4LLWA

Crystal structure of pertuzumab clambda fab with variable domain redesign (vrd2) at 1.95a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
213
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRYAPGKGLEWVADVNPNSGGSIYNQRFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mutated Pertuzumab Fab heavy chain
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 213
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llwA01
3RX5A 2IFFH 2CDGB 5EBLA 3BH9A 1VACB 1QSFE 4M1GL 1RZFH 5FYJH 3ZLQC 4G8FB 5AZ2L 3WBDA 4Q6IA 5GRJH 2F8VA 4S1DC 1H3VA 1GAFL 2FIKB 3CXDH 4UUJB 3BZEA 5AG8A 2IGFH 1NUGA 1CWVA 4UT9L 5DO2C 1FFOA 1EAPA 3O11A 3I3DA 3MGTA 4U6XB 3ORJA 5LCVH 2YRLA 5I75C 2EE3A 5I1GL 4OZGF 2CMRH 1P1ZA 4OLWH 5L8LB 5EU7E 5DS8B 1W72L 1H3TA 1JVKA 3IFPB 2ITDA 2X41A 4LPCA 4S1QL 5C2BL 3LEYL 5A43C 2A73B 3QO1A 4YX2L 4JFFD 1T89A 4N8VA 4OQTH 5C0DB 3MV8E 1F58L 4UQ2A 5FUZL 3HAEH 5GQBA 5E0QA 3TJEH 3T4AA 4EI6B 3RGVA 5CINL 3QNXA 1I1FA 3QIBB 3L3OB 1IGJA 5HHOE 1KJ3H 3C9NA 4F7TB 4UMGA 2DD8H 4NZRH 2YZ8A 5BRZE 3QP3A 5IBLC 4QOKE 1I1RA 4JO4H 3VI3E 3ESVF 2OLDA 1CXEA 1SBSH 3VDCA 5JPMB 3X3FL 5DDHA 4IMLB 5H37G 1N6QH 3VH8A 4AEIL 3O3DB 1WEJL 5EUOB 3I3BA 4ZO8A 1SJVA 3ARDC 4Z7UB 1A02N 3V79C 4B53A 1MFEH 3PWJA 4DOHE 5F1NB 1XR8B 3SKJH 3SDDA 2HYMA 4X7DC 4N0RA 5FHAH 2M1KA 3UYRL 1EV2E 5HYJE 1WWCA 3JWOH 2GUOB 5F9WB 5F9JA 3QIWD 4U05A 1EIBA 4G9FB 1HYSD 2Y72A 3TLRA 2XWJA 1UXSA 5IG7A 1INDL 1B0WA 1AO7A 2KUTA 1S7XB 3FQWA 5I74B 1DQQB 3FB6A 5IQ7H 1AGDA 4DAGL 4I18B 4KUCF 4QRSB 1BZ9A 3U2SB 1AQKL 4DEPB 4JZJB 4RFOL 5FM4A 2ATKA 4RIRA 3GSNA 4PJGB 4UIKH 1NMBH 4MJIB 1D3CA 1HKLH 1X6LA 1GGTA 2NY1D 4R3SB 4ISVB 2RCSL 1S8DA 1YN7B 4Y5VA 4YHML 3T3PE 3CCHA 3MLTA 4NO5B 5CD3A 1CD8A 2GITA 4HWEL 4LSVH 2AQ1A 3GSXA 4IOFD 1V3LA 2BVPB 4ZPVA 5JHDA 5AUMA 5K9KA 5MENA 4BFGA 3ILPB 2I25N 1OVZA 3QQ3A 4XMPH 1AD0B 1NUNB 1U8HB 1SM3L 4QHNB 4XWOD 2D03H 3ZL4H 3CSYA 4TUOA 4ZSOB 4AH2A 3AGVA 3U4BH 4WO4A 1IGTB 1RZIB 2ADJA 4WCYL 4N0FA 3JV6B 2FX8L 4GFTB 4PB9H 3F6IA 5I1AA 3OKLB 1S5HA 1AIFB 2J6EA 4KTDH 1C8PA 2NPLX 1VA9A 3QWOB 2W1NA 2BJML 1LEGB 3MUJA 4EUPH 4KZDH 4NPYB 5GJTL 1Q1JL 2VNCA 1U8MB 1R0AL 1S7QB 3EYQC 1J1PL 1RJZB 1D5MB 2FO1A 3AREA 4JVPA 4MNGE 5JIKA 1PKQE 1MELA 1GHFH 3OKOB 3UTSB 3CVIL 5E8DL 3C87A 1OY3B 3CSBA 5D7KE 4E41A 4FZ8L 3V5HB 1NJ9B 3GBNL 3D3VA 3R8QA 4V1DA 2J1KA 4QTIL 5F7DB 1OM3L 1YY9C 4WUUE 5JOPD 4XCFH 3UZVB 1MCOL 3T3PF 4H1LG 3V7AG 4LSSH 3QXVA 4JY5H 1A2YB 3GNMH 2HRLA 4UT7H 2FZ3B 3B3IB 3FT4A 3GI9H 1QFUL 4WEBH 3UZQA 2YKLH 1BFOA 3CVHA 3W11C 5LWYH 2EZ0C 5J8OA 1NLBH 1MUJA 2P4AB 3SE3C 4M02A 1OARH 4JM2C 4OCSH 3TN0D 3GSQA 3BT2H 1HK6A 1NCCH 3K0WA 4FABH 4MLIA 4JFEE 3TVMD 4JPIA 4NJAL 4ETQB 1BMGA 3B8SA 3J7HA 5D2NE 4HG4K 3VD4A 3BP4B 1CE6A 1TTGA 3QEQE 3C60C 4NKOA 5EU5A 4FQJL 1ACYL 1XGUA 4X5LA 4O51A 5E8OB 3TWCL 5EZLA 5AWNL 4KVNL 5DVNA 1UXWB 5DQDL 1NC2B 3V9FA 2ID5A 4WV1A 1ZTXH 4Q9QH 1R5WA 5GGSY 1FZKB 2XN9A 4R4BA 5FKAB 4OV5B 1CK0H 2GYSA 2FGWH 5CILL 1P84J 2I26N 2BY1A 1I85C 4Y1AA 2ESVE 3QZWG 1G7PB 5L88L 2WZPD 5HGBB 5IV2A 1GVIA 2FB4L 4K71B 5IHZB 3GSRA 5B8CA 4PJFB 2GT9A 1KFAL 3UTZA 4HLZH 2A9MH 3A6OA 2HFGH 3FONA 1NC4D 4LLAA 1FZOB 2HMID 4P9HL 3FO1B 3VXMA 5JDJA 1QA9A 3RTQD 5KJRH 3ZKXB 5BVJB 3IAPA 4JG0L 5TE6L 4BFIA 3JVGA 2AV1B 5FGBA 5FYJD 2WBKA 4JREC 3VFWA 1TQBC 2JIXD 4YNYA 4MNHB 4FFWC 4HKJB 3TBVA 1XGYH 4I1NB 2BNUA 5D7LD 1DBJL 3JSSA 5ALCL 3O6FC 4G5ZH 1CFBA 1VFUA 5I6XC 1EMTL 1KLUB 2QLVB 2R9HC 2CLVB 3VXSE 1NGWB 2ZSVB 5IVXE 5DMKB 2PXYC 2AXJA 1AGFB 2ADIB 1A3LH 1DN0B 1GPOL 4IRJC 2WANA 2F54E 2MPAL 5F9OL 5FGCE 6FABH 1NBZA 3HE7C 5DLML 4OLXH 5BS0D 3LS5L 1A7PL 3DSFH 2EXYC 3D85A 2AJVL 4H0HB 4M6AA 2B1AL 3O9WD 3GBLA 2ZOKB 4HUXB 4DK6A 3HUJE 2YPKA 3MV11 3VD9A 4JB9L 1G0YR 5I0ZA 4Z95H 1MH5B 5BV7B 1AR1D 1KEMH 1FL5A 4P4KC 5J6HA 5T1KD 3SE8H 4JFDD 2ZCKL 1RK1B 4K7PH 1DBKH 3HAEB 4WFFD 5HTSA 5IEKA 1U95B 1P7KA 3GO1H 3VFMA 3KS0H 3WXVH 4EOWL 2H32H 4XVJH 1CD1A 4LVOB 4OFKA 1CIDA 4YBLB 1XIWA 1LE5B 5GS2H 3QEUA 3DUSA 1DJSA 3P2TA 5EU6A 1QRNE 4P9HC 4PS4H 5D1QB 3E3QE 3TH4T 1ZA3B 2UYLB 1LK3H 1WFOA 5I15L 1MI5D 4ALAL 4Z7WA 1ADQL 1Y18A 3OJ2C 5C0RL 4PJBF 2DYPB 2NY2C 4NO0A 3MRDA 1N59B 2V5MA 2DL9A 4PB0L 4LU5H 4XB7A 3BZFB 1YEIL 2KKQA 2WM0A 3ARWA 4LSRL 2P1YA 3F7YB 1S7SA 3TYFA 5D7JB 4M5ZH 4PREB 2CKBA 4U1KB 4FQ1L 4EQ2A 2V2WB 5EOTB 3S6CA 2GW5A 3UZEA 4X4MA 5EOCJ 2NX5E 1UZ8A 1GAFH 5FF6A 2R4SL 4PIRF 3BO8B 3HC3H 4WDIB 4LPYA 4WW1A 3MRGB 4E9LA 4H1LA 4UT9H 4XVUC 4GOSA 1SJEB 4JHWL 3LDBC 4PJEA 2W9EL 1ZHKB 2V7NA 5DQJB 3HUJF 1T1XA 3EFDL 1F4WH 4NKMB 5CJ8A 1CICB 2YD5A 2DWEA 4RAVA 5I1GH 3ARGA 1W72H 1RUQH 3I02B 1AXTH 3PG2A 2QBWA 2D7QA 3LRGA 3T0ED 3DHJA 4S1QH 2B2XL 4JRYB 4YQXH 2BOCA 4FQXB 2XOTA 1M7IA 3IU4L 4PJ5B 3M17B 4R6UA 1T21B 4FQIL 2OTPA 4NWTH 1CFNA 4G3YH 1B0GB 4PJAB 4ORZC 3DYOA 5LKNA 5HYIA 1T1WA 3WNLA 2BSTB 1QSEA 1YUHB 5FM5M 5IBUG 3KLHD 4FFYH 4L4VB 4GW4B 4UNVA 3JWNC 4GRMB 5ESAA 5CCKH 3EUUA 1ZLWK 1N8ZB 4OCRH 3H3PH 1BM3L 1UB6A 3OXRB 1IE5A 4ZQKB 3MRHA 2X5PA 3QZWA 4O2EB 4YDJB 5F1IA 3X3FH 3PWPE 3L3JB 4AEIH 3ZYIA 3B6SA 4F3FB 1MFDL 2C7UA 3IFOA 4ZNEE 3EZ8A 4X99A 1NFDE 4OUUB 