4LLWB

Crystal structure of pertuzumab clambda fab with variable domain redesign (vrd2) at 1.95a
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
210
structure length
207
Chain Sequence
b'DIQMTQSPSSLSASVGDRVTITCKASQDVSIGVAWYQRKPGKAPKLLIYSASYRYTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYIYPYTFGQGTKVEIKGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mutated Pertuzumab Fab heavy chain
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 207
sequence length 210
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llwB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llwB01
1D5BA 1A22B 3QHZH 1U95A 4GAJH 1LQSR 2YHGA 1S7QA 5DMGC 4Z0BH 5DUBB 5ICZB 4Z18A 1A6ZB 4H1LG 3MRIB 1CD1A 1UCBH 1DQQA 2YK1L 1HYSC 2XKNB 3NA9L 1QSFA 2I24N 4PTUA 4ZAKB 1ZGLA 5DHYA 3U6RA 5KSVA 5IB4A 5CLTA 5B38B 3RUGF 4PJCA 3RKDD 3Q6FA 2A0LC 1DUZA 3DTXA 4EQ2A 1OM3L 4ERSL 2I60H 2D31A 1AI1H 4Z6AT 5IMMA 2AJVL 2I5YH 4KJWD 2VC2H 4XZUB 5JQ6L 1OT1A 4YAQB 4AY0A 4ZO6A 3D5OF 1WAAF 2WNGA 5B8CB 1Z5LA 4DFIA 2PTTA 4ZXBC 3TT3L 1UZ8B 3S35H 2IMMA 1F6FB 3CVHL 3S3PA 2NY7H 3MNZA 4HDIA 2DN7A 2AW2A 4XWOC 2WUBL 2NNAA 3VXTB 2MSPA 5KSAB 4AH2A 3FO9B 4EUPB 5FB8B 1RMFH 4U6XB 4UOW0 1FNHA 4V2BA 1ZT1A 2QHRH 5AYQA 4Z78B 1O7SA 2VXUH 5FA3B 3KGRA 1RV6X 15C8L 2A73B 4I13B 4PJBA 2GSGA 3KDMA 3BUYB 4QOKA 1LEKA 3Q6GH 3OJVC 3CCHB 1QFUH 4JQIL 4PRAB 4R96A 4HJ0C 3DVNA 4XMPH 2A6JA 2ORBH 5I1CH 2O5YL 1AD9A 3DMMC 5ILTL 4HPYH 5IJVB 3RFZC 3T3PF 4C56B 3HB3D 4JKPL 2VXTH 3UTSA 4ONGH 4TTGA 5HDBF 1SYSA 4Z7WB 5L2KD 3LCYA 4PRHD 3S5LA 5B3JF 5DVKA 4Z7QE 5JW5B 2BSED 4LF3B 4MJ4A 4Y5VC 3QO0B 4GO6B 2EZ0C 4G80A 2R1YB 1G9MH 4EN3A 1MLBA 3DV4A 4OD1H 1OTTC 3ARDB 3DX8A 4KMTL 4QYOB 4OSUL 1RIHH 3U82B 5EIIB 2AJUL 1PKOA 2Z91B 1ZLWH 2BSRA 2AXFA 1G9MC 3MBED 3DARA 5GZOD 2R2BA 2DQFA 1NAMB 3K1DA 4AQ1B 1NANH 1CFVL 4KK9C 4KRNA 5E2WL 1LO4L 4JZOA 3LH2L 3EDFA 5AZ2L 3S88H 5CD3B 