KA 4XHJC 3WXWL 3MFGB 5IGXH 5IOPB 5JW4Q 1O5DT 4HIIB 4AH2B 1K3ZA 4IMLB 2EIDA 5D5MF 1CICC 1JPFA 5IHLB 2VQTA 3K4ZA 4KHTL 2BJML 5HI4D 4M7JH 2XN9B 3QPQC 5H94A 3U4EB 1P69B 4RGOL 2O61A 1FNGA 1AGDB 3RIAK 1FFRA 4TVPE 4RGND 3BQUC 3T2NH 3LB6C 2CLVB 1N6QL 4ZUWA 3HC3H 3VFMA 3NCJL 5DUML 1UYWH 2Q7YA 3UTSE 1NGPL 2V7HA 4ISVA 4UINH 5CSZB 4BK5A 1Z5LA 4PJIB 1YUHB 3KJ6L 4XNXL 1G9MH 4HEME 1ACYH 2NZ9D 3QDMD 1AP2A 2J88H 4H8WL 4P9HL 5HGGS 4PRDA 4M93B 1TLKA 1HCVA 2YMXH 1QLRB 3P0VL 3TIDB 1U8HB 1MFAL 1E4JA 5C09B 5FUZL 4LLUA 1G7MB 2IPKA 4BUHA 2APXA 4NQXB 2NY2D 3MLTA 3Q6FB 1U8IB 3NZHH 4Y4KC 3RNKA 4WRLA 3LEVL 2VLRD 3KPPA 3IDGB 4G9FE 2NNAA 5I19H 1RZKC 5GRVK 5KANG 3MXWL 4NKMB 4PJGB 5EU6B 4U2YA 1NL0H 2DI8A 2ZOLA 3OPZL 1VDGA 1U2HA 1CDBA 3VWJB 3KHOA 5I1EL 3HHRB 4QRTA 3CZFB 2H1PH 4M43L 4R8WH 1DQLL 4HJ0D 4MD4A 1E4XH 2WBJA 3IXAB 5C0IB 1LEIB 1I3RB 2DMKA 1FZOB 3LSOA 3ARQA 1U8KA 1ZS8B 3VXNA 1FG2B 3TPUB 2DJSA 5CD5C 4NJ9H 3QJFB 1S7XA 3H0TA 5E00A 3GSQA 4XNQB 4PJ8D 3L5XL 1FYTE 3OB8A 5CSBA 5IFJB 2CRZA 1OSPH 4NZRL 5E6IA 4QXGL 4UNUA 2A0LC 1GYAA 4TNVK 3W9EB 2FH8A 4P5KB 2XFXB 1CXFA 3DRQB 2NY1B 4LP5A 4U1JB 1X4YA 2CLZB 4JFQA 4P4KC 4JDTH 4KGLA 3QEQB 1J11A 3FKUS 3STBA 1EO8L 3DETC 5HPOA 5LCVL 3G5XB 4LAJH 1OB1B 4LLAA 3IXTA 3BDBA 3QPXH 4XTRC 3BZ4B 1KXTB 4CDHA 3D39A 4PJ7E 1OB1A 2YPVH 3ELAT 3C6LA 4N0RA 3MRMA 3BMVA 3K4AA 1GGCH 4LFHD 1CWVA 3HNSL 3QUYD 2AJUH 1PJ9A 5EU7E 3BPLB 1YMHB 4JQXC 3P77B 4F15B 5I76A 3DVIA 1WZKA 2OL3B 5EOQH 4Z7UA 1HH6A 2CPCA 3HPJB 3WO4B 1UH4A 5HYSB 3HMWH 1KJ3H 3MRRA 3L3KB 2VLRE 4KV5F 3RPKA 4YDLC 5CIPH 3F7VB 3OTTA 2XQBL 4M03A 3HUJB 4GG8A 1J8HE 5IB5B 3SKOB 5KVFH 1NLDH 2AJXH 2D2OA 4LU5H 3H42L 4LMQI 1N64L 5E00B 4LBEA 1HQ4A 4H0IA 2CH8A 3OV6A 1AGCB 2IADA 1H3WM 1KJ3L 3OZ9H 1IFHL 3EO0A 4XP4H 3NPSC 1L7TL 3PDOB 4UT7H 2A77H 4P4KD 2GTZB 2NW2B 2BVYA 4GAGL 3ULUC 1AC0A 3FB6B 4JDVB 1KIQB 5E8NA 1MWAH 5HYSG 3WE6B 4ETYA 3CFBA 1H3PH 1DLFL 4V1DE 3TCLA 4K7PL 1NDMB 4QRQA 4XI5D 4RMUA 3MRJA 4YH6A 4FMFA 3K1DA 4CNIB 2YD7A 4LL9A 3A6BH 1Q94B 4OM0H 4L9LB 3QIUD 5B4MD 1U41A 4I3GA 3T4YB 2FD6L 4YDVA 1RZ7H 4AT6B 2AKRA 3V52H 3RGHA 4QOKB 3RIAF 4OGZA 1DQJA 2C3VA 2OP4H 2Z92A 4ENEC 3CFKB 1XF3B 3W9EA 1WT5C 4PJ5D 4KJQD 5D2LF 4P4RA 2UUDK 5ALBH 5KSBA 4PJEF 1H3UA 3JSSA 3A6BL 3V7MA 2BNRD 3SDXB 5SWZD 3QIWA 3REWB 1RUAH 4ODXB 4CU7A 3RZCD 1I1FB 4G9FD 2BZDA 4GKZB 4NNXB 4XCYA 3VXOB 4Z7WE 4WWKC 4TULH 5MEPA 5D6DA 5BVPH 2H6PA 5IEHA 4GKSA 2BVUA 1R5WA 4GJTB 1S7RA 5K9JH 2VAAB 4XH2B 3VD7A 3NOIA 4CVZA 5J6GA 2APTA 5EN2B 3BQUA 1J8HB 4HS8L 3HZKB 3JTTB 3VXRA 2V2WB 1I7RA 1RMFH 3MBXH 1FPTH 4QXUH 1FNGB 1Q72L 3IDGA 4UBDD 3UPAA 4K94H 5FDWB 3O41B 2NZIA 4O58L 1TVDA 5K9OB 1EO5A 2F5AH 1XF1A 3FOLB 5ADOL 3QUZC 2DQTH 3OKEA 3QDJD 3S35L 1HZHL 2W0PA 1MIMH 4UTAL 4WI2A 1XGQB 5DUBB 2I60H 4PD4K 2RBLA 3PHOB 1FBIL 5ESAB 1NEUA 4QHUA 3GDBA 3STLA 3EO9L 2G5BB 3JZ7A 4J2XA 1ZTXH 2QADC 2CK2A 3FQTB 4URTB 3T09A 1K8IA 1BOGA 4KPHL 2EYRA 1YUHA 2VH5L 1UKQA 2DQTL 2FGWL 3VE0A 5HVFB 2AK1L 4WU5B 2ORBH 4OJFH 5JW5B 4PTUA 1T03H 2HRLA 3TJHC 2PYED 2AK4D 5F9DC 4K3JL 2C4FU 1FBIH 4FFVD 3U7AA 2P5ED 3EBAA 1AD0B 3C08L 3QB7C 3VXTB 2ATPB 2Y5TB 3QQ4A 4YX2H 5A43C 1YNTA 2MTPA 2NW3B 3D9AL 4ODHH 2ATPA 2Y5TA 2B4CH 3NMEA 4G7YL 3QQ4B 4PRHD 5JUEL 2B8OT 5JHLL 4O9HH 4S11A 3B5TA 1MFBL 4FQLL 1ZHBB 4LSSL 3QCTL 1KTDA 3LD8B 3RVTD 1WTGT 4FFWD 3FN0L 3U6RB 5I1GL 5JQ6H 3KR3L 3DTXB 35C8H 3F12A 1CDHA 3S35X 4GS7B 2J12B 5F93C 4EXKA 1FYTA 1WIOA 3T3PE 1LMKA 