3MA7A 3LEXA 4WHDA 3WNKA 2BDNL 4NNXB 2VISB 5IW1A 2ZNXA 4JFQA 3UYRH 1XF4A 5F7LB 5TF0A 15C8L 1U8LA 4J3VA 5DK0A 1V3JA 5DR5L 5C0CA 3Q5TA 4XHQA 2EKSB 4MWFA 4G42B 3QIBC 4PJ7E 5DD5H 4HIHB 1INDH 3G5VA 3RUGE 3DLQR 3IKCB 4CVZA 2DN7A 5DJZA 5E5MA 4DAGH 1GJIA 3OAUL 3X14B 3NH7L 4JAMB 1AQKH 1G6RB 4RFOH 4HUNB 4LSDA 3BPNB 3K4AA 4TUJB 2F5BH 2Z4QA 1YPZA 4UQ3A 2EEBA 5T3ZL 4D9LH 1MHHB 2VITA 3TO4C 1U8IA 4KZEL 4QRRE 1CG9B 4OGZA 4YHMH 5C0AE 5E8NB 3RZCB 3BGFB 3VFUB 2V7HA 2C3HA 3OGOE 1R3JB 2QHRL 3GJFB 3SKNA 4LCCC 3NZ8B 3P9MA 3H9SE 3VXRA 2AJZA 1I7TB 2IFGA 3DBXA 3FTGA 2VZ3A 6CGTA 4KJQD 4PRHA 1TNMA 1NFDF 1SM3H 2YEZB 4J4PA 5DA4A 2UWEB 1CE1L 5I74C 4YHKH 3WIIL 3T2NL 3W2DL 3V6OA 1J5OL 1VFAB 3BKCL 4I18C 1HWHB 1AE6H 4QXTA 2FX8H 3CJJA 4DEPC 1LDSA 2RB8A 1I3GL 3VWJB 2P8PB 3G6JB 4PY7A 2WBJA 3L5HA 4GSDL 4HS6B 4PGEA 3DMMB 5EWIL 1Q1JH 2C4XA 1XGRB 4CVUA 3RUGF 3CU7A 3DO7B 1HEZA 1J1PH 1LO2L 3NN8A 5EULV 4MJ6B 1WBYA 4XRCA 1A4JA 1U8NB 3B9EA 2YD3A 4Y16B 4XPAH 2R15A 4K8RL 1L6ZA 5C7XL 1I7ZB 3CVIH 5E8DH 1JTPA 1ZGLM 2BNQD 12E8L 1WUNT 2OTUA 5GSVA 4FZ8H 1XF2A 2ZPKH 2MHAB 1FN4A 3GBNH 4Y2DB 4YHLL 4GS7C 1OM3H 1SVZA 3LEVL 2BX5A 1MCOH 3CDFA 3MRBA 4IRSD 3ARRA 2CDEA 3SJVA 1MREH 4GG8B 3C5JB 2Y5EA 4ZUSB 4MQ7B 2BSRA 4MA3A 4PJHB 4S1DD 2FO4B 4Y4FB 4X9GA 1AGCB 5EBWB 5BW7A 1NBYB 2LVEA 3SGKA 3C8DA 5E8EB 3NCEB 4NJAH 3QDJA 4AIXA 3Q1SL 4U6YB 1G7QB 2CD0A 2VIRA 1ACYH 2DICA 1KJ2B 3M07A 4OCWL 3H9YA 3U4EA 1JHKH 5AWNH 4KVNH 5GGTA 1S7RB 2IQAB 4HBCH 1U91A 5C9JA 1R3KB 1KCVL 4W81A 5DQDH 4KHTL 4IMKA 5BOPA 5CEXA 3OMZA 4QY8B 4YK4C 2CR6A 4LAQL 1AO7E 1BEYL 2H32B 4IOIB 4TQEL 1MFAL 5ALBL 5DJYA 4QRPB 4YXHL 3IDNB 3KWWB 1C12B 2DI7A 4K8RC 5L88H 4OLZL 5L2KA 3FB8A 4NC1C 2FB4H 5L2JA 4IRZL 3QUML 3UTQB 3P0GB 4U2YA 4JDTL 2PYEE 3L3GA 5TF1L 3STBA 2P8MB 4TSCL 5FM8A 1CLYH 5JIHA 2EDFA 1RZ8B 2DM7A 2MJWA 1FNGB 4L3EB 4LHUD 4M6OL 5IBLD 3SY0B 3OAYK 3OJMB 4NM4L 4NO2B 3RWDB 1FG2A 1NGXB 2PCPB 4EN3B 2NTFB 3SN6N 2ERJB 2LU3A 4XXCA 2KBGA 5JHDE 4MA7L 2VO5A 3K8KA 1U9KA 3ARDD 3HRZA 3QRGH 1RZGA 2WP3T 5IMKA 3RL2B 5MENE 1MRFH 1JWUB 4RWYH 3CK0L 3HRPA 1OGAA 3BEVB 1S7UA 3MJ7B 4X0KA 3DGGB 4K7FB 1DBJH 3U46B 2J7LA 1QACA 2VLRE 4W6WB 3GB7A 1HXYB 1EMTH 3MV01 3WHE0 1CIUA 3MRFB 4QF1B 1ND0B 5KSAD 4GW1A 3MTRA 3WFEL 1GPOH 1KLGA 5DRWA 1NKRA 3STZA 2YN5A 9CGTA 3LKPB 5HI5C 3LS5H 1S3KH 1A47A 2AJVH 2IPTL 3PL6C 5HHQB 1NLDH 3GMLB 3ZKXC 3O81A 3WJLC 5DC4B 4PGCA 4U7MA 1HKFA 2E8ZA 2QQNH 5CP3H 5F71A 3B2VL 2E7CA 3ES6A 4NOBA 3TP4A 4YDVA 5T3XE 1A6WL 3KYNB 3BN9C 2FWOA 5DHYB 4MVBD 1X5KA 3VE0A 1GYAA 2X4TA 4YC2C 5GGRA 1SJHA 4AT6B 3D3VE 3D25A 4F15B 4V1DE 2W92A 4OFDA 3IS0X 4WFEE 1WCBB 3VFVA 1LE9A 2VLKD 1MCKA 3TF7C 3WFCL 3ULUL 3LQZA 3BI9X 1GGBL 3BKYL 3MV9A 3HNTL 5IVOA 1RAMA 3WE6B 1KJVA 1M71B 2VR4A 5I15H 3OHXA 43C9A 3TESA 5JDSA 5C0RH 2VYRE 3QG6B 2BSSA 5D1XB 2YPVL 2HWZL 3C5ZB 4KRPC 4L4TD 1A22B 1Y0LA 1YEIH 1D7FA 1YNTA 1FYTB 2DQGH 1DCLA 5IUSA 3KPRA 1WF5A 4M6ML 3IB4A 2Q1EA 1JRHI 4FQ1H 5T1DL 5EOQL 5JHLL 2YC1A 4BELD 4JO3H 4PD4K 2IPKB 5DJCB 4R90L 1J88A 2R1YA 2OJEA 3NPSC 4LBEA 4OUOA 3MBXL 4YHNB 1LO5B 3RWJA 4YBLC 4OCYH 3F7VB 1WISA 2W9EH 3QI9B 3RVVC 3SQBA 4KHXH 4YHIB 5CJXA 1B6UA 3EFDH 3FFCE 1ZA6A 5E7FA 4D3CH 2XN9E 3FAXA 4J3XA 1N6VA 2ARJQ 3SKOB 5DF0A 1TTUA 3O41A 3R8BB 4Y1AE 3P40A 3Q6GL 3EYSL 1V7ML 4YO0B 4QHMB 1MCDA 4HH9B 5SWSB 4KQ3H 3VD5A 2Q7YA 4P99A 1YY9D 2B2XH 4LKCA 1AGEA 3IJYA 3SKMA 5D7JC 1JGEA 1EFXD 5JLZA 2QSTA 3FOMB 4MJ5A 3IU4H 3QXWA 2MSPA 4J3SA 4FQIH 2CPCA 1XR9B 3VXME 3WIFA 3ULUC 5DUBA 1QSZA 1D5XB 1JI1A 5DMIL 2EZ0D 4N0CC 1QFWL 4JM2D 2YBRB 2R56L 3MACL 1P5VA 4ELKB 3SDAC 3EGSB 4NIKB 4APQB 4Z78B 1NGYA 4K3EL 4M8VA 3PDOA 4FNLL 4YXLL 2MCPL 1BM3H 3KPNA 1QD0A 5DD1L 3J8F7 1CICC 3S96B 5FYLE 3QBTB 4HMCA 2QQLH 3JV4B 5D6CA 3G6DL 3L3KA 2Y5TA 3GSUB 4ERSL 2WV3A 3MV7B 3FL7A 3Q3GB 1CFVH 4MD0A 4PJCA 3QPQC 1EAJA 3NIFF 4P2QD 5CBAB 2R29L 2R0LL 1G7MA 4FQXC 5DK2B 4RMTA 2BDNH 3WLWD 1VADB 4XNQB 4QNPE 3MR9B 4NUGL 3CD4A 1JZ8A 15C8H 4Z6AT 3QUZB 3RVWD 1D9KA 3VJ6A 1EERB 2NW2B 1IEHA 3MOBL 3QCVL 4EDXB 5ENWB 1IEBA 3LKOA 2E9WA 4WIQA 3TCLA 4HKZA 3TZVB 1E27A 1FCCA 4NN6C 2VLJA 2DDQL 1LILA 1BJ8A 3FB5A 4JVUA 3VXUD 2Z0BA 2FX7L 3OAUH 5IJKC 2DM2A 3NH7H 1FPTH 5C07B 4NBZB 2FECL 1I7UA 3IGAB 3GEWB 3MRIA 5EU6E 4XCCL 3QFJB 2EYRB 4ZYKB 3SGEI 5I66B 1PZ5A 3MLSL 4Z7WE 1FGVH 3KYOA 2VZOA 4FFWD 3VFPA 2A38A 1LO0H 3C8KB 4MJ4A 3W5NA 3H0TA 3GMOB 2RAMA 2QHRH 3WO4B 3TV3H 3O6FD 4NJ9H 5E9DB 4R9HA 2R9HD 4OZFH 3RWCA 2PXYD 2VN7A 4IRJD 3IYLW 2QSQA 3QR2A 4K23L 1MLBB 2G9HA 3N1FC 3VRLE 3WN5A 1U36A 4X4ME 3BP7B 2VLLB 3HE7D 1NFIA 3U0WL 1A3QA 3RPIB 1XCTB 4WWKD 1J5OH 3BKCH 4P5KB 3V7AE 4AQ1B 3Q48A 2WW8A 3BFOA 4Y4HC 5JQ6H 1EEYA 3BPNC 3DIFA 3FQXA 1JHTB 2YD9A 1WWWX 1OTUD 4NQCD 3HLAB 4P4KD 3MOQA 1EO8L 4HUKB 4CMHC 2XZQL 3FT3B 4QHKI 5IOPB 3BQUB 1KB9K 1N2RA 5EWIH 4PJ9B 2PO6B 1WWBX 4N9OB 4Z7QE 3BGFC 5T33L 4YHPB 1U6AL 1N5AB 4PRNB 3TJHC 5E08L 4OZGB 2WIIA 2YD8A 1HNGA 4UINL 1IAOA 2PYFA 1OPGL 5C7XH 4QGYA 4FP8L 2J3SA 4YDKL 3UTTB 4JR9H 2PR4H 1H9VA 2HAZA 12E8H 3CSGA 4ZXBB 3SBWC 1NCBL 4FTVB 3UJIH 1HI6B 4ODWA 4LPVA 2CH8A 4Z7WF 4YHLH 4XNXL 4MD5B 3AAZB 3B4NA 1QSEE 