5E99L 1I8IB 1X4XA 3FO2A 3MYJA 4OGYH 2AV1A 2JELL 4WW1A 1R0AL 4OZIB 3QUXA 5ALCH 4XVJL 5CILL 4FQHB 4H0HB 1YEIL 2OJEA 5DD0H 4OFVA 4MQXD 1F3DH 5E8EB 2CJUH 3DX9B 4UT6L 4MNGB 1H3PH 3G04A 3I3DA 3VU2A 1T4KB 3G5YA 3VFTA 4G8EA 1RZJC 3QXVA 4HS3B 4CMHC 1HHJB 1RFDH 2ITDA 4GRWB 4I18A 4NQDD 1UEMA 2PCPB 4KROC 1QO3A 3FQXA 4FFWC 5ANME 4CVWA 2R2CA 1C08A 1HHKB 1NMBL 3KPLB 3VFUA 3FO0H 1UB5B 1EEYB 1L7TL 2P5EB 3PWPA 4IMKA 1CZ8H 1UJ3B 2ZCHH 1YDPB 4XNQB 2ENYA 1Y6NR 5FKAB 4NHCL 1CI5A 3WXWH 4FQQB 4KQ4L 1AC6A 2A9NH 3CZFA 3FT3B 2XZAL 2O61A 3H9HA 2ICWB 3CDYA 3V0WL 3VGHA 3LN9A 1IC1A 4LCIH 4BKLA 3C9NB 5ANMB 4C54A 2VDNL 3L6FB 2J2ZA 4Z95H 5LGJB 3GSVB 3FCTA 4HT1H 5IM7A 1QSZA 5J89A 1FG2B 5SV4A 1X3DA 3C87A 4K2UL 3C5ZB 5CWSA 4BUGA 5EC2A 2QQNL 3V6OC 2ZSWA 4Y8AA 5DJYB 3OSKA 1NUGA 1VCAA 5C0CE 1IAIM 4Z7OF 5A2LH 3S35X 5C0RL 2XTJD 5IMOA 1YEEL 3QIUC 1KN4L 4ONOA 5F9AC 4J3TA 4KI5D 4ZMAT 2ZUYA 3SKMB 4ZS6C 2C4FU 1TJGL 3DI2B 5F21B 3W2DH 3E6HB 1DBKH 3E0GA 1N6QH 3G6JF 1F2XK 1WBZA 3MNWA 1IEHA 2P42B 1FL3B 5FGCB 3ARBD 4X7TA 5C8JA 2Z4QA 5F89A 5MEPB 2NR6D 3DV6B 3BKJL 5I1EL 2IPTH 1WAAE 1WFNA 3U7WH 3MR9B 5I1LB 5TE4H 1IQWL 2AQ2A 4WCYL 1KYOJ 3MV8D 4YBQC 5EU3B 4E41A 3RUGB 1RUAH 3EKCA 5GISL 1E6JH 3ZKSD 1U3ZA 4MNHB 5A2FA 4LCWB 4UQ2A 3S96B 1LILA 1EHLH 4L4VD 5F96H 1AGCB 2C3HA 3NZ8B 5E6IC 1AGDA 5I30H 1PEZA 3MJGX 1KJ2A 4QT5B 1S7RA 1WBXA 5HDOA 4M61B 2VDKL 3OKKA 3QDJD 3TWCL 3K8MA 4O5LL 1ZLSL 4M93B 3IRPX 3QFDB 2NY2D 1H5BB 4Q2ZA 1KELH 1SMOA 1LEIA 4QRQA 3RPIA 4FQXD 2PYFB 1F3RB 3TN0B 3T3PE 4EDWH 5IBTH 3V5KB 1RU9L 4K3EL 3SJVD 5HDBE 1IGTA 5GZND 2V5MA 3HMXH 5B3JE 1QBML 1DBMH 1UYWH 4IRSB 1X5HA 1A1MA 2PR4L 2W9LA 3W0WE 5CJ5A 2E7HA 2GKIA 4IDJH 3AY4A 1ODAA 4LP4A 3RP1A 2GIYA 3NCJH 3FB8A 3VG9C 4JPVL 5FK9A 1ORQA 5EG6C 1A1OB 1DVFD 2JJWA 1AJ7L 4RQQB 1NGPL 4QCIB 5TDPB 5M95B 5KOVC 2XRAL 3DVGB 4NYLA 3W0WB 2NY6D 2D7NA 1L0YA 2F5AH 5DHVH 1IVLA 4NQED 5DSCA 4QF1A 3O45B 