2BSTB 2H32H 3HRZB 5FYJD 3GGWA 1F00I 1FLTX 1AGBA 1I1AD 4G8FA 1JPFB 3O2DH 5E7FA 1ONQB 4EKXA 5CHNA 2AXFA 4WU7A 1MY7A 4XCEB 3LHPL 4MQSB 1CE6A 4Z8FH 1PG7L 1Y6MR 2H2PC 4TSBL 4LSVL 3HN3A 4Y1AD 3GRWH 4EI6B 4NQTA 1KB5L 5TDNB 5LG1A 4QXGH 1KSRA 5CILL 4Y4HD 5B3JF 4MA7H 4ZO9A 3WHE1 4XPHL 1QPPA 2UWEB 4Z7VA 5KTEH 2HVKA 3P0VH 4I2XB 4J1UA 4X7CC 3IT8D 4PB9L 3QR2A 5IT2H 3LHPH 2K7PA 5D7SH 3TN0D 4UB0L 3PV6A 4JAMB 4RQQA 3KGRA 2ICEB 3OAYK 4XCFH 1Z9OA 2CRIA 3NFNA 5I1HL 1HNFA 4IOFD 1A1NA 1PY9A 1S5HB 2XPGA 1AY1H 2ESVD 2J7LA 1F58L 3G6JB 2IAMC 2OMNA 5AG9A 1M4KA 1G7LA 3RJDA 3OKLB 4HWBL 3BZEA 1RIHH 3JV6A 3HC4L 2F53D 3DV4B 3BRDA 1L0YA 4U2ZA 5EZIL 1JF6A 1RU9H 4ENED 3IDNB 3QG7H 1E4XL 4G8GD 5B8CC 3SDDA 4ZG1A 1U8MB 3HMWL 3RNKB 4M1GH 1NLBH 1PLGH 1NCWL 3EYOB 2EXYC 4Q9QL 1FO0B 1ZHKB 3GHEH 3OR6B 3QIUC 3GJFB 4S10A 2BY3A 1WIPA 5C8JA 5M94B 3BN9C 4Q97A 5CD3B 1NCNA 2IQ9H 3FQNB 4P3CH 1ZLWH 1JZ7A 4POUB 2BSTA 3HRZA 5CKGA 1X5KA 5DDHB 3PP3K 1FYTB 5JXAH 4R97B 4OD3L 5JW4R 3QNZA 4GT7A 4Y5VB 3VFSB 3QUMA 4Z0BL 2LAGB 1N4XH 4G8IA 1NAMH 3EO0B 1FVCB 3C5JA 4KHXH 3KPRB 4ZFFB 3MLVL 4MLSA 1XIWD 4AEFA 4XGZA 4YZFF 2PN5A 4MB4A 4L8SC 3WS3A 1YDPA 4QRRA 1K4DB 1YJDH 3O6FD 5JXAL 5FGSA 4X4YB 2RHEA 2QQNL 3GIVB 2F19H 4MNQB 5F7MC 2UYLB 4TOYH 2WWKT 1FFNA 2FB4L 4LPYA 5J1AB 4RDQG 3DUHA 1P2CA 4CMHB 1MLBA 5FOJA 3SQOH 1BAFH 5SWSE 4AQOA 5EBMA 3AMLA 3J8F7 2ARJB 5AG8A 3V4PL 2B1AH 1DVFA 3DSFH 3HUJA 3STZB 1EHNA 1FV1B 4MQXC 4WWKA 2XZAL 5C0JB 3HR6A 3SO5A 1TFHA 4M48H 2H2SD 2HN7B 3TESA 2AABH 2WBWB 2XY1A 2IFFL 1NANI 4KQ4L 5C0EB 1WCBB 4HKJA 3C6LC 1UXWA 5JHDB 4QKXB 1G1CA 2Y7QA 5HY9B 1UB5B 3JTSB 2J8UF 1NCUA 3PWPB 2EDKA 4TTDD 4H25B 2UZIH 4D9RD 3QFJB 2N7BA 1G7HB 2NY3C 1T20B 4LCCB 4Y16B 4HWBA 3DI3B 4PGCB 4U1NB 2R29L 4HLZG 2HH0H 2BK8A 4DWHA 1T1YB 2HRPH 4G5ZL 5TE4L 4XMKH 5DMKA 4NQDB 4CJ0A 2V5SA 4HJJH 1INEL 4U1KA 3BKCL 4PR5A 1EGJA 3WYRA 4K8RD 2AGJH 3B2VH 4JFOA 5DT1L 5EIIB 1A4KB 1AD9A 3ULVH 2DQUH 5IVXB 3SY0A 5H2BB 4D3CL 5IW6A 3WUWG 1XCQA 4XBPB 1YC8A 3KWWB 4P4RB 3L7FB 2YZ8A 3CXHJ 1N26A 2F8XC 5HVWA 4MNQE 1BBJB 3C5JB 5EU3B 1DEDA 1QFWL 4HKJB 3VXSB 1F45A 1XF5A 4XNMA 5FDYA 4LCCC 3BH8A 1MELA 2JJTA 3EOTL 2FX9H 4OD1H 5KJRL 5TE6H 3MRQB 1UCTA 1QBLL 5L9DL 1C12B 4NPYA 1CU4H 1TJHH 2XICA 2NR6C 1S3KH 3RBGA 5D9SB 4FA8A 4V1DA 2ZOLB 2ZWLT 4GW1B 4M8QB 3IDIB 4FTVB 4LAQH 4HG4J 5DYOB 4B41A 5BW7C 3OJDB 3TN0C 4HIEA 4JY6B 4QRPA 3JVGA 5FYLH 2BRQA 4ETQA 2V9TA 4M3KB 2ZCKH 5L9DH 3GMQB 2X7LA 1AP2B 2V5MA 3O2DL 1QACA 1X7QA 3FT2A 4K9EL 2YXFA 3S3JA 3E3QC 3U0WL 1CFBA 1A7BA 2IPUK 1I3GH 2XXCB 1V3KA 4OV5A 1UQSB 5JORA 4WW2C 1A6PA 4Y4FA 1INDH 1A14L 3MJ8B 1RZ8B 1VFBA 1YN6A 3ARGC 3HCVB 4JRYB 5I8OH 2HJKB 4PB9H 5D1XD 4WHTB 3B8SA 5F9JA 4NQED 5GGTH 2EYSA 2Y1VA 1QSEB 2XTJB 1CXEA 2W07A 4D2NA 4WI7A 1BOGB 1I7TB 1A7RL 5DQ9A 4PJDA 4XC3H 5E8EB 3FQTA 4MXVE 2NY7L 1KELH 3STLB 2Z91A 3LPFA 3DO3A 4QRPB 1CFNA 5CEZD 4HUMB 3ARED 4Q6IC 3X11A 2JCCE 1QKZL 5F88A 2JIXB 3ECBB 1X5ZA 1TZHA 1AO7A 5FHAH 5C2BL 4LVNC 4M1GL 4N5EC 3F7YB 4AEHH 1EGJL 2L7UA 3HI1A 1N59B 3F62A 1DBAH 3FT4B 4ZO6A 1BZ9A 5ITBL 1F4AA 3OGCA 2D9QB 5FYJE 5C0AB 4HC1A 32C2A 3SJVD 1U92A 2MHAB 3GHEL 3U6RA 3GSWB 1ZSDA 3QUYC 1JN6B 1ZLSL 4YHZL 2ZCHH 3LQAL 1AGFA 3SE8H 5T5FL 1MWAA 4EN3D 5DK0A 2R0ZH 1XR8B 1RUML 4H5SA 4CAGA 4ZD3H 3EDKA 5C0CB 1BFOB 4I2XA 4J4PC 3QCVL 1JPSH 3O0RL 1QLFA 1OT2A 4PG9A 3UJIH 3ARUA 2VQ1B 3DX9A 1UJ3C 3SKMA 1J1OL 2YK1L 3O2VH 5F1NB 2H8PA 3EOBB 2X4QA 1VA9A 4K23H 2XN9D 