4UIMA 5E6YA 2LAGB 5GGVY 5D72L 3U48A 3TBWA 1FO0B 3MGOB 2Q76B 4L1HA 1CXHA 3SDCD 4PGBA 3BUTA 3GGWB 2VWEC 1K8DA 4LARL 4GW5B 2VABA 4H5SB 1UWEL 5BMFL 4QRUB 1FZMB 3X3GH 3VRLF 5DURD 5D71L 2VL5A 1FVDA 3QRFM 4ZFGH 3HZYA 3K2MC 4H0IA 3JUYA 1AI1L 5DJXA 4MAYD 2YR3A 5SV3A 1J7VR 4ODVL 4MA1B 1JYNA 4TNVF 4XVUD 1QSFD 5D93C 4Y16C 1MCRA 1HHJB 4P5MA 1CFSA 4PJEF 4P23B 3REVB 2C1OA 4NT6B 5MEQB 3BVNA 1G7HA 4OCWH 4Y2DC 2ZP0T 1FZJB 5K59E 2VQTA 1BIHA 5C0CE 3PP4H 1KCVH 2ZSWA 3MRNB 1XAUA 1JV5A 5FUCC 5DFTA 4K2UH 2E9IA 2YK1L 2C3VB 4Z7QF 1QR1A 4JANB 4PV8A 4WEUD 3T09A 4AJ0A 4LAQH 3EJJX 1BEYH 3HNSL 4HGKC 4TQEH 2X4UA 2X7LA 1NGZB 2FR4B 1T22B 3L95A 4RGOL 5CS7A 2X40A 3P0VL 3PQYD 4Y19A 2W65A 4Y4FC 2WINB 3QUMH 3GUTA 2YD2A 4LCIH 4X7FC 3QNZB 4KUCD 4NZTL 2EIBA 2R1WB 4JDTH 1WFTA 2IC2A 5HJ3B 4LCYA 3RIAF 1C1EH 4WI9A 3MV8B 4TSCH 4DVRL 3HC0A 1QRKA 4M6OH 4NN5C 2AI0H 1G9NC 1RK0B 1NCDL 1DANT 2XWTA 1RJLB 3VA2C 1CGUA 4TTGA 4GXVH 4MA7H 4X6FB 5HHOD 3VXRE 1YC7A 5BRZD 4ZD3L 1HQ4B 4QOKD 2BXYA 1PDKA 3CK0H 4PRHE 3QQ4B 1KCKA 4NQSB 5I16A 4WUKH 2DQDL 3V6OE 2YUZA 5IGXL 3N85L 4EVNB 3N9GL 4ZPTB 2NY4D 3WFHA 4HWBL 4POZC 2MOVA 4R0LB 2ATPA 2ZUSA 4EXKA 1MHEA 2CDFA 3BP5B 5E70A 5K59F 1U58B 5HYJD 4PBWD 1IRAY 4KRLB 4PGDA 1YY8A 4RZCA 4U1NB 4W6YB 4RQQB 3KLDA 3BIAX 4CU6A 1EBAA 1JYVA 1QEWB 3MOAH 3OKKB 2QR0A 5FGRA 4EN3C 4KGLA 3B2VH 5FO7B 1IEAA 2JJUA 1HDMA 2OTWA 3QEHB 4WJ5A 1A6WH 4P46D 4PLKD 1F45A 5JR1H 1B2WH 1YPZF 4MB5A 1MIMH 1P2CB 3TO4D 3R1GL 4P2CG 3VWKC 3C6LB 2YA2A 1M1SA 2XKNA 1OAYL 4NC2B 4QT5A 3U0TB 4E5XA 2CUMA 3MCLL 2F19H 1QHPA 2XWBB 3WFCH 1JTOA 5GRUL 3SJVE 3BKYH 4QCIA 3OGCA 1X7QB 1BVLA 1DUZA 3HNTH 2A6KB 2DKMA 5CMAA 5FFLA 5FCUL 4F58L 4G80A 5TE7L 3BIBX 2X4NB 2YPVH 2HWZH 5IB5A 3ZYZA 4MXVE 5IMMA 4U1MB 2B1HL 3RNQA 2ICWB 1BQLL 3DNKA 3IDMA 5IEHA 1QP1A 4NQXB 4XC3L 1QVOB 2P5ED 3WEXA 3RFZC 2Q3ZA 3QDJE 2JK5A 2DBJA 5EOQH 4I48A 5JHLH 4WVRA 1X5XA 1CGYA 4NNYB 4O58H 4L8SA 3EW3B 4F15C 4OM0H 3NBNA 5HBBA 3GMNA 2BRRL 5K33A 1VGKA 3VGDA 1UJ3C 3HNVH 4HFUL 5T1LD 3DX6B 5I17B 4RBPK 5L0QB 2NY3C 1WT5A 2J8UA 3P4LA 1RJYB 3DRTB 3QIWA 5D1ZC 4LSPH 3Q6GH 1UWXH 5IWLA 5D1XC 4NSKA 5J7CC 3EYSH 1FNEA 1V7MH 3BPOB 4XP5H 2XFXB 5L2KE 2CXKA 3C5ZC 4MNGB 5T3ZD 3CAFA 2FSEA 1JJUA 3T2PA 3KPSA 3PWVA 4R7DA 1AKJA 4GJTB 4IJ3B 5D7KD 1CF8L 1QBMH 4KMTL 4JDVA 1OT2A 1KPVA 1YJDH 4H26A 3TBYB 3MYJB 3R4DA 1GL4B 1OAQH 1MHCB 1F02I 2D7TL 4WUUB 5DMIH 2NYYD 2Y36L 4NO3A 1QFWH 5CEYA 4HGMA 4XAKE 3MMEB 3MACH 2R56H 3SE4C 5ECJE 5BCAA 1N3NA 5CD5C 3QUXB 2ICWJ 5HHVL 4PLOB 2PTVA 4MXVF 3UDWC 5CP7A 5HI3C 5KSBB 2VZVA 2W9LA 4K3EH 1VFBA 2G5RA 1BZ7A 1CYGA 4IS6B 1JF1A 2MCPH 3P4OA 1OGAE 5DMYA 4IOSD 1MY7A 32C2B 4XNUL 2UVEA 5CJBA 3ULVL 1Q94B 1WFNA 5L8KB 3CIQA 3G6DH 2YWZA 4JFEB 4X5WB 5H2BB 5HGAA 1KOAA 4YE4L 4ERSH 3MLYL 4TPRL 5D2NB 1TETH 4LKXA 3LOWA 3VFNA 2ADFH 1KTLB 3QEQD 4Y4KC 4XVTL 5B21A 4CUCA 4X4YA 1FL6A 1ZT7A 4CU7A 1RSFA 1ONQA 4NUGH 3FRUA 5FUOL 3RDTC 2V17L 5F6HJ 5T5NG 4K8RD 4ONFL 3V2AR 1S7VB 1ZKAA 5DXWA 3D0VB 2OL3L 3MOBH 3T4YB 4YPGA 1NDGB 3B83A 3QCVH 4OAWB 5DWUH 1EHNA 1OAZL 4HS8L 4QLRA 3KLAA 1HE7A 2DDQH 2ESVB 2X9XA 2IJ0C 5AAMA 3FQUB 4I4WB 4X9IA 5HHME 2FX7H 3OG4B 4RX4D 5IR1A 4BSJA 1EEUA 4XCCH 4W6XB 2UZIL 3MV9E 4CRPA 2BERA 3MLSH 4U0RC 5A1AA 3LH2L 4M93B 5ERWA 2OZ4L 3RWHB 4P9ML 2MFNA 2CIKA 4CADA 4PJBB 3RI5F 3QUZC 3KPRE 1AHWB 5JA9A 2HVJA 4WHYH 5FV2A 1CFQA 2O5YL 3WUWG 5KVDH 3ULVC 4M7KL 1BVKB 3PABA 2W0FA 3SCMD 5F88A 5SWZB 4PJ8B 3BH8B 1LHZA 2NY5L 3TN0A 3U0WH 4LVNC 4K3JH 5M7QA 4PRBA 3A6BH 5DGQA 4TNVK 2DKSA 2HVKB 3PL6D 3VXSD 2Q87A 4RFEB 1GOFA 1QFOA 5DVLA 3FO2A 4FN0A 2OJZH 4CN1A 2F54B 5FGCB 3O3EA 5DRNA 5I8KH 2ITCB 1U93A 3KDMA 1HILA 4AYFA 4G8IA 4ORGB 1FO0L 2QADB 3HUJB 3N1MC 4RGNE 5T33H 1A6VL 2UZYB 4YAQB 3NCJL 4ZUVB 3SPVB 4NBXB 1K4CB 1BP3B 5F1OB 3WSQL 3AFLA 1OPGH 5DD6B 1NCNA 3BKJH 5ESQA 4NQEB 3ARZA 1NCBH 1QG3A 1ZT1B 2D31B 4KTEL 5TH2A 5DHXB 5FYJU 2A83A 1JI2A 3DUUB 4H0GA 3WNNA 3OB8A 2K1MA 2VDNL 4XNXH 4ZDHA 1QRNB 4KRPD 5EO0B 5D72H 3RIAK 4JQIL 4PTUA 1NC4A 2FJHA 3K3QA 1ORSA 1I1YA 4AMKL 5C0JA 4KRNA 4XPGH 4BKLB 2HFFB 3L3IB 1YYLL 3BQUC 3IU3A 4YGVB 5BMFH 4PJ9C 5IB3B 4XZUB 1L6XA 5D71H 1A3RH 4H8WL 4JZOB 4PJDA 4XTRC 1AI1H 4ZS7L 2JIXA 4LQ1A 3U1SL 4ODVH 4LLDA 4PJCE 4LNRA 1YEEL 1BLNA 3EO9H 5D7LA 5ID1B 3RVVD 2NX5B 3IT8D 4CDHA 1HHKA 5IMLA 4X6BB 3UCRA 2AS5M 3MODL 4GRLB 5ACMA 1G7LA 2Q8BL 3DROA 1T2XA 4G7VL 1IGIL 3MJ9A 5ITBL 3U83A 4GBXD 4ENED 4W4NA 3D1MC 1B4RA 3UX9B 1MOEA 1MVUA 5BS0A 3MCKB 5K9JH 3T8XB 1D5IL 3O9WA 5E4EB 5D7JD 2VLJE 3VFTB 3QUYD 5KW9L 5IMOA 1J0ZA 2Q6WA 4G8EB 1A5FL 1H8OA 3ULUD 3JV0A 1MWAL 1BHGA 3SQOL 3ARBD 4OQTA 5T1KA 4N0CD 2NQCA 4JFDA 1EH9A 4RAUB 4NZTH 3OKMB 3SDAD 5T3XH 3MREB 2BNRA 4DVRH 4LLWA 3H42H 5GGVL 5F3BB 3S5LG 4P23C 3CXHK 2YD1A 1L9MA 4HUMB 4UILL 4KK5D 3E0GA 4F33A 2NW3B 1MI5A 4BZ2L 1LK2B 1FFQA 4WHCA 4XPTH 1I8IA 1MCNA 3W39A 3VFRA 4J2XA 4E0RA 4DGYL 4H8WC 1X4ZA 4JY4B 4PJCF 5D9SA 5DJAA 3LB6C 4PD4J 2Y25A 2DQDH 3PWPD 2EH8L 3QCTL 1II4E 3KJ6L 4AIOA 4L29B 4X5XB 4HWBH 4Z5RB 1F11A 4RAHA 2OQJA 1T2QL 4J3OC 3VW3H 1FBIL 4F9LC 4X8JA 4PLJC 3MX0A 1XF3B 2VXSH 3ZKNC 1KYOK 3ZDZF 2I07B 3BGAA 4F9PC 