4OFPA 1J1OL 4ZTOL 2X4NB 1X5XA 4D94A 4N0FA 5ACMA 5BW7A 2YRLA 3WLWD 5C08D 4EOWL 3BP6A 5JMOC 2EXWC 3UZQA 4U1NB 4RGNB 3ARFB 2WQRA 5JHLL 1IAIH 3O6LH 1M7IB 3ARTA 2BNQA 2M26A 1NSNL 4ZODA 1XGTB 1Z3GH 4P99A 4JFQB 1FFPB 1AP2B 1HHHA 5SWSD 3V8OA 5T1LD 3HI5L 4MJIA 1I3RB 3S5LG 1A6UH 1SJVA 3S7GA 1NEZA 1YC8A 2MPAH 2YA0A 3MCLL 4OFYD 4FQJL 1I3GL 2X41A 4C83A 5E24E 3DBXA 4M7LH 3X3FL 2V2TA 3S36L 3ARGB 3D39B 1WBYB 4NQCE 5T3ZH 3GBNL 3FQWA 1TZHB 4NO5B 1WVZA 2E7LC 3FB5A 3WDIA 3ZTNH 1BVZA 4S10A 1E4KA 1U8MB 4A6YH 3DXAE 4I3RH 5CP3H 2Q8BH 3P4MA 1S78C 2YSSB 3LRGA 1BD2B 3KPMA 2V7NB 3EOTL 5TDNB 5C9KA 2YRZA 2EDBA 5BQ7B 3K2UH 1MIMH 2D0GA 4IIQC 4X7SH 3CLFL 2NPLX 5LWYH 1CT8A 3BHBB 1W0WB 2DQEL 3TBVA 1RIUL 5LJYH 3I02A 4YDLC 4XP1L 2V5SA 4XPFL 5EBMB 4TPRH 2P48B 3CX5K 4KC3B 4DVBB 4LPVA 5EU5A 4ZUWA 1TZIB 5I66A 1OF2B 2VZTA 2XWBB 5DMYA 2HYMA 4J6RH 2E9BA 5IBUG 4QRUB 3PG2A 3F7RA 2GJZA 3ROOB 2JF1A 5GRJH 2CMRH 5C6WH 4XXCA 4QHNB 1JF6A 5L9DH 3GSNL 4WTXA 3KPRA 1ZE3C 4OUUB 4U1GC 1A7OH 5D1XA 1CQYA 1D5XB 2Q3ZA 5DJ0B 2AK4D 4IOFD 3WL9B 4YDKH 1MLCA 3UDWA 2P5WA 1HWGB 4JDVB 3P30H 3MRCB 3RWCB 1YNTA 2ZZUT 4NO3B 2XY2A 4GLRH 1ZA3A 3G6JB 5DTFA 4U05A 1IM9A 5D70L 4Y5XC 1MHCA 1KGCD 4UB0L 2GJJA 4XCFL 4JFZH 1OAXH 1JNLL 4Y1AD 1IMHC 4GQ9H 4H88H 5DQDH 3IXTB 1EH9A 4JR9L 4HUWB 3HS0A 4P46C 3QZWB 4N1EA 1TNMA 3OR6A 1T5XB 2JJSA 4FQPA 5DJ8A 2H3NA 1HZHH 2B39A 4R0LB 1GZQB 2GTWB 4H0IA 5GRVL 1AHWA 4LQFH 1EEUA 4TN9A 1AR1C 1KPVA 3KAAA 5FECB 3RVWD 2YPVL 1DDHA 1KNOB 1T0PB 2VDPL 2GT9B 1JHKL 3T0BA 1EX0A 3TNMB 1BZ7A 4UOJA 3A67L 3BP7B 3N1PC 2I27N 5DJZA 4EUPH 3QPXH 2EH7H 4HMDA 5KANG 2A77H 4XHQA 1GC1L 1E28A 1GZPA 2K1MA 1B0RB 2PKDA 4XPAL 1JFQH 3O3BB 1Z9SA 5FYLD 4BFGA 1J87A 4ODUA 3EFDH 3VJ6A 5KSAC 3TPKA 4GAGH 4TSBL 2QLVB 4OCRL 3BD5A 1JGEB 3T8XB 1KEML 3CXHJ 2VDLH 3EYQC 2RQ8A 3U7AA 4O2CB 5E0QA 3WHE0 3IU4L 4YPJA 4F57L 5M94B 2H8PB 2UZIH 2IGFH 2ESVD 2J7LA 3L5HA 3KYKH 3UO1L 