2VIRB 4KZEL 3MGTB 4OZGF 1DQDH 3SJVB 3U4BH 2LAAA 2VUYA 1HHJB 3D39E 3OG4B 5DR5H 3GSNA 4XCEA 2YPLE 1H8SA 1XR9B 5CHNB 1OAKL 4AQ1B 1FVDB 1CDIA 4IMKA 1PKQA 2EC8A 4EJ1C 5T1LD 5GRYA 5C0DA 4UDTB 4DVBB 4JFEB 4UIMB 2JKXA 3PWJB 3DSNA 3BPCA 4UTBL 4NDMA 4MMXC 3WN5A 5I8CB 4OZHB 3GEWB 4FP8H 2LV4A 2P45B 2HA1A 4GRLA 5ABDE 4WW2B 2C3GA 1UEYA 2ADIB 3RVTC 1G0YR 3V2AR 3OB0K 3QCUL 2X09A 3LQMA 3MYJA 4QHMA 1F11B 3FCTA 3W11C 4YHOH 4ONOA 3U30C 3QHFL 4YIQA 3ZSSA 5DJYA 3RAJH 1DFBL 4PP1C 4JQVC 2GYSA 3U9UB 1CFVH 3VXSA 5D72L 3FT3A 5CS7A 4XAKE 2XZCH 1X44A 4TQEH 1P6AB 1MCSA 2P49B 3LKQB 5HGDA 3MRPB 4L3EB 4YHLH 4CGTA 4ZUWB 3VFMB 4PRIA 3I3DA 1GHFL 3EJYD 4WTXA 2VLKB 4TN9A 4NNXA 3RP1A 4NO0D 5F7UA 5D7IE 4ZOCA 4TPRL 5HYFA 3PWUB 4P57B 5DQDH 5E08H 2R15A 3L3KA 5IMKB 5BVJA 1IM9D 4PV8B 3MPCA 4Z0XA 2ATKA 5GS0H 1IM3B 3V95A 1M71A 4HK3J 4YHLL 1X5YA 3QFJD 5DZLA 2B1HL 4P2QB 1GZPB 3HB3C 1QO3B 2YA2A 1WBYB 4UILH 3QUXB 4XC1L 2GSGA 3LRSA 4EZMA 4Z7VE 5MEOB 3LOWA 3FJTA 3G5YA 3B2UC 1JF5A 3DURB 1AKJA 2ED8A 5JHDD 4D3CH 3QUMB 4KROB 3RHWF 4GBXA 4R96B 3EO1B 1INQA 1OPGH 2YPLB 3AY4C 1KEMH 5HHME 3E1F1 4CVZB 5J6GB 5J3HD 4PP1D 4JVUA 3FB8A 2BNRA 5AWNH 3MLUL 3QO1A 5FOBB 1C5BL 5K9QG 3HPLB 4PJ8B 3OF6A 1G9NL 2W92A 1YEIL 5L2KD 3P9LA 4I18C 2OMBA 1JBJA 3CLFH 2OSLB 4PJFE 5I8KH 1I8IB 4P46B 3GMPA 3L1OH 4Z78B 1S3KL 2X4NA 5TQ2L 2DWDA 3CPLA 5GHWL 4HXAL 1EFXA 4G9FA 4B53A 1VKXA 1G7LB 3I75A 4RZCA 3WKMH 1R24A 2HAZA 3U0PB 2N7AA 4F7MA 3VG9B 1ZA6A 4K3EH 4L3EE 1H0DA 3LRGA 5IHBA 5JZ7C 2R0WH 3QUKB 4IOSD 4MAYB 2R1XA 5KOVC 3N50A 1OAZL 2UVFA 5HI3C 1UXWB 5L2JA 1IQWL 1YNKL 1MCOL 3PWPD 2JJVA 5C0EA 1TZGL 3OMZA 3OBAA 1BEYL 2EDXA 1NCAL 3Q1SL 1INDL 4N90E 2ZUQB 2DBLH 3TA3D 2ADGB 4OLWH 3VWKB 5EC1A 5GGRB 4PJHA 4L4TB 1XCTB 3CMOH 1F13A 5ERWA 4XWOC 4X7TB 5C0DB 1LK3H 1JFQL 1YEDB 4NRYA 2V7NB 4PREA 2FIRT 4NSKB 2DDQH 1HILA 1KLUB 4Z7UF 4OM1L 1MRDH 3DRTA 2O5ZH 3SCMD 2DBLL 3O6ML 5TE6L 1AXSA 5EIIA 1XGYL 5ISZD 1F6FB 3QG6A 4PJBA 5F1NA 1D9KB 1CU4L 5HYSA 5SX5K 1LO2L 2BNQD 1FZMB 3KPSA 3MLXL 1S9VB 4YO0B 1MFCL 4P9MH 1P4IH 2QR0A 2VYRE 3JV6B 4KQ3L 3DROA 3QISA 1U8KB 3ARZA 5GRVL 5JDJA 5L0QB 2HVJB 3WFBL 2IFGA 3RWHB 5EDXA 1JPTL 4YWGL 3T3PF 5DFVC 3JVGC 4KJPC 4PRHA 3W0WB 1I1AA 3HUJE 4CVXB 2PTVA 5C0AA 4F57L 3RI5F 2H9GA 2ZOKB 1ZANH 3IU4H 5TDPB 4RQQB 5DQJB 4YHZH 1ZLSH 5MHSE 4ZUUA 1MH5B 1IAKA 3JWOH 3ZO0A 3L3OB 3BISA 1AXTL 3OKYA 1FYTD 3CIQA 4MQXD 2WWMD 3TIEB 2HN7A 4UNVA 1A6TB 5DVKA 4ZSOA 5I15H 1WEJL 1K8DA 1QRKA 5D7LA 4GXUN 4HWUA 3X13B 1NBVH 1Z9LA 4MJ4A 1HNGA 4U0QB 3JV4A 4XXDB 4AIOA 5DD1L 2BDNH 1OAQH 1F6AA 2HT4D 4UV4L 2R2CA 2YC1B 4NKOB 5J8OA 5GS3A 3MOAH 3OHXA 3Q2CA 4JFDD 2MCPL 4LCWE 5T33H 5DJ0A 5I15L 5HTSA 1A7RH 3OF6D 4L4TE 3MOBL 3I6GA 4NOBA 4JO1L 3UYRH 4BKLB 3PJSA 5FDWA 3SKJL 4MNQA 3MJ8A 1OCWH 4Z7OF 1NFKA 1AIFB 1RZKL 1XGUA 1XGTB 3OG6B 2NLJA 5EZLB 5F7WC 3HZKA 3F7PC 4WEUD 5JIHA 1KV3A 3P9MB 4HJGB 1NDGA 1BZ7A 2FO1A 3O3AA 1E28B 3V7AE 5DMYA 1HSBA 2LU3A 1F3JB 2M2DA 5L7XH 1FDLH 3SDXE 5DJCB 2DQFA 4BSVA 4GXUM 4LNVA 1M7XA 3UJJH 2AJVH 1NMBH 3IDYB 4AY0A 5C6PB 2I5YH 3FONB 1YECL 3WHXA 2FJHA 3MV9D 3L5IA 1GZQB 3QEGH 1U91A 3CLEL 4R4BA 5D72H 5FIEA 1F11A 3I3BA 1UEMA 3GMMB 4NO2B 4P59H 3SE8L 3SDXA 5DO2C 5EOCH 4HHAA 1I3UA 5CP7A 3UTQB 2B4CC 3N9GH 2CDFA 3W0WE 2D7QA 2VUOA 1B88A 1J5OL 1ZAGA 3GBMH 1CLCA 1ZHLB 4YLQT 1OL0A 4IRJB 5EZJA 3PQYA 3DVGA 1J0IA 1IC7H 4LHQB 5D1ZC 4PS4H 3ZYJA 1J05B 1OTTD 4KDVA 4I0PD 4WFGD 4XWGL 1UACH 3OKLA 5I1IH 4POZC 