1ZLVK 5E2VL 5DI8A 1WC7A 3RWFA 5HYFA 5J13B 2CK0L 1IZKA 1ZVYA 4Y88A 3QULA 2WWMC 1CR9L 2APVA 3RUGB 1ULVA 4HIJB 4ZMAT 2J12B 3FZUC 4G9DA 1JPSH 3R1GH 1A21A 3T0EA 5H37H 4DK3A 1KEGH 2PTTA 2DWDA 5CJQL 35C8L 4LVHC 3HZMA 1U8OB 4R0LC 4GG6B 4M7LL 1BQUA 4QRRB 4F58H 1Q0YL 3IAGC 4N0UA 4HWZB 5TE7H 5C0AB 1DUYB 5CJ5A 3QEGH 1HXMA 3D0LA 4H25B 1UADC 1FFRA 1F97A 1MCQA 1BQLH 2UV3A 3MJ8A 3TA3B 3H9SB 5F3HA 4U7SA 4DGVL 5EBLB 4XC3H 2C5DC 3BH9B 5C3TA 3U7WL 2FLRT 4RMUA 1HWGB 4Q6IB 4Y4HD 3NOIA 4LPTA 2K7QA 2AXFA 8CGTA 1YEJL 3MUHL 1EX0A 2HT2D 4PG2C 1P7QD 1FFOB 4OB5L 1EAPB 3ISWA 4KK8C 2CQVA 3O11B 4EUPA 4IM8A 4HFUH 3MGTB 4OFPA 1JZ2A 5CZKA 3D48R 5EG6C 3S36H 4PRPD 1B4JL 4LHUG 4J6RL 3CC5A 5DMJB 1I8MA 2ITDB 4Y19E 1RY7B 4HCRA 4TVSa 4I3RL 3FQTA 1BECA 3QO1B 3GZKA 1VKXA 4W70A 4I0PC 4N8VB 2EDYA 1SEBA 3BZ4A 4JN1L 2AQ2A 4KMTH 3P4NB 4O2FB 4BH7A 4UQ2B 3SE9L 5C70A 4HUVA 3OZ9L 5AD0A 3GMMA 2VAJA 3T4AB 1P4LA 3RGVD 2D7TH 3QNXB 5IBTL 5GHWL 5MHSD 1I1FB 4HK0A 3T2QA 2HLFC 4PG9A 1IGJB 2CRMA 3C9NB 5HHVH 2VLME 2FYYA 5GSRA 2GSIB 5IHUL 4MB3A 4KJYA 2AV7A 4XP6L 4RISH 5HY9B 4HGWA 3GBMH 5EZJA 5JZ7D 5MEOA 3RI5K 4N5EC 5DDHB 3ULVH 3VH8B 3INUL 4JHAL 4R7NA 3BDXA 5FOBA 3BPOC 4LCUB 3PWJB 4YE4H 1KT2B 2LU4A 5IFJA 4TPRH 3SDDB 4NQUA 1YEKL 4WW2C 1MCPL 4JVWA 4IHOA 4LOUC 3OB0K 3N1QC 5IFAL 4IJ3C 2BHUA 4XVTH 4P57A 4LSQL 5F9JB 2RGSA 5E00A 2ZUQB 2XG4A 1KB9J 1KB5A 7FABH 4KKNA 4Z9KB 3PHOA 4K3DL 1MNUL 5FM5O 4I3GA 4ONFH 3EJYD 4H1LH 2XWJB 1UXSB 2OL3H 4N5UA 5IG7B 1IKNA 1VCAA 5TE4L 2PW1A 1AO7B 2JJSC 3FQWB 1OAZH 3RY6A 3B9KB 3FB6B 1AGDB 3CFBA 1P9MC 2R4RL 4ELMA 5JW4N 3V4PL 3DVGB 5I2IA 2Z91A 2ATKB 1M7XA 3GSNB 4RIRB 5FKPA 2A2QT 1A1MA 1F8TL 4JRWA 5DEGA 2ADGA 2MKWA 2AXGA 3OAZK 2PYED 2UZIH 2GQHA 4LHQB 3UYOD 2IAND 3EZJB 1EO5A 3KYMA 1E28A 3LH2H 4KY1L 5C0GA 2NXZB 1L0YA 4IEFB 4D9RE 3CCHB 3MLTB 3DSNA 4WI3A 2OZ4H 5IW6A 1AY1L 1QSVA 3IJHB 5CD3B 5A16A 3KG5A 2GITB 4L3AA 3QFDA 3UBXG 3GSXB 4P9MH 1RURL 4IRSA 3ETBF 5JHDD 5IB4A 5K9KB 5MEND 2APWA 3DI3B 1PD6A 2Z31D 2O5YH 3QQ3B 4M7KH 4ZTPL 2EH7H 4DN3H 4Z76A 4AH2B 3BP6A 4TUOB 4KGJA 2NY5H 2VLRD 4WO4B 3ZHDA 1DBMH 3QO0A 4R4FL 1A6AA 4N0FB 1HH9B 5I1AB 3QQ9D 4J1UB 4GXUM 1S5HB 3PUCA 2D4DA 1IKFL 5C0IB 4JFXA 5EZIH 1OWWA 5F9DC 3GFUA 2J2ZA 1TZHA 2COQA 2J8UE 5FDWA 4M93C 4XBPA 4KMLB 2JCCA 3AREB 3QCUL 4BSWA 1IM3B 4PJXA 3VWKD 4BYHA 1FL3A 1ZXQA 4NQDE 3T1FA 3BW9A 1NBVL 3KPSE 4S2SA 2HFEB 1N26A 5T3XD 4X6CA 3WSQH 3D69A 5EBMA 4E41B 3MRRA 2JB5L 3D3VB 5CWSA 2V9QA 2X4RB 2FBOJ 1Z0MA 4V1DD 1D6EA 4PJ8C 4OCLC 5JQHC 1KCRH 4HKXA 4I5BA 5F6IC 2GTWA 1RJCA 2VDNH 4M7JL 5IVZA 3GMRA 4GRWE 5IK3A 4LK4A 1I3VA 5J1AB 4AMKH 3IS1X 3CVHB 4LHUA 5MP6L 3ARQA 1OSPL 2YA0A 1MUJB 5I1HL 3MLVL 2R0WH 1YYLH 2DLGA 1JGVL 2DB8A 5IB2A 3GSQB 5E24E 2QADC 4NQTA 3K4ZA 3ARDA 1A9BB 3D39B 1C08B 1GGUA 4D0CA 3R0NA 1TPXB 4OM1L 1YEEH 1T5WA 1TENA 2X4PA 1R5IA 4QXUL 4WU5B 5EU5B 1YNLH 3D2UB 3L3DA 2YWYA 4OFIA 3ZO0A 1G9ML 1XGUB 4YHYB 2IH3A 2NY3D 1WZLA 5ITFA 4O51B 3Q0HA 5EZLB 2VMFA 2C3WA 5KSAA 5IROC 5D1ZD 2BY0A 3FN9A 4G7VH 1IGIH 3WKML 5CSGA 2J8UF 3UROR 5ITBH 2DQTL 3IETA 4B0MM 1R5WB 3FFCD 2XN9D 1W72A 4P2OC 2VAAB 1D5IH 5J06A 4OCMC 4Y1AD 3EOAA 4KWUA 3AS0A 5KW9H 4AG4H 4Q9CA 2QTEA 3PHQA 5IV2B 4UB0H 1MWAH 1AXSA 3SQOH 3GSRB 5SV4A 5B8CB 2P48B 1RPQA 5J11B 2GT9B 3UTZB 5CZVL 2A6JA 4HJ0D 4CW1A 3HZVA 3QAZB 2ZOLA 4P5TD 2H2SD 1YECL 1KELH 1G7JB 4KFZC 1MVFA 3X12A 2HKHL 4GRWF 5HI3D 1HSAA 5JO5A 3VXMB 1RHHB 1QA9B 2A6DB 5GGVH 4QRTA 2VLKA 5JOPE 3M8OL 3PWNA 4XC1H 4UILH 5INDA 4PRIE 1OAXL 3MSPA 1ZGLP 1KG0A 3VFWB 1ZE3C 4YNYB 3TBVB 3BRFA 1PVHA 1QPXA 3QQNA 2BNUB 1FV1A 3TBTA 4DGYH 1WZMA 4HZLB 5E4EC 4Y4KD 4L4TA 3L5XH 4BZ1L 1JNLL 3MFGB 1D5ZB 4K7PX 1BGXL 4XPHL 3QA3A 3RDTD 1UKQA 1G9MC 4HHAB 5DMGC 4R26L 1I4FA 2RBLA 1JL8A 3EDJA 4G6FB 4P2RB 1MRDL 5ESVA 1T2QH 4ZOAA 4M48H 1HH6A 3D85D 4QO1A 4ODXA 4AIZA 3UBXA 2AEQH 1A7RL 2YPKB 4NOFA 1WFUA 4AM0A 1KTDB 2HTLD 3AB0B 2GEEA 5I1KH 1NUFA 1FL5B 5J6HB 5GGTH 2DF3A 4AEHL 1CR9H 1A1OA 5AG9A 5IEKB 1XGQA 4RDQF 4PP1C 1P7KB 4EDWL 4N0YL 4ZOEA 5SWQA 4ZS6C 4NKDA 3U0PA 3FMGL 1CD1B 3SO5A 5E6ID 1XIWB 1PGRB 3QEUB 2H45A 1BFTA 3DUSB 1VESA 4MGXA 5EU6D 3PXHA 1TVHB 5CJQH 1MEXL 35C8H 1EFXA 1OGTB 3F5WA 5EO1B 2AJXL 3C6SA 1QLFA 5H35A 1Y18B 4M7LH 3NCBB 3ULVD 4NO0B 3IKKA 3PIQA 3SE3A 3LV3A 4JM2A 4Y8DC 5JW4Q 2DJ4A 5D7SH 5HD8C 1K6QL 5FYJE 4PJDE 1S7SB 2ZJSH 3TYFB 5J3HC 2A74A 2CKBB 1PQZA 3ZT5A 5HYSG 3FCTA 1LEKA 3U7WH 1U92A 3DX9A 5D7LE 1FNSL 2AJ3A 1I9EA 1UZ8B 4RWHA 3IDUA 2ZKHH 1YEJH 4XGZA 5FF6B 3WNPA 2NXYD 3CX5K 3ZT6A 3DJ9A 3V5KA 3O2DL 4H1LB 4KKBC 4OB5H 2MMXA 1HYRC 4PJEB 3C08L 4XBGA 4P2QA 3DXAE 2V7NB 4RMVA 2JE8A 5C09D 3QJFA 1RIVH 1IC4L 5JA8B 2GJZA 1P53A 2OR8A 3G04B 2DWEB 5ISZD 3ARGB 1DZBA 4J6RH 5DHVH 1GGYA 4ODHH 1I85A 1ZLUK 2VDQH 1PG7X 5F44A 5GIRA 3KPPB 2X09A 1RUPL 1JYXA 1MRCL 1UB5B 1MHPL 5FA3A 4I3RH 3ULSA 3V5DB 1S9KC 3OX8B 4GAYA 4JFDE 4WFFE 4R2GD 5ICXA 1M7IB 3T2OA 3ARFB 4WTZG 1C16A 1EPFA 1CFNB 3FO9B 2BNRE 2PF6A 3UPRB 1X5LA 4UBDD 2UUDH 3I2CH 3OZ9H 1T1WB 1KUMA 3RA7L 1KJMA 2IPUK 5IBTH 1QSED 5IFHL 1UM5L 5GHWH 4RNRA 1OP9A 3BDYL 4H88H 8FABA 4MXQC 4XTRD 4V2CB 1MI5E 5ESAB 3OG6B 3ECBA 