5GIRA 5FDYA 3RNKA 3LEVH 5FCSH 1JYNA 5C7XL 5MEOB 4QRTA 3GSWA 3P4LA 3D9AL 3QUKA 4NZJA 5CIPB 4BSJA 1N7ML 3VXOB 3CSBA 2YMXL 2OQJB 2KL6A 2NY1C 4MNQA 1YMHB 4QKXB 1E4WH 5I1HL 1MFBL 3U2SA 1I9EA 1IGIL 4QTHA 1RK0B 4RIRA 3WN5A 1J5OH 1T2XA 4Y88A 3IAPA 4I48B 4XNMB 3I6LE 1ZT7A 3RAJL 3TF7C 3QEGL 5I16A 5DK2A 4P9HL 1KEGL 1QRNE 3QA3A 3FJTA 2ZPKH 3RZCA 1I7ZA 5C86A 2O93L 4YJZL 3O6FA 3H9SA 4HLZH 5JORB 3MV9D 2Z93B 1D9KB 3GSXA 4QRRB 4PJ5A 5HI5D 1G7PA 5FHAH 1A9BA 2J88H 4JFEE 3UAJD 1X4YA 3VFSB 1MH5A 4RFOH 1JYXA 3MBXH 1MJJA 3N0PB 1JZ7A 3V7MA 1J12A 3I75A 4H5SB 3TZVB 1OGAE 3RU8L 1QRNB 3KYMA 3U4EB 5SV3A 1Z9OA 2AJ3B 4N9GA 4Z0XB 4GAYB 1WF5A 3MXWL 4PB0L 4M1DL 4YXLL 1G9NH 3K1KC 1N8ZA 1QTYT 4TUOA 3MCKB 2NY4C 4YX2H 4G8GB 4KDTC 1BIIB 3QRGH 3D2UB 3MLTA 4LRIC 4QHKI 3F58L 3NACL 5DK3A 1NEZG 4WHYG 1G9NC 1OGAB 4JZJA 5A16A 1I8KA 1SJEA 4OF6A 1P4IH 1QFWM 3BFOA 1AD0B 2YPLB 3BKYL 5IG7B 3X3GL 2DM4A 1F4YH 3PWPD 3T1FB 4IRJA 3BMWA 4P57A 3F6LA 2LE9A 5DMJB 1GJIA 3DURA 4B5EA 2HJLA 4LLMA 3SE3C 2NLJB 3HUJA 4OT1L 3T2PA 4R26L 2EDQA 5LAXA 3VFMB 3ARED 4HW6A 5D1ZB 1KV3A 4NQSB 3T3MF 1S3KL 5E94B 4POYA 1XGRB 3VFWB 4EVNA 3MYZA 5F3BA 2V6HA 1ZK9A 2FNBA 1CF8H 2HMIC 5FO9B 2VZOA 2RR3A 1I1AB 1EEZA 2VSCA 4FFYL 1CXIA 3MLWL 3QUZB 3KLDA 2PTVA 1A7NL 3MV7E 1MFDH 4OLZL 4M4RA 4JRYA 4LDOB 5GGUB 1Z6JT 1WZLA 2IAMC 3EYVB 2FJFB 3NA4A 3U48A 1FZKA 1M71B 2NXZB 4R9HA 5JMRA 3GGWB 5JHDB 3LKSB 5C71A 5I0DA 4TQEH 4K3DH 5EIVA 1PX3A 3T0AA 3BQUD 4ZXBA 5D7KD 5DO2C 5ADPH 5I1KL 3EOAA 4ONFH 1AXSB 3IETB 1AIFB 4LIQE 3L95B 4NQUA 3VFOB 1AO7D 4XRCA 5KVEL 4Q7DA 3JWDL 5C9JB 1BVLB 5HGAB 2XXCB 5FM4A 5D6CA 1UB6A 3FFDB 1D6VH 1E4XH 5K33A 3VFVA 5IESH 3CNKA 5FOBB 4X7FC 3R06A 2AEPH 3MUJA 4F7EB 4YHKL 1FCCA 5GGSY 1N4XH 5IVZA 5L0QB 1HHIB 3GUTA 3MROB 4HX1B 3JV4B 1RURL 2CKBB 4OZGF 3DMMA 4U6YA 4M93C 5F7NC 4R97B 5IK3A 4QRPB 4X4ME 3A6CH 5HI4C 5ECJE 3B9DA 3TN0C 5IW1A 3SDAC 4OBSA 3CDGB 3ZDZF 1RJZA 