3D87B 3MA9H 3RDTA 1UG9A 4QXTB 2GIYA 5DWUL 3I50L 3C2AH 3O3BA 3DUSB 3MGOB 4HF5L 4LHUA 3NCBB 3KPLB 43C9A 1MHPH 1ZT7A 3TFKC 2D4DA 1EEZA 4EI5A 4HPOL 2HYMA 4YHKH 3GZKA 3TYGH 5C0FB 4JFDE 3CH8A 4M5YH 1DE4A 1SJEA 4P99A 4P2RA 2YC1A 5F8RC 4NHCL 5J57B 4LLMA 3O4OC 3MJGX 5JXED 3L5WA 4HF5H 3BVNA 2NXZC 1K2DB 3QP3A 3BEWA 4ODUB 1CXIA 3MACH 3JWNC 4U3HA 1AHWB 5L6YH 4FXKB 4MA1B 5DMKB 3P4NA 1NC4D 4BA8A 5EZOL 2FLRT 3RWEB 4N0FA 4FZEH 3I9GH 1E4XI 2FJGA 3VRJA 1NGYB 3LQZA 1U3HA 4R0LA 3CFDA 5DI8A 2F54A 2HT2D 5EPMB 3QDGE 4N0CC 4O2CB 4EQ2A 2H3NB 5DQJA 4G9DB 1CLYL 2DAVA 3GSXA 4FQHA 5IF0B 1MJ7L 5IROA 4B0MM 3GMNB 3BZ4A 4Z7NF 3FAXA 3D3VD 3T2PA 1VADB 3AREC 3EZJB 4DAGL 5KN5A 1VFOA 4L4VA 5BZDB 4NQDE 3D39D 1VPOH 1T3FB 2IAND 3ARBB 3W82A 3E6FB 2YKLL 3NZ8B 1TZGH 4HH8A 3GJEB 3VWJC 1F8TH 3KXFD 1YNTB 2AS5M 5GGVH 1MLBB 1RHHB 2G60H 4QYOB 3T1WA 2XV6B 2V17H 3HS0A 4Q0XL 3SOBH 4WY7L 4S2SA 7FABH 5C08D 1JPGB 5M95B 3TN0B 4GXVL 4ZS7H 2NXYC 3R1GL 5DD0H 4P2RB 5GIRB 2R0KH 3GMOA 4Z95H 3BP6B 1SVZA 3O2WL 4NC1C 4AYFA 2X1OA 1OQOA 1LE9B 2E5EA 5J56B 1TTFA 4HIEB 3QUYB 4DZ8A 2FYYB 5DJAB 3IXAA 1NFDF 2CIIB 3MMEA 1I4FB 1KIPA 5E8DH 1MFCH 4P9ML 5H35B 2VL5A 1MF2H 4QT5B 5BS0A 4OQTL 1MVUA 2CXKA 3OKKA 5H35A 5C8JB 2VDQL 2P8MA 1OWRM 4KROD 1UCBH 1P7HL 4OLZL 4XP6L 3LZFH 2D0HA 5D1ZB 4BH7A 3I3EA 4GW5B 4S0TD 4QHNB 3LKOB 5E8PA 4PRIE 3PQYD 1B0WA 4P5MB 2ZUYA 4DGIL 3R8BB 3QFDA 2A1WH 2V6HA 4XCNA 3DRQA 1BZQK 2PYFB 5CJQH 5EBWB 4D0CA 4P4KB 1FPTL 1BEYH 4OLZH 1UM5H 2P44B 1A1OA 2YEZB 4P9HH 2EH7H 4NO0B 4G6KL 4FQ2L 2X4PB 1RJCA 3RQ3A 5BO1L 4LSDA 1MIML 2BDNL 3TCXA 4WDIB 5IG7B 3S3SA 5DSCB 3O4OB 1CS6A 3DV4A 2X70A 4P46C 1RIVL 2P5EE 3WXVL 4DKAA 3HC3L 4OZIA 4JQIL 3VD5A 2NY2C 2XIDA 3ZDYE 2QSVA 5MENE 5FYKL 3V5HA 2AAVA 3O45B 1ORSB 2P7TB 1IKFH 3WIHH 3U4EA 3HE6B 3CZFA 1P4IL 4Q6YA 1RIVH 2QHLA 4RGMC 3EFDL 3P0GB 3LKSA 4IIQA 1N0XL 1INQB 1F6AB 1A3LL 3PHSA 4MDJA 1MCLA 4RCAA 1WZ1L 4JVWA 3OAYH 4CUCA 3G5YB 2EXWD 1U2CA 3SBWC 1GOHA 2JB5L 1TCRA 3RL2B 4P59L 3VH8A 5EPMA 2IANA 1LP9B 4EIZC 3AXLB 3TP4A 3B9KD 1CTNA 3SE9H 4XNXH 4DN4L 1JGEB 5I19L 4JRYD 4ODWA 1A7PH 5IHZB 4PV9B 4L3EA 3HZYB 4IEFB 4H1LB 2KKQA 2GY5A 4WHTA 1CVSC 3UZEA 3KLSA 4ELKB 3KG5A 3HMXH 3PP4L 1BM3L 3BOVA 3EUUA 3V7AG 3SJVE 4PJBE 2VMFA 3N1PC 4X4YA 2J1KA 2A0LD 1HXYB 2OTWA 1MLCA 8FABA 5DRXA 1FORH 1RK1B 3ULUE 2OL3H 2YBRB 5KAQG 1D6VH 2BOCB 3ZKMD 2HLFC 4IRZH 1VFAB 4DKEH 4R6UA 4ELMB 3NACH 2VZUA 2DF3A 3EFFB 4KVNH 3PQYB 2VDRL 3DVGB 3TZVC 3VE0B 4NJ9L 1LEGA 1LDPL 2DQJH 2HT2C 3WMSA 5BQ7B 3U4AA 3SN6N 3DXAA 1CFQB 2DM7A 2FX8H 4R7DB 4DKEL 5JW5A 1B0RA 5JR1L 1G6RB 2BOBB 4CADA 1C08B 5IHUH 4CN6A 2NY6D 3FAWA 1OD7A 2Z93A 4MVBC 4HIJA 5JPNB 1ZGLB 3NA9L 4E9LA 4L4JA 4HZAA 3NH7L 5C09D 3LVEA 5DC0A 5I74C 4DTGL 3TM6A 3WJJC 2RCSH 4LLMB 2AK4A 1I7RB 2OJEA 3IS1X 5EZOH 2D7TH 43CAB 3OZ9L 4XP4L 1HSBB 1NLBL 1RZIB 2A77L 3HAEG 1JWSB 2A6DA 3ALWA 4PJAE 4IDJL 4KZDH 2F53B 1CQYA 4M7LH 3L7FA 4JRXD 1EEYA 3WL9B 2DS4A 3SY0B 1DBBL 2HT3D 2VB5A 1SMAA 3WDJA 3RVWD 1S7RB 1CK0H 3B6SA 2IH1A 1N6UA 3PL6B 5IHZA 1CD1B 2CLRB 1DZBA 1MJUL 5E2TL 3V8CA 5F1IB 4UMGA 2AJXL 2I25N 5BV7B 3VRIB 2J8OA 4AIZB 4HBCL 3MRCA 5ESQA 3VXSE 1T0PB 4QOKA 4G42B 4Z7QF 1CGVA 3SOBL 1KCVL 1A6ZB 1QFUH 1RHFA 1R5IA 3TBVB 1G6RA 3QWQB 1RUPL 1DANU 3IU3A 5DC4B 1HN1A 1QSEE 1WBXB 3TCLB 4LCYB 1UZ6F 2HG5A 2XRAL 1MOEA 4LVHC 4AIXA 3HNTH 2LVEA 2BMKB 4ZUVA 1QSEA 3ZT7A 5EFIA 3VD3A 1RVFH 1EFXD 2FEEI 4LNRB 2RFXA 4XNZC 4UT7L 3UBXG 3NN8B 4X4MA 