1TLKA 5I76B 5IHUH 4PJDF 2V6HA 4C56B 3MRHB 5C1MB 1DL7H 3MRCA 5F1IB 4XCYA 1FE8H 1Q38A 3O6FA 1S9XA 4GKZA 3B6SB 2Q86A 2OSLA 2XKUA 1XFPA 2C7UB 4JY6B 4YBQC 5C9KA 2PXYA 3ZMRA 1JWSA 4IRJA 4FHBD 1YEKH 2EO1A 5D6DC 3HE7A 1BFVL 1TXKA 1ZHNA 4GXUN 2NNAA 2V5RA 5IFAH 4JFQB 1XF4B 1O5DT 2Z8WC 5DEZA 4LSQH 1U8LB 5DFWH 3L5WA 1YEGL 5C0CD 1MNUH 4MWFB 3GI8H 3F6LA 2HLAB 4P4KA 3MRJA 1J18A 3G5VB 5KANI 1WZ1L 3E6FA 5I8EA 5TE4H 2YMXH 1TFHA 3O8XC 1KULA 4OLVH 4CVZB 1WJ3A 2HRPL 5DJZB 2PNDA 2F8XC 3S34H 1AC6A 1S9YA 4G43A 4QHLB 3T0EE 5C0EA 2Z4QB 1F8TH 1YPZB 4UQ3B 2R0KH 1Z5LA 1TITA 1ZLSL 3SDDC 5IIEA 1U8IB 4OJFH 2WMPA 2VZ1A 4BSVA 4KY1H 2X1OA 4N0UE 4POUB 4UTBH 2VKXA 4HIEA 1S5IL 4JZNB 1RZKC 3WXWH 4KJWC 3SKNB 2ZUQC 3P9MB 5DJDA 3LB6D 1RURH 1EXUA 5GJSL 3VXRB 1QNZL 2YPLE 3HN3A 3SDCA 2AJZB 3UJTH 3VG0L 3DBXB 3FTGB 2EYTA 4ZTPH 4PRHB 3FO0L 1F4HA 4I0KA 4HV8A 1MCHA 3B9KC 5CHNA 4R4FH 4MAYA 3EYOB 4OGAD 3ZKND 4QXTB 2VDML 1UH3A 1QSFA 5E2UL 1IKFH 4JLRA 3OXSA 5K9QI 5EIVA 1CLOH 3ZDXE 4HG4J 4ODTL 4PY7B 2WBJD 4PGEB 5CP3A 2W60A 2JLLA 1A6PA 1K2DA 1HEZB 3HI5H 3NN8B 3FZUD 2KQMA 5T5FL 1WBYB 4XRCB 1A4JB 1R3LB 4UI2A 4JHBA 5HYSA 5E2TL 3QWQB 1NBVH 3AU1A 2OXGA 3WDJA 3QXAA 1JGDA 1VEMA 2CDGA 2OTUB 5GSVB 4U3CA 1XF2B 1YA5A 3VXTA 1FN4B 1OW0C 2VN4A 3PQYA 4Y7MA 1EVUA 2Q8AH 2WQRA 2H9GB 4WO4C 4S0TD 2NZ9C 2NTSP 3CXHJ 2FH8A 4M7JH 5CIPH 1ADQA 1UM6L 3MRBB 2CDEB 3SJVD 5DJ6A 1XMWA 4XNMA 2P43B 3BOVA 4XVSL 3VDBA 2BSRB 5C08E 2XRAL 4GAJH 1OSPH 3RGHA 4MA3B 1FIGL 1KTKE 5ADOL 1GGCL 2YD4A 5I1HH 1UEMA 1WTGT 3OKDA 4LPXA 1PAMA 4FFZL 2QKIA 5EO9A 4X80L 3IFPA 3AREC 4H20L 4L8DB 3MRKA 5ANMB 1HIML 5BRZA 3QDJD 2B4CL 2W9DH 4NCDA 2EC8A 2WK2A 2XA8H 2VIRB 1Q9KA 1JE6A 1G84A 4FQ2H 4HIIA 5K9OB 4IIQC 1KYOJ 1MAML 3BXNA 4FQPA 1U91B 5C9JB 3WKMH 4EI6A 3TEUA 2ZUTA 2NMSA 2DQTH 2DMBA 5I1IL 43CAA 3PWUA 2K3TA 5CEXB 2HT3C 2OP4H 5KS9A 1I1AB 1L7TL 4N8CL 1UT9A 4I0PD 4XHJD 2WWKO 3M45A 4MA8L 5DJYB 5T1MA 4ELME 5ADPL 3BRGC 2VE6A 5L2KD 3FB8B 2P5WD 2J5LC 5L2JB 5JPMA 3H9ZA 4JFYA 2Q7NA 4MZ3A 1NMAH 4FRWA 3T77B 4U6HA 1J05A 1VENA 1EVTC 4P46A 3L3GB 2CSPA 1YECH 1I9IH 1OTTD 1INQA 4YDLC 1TPXC 4LMQI 1XR8A 2X1QA 4RA0C 3TO4A 2HKHH 4F8TA 1F6AA 1RMFL 1ZSDA 3CLEL 3Q5OA 1FG2B 1A7OL 1NQBA 2BVTA 1A6UL 3KXFD 5JW3L 1BD2B 1H8SA 1X5IA 4XAKD 4LCCA 1OAXH 2P42B 1QBAA 2O5XH 5HHNB 2DQJL 4TNWK 5IMKB 1RZGB 2ZUYA 3HHRB 5TDPA 1BOGA 2C3XA 2GY7B 5TFSH 5FB8A 4XP4L 4MQXD 1OGAB 3S37H 1S7UB 5SX5K 4KI5C 4LOUD 4N90D 4X0KB 3DYPA 1GC1L 2EICA 2B4CC 5KG9A 1DQDL 5CKGA 3V6ZA 3NZHL 1BGXH 1N64H 2P5EA 4GW1B 4PGJA 2AJYH 5HPOA 3ZYJA 3MRPA 3PGFL 1KLGB 4G8GD 3STZB 1Z9MA 3HI1A 3QAZC 4HIXH 5I1EL 4HBQA 5DUPL 2FBJL 1HQRB 3U6RA 3S35H 4KKLC 1YN7A 4XAWH 2VUYA 5D7IE 5FO9B 1A7RH 5DA0B 4JFZL 3E8UH 2JCCE 5DZOA 4HFWA 5T1LA 2DQHH 4ELMF 2CO6B 4HPOH 4X83A 3GMQB 5E2JA 4P3WA 5IJVA 4P0DA 2FWOB 2H41A 3VE0B 3R0MA 3ILPA 5KVMC 2O61A 4G6ML 1QUNA 5GGRB 1SJHB 1KIUA 3I9GH 4GQ9H 1J8HD 3D25B 3FMGH 4I0CC 5HHMB 3EHBC 3KGRA 3VFVB 1LE9B 3IFLH 4DCQB 3TPUA 1PKQA 5I1LB 1V3MA 1I8LA 4JPVL 5ACLA 3MV9B 1MEXH 4XCEA 1KJVB 43C9B 4HWNA 3OV6A 5JDSB 4UAOB 5FGSA 5LVEA 4TTDC 3WJJC 4OZFA 1Y0LB 3NPZB 1YNTB 5E99H 4EBQL 1RJZA 3CLFH 2KZ1B 3KPRB 1D5MA 3QG7L 4MXWL 3RBGA 3AB0C 3ELAT 3RVTC 1GC1C 2EDRA 2W59A 4FQLL 2J4WH 4KJPD 1FNSH 1DFBL 1SYVA 4XPBH 5F7KC 2R1YB 2OJEB 5I71B 4LBEB 3G5ZA 3V5HA 3ZE1E 1V5JA 2IH1B 3RWJB 3FB7A 2BMKA 3TNNA 2X4QB 1QO3B 2JCCF 4K9EH 4PJXF 2GK2A 1A2YA 3O41B 2ICWI 3BEWA 4X6CF 3MRQA 3IDIA 4HAFA 2XTJC 4RGNB 3T0VA 3VA6A 4EKXA 2Q7YB 1F4XL 1RUPH 3TH3T 5KN5A 4LKCB 2Z35B 4DWHA 2X10A 3IJYB 2AK4D 5GS0L 1JGEB 3O6LH 5JLZB 4MJ5B 1DQML 4KH2A 3EO0A 2OCFD 3WIFB 5CEZL 3B43A 2NY7L 2WAHA 3OBAA 4RX4A 5IFHH 5I73B 5E8OA 1UM5H 5FIEA 1NDMA 4NKIL 1NGYB 3PDOB 1JPGA 1VB9A 2FCBA 4KROB 4U1HA 5FKAA 5M95B 4GQPH 3ARGC 3NABL 4L4TE 5HYQA 3PV6A 5LGHL 4HH8A 1S78C 5D6CB 4JFOA 4JRXD 3L3KB 2NR6C 5HI4D 2WUBL 1L4IA 4MD0B 1MCLA 4J12A 4PJCB 1UM4L 3SCMA 1G7MB 4UDUA 1I7RA 1UYWL 1BFVH 3H3BC 4HQQL 2O26U 1FGNL 3ARFC 1FZOA 1KIRB 2H1PL 3QDMD 4P2OD 1JBJA 3PL6A 3VXSA 5IVXA 1SMAA 4JO2H 2XACC 1YEGH 3WJLA 1D9KD 2JB6B 3HE6D 5LQBL 5C0BD 1BJ1H 1SVCP 1IEBB 3LKOB 1CD0A 2AV1A 3TCLB 3L3HA 4HKZB 3N06B 1E27B 5C8JA 1WZ1H 1FQ9C 4OZHA 2VLJB 3V6BR 3FB5B 2X2YA 2V9RA 4X7SH 1IAIM 1A7NL 3QUMA 5GS0C 4F37F 1I7UB 4LLYA 4D2NA 4ZFOL 5C0NC 5J56B 3MRIB 5KZCB 4ODSL 1U8QB 5FEBA 1NGWA 4C58B 1PZ5B 3IDYC 1NCAH 2ADIA 4JQVA 3RX7A 2GCYA 2C4FU 3E1F1 3VFPB 4BJLA 2JJTC 4A6YL 1JHLH 1HN1A 2QHLA 1IFHL 1S5IH 3CMOL 3AM8A 2XZCH 5KVGH 2LTQC 3RU8H 2KL6A 1JPFA 3RWCB 4GRWH 1WQVT 1ZGLA 5DMGD 2G9HB 2B5IC 5DYOA 3WN5B 3FO0H 1RK1A 1NFIB 4F7CB 1DDHB 4QRQA 1U95A 2A6IA 2DBLL 3OKEA 4OFVA 4CKVX 4PY8I 4R97C 2XT1B 2VDMH 3QHFH 4ZODA 1XF5B 1EEYB 1SBBA 1IC1A 2DQUH 2J88H 3FQXB 5CLWA 1ZVSA 2F8OA 3RVUC 1AJ7L 4ODTH 5TDNB 5TDOA 1P4IL 1N2RB 1H5BB 3EYUL 3IDXH 4PP1D 1OSZA 3DI2B 3QISA 1RU9L 3W5MA 4KKAD 1ERNA 5T5FH 4LDOB 2L7JA 2WIIB 3OR7A 1IAOB 2PYFB 4KKCC 5D96B 1U3HD 2NLJA 4FFVC 5E2TH 5EH1A 5D7JA 1G0XA 1NMCC 3O0RL 4NRXA 3NFPA 3QUYA 1WV7T 4PRDA 4ODWB 1AQDA 4K55A 1NUDA 4UIMB 3TBWB 1UM6H 3SDAA 2GJ6D 4JM2F 3PDDA 1SJEA 1L0XA 5J3HD 1RIUH 3TO2A 