2B2XL 4OCYL 3JWNC 3MLXL 3HZMB 1WZ1H 3Q5YA 4HH9B 4S2SA 4M6OH 3DYMA 1CL7H 1P4BL 3EO1A 3WCYA 3KYOA 1KC5L 3OV6A 3KPTA 1T1YB 1LO0L 1KLUA 3NIGF 3MO1A 4KKAC 3LKOA 1YMMA 4FQCH 1QFWH 3KPSE 1K2DB 1A64A 3LKNA 5FF6B 4LNRB 3MACL 3WYRA 1W72L 4LEXH 4LQ1A 5KVFL 4KTDH 3LOWA 2DM7A 2QSVA 5SWQA 1IL1A 3VD9A 1U8NB 1WSST 4D0CB 3D87B 4CVXA 3FMGL 4MJ5A 1LD9A 4PJXA 4EIZC 3EW3B 4X6EA 4QRSB 1VB9A 5D7IF 1HSAA 2OJZH 1G7MA 1B2WH 1OSZB 3WDHA 4K07A 1QSED 4GW4A 4NZUL 3T2OA 3ARFC 4TYUA 1W8OA 4BZ2L 2HT2C 5ESQB 1VFBB 3L9RB 1D5MA 1YEFH 2AJSH 2IBBA 3IKCA 1LDSA 1ULVA 1JZ2A 2IQ9L 4TSCH 2BVPA 2FZ3B 1U93B 1IZJA 4LAQH 4G6KH 3P4NA 5DFWH 1FE8L 5HHOD 5D5MF 5DEGA 5IROA 5JLZB 1WQVT 2ZG1A 1VFMA 3RGVD 1U8OA 2PN5A 3ARGC 2B8OT 2Y9RT 3GSRA 1Q0XH 2C5DC 4HS6A 4HHAA 5DLMH 1I7UB 5FYLL 1N6UA 1IGCL 3OR7A 1H0DA 4NT6A 4MHHG 3O3EA 1JRHI 1SJHB 3QP3A 4NN7C 4JFDA 3AS3A 4WHCA 4ZTPL 3QG7L 4JFOB 4MDIB 5SX5K 3MGTB 4HIXH 2F8XC 4HC1L 4PRIB 3T3ME 3V6OA 3P3YA 3GHBL 1FLRH 3TBSA 3HAEB 3UJIH 5JPNB 3CX5J 5HYJE 5ADOL 2AEQL 1PGRB 2GAZB 2VLJB 2J8HA 2F53D 1WIPA 3QIUA 1YYLH 1A7QH 3W11D 4H20H 3KLAB 1ZHLB 3VMOA 4WTZA 3X14B 5E4EB 5GGRB 3LSOA 4CADA 5T5FH 3QULA 3DHJA 1MNUL 5HGGS 3ZKMD 4JM2B 2BVQA 2XA8L 3LMJH 1IFHL 4YDJA 4DTGH 2MWCA 1VA9A 1DQML 1FG9C 3C60B 3MFGB 5I1AA 4DZBA 3TT1L 2OMBA 2EDNA 2XQYK 5DGQA 3CVHB 5I2IA 4ODTL 5I1JH 5KVGH 2VABB 5EBLA 2A83A 3LPGA 4PR5B 4S1RH 1KB5A 3ULUD 1JWMA 1HKLH 3HRZA 3QIBB 5GGSA 1FFNA 4FTVE 1U8KB 2DQHH 2VLME 5E9DD 3DO7A 5E6IA 5IW3A 4HGWB 1ZEAH 1YNLH 1S7SB 1YA5A 4YXHL 4KMQA 3FL7A 3BGFB 4APQA 1JRHL 1INDH 4OZGE 2L7JA 3FT2B 1CLYH 2YOCA 4RSVA 3ZKXC 1PSKH 2CLVB 4EI5D 2IH3A 1Y0LB 4R4FH 4DUVA 1EHXA 1MCDA 2C7UB 3ZDZE 4F58L 1Q0YL 2XQBH 3FB6B 3VWJB 2AEWA 2Q86A 5CKAA 4K7FB 2ZSVA 3VG0H 3CMOH 5EOTB 2AXHA 3FQUB 4OZGB 3NIGE 2OCFD 5JDJA 2EEDA 4YHYB 1U3HB 2YD7A 2VQ1B 5DS8A 3IJHB 1TZGL 1M1SA 1PW3A 1KIPA 5EPMB 1CS6A 4PV9A 2VNCA 1AGFA 3ETBF 4CNIA 3WS3B 