2VAJA 4M48L 4NP4L 1MCJA 1G7JA 3T65B 2GK0B 4JKMA 1EDQA 1XGUB 3PWLB 2NW3A 4M1CD 2V2TA 1OARH 5FEBA 4QWWD 1GGBL 5IMKA 3PIQB 4QRRD 1H3XA 3VJ6A 5CWSA 1U8NA 1GAFL 4EDWL 2Y4SA 4K7PH 1L9MA 1BJMA 4FOMA 5GGQL 5D7JA 1ZA3A 2P5WD 3C60C 4LSTL 4MHHI 4BQCA 1JTTA 4JRYE 1IGIL 3WIFA 4GQ9H 4NP4H 4F3FB 3SDDD 2EEDA 5B39G 5LVEA 5E1AA 1RSFA 3BD5A 3HC0B 1DBKH 5EU6D 5BVPL 5DURD 3VFRA 1TZIB 2VE6B 1NGZA 3ZKQD 4GRWB 1KCKA 1TJIL 4FRWA 4ZSOB 3FQUA 2Z35A 5JLZB 5EUOB 2VZ1A 2NTFB 2YSSA 4DW2L 1IGIH 2E6PA 2GHWB 4XNMB 3ULSA 1E27B 2W9DL 3CMGA 5IIEA 5TFSL 3WLBA 2Q6WA 2DYPB 5JW4N 5I17B 4YHPA 1ADQH 5IW1A 3KDMA 1S9YB 3MRMB 1NBYA 5KSVA 5C0BE 4P2RE 4AM0B 1BFVH 4WW2A 1CDUA 5ISZA 5IVOA 4LLWB 5ADOH 1G0XA 5SWQB 1KIPB 5E9DE 1TQBC 4ZDHB 5HJ3A 3MTRA 3ARFA 4G8GB 3VFPA 3N06B 1IQDB 4N1EA 2QV2A 3D0VA 1H5BB 1MF2L 4X8JA 1BD2B 3DPBA 5HHPA 1R5WB 2FHCA 1VGEH 5T3XE 4JY4A 3TZVA 3EFDH 1U3JA 1J8HD 4FFZL 1EUTA 4A6YA 1XR9A 4X6DB 3D25B 2Q8BL 1IEAB 1KC5L 4GG6A 3WIFB 3GBLA 4K94L 2GJJA 1JPGA 2BP3A 4Y16A 2DLFL 4RWYH 1AXSB 5E24E 3IJYB 2MQCA 1IAOB 4Y8DC 1MJ8L 4GSDH 6FABL 1MRCH 3E8UL 2FH6A 3WEXA 4K9EC 3THMH 3ULVD 1O7SA 3O81A 3EYSH 1SEBB 3IDXH 3RZCB 3RX7A 5FO7A 5CEXA 3AS0A 4GAJL 3GJFK 3ILQD 1N6QH 1EHLL 4UAOB 4O9HL 1I9IH 3QIWC 4LCCA 4AEEA 4JKKA 5I17A 5L8KB 2BY2A 2COQA 4MWFA 5HHXH 4BFGA 1JGDB 3ARDC 4Y4KB 5I1JH 4JQVA 5DJ8A 5EO0A 5ADPL 2AK1H 4JN1L 4OFIA 3DJ9A 1LILA 2WAHA 1JJUA 3L3IA 1ED3A 4KK9D 2CRYA 4D0DB 3FQXB 4O2CA 1IRAY 2MFNA 2YPLD 2Z31A 4JZOA 3VXQB 1CVRA 1W0VA 1WSST 5D7IA 1FYHB 4YK4C 5EU6E 3D85A 2FIKA 3ZHDA 4F3FA 1XT5A 2ZPKH 5DJAA 1M71B 4ODHL 2Z35B 3OSKA 4PG2A 2BSRA 3EDJA 3U0PA 5FUZH 5F1SA 4H1LH 5GGUA 4WWKB 5MEND 1CFTA 5FF6B 4Z8FL 4M7ZC 5I0DA 1E4KA 4OD2B 4EUPH 2KPNA 4JG0H 2CK0L 3ALXA 2D7MA 2B2XL 3L3GB 1I85A 1OGTB 2XQYK 1K4DA 2IBBA 1UWXK 1BQUA 1OGTA 4Z78A 4PRHE 3FRPG 4C54A 2NY7H 4L8SA 4LKXB 2R9HD 5J1AA 3NA9H 2DB8A 3MV9A 4J6RL 1Q0XH 4JPIA 3O6FC 3MCLL 4M6NL 1CL7H 1HK6A 1KCRH 5A40E 1J0JA 1I8LC 5F1KC 3MV7D 4X6DE 4KKBD 2XXMB 5HPMB 3GO1H 3IETB 4PJEA 1S9WB 4ESKA 1BECA 1I8KB 3H3PH 1AY1L 1ND0A 3ARGA 4JR9H 1YMME 4ORGA 3RVUC 5ACZB 4Y4HB 3MCLH 1QQDA 3RGVB 1BQHG 5EUKA 1YY9C 1DBBH 2YUWA 2UWEE 4UB0H 1YEFL 3LS4H 4MNGA 4KRLB 2HFEA 5LBSL 3EKCA 4PJHE 5DEGB 2W9EL 3T0ED 1CDJA 2QQNH 5IOPA 2W91A 3IRZA 3FO2B 5GS2D 2W59A 3WEXB 4F9PA 3QZWB 4XZUB 2V2XB 4NDMB 1ZVYA 3MRIA 4JGUA 1ZVSB 1PX4A 4XPTH 3T0DA 1H3PL 1F97A 1ZVHA 2GTWA 4AL8H 1E6JL 2XA8H 1ETZA 5IK3A 2ZUSA 5LCVH 4P3WA 3RZWA 5E0QA 2WIMA 3KPSE 2HTKD 1AC6A 2FD6H 2PNDA 5DK0B 3RVVD 3GHBL 1VEOA 1RD6A 2XRAH 3EYUH 4QTIL 4ZAKC 3X17A 1AJ7L 1PDKA 1T89A 3MNZA 3RNQA 3DVFA 4M5ZH 4KI5C 3OJMB 3H2WA 5MP6L 4KQ4H 5BZWA 3BWAA 4D9LL 3KLAA 2DIJA 3QZWG 3V5KB 1R3KA 5DA4A 3F5WA 4K7FB 4J23A 3SDCC 5DRNA 4HK0A 3LN5B 3NCYP 2PXYD 2WQRA 2CKBL 4LPTA 1Q1JL 4DKFL 3B9AA 3D0LA 2PO6A 5B39A 4F7CB 1FZJB 1N64H 5HVHB 1JHTA 3SO3B 2EDFA 2VKWA 4PJAB 3MLTB 1EH9A 1P84J 4ZFGL 3VXRD 4TNWK 1JHTB 5GGQH 2E7MA 1AQKL 2VZTA 4DK6A 1K8DB 2HRPL 2VABA 1NFIA 1FVDA 4NRXA 1D5MB 2A2QT 3DX6B 5HHNB 4PJIE 4Y4HA 2F19L 5GPRA 1NDMA 1BVLA 2ICWJ 5DJXB 1JMZA 3EIFA 5JDSA 1R3IH 1Z0MA 3QRGH 1JMXA 1DEEB 3SDAD 2VXSH 5EUKB 1I7TA 3U7YL 4L4VD 2GTZA 2NW2A 4NJAH 3WSQL 1W8OA 2GK0A 4TVPH 3UTTA 3PNWB 1NEZA 2VLKD 4UILL 1MWAL 3PDOA 1CIUA 4OT1H 4DGVL 4JFEE 1MRFL 1R0AH 4OLUH 2YA0A 4UNTA 3HR5A 3EOTH 4YBQD 3GMLA 5FM5O 2OR9H 1ZEAL 5IK3B 4JPVH 2E7LC 4ONGL 1QBLH 5J1TC 2MCG1 3PABA 1T7XA 2XN9A 1EMTH 4UV7L 1HHIA 1TJHL 