2EEDA 2K7PA 2XRAH 5ADOH 1FIGH 1GGCH 1CICA 4NCC2 3HG1D 3K2UH 2LABA 4XMKL 3DVNB 1A7BA 4LQFH 2VL5B 1FVDB 3HZYB 5DJXB 1OHQA 1F3DJ 2Y06L 1IAIL 4PGZA 5HVGB 4I77H 3P4MA 2X9WA 3MLXL 2DLFH 3LN9A 4H20H 4J8RA 4KKBD 2B4CH 3L7FA 3LD8C 1CFSB 4JRYA 4P5MB 4FQXA 5EU4A 4M9PA 2CUHA 4UOJA 2AJSL 2ENSA 3QYCA 2C1OB 3BVNB 1G7HB 4CVXB 3W82A 1MAMH 1Q0XL 1LD9B 4PFEA 2ZSWB 2FL5A 3LHPH 1JV5B 4Y5YA 1W8OA 1R24A 5I1IH 3U30C 1QR1B 1JPTL 4PV8B 4U1GB 1I8KA 2NY6B 2X4UB 2X7LB 1N8ZA 4N8CH 4ZAKC 3MJ6A 3L95B 5ETUA 4WI7A 5ADPH 2XYCA 1EGJL 1HCFX 4O2EA 5HVHB 4Y19B 3SGDH 5IJKA 1DEDA 3KR3L 4PJ7A 2AABL 3JWDH 4L9LA 5GXBB 5LGJA 1JZ4A 5BW7C 3CNKA 4OF7A 3SGKC 1X5GA 3FN0H 1U3ZA 4UNTA 4LCYB 4OUUA 3HC0B 4HZAA 1DQLL 1BJMA 4HF5H 4NNXA 1RMFH 3CLEH 1K8IB 1KV3A 2A1WL 2XWTB 1KLFA 1SQ2N 1A6UH 2R0ZL 3WS3B 5JW3H 3FHQA 1GH7A 5E4IA 3RIFF 1U8KA 4YBQD 4L5FH 5L8JB 4IMKC 4Q0XL 2EKSA 5DZLA 2E9JA 3DRQA 3MBEC 5JW5A 4WY7L 1MCWM 3ARTA 1YEFL 1QLRA 1MJJA 1I1AC 5I16B 1RI8A 3IF1A 4CN4A 3GK8L 4F7EA 4ONGH 3CX5J 3WFHB 3QB7C 1Z9SA 3NZHH 3SDYL 4WFGE 3FT2B 5LBSL 4JAMA 4DTGL 1K5NA 3TNMA 1MHEB 2CDFB 4Y4HA 3HZKB 1J9CT 1NAMB 4OD2A 5DC0A 4NFBA 5DUPH 2OBGA 3QJHB 1IMHC 4LMQE 3O8XD 1MHHA 1P7QA 3G6AB 4PGDB 2R2HA 1YY8B 4RZCB 5LXGH 3QDGD 4NGHL 4JFZH 4OLYH 2QR0B 1FH5L 1EEZB 4X98B 1IEAB 5EFIB 1HDMB 2OTWB 3MJ9H 4WJ5B 3MQIA 2AAVA 3S9DB 1TNNA 2IAMC 4PRPA 5KOVC 1GRWA 4M1CC 4NRYB 3ZE2E 3EDKA 4OSUL 4KTYA 5A2KH 2AGJH 5D70H 4BQ8A 4L8CB 3SBWA 1C5CL 3PQYE 3DHMA 3D9AH 2XKNB 4CBPA 4XMLL 4LIQL 4QT5B 4MCZA 1ZMYA 2HJFA 4KJWD 3DVIA 4JFFB 4JPVH 4QCIB 2CKNA 3OGCB 1G0DA 1BVLB 1DUZB 1MAJA 4NM8L 5D4QA 2H8PA 4G80B 1UACL 4Z0BL 4D9RD 4UNUA 1J1XH 2AEPH 2FEDC 4M00A 4QHUB 3G6JA 5IB5B 4NP4L 5IMMB 3RNQB 4LEOB 1DBBL 3LPWA 4UV7L 1TZGH 2EDHA 3NTCL 1A4KA 3IDMB 1E4KA 5IEHB 4EBQH 3PGCB 4LP4A 3WEXB 4MXWH 5FDYA 3UO1H 2JK5B 4BFEA 1CXFA 3MLRL 4Y16A 4I48B 1FP5A 1QFWI 2JTDA 4L8BB 4DKEH 1YYMH 1DBAL 5GRWA 4L8SB 2F74A 3TH2T 1CXKA 1VDGA 2MHAA 4YIQB 3GMNB 5B38B 3MA9H 4Y2DA 1KCUL 2EIZA 2DIAA 1GOGA 2AJUH 2BVUA 1YMHA 4OZ4A 5B39A 1JK8A 1LP9A 4GG8A 5KS9E 1H15A 2X1XR 4ONHA 4Z7OE 3QIWB 4PUBL 4G6AD 4UAOC 4MQ7A 3QIUC 4NSKB 4HPYL 1FNEB 5FYKL 4UOW0 4TOYH 4GLRH 4WTWA 3WFBL 4X9BA 2I9LA 1F4XH 4NQDD 3KPSD 3PWVB 4R7DB 2NZ9D 5EUOE 5EBWA 1AKJD 4Z7UE 5GS0H 3G9AB 2CRYA 2W07A 2NY0D 1IILE 4F37K 4JDVB 1KPVB 2BOBA 3NAAH 4H26B 5ICZB 5EBGA 3EDEA 4BQBA 3VGBA 1DE4B 1NAKL 4KRMB 4V2BA 3PF2A 4NO3B 5I1CH 5I71C 2NY1B 3BYTA 2EIDA 5IF0A 3X13B 3PJSA 1T1ZA 2PYEA 4NKIH 5HDOA 2I27N 1UVQA 4M9OA 5CP7B 2IANA 4PYHA 5JXAL 4XI5C 1VFBB 1BZ7B 3RP1A 4OGXL 4QY8A 5C0FA 2GIYA 3P4OB 4GH7B 4RRPA 3WUZA 4NN7C 2NZIA 2XKSA 3NACL 3NCCB 2AP2A 3VI3F 5LGHH 5KANG 1RV6X 3ARVA 1T7WA 4QRPA 4X7EC 3IDNA 5HGAB 3KWWA 2P5EE 3MROB 3ALXA 2ORBH 2Z31A 4LKXB 3VFNB 1JIBA 2ZG3A 3UTQA 2A77L 3MUZ1 3ZTNL 4X4YB 1FL6B 1ZT7B 2HT3D 3LS4L 1X44A 2VLRA 4HQQH 3NFNA 1ONQB 1UC6A 2VUOA 2H1PH 3FRUB 1FNGA 5KS9F 4XX1G 4KPHH 4OF6A 3SY0A 1E4XH 3KYKL 4NO2A 4U3XA 4Z7OF 5LQBH 3DV6A 4YPGB 2O5ZL 5E03A 4O2CA 1A8JH 3A0OA 4MHHI 3RL2A 3KLAB 4EI5C 2DS4A 4M1DL 1DTUA 4KROC 3DURA 3LVEA 3VCLB 1D6VL 1A7NH 2I5YL 5T3ZE 3VWKA 2ED8A 5HDBE 1BREA 3U46A 3V4UL 4BH8A 1A0QH 1SEQL 1MSPA 4OI9A 5IR1B 4OZIA 3WKNA 1T7VA 4LVEA 5CUSL 3MRFA 4HCRH 4QF1A 4C57C 1ND0A 1U8JA 5F1KC 4LSTL 5ERWB 1RULL 1MLCA 5KVFL 2R2CA 3CMOH 4U6VL 1YNKH 4KI5D 3WD5L 2CIKB 1H8NA 4MYWB 4PRID 4CADB 1H3WM 2HVJB 1I9JH 3LIZL 2G5BA 1CFQB 2W0FB 2ZCHL 5F88B 3GJEA 4S1SH 2IG2L 4AEFA 4HWBA 3TN0B 5DHYA 3WHXA 4PRBB 4KKLD 4XPFL 2DBLH 2VDLH 3L7EA 3RWGB 3TVMB 4YJZL 3FO2B 5FHBL 3EKCA 3MXVL 1UJ3A 3O3EB 5DRNB 1JFQL 1CVSC 1WBZA 1U93B 1AJ7H 3KDMB 1FJ1A 1HILB 1NH6A 1YDPB 1P4IH 1C5BH 3EYUH 2APXA 4LSUL 5D1ZA 1RZ7L 3QG6A 1EUTA 5D1XA 1RU9H 1CGSH 4NC1E 1KB5H 3EHBD 4N68A 3FFCA 1M05B 1MFCH 3QXDB 1BQSA 4EIZC 4Q9RL 5HDBF 4KAQL 3K8LA 3T0WA 4OLUL 1ZHLA 3B5HA 5TH2B 4P2RD 2A83B 4UT6L 1UA6L 4MJ2A 4ZDHB 1BOYA 4P5TA 3SE4A 4PTUB 3CFKA 1NC4B 1Z0NA 1I1YB 1V05A 1BIIA 2P8LA 5C0JB 3F7VA 2XIDA 3UDWA 3IXTA 5EUKA 3RTQB 5I9QB 2GKIA 5HXMA 1FNLA 3PDGA 5FECA 1F90H 3IU3B 1H5BC 3RIFK 2QSCL 4XMKH 2R2EB 4G6JH 3MLWH 1Z9LA 4PJDB 5HPMB 2Y06H 1IAIH 1MCIA 2JIXB 4YO0A 4LLDB 3BWAB 3MLXH 4D0BA 4QXGH 4LNRB 2AKRA 4IDJL 4XCNA 1CQKA 1BLNB 3C8HA 3EIFA 5D7LB 2F58L 3ZYOA 4CNIB 5IMLB 1HHKB 3RQ3A 3BSZL 4Y4KA 4PR5A 4F80A 4PBXA 2R39A 3O2WL 3GDBA 1G7LB 3LPFA 1KENH 5C2UB 3RDTA 1A1NA 1IQDA 5E1HB 2P7TA 2XTJD 1Q0XH 2C3GA 5DD3L 3DXAD 1ZWIB 2R2BA 1IQWL 3HI6L 4S11A 4ELKA 5BS0B 1MVUB 5F7NC 3VFSB 1KSRA 4OZHE 1GZQB 3O9WB 4X4ZA 1IARB 4UV4H 4NWUH 4OGYL 2Q6WB 5H94A 5DUMH 1EGJH 3LSOA 1LO3L 3V6FA 4DN4H 4WU7A 3O3BA 3ALPA 1MCJA 3JV4A 5T1KB 1SY6L 2VXUL 3RKDC 3O4OB 4JFDB 4XXDB 2EE9A 3VXPB 4N1HB 3O4LD 2V5TA 2PETA 3Q3GA 4KQ4L 2EE6A 2BNRD 4LLWB 1PSKL 4TSBL 1DQLH 5E6IA 3AUVA 2E3VA 3MR9A 2R0ZH 4FG6C 1NAML 2YD7A 2PN5A 1T66D 4F33B 3FRPG 5EU3A 1S78D 2EDQA 1MI5B 3QUZA 3D18A 2NR6D 1JZ5A 1I8IB 2V5SA 4Q0XH 3LQAL 3SDXA 3VFRB 3W39B 2FHFA 1CDBA 4E0RB 4WY7H 3BMWA 4U1GC 5DJAB 1U42A 2NY6C 4KU1A 4JFPA 1KN2H 3F58H 5ELIA 1JNHA 1DR9A 5KAQF 2L4OA 1CVRA 1F11B 3O6ML 3SDYH 1PEZA 3HMXL 4MS8C 2AK1L 2HN7A 2OQJB 4M1GH 4O02L 