1I1AC 4HJJL 1Y18B 3ZL4L 2BNQE 3PG2A 1TZHB 1YEEH 4MJ6B 2M1KA 4WUKH 3KPTA 2V2TB 4FXGB 3ARVA 4NKOA 4YX2L 4OLUL 5FA3A 2Q8BH 1XF2B 2OR9L 4MYWB 5JHLH 4G7YH 1MFNA 5FA4A 5JQHC 3BO8B 1KJVA 3QCTH 1KCSL 3MZTA 1GAFH 4K9EH 5DHYB 2YN3A 3FTGA 1U8LB 3E8UH 4RA3A 4ZUVB 5C3TA 3WDIA 4U05A 3QUXC 5F1IA 4KJYB 1INEH 1C7TA 3ROOA 1BP3B 5D7KD 3BRGC 1YPZB 5IQ7L 3BWUC 4GKSB 4I48B 1U6AH 4RX4A 3VXSD 2JK5A 3SBWA 1N6VA 4ZXBB 2VXVH 5DJ2A 3V5DB 2B5IB 4TUOB 2DI7A 3U7WL 3MNVB 3O6LH 4TSBH 2VDMH 2DTMH 4XVUD 1F4XH 3LEYH 2ADJA 4JFPB 4NQDA 1OGAE 5LAXA 4RMVA 3EOYG 4FMKA 1IAII 1DQQB 4EN3C 2JJSC 4S1DC 5ITFA 4NQSB 1I1CA 1ZS8A 3N1FC 3MRDB 1D6EB 5E9DB 4K3JH 4I0PC 1ACZA 1A1MA 3U0WH 4RFNC 4U1HB 2R4RL 1A1OB 2AJZB 1QKZH 2YEZA 3C08H 3MBEA 1CF8H 1S8DA 2DIAA 5D1ZA 3UDWA 3I2CL 3ZTNL 5DS8B 4Z5RA 1JGUH 3KLHD 3QQ9D 3D9AH 3A6CL 5HGDB 1MVUB 3OKKB 4Y2DD 1MCIA 4JB9H 5HI5C 3AREB 4I5BB 4OCRH 4Z6AT 2VLRB 1M1SA 4X8XA 3FT3B 4CL7A 1E27A 1T2QL 4BFBD 1ORQA 4G8GA 3MLXH 4K3DH 3FTGB 5E95B 3QXWA 3PWPA 1MRCL 2X4TB 3INUL 3RY6C 1MJJA 4LSQH 3TVMB 4L9LC 4FQHB 4LASL 2WBJD 2R0ZL 3FFCB 2X10A 4FQLH 5EOTA 5DD5L 4X9HA 4HUWA 1KJ2B 1TZIA 3T04D 4YWGH 3WE6A 3Q5TA 2QQLH 4NUJA 3RFZC 1K9TA 1KBGL 3S34L 4JM2D 1LQSR 4WU7B 1NCWH 1NFDA 1MEXH 1EAPB 3C6SB 5CEYB 4Z0XB 1LEKA 4K3HA 5C0JA 3SKOA 4KJQC 1D5ZA 2HTLD 2Z8VC 4NQSA 3GRWL 3U83A 1JF1A 5IQ9B 3G6DH 2WIIA 1R5VA 3DMMB 5T5NF 3PWLA 1FFOA 3FRUB 1A02N 5JXEC 4HFUH 3S9DB 1EV2E 3ARTA 3QEUA 1FJ1A 5FECB 1C16A 1FVCA 3LD8C 1AGEB 4EVNA 1MCWM 4PJ8A 3HPJA 4DZBB 2XZQL 1OGAB 5DJDB 2RJMA 1JHKH 1XIWB 2R56H 1J87A 3EZ8A 5H94B 2JJUA 1A6WH 5C92A 1IT9L 4YFDB 2AEQH 1JZ5A 3E6FA 4JO1H 3QQNA 5FYLE 1BVLB 4ZO8A 2IBZY 1ZSDB 4GG6E 4U1JA 1Z0NA 3RWIB 1DFBH 4HIIA 4AH2A 2P1YA 5JLZA 5I1HH 4R7NA 3DXAD 3NFPA 2PTUA 1YJDC 2A6KB 3GSXB 1WGOA 2X89A 4PJEE 2WZPD 1HKLL 2G5BA 5E9DA 1HYRC 2AV7B 3BX7C 3WD5H 4Y0GA 1FCCA 3CNKA 3KS0H 4N8VB 5FA4B 1GHFH 4JHAL 5D7LD 1IGFH 2HTLC 4FQXC 4DKFH 3OB0H 5JOFA 1BQHA 5DXWA 1WIUA 5DURB 5E2WL 2ZUUA 1GJIA 2F53E 5CEZH 3X11B 3ILQC 1SJHA 4NGHH 4YFEA 2OBGA 4G7VH 2BNUB 4JRXA 1F4WL 4LLVB 1RZGA 2CGRH 3V4UL 2H8PB 1S7VB 3ARDD 4UOJA 5D1QC 1U8MA 5ESQB 5J12B 1D5BB 3HE6C 5HGBB 2WLZA 1Q38A 4Q9QH 4NQDD 2FDBP 5DLML 5GZND 1RJZB 1U3HC 3LS5L 4XGZB 1TJGL 3VFTB 4G7VL 2OTUA 4XPTL 3HZMA 1U93A 4AL8L 3R8QA 3NCMA 1I3RA 2DJUA 4BH7B 1KENH 3VFSA 4EIGB 5B21A 1E0OB 5FYJH 1JYNA 5D7JC 2BHUA 4YDKL 4NO3A 5F3HA 2X4OA 4MB3A 4KHXL 3OX8A 4FQCH 2ADIA 4XPGL 5F8QC 5MI0C 3MRIB 3DI2B 3QZWA 3SQOL 4UIKL 2OZ4L 4NRXB 4Z7QE 5FUCC 3T77A 3BPCB 5DEGA 4O51A 5I8KL 4D9LH 2CIKB 2FB4H 3C5ZC 4PJXF 4P5MA 3BHBA 4RAUA 3W9DA 4MXQC 4TRPL 1U0QA 5CGMA 5IJVB 1LHZA 3UAJC 4QF1A 4FQJH 1U8HA 1F2QA 2V7HB 2WINA 1KJMB 3GMMA 4NO2A 1C12A 2NY4D 4Y5VC 1P9MA 4TUJB 5BZWB 4M93C 1B0GA 3F7QA 5AWNL 3S3PA 4PJIA 5ECJE 2VWEE 2HKHH 4HKZB 4Y2OA 2EIBA 4F7TB 1VSCA 2HMID 1FP5A 1IQWH 1YNKH 4WFFD 1FGNL 1IGJA 2ZCKL 2DLTA 3MJ9A 1A9EB 4GLRH 1VGKA 1U95A 1R3IL 3MRBB 3QUZD 5HDQL 3BJLA 1RZFH 2XT1B 5HGHA 4QRRE 5IEKA 4XPBL 1S7WB 4HX1B 4I1NB 3CFJB 2PYEB 3BQUD 4KH2A 2GFBB 2YD8A 1VERA 1NBZA 3K1KC 5DO2D 1CGTA 3TIEA 2IGFL 1W72B 3IDIA 4LLDA 1JYVA 3ARFD 1CYGA 1GIGH 3ZDZE 1IAMA 4WFGE 3TA3B 4HK0B 3BRFA 4JM2C 3OXRB 2J6EA 5ESAA 2R4RH 3RGVA 3N85H 4WTZA 3MRQA 1X6NA 4IHOA 3SGDH 3GMNA 2ZSWA 4NQCB 5AYQA 1WVZA 1DUZB 1KNOA 5BW7A 2VZ3A 3A6CH 4K7PX 2V5RA 5FKPA 3V0VB 3AREA 3MRGA 5DMGC 3TNNB 5C0NC 5D2NA 1EEQA 2GT9A 4H88H 4RAHA 5FCUH 3U2SB 1QFWI 5DS8A 4Z5RB 4GRMA 5HGAB 4K2UH 4OLVH 1JNHA 4XAKD 4GQPH 3VXTA 2CRMA 5DK2B 3QG6B 4PJBB 2Q76B 2GJ6A 5IWLC 1FO0L 4NZUH 5KZCB 4C4KO 3DUUB 2ARJA 1J05A 1KBGH 4JG1H 3S34H 1T7WA 5ID0B 3L9RB 1DBMH 4OF5A 4QF1B 4D0CB 2A73A 3VFGL 4NFDA 4ORZC 2C4FT 3MRHA 4LEOA 5DD3L 5EORH 4KHTH 4KC3B 3BAEL 1MAML 1F4HA 4L4VE 1FFNB 4M1DL 3MLPA 3BKYL 3SDCD 3DUSA 3MGOA 4RGNE 4Y88A 5D71L 3C6SA 5HJ3B 2WBJB 1FC2D 4JG1L 1Q9WB 2F54D 4OCSH 3P4LA 3UJIL 2WMPA 5JA9A 2K3TA 1FQ9C 5DUMH 3IVKB 5BS0B 4PJFF 5EORL 3V6OC 3FZUC 5F3HB 2IBZX 4C56E 3ARSA 4ODTL 5HPMA 3D1MC 3OL2A 1I4FA 4OFKA 4Q6IA 3QNYA 1YY8A 3F58L 1CD8A 2E27H 3KPPB 1LP9F 4KFZC 3DX8B 4KK8D 3QYCA 2XKNB 3IJHA 4MD0A 4WHYG 4WV1A 1NBVL 3CFEA 3CXDH 4A6YL 2FJFA 3ZYOA 4KWUA 2W65A 4TUKL 1Y0LB 3VG9C 2VR4A 3H7LA 2D7OA 4LHUG 3G5VB 3HG1A 2MCPH 2MPAH 2F74B 3RKDC 3WD5L 4U1LA 5IROC 1N0XH 2X4UB 2ESVA 4IS6B 3NCCB 3L9RA 4YDIH 4A2LA 4Q9RH 3M1BA 4X5XB 1MEXL 2IAMD 4PRIB 4WTZG 5E2UH 3GMPB 1AE6L 2AV7A 3B2UD 2H1PL 2G2RA 1RIUL 1L7IH 1HSAA 4BFEA 1QTYT 1PZ5A 5F7EH 3BZFB 1A5FL 4LLWA 5JO5A 3PJSB 1FLRL 2AJVL 4I3RH 2Y7QB 3G5XA 5HY9A 5DRZB 4HFUL 1T0NB 1YECH 1S5IH 3QEQA 3CVHA 5T1KB 2DQEH 3LKPB 1T22B 4LLYA 4YE4H 1XIWA 1DQDL 1S7TA 4RRPA 3PXHA 5E8OB 3E0GA 3NCEB 4P23B 1JPSL 1IM3A 1SJVA 5F3BA 1AI1L 3GUTA 2Z4QB 5GZOC 1RK0B 3WNKA 4XBEH 3NABL 3TGXA 4M5YL 3G04B 1UFUA 3KNBB 5TGBA 1N7ML 5INCB 2X42A 4YHMH 4APQB 1KACB 5FYLD 3FHAA 2BERA 5F7FA 2Q87A 3G9AB 1T7ZA 4GG8B 5IB5A 1FZKA 1TVBA 1MHHA 2A6JB 2GSIB 5EU7C 1S78C 1U8NB 3CFJA 4X6BA 1LO5B 4K71B 1UWEH 1I9EA 5C0CD 3ZTJH 1YQVH 3C5ZA 5A3ID 1NFDB 3NTCH 1CLOL 3ALPA 8CGTA 4JKPH 3T08A 2BXYA 4JAMA 4P2OD 5ENWB 1PFCA 5KSVB 3MYJB 1E4KC 1UXSB 1QUNA 2XKNA 2Q3ZA 3IJHB 1BPVA 3P30H 4YHYB 4HC1H 4YUEL 2GAZB 4YHKL 4TSAL 1UZ8B 5EOQL 5BOZG 2XTJC 5E6ID 5C0IA 2J5LC 5DRWA 2WLYA 2X1QA 5E03A 1HQRA 4WWKD 5TDNA 2IQAB 2VLRA 4HULB 3UEZA 3EJYC 3OAZK 3MRKA 2ICES 5DWUH 2EYRB 5IJVA 2L7JA 4TSAH 2MMXA 3B8YA 4RFNB 1ZOXA 3TVMC 3OX8B 2VDOH 4F8TA 3VXRE 3LKNB 3PP3H 2FR4A 3VXPA 1OM3L 2P24A 4X98B 4WFHD 3RI5K 1C5DA 4PRNB 4ZOAA 4ZTOL 3H3KA 1DDHB 2QSCH 1UM4L 3B43A 3L5HA 4O4YH 2AEIT 4MA1C 1KB5A 4MCZB 1D3CA 3PDGA 5ICYA 5C6WH 3QDJE 1KEML 2BSED 5K9OA 1MWAB 1MQ8A 3NIFF 1QFOA 4NO3B 5C3LD 1LK3L 2GW5A 3Q6GL 1X5FA 1KCUH 1PG7X 2YWZA 1MCKA 4I0KA 4JHWH 1QLFB 4PG9B 4QHKJ 5E8DL 3EAKA 2MQ0A 1G7IA 1J1PH 5J4MA 1JWSA 4OZFB 5D1QB 5A16A 2GCYA 3D2UA 4FQXD 2ED9A 1HDMA 3IFOA 4O02H 3K2UL 2JB6A 4NRZA 1IBGH 5T3XH 2PF6A 1J10A 1NCBH 5HBBA 4RFOL 5I1AA 4FQPA 3MUHL 1IILE 5HYJD 3D18A 1PY4A 1MNUH 4FTVD 4NYLB 3QEQD 2AXHA 2JIXA 3PHOA 4NC0B 4AIZA 4YGAB 4O02L 4TULL 1XGQA 5IVXF 5D9SA 4TNWF 2VLJE 2Z91B 2AKRB 5EO1B 4HKBB 1ROWA 3BP5B 4RWHA 2Y6SD 3RBSA 4I77L 1ITCA 2ZG2A 1PKQE 3TO2A 4OGXH 2R39A 4X7DC 1J8KA 2F5AL 1ND0B 1CQKA 4TTGA 2FBJH 4LKXA 4OCXH 4PJXA 1MQKH 2X2YA 4LIQL 3KS0J 4NWUH 3O3UN 3JXAA 4ODTH 2BVPB 5CP3H 4UTAH 2FWOA 2I60L 2BXZA 4IOIB 4MA3A 3WFDL 5KS9F 4Y4HC 3MOAL 1NGWB 1DTUA 1UQSA 5JORB 2R69L 1OSZB 1D9KA 4ZTPH 2PTTB 3LH2L 4NNYB 3CMOL 3VXPB 3LEVH 3PDDA 5JXEA 2EZ0D 3TEUA 5C9JB 5HHMD 3DV6A 3MXWH 2EE9A 1T1WB 4LBEB 2OLDA 4KUZL 3WNMA 1W8NA 2VXQH 3BN9D 5HDBE 5AAMA 2C1OB 1K6QL 4S1RH 5BRZA 5IQ9A 4KU1A 2KUTA 4MD0B 1MCRA 2Y25A 2BJMH 4R4FH 5KSUB 2CUMA 3LH2H 3T2QA 4MDJB 3SE9L 4DN4H 3QIUA 5HD8C 2B4CL 1OW0C 5A3IC 1HEZA 3VFGH 1KTLB 4Y4KD 1ZT1A 5ILTL 1A9BA 1BM3H 5DRNB 1NGPH 1ADQA 5C09E 3Q3GB 3L3IB 5BO1H 1MJ8H 5BOPA 3MNWB 5CZKA 4L3CB 4HQQH 1MLCB 3W0WA 1I8LA 4QCIB 5DJ8B 1C7SA 1D6VL 1QSFE 