5LBSH 5IVXF 5AZ2H 1YC8A 3TGXA 3KPQB 3UPAA 5CSZA 2Z93B 4X8JB 3AS2A 4ZYKA 3MUY1 1Z2KA 3GMPB 4NGHH 2OL3A 1FVEA 1JN6A 4OZHF 3V52L 2BZDA 4F7MA 5DI8B 4YWGL 5GS0D 1WC7B 3RWFB 1A6ZA 4YBHA 1FH5H 4ZUTA 3LRHA 5C09A 1CZ8L 3QULB 5C0ND 1OAUL 4OCXL 5ISZA 2QV2A 3UEZA 2WIMA 1BBJA 1DVFD 4OSUH 5CZXD 2EDNA 4G9DB 3ULUE 2R23A 3BP7A 2VLLA 3T0EB 3MFFA 2B7DT 3LEYH 5C2BH 4LIQH 5GRVL 1RZJL 2VXTL 3HZMB 4YX2H 2FHBA 5L9DL 2OZ4A 4KMQA 1TJGL 3MZTA 4NZJA 4NM8H 4P3CL 1F58H 3Q6FA 5FUZH 2AEWA 3X17A 1FDLL 1HXMB 1Q72L 3D0LB 5CINH 1E6OL 4ACPA 3V0AC 4PJ9A 2JJWA 3WL9A 2D0HA 2BVQB 3LQAC 3CFJA 3S36X 3K81A 2YPLD 1N5AA 4PRNA 2V2XB 1A14L 3WIHL 4JRYE 3MLRH 4YUEL 1Z3GL 2AEIT 2CLRA 5J89A 4CVWA 2AXFB 3FFDA 1T3FB 1GOHA 2MQ3A 3RVUD 1DBAH 4PJIB 1WEJH 4FTVA 3U9PL 4PJAE 4U1IA 3LKNA 4EUPB 1KCUH 4M61A 1BF2A 2FD6L 1FO0A 3UPCA 4KKCD 1J8KA 4FFVD 2VXVL 3TIDA 1NEZB 4DUWA 1I8MB 1CBVL 1Q9LA 2BCKB 4PBVC 4PUBH 4E42B 1XF1A 3GGWA 3K7UA 2BVEA 2EECA 5FYKH 4GW5A 3WFBH 5HGGS 3VXNB 1FZMA 3WO3B 1QFHA 3ULUF 3BUYA 4FA8A 3EYVA 3I6KA 3L1OL 3BZ4B 4ZFZA 1FORL 1T03L 1HHJA 1NANH 4I13B 4HUVB 3EDFA 5AD0B 1RZJC 4OCNC 3SEPA 1E6JL 1P4LB 4P23A 1NAKH 5ICYB 25C8L 4HK0B 5KBNC 1FNAA 4PG9B 5MEQA 1PZUB 3H9HA 5HGHA 1FZJA 2RCSH 2FYYB 5IVNA 1ZHBB 4KJYB 3EOYG 4NHCL 2AV7B 2DLEA 2X4SA 1IM9D 4HGWB 5C08D 5EZJB 1WAAE 1ZAGA 2C3VA 1SYSA 1T7YA 5MEOB 3ROOA 4HWEH 2XA3A 3MRLB 5F9WC 2X44D 3NACH 5B3JE 1VFOA 4R7NB 4LDEB 1PLGL 4NFCA 4WHTA 2XZAL 4UU9A 3MLUL 5IFJB 4R96A 4D8PA 4MNQD 2A0LC 4IHOB 5DSCA 4A2MA 2EDKA 1YMMD 4F9LA 4P57B 2LV4A 4WCYH 5E00B 5INCB 1T83C 2H2PD 4ZAKD 4JZJC 3FQNA 3PHOB 1RK0A 2B8OT 4F9PA 2HKFL 3AROA 4LRIC 4P4RB 4OIBA 1TZIB 2PW1B 2BJMH 4C55A 1W0WB 4PRPE 1WBXA 4PJ7F 5GJTH 1R0AH 1MWAA 3CFBB 4MDJA 4M1DH 5KVEL 3TC9A 5I2IB 3FKUS 4IDLA 2Z91B 3AXLA 1D6VH 3QQ4A 4OF3A 4IOFC 2UWEE 4I2XA 2YXFA 5IHLB 5DEGB 2ADGB 1I3RA 1RUKL 2AXGB 4L9DA 4X6DA 5CUSH 2BNQB 4R0LA 3IDGA 4BQ9A 1E28B 1EHLL 5C0GB 1CXLA 4XWOC 3UP1A 3MBED 2VWEE 5IW6B 4QTIH 3VRIB 3G6JE 4NNPL 4KUZL 4B7LA 3QFDB 5KVFH 3MNVA 5MHSE 4U6VH 4IRSB 3WD5H 3U79A 5IB4B 1FFNB 4C4KT 2ZZUT 3RHWF 3LIZH 4WGWB 4O4YL 1QFUH 5F7EL 2ZCHH 1J1OL 3O3UN 4U1JA 3I84A 5GISL 3U7YL 4Z76B 3BP6B 4PG2A 1A6AB 1P2CA 4XPFH 1L7IL 4HJJL 5HGDB 4AENA 1YN6B 5DO2D 5FHBH 1RUML 4BFBD 3MXVH 2F5AL 3A6CL 1GIGL 3EFFA 4JFXB 1KN4L 5FUCE 2XWBA 4FQJH 2G2RA 1INEL 1LEIA 1LP9E 1TZHB 5EN2A 2A6KA 5FDWB 5FXCH 2IAMD 4XBPB 3TWCH 4M1CD 4LSUH 1RZ7H 2G75A 1FLRL 2Y07L 4BSWB 4PJHE 4PJXB 1FL3B 2HT4C 4U1MA 3T1FB 1CS6A 3CMGA 3BW9B 1ZS8A 4S2SB 4WFHD 2LU7A 4X6CB 3I6LD 3D69B 1U0QA 5IT2L 4Q9RH 3GRWL 3EOBA 4YFDB 5BZWA 5CILH 1KC5L 4I0PA 4HAGA 4LLMB 2Z92A 4K94C 5CWSB 1CT8B 1D6EB 2P5WA 3CDYA 5K93A 4HKXB 4HW6A 4I5BB 2GTWB 1XH3A 2IGFL 3GMRB 1KFAH 2F53D 3TVMC 3ALWA 5IK3B 1JGLL 3G6JF 3LN5A 2IEPA 2IANE 4YZFE 5JXEC 3R06B 4P9HH 2DL2A 4NHUA 3W9EA 5EOCL 2DM3A 5LCVL 3KXFA 4TYUA 2CMRL 4OLWL 4AEEA 5IB2B 4JG0H 5TE6H 1UEYA 2QSCH 1G7IA 2X70A 4QRPE 1YEDA 3ARDB 1LWRA 1IL1B 3ZDYE 5ACZB 4D0CB 3HA0A 1T04A 5LG1A 1T5WB 2X4PB 1R5IB 4WW2A 4CAGA 4LRNL 1F3RB 5BV7L 4BQ6A 3BSZH 2IH3B 5ALCH 4RMQA 3O2WH 5IB1A 2GSGA 1RD6A 5KSAB 3TBYA 1F2XK 1LP9F 2ZG2A 4K71C 1MHCA 3QIUD 4QYOA 4MLSA 4G8GA 5F9OH 1IAKA 2MPAH 1TVBA 5DD3H 3X11A 3HI6H 1IQWH 3L6FA 5DLMH 5DHVA 2M2DA 1W72B 1NGPL 1KJ3L 1A7PH 4DKFL 2DD8L 3KS0J 2D7OA 2HA1A 2B1AH 2JJSA 5KSBA 4MQSB 4OGYH 3EOAB 3RTQC 5I9QC 3LN4A 1FNFA 1P9MA 3WYRA 2PKDA 4JB9H 4JO4L 1SBSL 2D3VA 1AXSB 2VB5A 2A6JB 4CW1B 1SY6H 2VXUH 2X4OB 4OFYD 2ZOLB 4ZNCD 4OZIE 2ZCKH 3SKJL 3M1BA 3X12B 1KCSL 4KQ4H 1FNHA 1HSAB 1RVFL 4OF8A 4WWID 5JO5B 1B88A 1J8HA 2Q3AA 5FHAL 4EOWH 5MI0B 1PSKH 4TSBH 1XGTB 1M6OA 5BZDA 3LKRA 4OKVA 2VLKB 4YZFF 3DO3A 2B39A 4XP9L 2VZSA 5INDB 1DN2A 3V0VA 4HD9A 4JGMA 1KG0B 3G08A 4ALAH 1ADQH 2CXGA 2EDEA 1FV1B 3ZDYF 4OAWA 2Z8RA 2MNUA 4PB0H 5CBEA 2BXZA 3O9WC 4JKPL 4L4TB 3AY4C 4OIIL 2K9UA 2XI9A 5E5RB 4LSRH 3GIVB 3QA3B 1WLHA 5BV7C 3HMXH 3RJQB 4LGPB 4UIKL 4O02H 1NMBL 1I4FB 3P73A 2CUIA 4FOMA 3GSVA 5ESVB 1OF2B 3HS0B 1HH6B 5IQ9B 2R4SH 4ODXB 5DJ8B 5FYKD 4AIZB 4NRZA 1X5YA 4ZUUA 1TJIL 4EI5D 4LVOC 3EYQD 4AM0B 3V52H 1OD9A 4JHWH 4LSVL 2WQ8A 1VERA 4YWGH 5D1QC 1PX3A 1F6LL 2XZZA 4HMDA 3QHZL 3CH1A 4U7KA 5CJOL 3BRDA 1FYTE 1BZQK 1A1OB 1XGQB 5KSVA 4U49A 4MAUL 5TPWL 4S10A 4OZIF 1EA9C 4NKDB 3U0PB 2D7MA 4DZBA 1G9EA 1CL7L 4C83A 2D03L 4HKBA 3ZL4L 4PJ8A 3BH8A 3SGJC 4FQCL 3T0AA 2AK4A 1OP5H 1J0IA 1T0MA 1EFXB 4RFEA 2HG5A 3C6SB 1QLFB 5H35B 1WCQA 4U0QB 4KTDL 3JWOC 3OWEA 4P3CH 1TCMA 3W11D 1JUFA 2ITCA 2PTUA 4O9HL 5J9PA 3PIQB 4Y0GA 1J86A 1FDLH 3LV3B 1Q72H 4OD1L 4ORGA 4HS3A 1UG9A 3S4SB 4Q9BA 3I6GA 4YLQT 2QQQA 2A74B 1VSCA 2R8SL 1LVEA 1XEDA 1PQZB 5CSBA 3FCTB 4YAQA 1LEKB 1GHFL 3SPVA 1U92B 2GY5A 4D0DA 4HXAL 5LJYH 1A14H 3MRMA 3WIHH 2YSSB 2AJ3B 3C60D 1Z3GH 4XGZB 3JXAA 1BQHB 1JZ6A 3V5KB 4JRXA 3U9PH 1MFDH 4FQHA 5IROA 1FFPA 2R1XA 3EO1A 5TGBA 4XBGB 4P2QB 2X05A 4AY0A 3QJFB 3I85A 3O45B 2EYSB 4LSSL 1G6RL 2FD6H 2GJZB 2VXVH 1UWXK 4UT7L 3QDMA 3IJSA 4P2OA 2YKLL 5LWYL 4OT1L 1CBVH 3W0WD 5DR5H 1NLBL 3LKSA 5GIRB 1OARL 3HE6A 4OCSL 5C0BA 3BT2L 5FA3B 3ULSB 1GCFA 3I75A 4FABL 3KLHC 4GAYB 1OLLA 5JOEA 2MTPA 