2GAZA 1RUQL 4AG4L 2BCKA 3MRNB 5DVMA 3BP7A 1JGLH 4GAYA 3OXSA 3TWCL 2CLZA 4EOWH 1QP1A 3BGMB 5IKCB 4P5KA 3WNOA 1W0YT 3R0MA 4X6DA 4JFXB 4LKCB 1H0DB 3TZVD 1PQZB 4LCUB 2X4PA 3DUUA 3F65A 1TMCB 2WP3T 3P4OA 3S5LA 1FC1A 5T1LA 3P9LB 1LD9A 5CLWA 5JR1H 1LWRA 5KSBB 2OS7A 1NH6A 4GG6B 25C8L 3NFSH 5CEZE 4APQA 4MQ7A 2AEWA 4IIQB 1WISA 3JTSA 2HLAB 4MQTB 5JOFB 5BMFH 4DGYL 3BW9A 1CIDA 1F90L 1M6OA 1VESA 1FRGL 1T0NA 2MQ3A 4R8WL 5HYEA 3CDGA 5D96C 4LSPL 3WLWD 3FB7A 2A6IA 3C5SB 5HYJA 4L4TD 1U92B 2P8LB 1OCWL 3HPLA 4HCRA 5JNYB 5F89A 1WUNT 3H9ZA 3V5HB 4ZUSB 4JFYB 4XT1C 3U79A 1HHGA 2A74B 1N2RB 1CN4A 2G2RB 2PW2B 1MVFA 3WDHA 2QJDA 4WW1A 3CFDB 3P30L 4PRBB 5L6YL 3BZDA 4HGWA 1L7IL 2YPLA 2Z31D 4WENB 4ODSL 3ZT5A 2YUVA 1QR1A 5E99H 4TSCL 1OTUC 2VE6A 3DVNA 4HWEH 3JWDH 5F96L 4NO0A 4LEXH 1J5OH 3VWKC 3GIVA 2Q86A 4X5XA 4L8DA 4W6YB 2Y07L 2FNBA 1YDPB 4RSVA 4PG2C 3GBNL 2RCSL 5SV4A 1NEZG 4HDIB 1P9MC 4DAGH 4PIRF 3ULUD 2IH1B 4XCNB 4ODSH 4FZ8L 4JDTL 2BC4A 3G6JE 5DFWH 5GRUL 1MHEA 2E7LA 2VDLL 1QFUL 3ILPA 3NABH 3LKOA 5E8PB 4G43B 3MA9L 3KVQA 4NN5C 2E7HA 2D03L 5EA0H 2F15A 3S97C 2W65B 3O11A 3OAZH 1A6AA 4UU9B 3TT3L 3QA3A 3GK8L 3QIBA 4QHMB 1IEBA 3U0TA 4XP9L 2NPLX 4DQOL 2D4FA 4HPOH 4EXPX 5IESH 1BMGA 5I18H 4PJHF 5J0BA 3DURA 3MX0A 2I27N 4JJHA 1OP5K 3QQ3B 3IFLH 5SWSD 5TF0A 1WBYA 3PV7A 5KVFL 3RZCC 2HLAA 5MP6H 4I4WB 4IRJC 2AXFB 4M7LL 2Q8AL 3VXUE 4NHCH 1WITA 2EE3A 4GW4B 3TN0A 4X4ZA 5EC2B 1BFSA 3P3YA 3PWUA 2VLJA 2J4WH 3MA7A 4HV8A 4XVTL 3WIIH 5HHOB 4G6AC 2ITDA 3GKWL 1KEGL 3JUZA 3MV9E 3UMTA 3HNTL 1JNHB 3DX9B 1JI2A 3C2SA 3CC5B 2DQFB 1LO0H 2NY0D 3MREB 3Q5OA 2VIRA 3NZ8A 2G75A 2IAMB 5DGQA 1SY6H 4X0KA 1E28A 1NCCH 5ENWA 2VDOL 4OLEA 2DMCA 3LSOB 4PY8J 5DK2A 4F8QA 5GSRB 4J1UB 2E7BA 2VSDA 4PLNC 1JE6A 4LVHB 4LCWA 1CG9A 1PYWA 2YD5A 4ZTOH 5IW6B 3HFMH 5GSRA 3HLAB 1ADQL 2GY7B 1CI5A 1NBYB 2O93L 3SDAB 1FNEB 2GSIA 4Z7WF 2BSSB 1KN2L 3QT2A 1G6VK 4OCXL 1DLHB 1AO7B 4WNQB 2CUHA 2IALB 4I9WE 1TTUA 4LSTH 3SHSA 5E56A 1N5AB 5GISH 3U30B 3R1GH 1X5IA 1SYVA 5CKAA 5JA8B 3V52L 3BKCH 3T0BA 3HFML 3SKNB 2GTWB 5A2JH 3T0VA 2GUOB 5DT1H 1TXKA 1ZGLA 2V17L 2NXYD 3STZA 2DLGA 3B9KC 1FFQA 3BMWA 4WJ5A 4JPVL 3M8OL 4LRNH 3LV3B 1JL8A 1NBZB 5FK9B 4KMLB 5D6CA 5AAWA 3MO1A 1QFPA 1ZLVH 4XWOD 1KTDB 1IGJB 3V9FA 1VHPA 5TE7L 4J3OC 3VJ6B 3IETA 4PJEB 1FHGA 1ODAA 4XCCL 1B4JL 4L8BA 3IKCA 3HAEH 1D5IH 4W68A 3ARYA 4F9LC 3IDXL 3TJHD 4OD1L 5KJRH 2OK0L 3VDAA 3LZFL 5ACZA 3QXAA 2FO4A 4ZAKA 1VGKB 1KCSH 3IFPA 3REVA 4ZAKB 1O0VA 3LIZH 4JRYA 3EYVA 4JN1H 5J13B 1XGTA 3FRUA 2E8ZA 1B4JH 4I77H 3AXLA 1URLA 5CZXC 5HDLA 3SDCA 2XNAA 3ORJA 1B3JA 4M61B 4BKLA 3B9KB 2ERJB 5C7XH 3NVQA 3MUZ1 4FFWC 4DGIH 4I2XE 5JDSB 4PJXE 5FKAB 5DUPL 4XP5H 1K5NB 2NXZD 1DQMH 1KJMA 1MCQA 4ZUTA 1I85C 4M6OL 2OXHA 4HUUB 2I07A 4PYHA 4GSDL 6FABH 2V5TA 1KT2B 5IB2A 2IANB 3ARBD 2PYFA 3TH3T 3KJ6H 2DBJA 4P23D 4JFFA 4UQ3A 2FL5B 3W11D 4PJ8C 2VDNH 3KXFE 3WXVH 4KPHH 1QR1B 5DQ9B 1G0DA 3IDJB 4X6CB 1AH1A 3G6AB 1N3NB 4I0CC 5DRWB 2QKIB 4WIQA 3ZDXE 5DVLA 5I8OL 1OAXH 1T22A 3HG1E 3I84A 3FO1B 4IOFC 4LLYB 4OI8A 4J3UA 2G9HB 4WNQA 2VXQL 5CINL 1WF5A 4QRQB 4V2BA 4I8DA 3LN5A 3FQWB 3IDUA 3SDAA 2GI7A 4LPVA 5I73C 1FRGH 2X4OB 3BT2L 3FOMB 1MUJA 1IGMH 5FO7B 1LP9E 5CEXB 1A6AB 4M7LT 5I6XC 4HUXB 4UUJA 2P7TA 2ICWI 3BH8B 2P8LA 3PXJA 4BM7A 3BQUB 4MWFB 1D5BA 5KVDH 2O5XH 5BV7C 1C5CL 3QWRA 5SX5H 1KELL 4U6YB 1I3VA 3ABZA 5DJ0B 4Q9BA 3OAUH 3EGSB 5LGJA 2WANA 5D7JD 1FN4B 5GIRA 3QSKB 2FEDD 2FHBA 4XCYB