4FXLA 1U3JA 5HVFB 1A6TA 1C16B 1QOKA 3L1OH 3G5XA 3K1KC 3VXUB 4LCWD 3WNOA 3DX7A 5CIPA 5ID1A 3T0BA 3O3AA 3OKYA 4N8VG 4X6BA 1C7SA 1KJMB 4XX1E 3QUKA 4Q7DA 4WNQA 2CRIA 4MCYA 4RNRB 5JORA 2NCMA 5T3ZH 1HHHA 3EJZC 8FABB 4JREB 3MYZA 3ECBB 5DGRA 4MB4A 4KZEH 3ULVE 1ZTXL 3SDXE 5SX4H 4Q9QL 2MQCA 4ZOCA 5E1AA 3MRCB 1CK0L 2WP3O 4XCYB 3NVQA 3O6FB 1S9XB 4GKZB 5I6XB 4Y5XB 3RHWK 3VGAB 2E8YA 2OSLB 1B0RA 1PLGH 2PXYB 2XZAH 3VH8G 3MLUH 3TBSA 1JWSB 4IRJB 2A9ML 1JP5A 3HE7B 1SMOA 1ZHNB 2NNAB 1CE1H 1FVCB 3WIIH 1BPVA 2EXYD 3T2NH 4WWKB 3W2DH 1HNFA 2DLIA 3B2UC 4FXGA 4N9GA 2YZ1A 3IAQA 3L5WB 4QNPF 1N0XL 4PTTA 4JKLA 1MIEL 2XQBL 3HPLA 4NQCB 2PW2A 5C09E 1I3GH 4P4KB 1QTYT 3E6FB 5I8EB 3UJJL 3GSWA 5E9DE 5ISZE 2RFXA 4GSDH 4X4XA 1E0OB 2P24A 5C92A 3RZCC 4X7TA 5BXFB 2DAVA 1S9YB 1IGML 4G43B 4XH2A 5KVEH 1LO2H 3K46A 4G5ZL 1CFTA 3PWLB 5C0EB 4CGTA 4QEGA 1U3HA 4K8RH 1Z5LB 2DQCL 1A3LL 2KQNA 5IIEB 3W81A 1NGQL 2FEEI 1EHLH 6FABL 1KPRA 4LDLB 4DFHA 4OLXL 4HIEB 3HKFA 2NY2D 1H3UA 4NNPH 3W9DA 4KUZH 1KPUA 1V3KA 4HXBL 3SDXF 3ULVF 2YRZA 3LEVH 5E8PA 5DJDB 1G9NL 1EXUB 1KJ2L 2GJ6A 1A7QL 1ZK9A 2I24N 4LLUA 4HC1L 4XT1C 4Z95L 3RY4A 4D9QD 3SDCB 2LFGA 5AZEL 1KEML 5JOFA 4MS8D 2EYTB 4OLEA 3VWJC 4YEEA 1MCEA 1YQ2A 4HX1A 4K7PL 3ZT7A 2L0DA 1J1OH 4CMMA 3HG1A 5GISH 3DMMC 3RY6C 4HV8B 5DURB 3GO1L 3WXVL 4MAYB 2MCG1 4FTVE 3VGEA 4XVJL 3IFNL 1S9WB 5DRXA 4HJJH 4WFGD 3F12A 1I75A 1LO4L 1QSFB 3BYYA 3TYGL 1ACZA 3LDBB 3RRQA 4JLRB 3OXSB 3Q1SH 3A6CH 4LGRB 1U8OA 1INEH 2DOCA 5GPRA 4GG6A 4ODBD 5F7MC 1OT1A 2W60B 1K2DB 4HWZA 2E5EA 3KPLB 4LU5L 4GKOA 1FLRH 2OS7A 4KHTH 1HZHL 3AU1B 2HJKB 1V8HA 3STLA 3QXAB 5IT2H 1JGDB 1J0YA 3GRWH 4JJ5A 1Q8MA 3U9UA 3JTSA 1MFAH 5ALBH 1KC5H 4RMRA 3VXTB 4YXHH 3PGDA 3PQYB 4OLZH 1M4KA 1U8PB 4IRZH 1BAFL 3HC3L 5ABDE 5E94A 5TF1H 1CN4A 1JGLH 4P48A 5DJ6B 3VFGL 2RQ8A 4XNMB 4YHZL 3HFML 3H6JA 1F4WL 4NM4H 5EOCH 2QL1A 1NPUA 3OKDB 2X89A 1RUQL 4ZOBA 2QKIB 5HHOB 5EO9B 4ZFFA 4GMTL 1AXTL 3MRKB 3RNKA 5BRZB 1IGYA 1BX2A 4YQXL 3PP3K 2AXHA 4QOKB 2XPGA 2X1PA 1T1YB 4MQTB 2BC4A 5D6DA 4LRNH 3O2DA 1Q9KB 2E27L 5BV7H 4NWTL 3F8UB 4G3YL 2NY4B 3P4NA 4O2FA 4HIIB 1QBBA 2VR5A 1C5DB 4DOHB 3BXNB 3H7BB 2DTML 3WFEH 3JZ7A 5F7FA 43CAB 3PWUB 4K07A 2F15A 3QIBD 4ZUWA 1C7TA 2RR3A 4FFYL 5HYJB 1PG7L 5KS9B 1NGPH 5TQ2L 5CCKL 3O8XA 4DKFH 4OCRL 1B9ZA 2IPTH 3QH3A 3H3PL 2GSIA 3QDGA 5T1MB 5HY9A 4CN6A 2VE6B 2I9TB 2VC2L 3VGGA 3G9VA 1HOCB 2P49B 4I2XE 4JFYB 2ERJC 4U6HB 1J05B 3S37X 1WSST 4I8DA 5DTFA 4P46B 4X6DE 4LCUA 5BQ7A 1INQB 1KT2A 4MD4A 3TO4B 1KCSH 3DV4A 1RVFH 4YFLI 1MF2L 5GRXG 1F6AB 1ZSDB 3AMLA 2QEJA 3S88L 4XP9H 1MFNA 1OOAA 3ULUH 4HEME 4LCCB 4S1RL 5KSAC 1GGBH 3OJDA 5DVOA 3S35X 3OPZL 5TDPB 4G9FD 1BOGB 5DD5L 4Z7VA 5B22A 5FB8B 4S0SD 1Q9OA 2A0LD 5MEPA 3PNWB 4JKPH 5IM7A 4OIIH 3B9KA 5KG9B 3TT3L 3V6ZB 5D8JL 1DQJB 2P5EB 3DVGA 4M6MH 2ICES 2H26A 3MRPB 2D7NA 2F5BL 5T1DH 4MJID 2IWGA 1KNOA 3HI1B 1KGCE 5JW4R 1NSNL 4D9LL 2BY3A 4MVBC 3U6RB 1CDHA 3CFCL 4R90H 4LF3A 2VQ1A 5MI0C 3MBXH 1TJIH 2H6PA 3IJHA 4GKSA 4HFWB 5T1LB 4JJHA 3ZKMC 1JYWA 4LLVB 5IJVB 3QHZH 1L0QA 4M7ZB 5CJOH 4RA3A 2O61B 4MAUH 5TPWH 4X6DF 1NFKA 1PBYA 2P5WE 1OW0A 1CL7H 1MAKA 1D5BA 4GS7B 4YHKL 3TPUB 4NQDA 1PKQB 2APTA 2WUCL 5EDXA 1PYWA 3CU1A 4FQCH 1AE6L 1PJ9A 3GSOA 1HH9A 4XCEB 4J1UA 3ROLA 5C0IA 2CK2A 2GFBA 5C6TL 1R3HA 3EBAA 1PY4A 4O9HH 4L4JA 3KXFE 1MQ8A 4OZFB 4J23A 1AGBA 4OD1H 3T65A 5ID0A 3DWTA 5FO8B 1FAIL 4F7PB 1VGEL 3MUGA 2R8SH 3QI9C 3B9DA 2YXMA 3LAFA 4FNLH 1IM3A 4YXLH 1A64A 3LKQA 4XPAL 4HXAH 2HFEA 3UTSD 5DD1H 4N90E 2FJFA 3VXOA 1SYVB 2GAZB 3KPMA 2ZPKL 3G5ZB 2X4RA 3FB7B 4IIQA 2BMKB 1EJOL 1CDCA 4WI5A 5EB9A 3TNNB 2JF1A 4G8GE 2R29H 3QEQB 2R0LH 2HT4D 3EDDA 1MREL 1G6RH 4GO6B 2C1PA 4YK4B 2IALB 5J1AA 5KSBE 3VI4E 3RX8A 1QFPA 3BEWB 3MNZA 2E6JA 3MRQB 3IDIB 4OT1H 4Z77A 4HDIA 2DQFB 5IESL 5KN5B 1CGVA 4APQC 4Y2OA 1A9BA 3D39A 3K80A 3GJFH 1C08A 3EO0B 1AP2B 2IMMA 5E56A 5JXED 1J8HE 4WU5A 2R69L 3D2UA 1T6VN 2VR9A 4WTXA 4F8QA 4PP2A 3L5JA 5BO1L 1JHKL 1NDMB 5CGTA 4KV5E 1IJ9A 4HBCL 4DUXA 3F7PC 1NC2D 3P9LA 1F3JA 1JPGB 3RZWA 5KOMC 4GKNA 1EO7A 1LNUA 5J6GB 3WLWC 2DQIL 4U1HB 4Y89A 4D94A 2ZG1A 3DX8A 1RUAL 4WI6A 5HYQB 3PV6B 2VAAA 2QJDA 4PRIA 4WW2F 4JFOB 1OL0A 3BGMB 3RVWC 3CSPA 2OXHA 2MKLC 2SEBB 4YDIL 3SCMB 3WS6C 4K23H 3TZVC 3HPJA 4UDUB 5DQ9B 1I7RB 4F2MA 4HUWA 5HI5D 1G7JA 1URLA 5GS3A 1CLYL 1EEQA 1T5XB 3PL6B 3VXSB 5IVXB 1DLHB 1RHHA 2A6DA 4I9WE 2LQRA 3G5YA 3KPOA 1N0XH 5KSBF 3VI4F 1RHFA 1HSBB 1MIEH 2XQBH 3OL2A 3L3HB 1EO8H 4PJBE 2XZQH 5C8JB 4X9HA 1B6DA 3QRGL 4OZHB 3UJJH 2DTSA 1MRFL 3BN9D 1OP3H 4RWYL 4LHJB 1QBLL 3IVKB 4DVBB 4JCMA 4LPUA 3CDGA 3PV7A 4YC2B 2EDOA 3QUMB 5TQ0L 1KIQA 4EZMA 1IGMH 1U6AH 5SWZE 4JHZA 4HZLA 5E08H 1ZOXA 3WO4C 3RL1A 4YHOL 4LLYB 4Y5XC 4UINH 3VGAC 2AK4E 5JW4M 3ARXA 1D5ZA 4MX7A 5AAWA 2EO9A 2A9NL 4FP8H 2X42A 2DQCH 4PY8J 4YPJA 4YDKH 1P5UA 1IZJA 4HHAA 2GCYB 2E6PA 1NGQH 4KV5F 1RFDL 4P2RA 1FYHB 3QDAA 4XBEL 1H0DA 1S3KL 4MZ2A 4ZTOL 4MDIA 4WWKC 1AR2A 4BUGA 4HXBH 4KRPB 3WJJA 5F70A 3T1WA 3P11L 1NLDL 3BESR 1G9NH 1KJ2H 1A7QH 1JPFB 4PRAA 4HC1H 1KTDA 2QQNL 5AZEH 3ET9F 1OTUC 5DRZA 4YR6A 1ZGLB 2CLZA 1X4XA 5DYOB 3BZDA 4WRLA