3NAAH 3TIEA 3QNYB 3W39B 1U8PB 4CVZB 3QUMA 2HLAB 4O02H 4PTTA 2G75A 3JTSA 2A9ML 3GIZL 4PJGB 3BDYL 1U6AL 3L3GA 3C08L 1W0VA 1EAPA 4L5FH 5D7IE 5DRNB 4QEGA 5MP6H 2F5BL 3LS4L 4YFLF 4U6VL 3K2MC 4J7RA 3VGAC 3H42H 4OGAD 1FFRA 3CFKA 3WLBA 4U1SA 5CHNA 5HD8D 3VRLF 1S9KC 4MLSA 2IADA 4MB4A 5BXFA 5IOPA 1NCNA 3TYFB 3MZTA 4AIZA 4JREC 1AE6L 5BVJB 2ZKHH 5D5ME 1U8IA 4KVCL 3QQ4A 1JI2A 4QTIL 2OZ4L 5GHWL 4GKNB 3BGAA 5K9JH 4DZ8A 1DN0B 2AXGA 2Z92B 2P8LA 3VXRE 2R8SH 1FFOA 1KN2L 2E7LA 1MUJA 4BQBA 5SX5H 4XMKL 1MVUA 3M07A 2JCCF 5DJAA 2X6MA 3QIWB 4ZUSA 3BJ91 4OLYL 1UM4L 4U0RB 5F72S 1MCOH 2LU4A 1D9KC 2GFBA 4GKOA 1MHPL 2F15A 5D1QB 5GJSL 1T7WA 1QFOA 4PJIB 3Q3GB 3FQNA 3RKPA 1XR8B 4X6DF 4NDMA 3O4LD 5TPWL 1QR4A 5CP3A 4J3WA 4R4BB 4LPCA 3VFPB 4JG0L 4Y4KB 5IHZA 3BH9B 2K7QA 5CP7B 3VFRB 2VLRD 5C0DB 2DOCA 4S0SD 4OLWH 4L8DB 4OIAA 2VDRL 1FGVH 3IDMB 2G5BB 4MMXC 1REIA 3B9KB 5AYUH 4WI9A 1UT9A 3OKEB 2FR4A 3TH4T 5E00A 2EO9A 3L3OB 1RUQH 2ZUXA 4K3GA 5HGBA 5ICYA 3ZYIA 1ZS8A 3X11B 3AXLB 4YGVB 5K9QG 4XC3L 4JHAL 2NY3B 2DQJH 2H2PD 4PGBA 3RNQA 3QHFH 2BHZA 1FZOA 5JNYA 1LO5B 2EE9A 3QFJA 4Z8FH 3TVMB 4Y16B 3WEXB 4ENED 4P3WA 3OHXA 1EFXA 5CGTA 5C0JB 1F4WL 5D71H 4F9LC 5DRWB 4P23B 2YD4A 3QDGD 1OB1B 4Y5XA 4WENB 2BNRD 4N8VB 3F12B 1SMAA 2QSCH 1GGUA 5C0BD 5DUBA 5ICZA 1I1RA 5E5MB 3S3JA 4GBXB 4P46A 1GGCH 3MRIA 3N06B 3HMWL 2RIKA 1OWWA 5I8EB 3BWAB 2XKNA 1I1AC 1BBDH 1F90H 5DR5L 4PJ7B 1A6AB 3GMLB 4NWUL 3QUZC 4NWTL 1QFPA 5D72H 4J3UA 2EIDA 3NCYP 4P2OC 5B38A 4DKFH 2PXYD 2R0ZH 3UYOD 4Y2DC 4J4PC 2VKWA 2AJZB 4Y19E 2GSIB 5C0GB 4WTZG 2NXZC 3P77B 1FVDB 3OKNB 3CSPA 1HCVA 5DUPH 1KJ3H 5B8CA 4P3CL 1UZ8A 4HZLB 3CFEB 3MRQA 5TE6H 4ETQB 1SM3H 3TA3B 3TPUB 4AZ8A 4GW5B 3O0RH 1TENA 4KU1A 3VXTA 4AJ0A 5KSAA 1RULH 3FO9A 3WKML 4EUPA 4Z78A 4AMKL 3GMPB 4O4YH 4B53A 2CKBH 2DBLL 4LIQH 5FA3A 4HJGB 4QHKJ 4OCXH 3MJ7A 3BUYA 4JKKA 1R24B 4LLWB 3CCHA 4PRAA 4YBLB 2AKRB 1WEJL 3OAZK 4DGVL 4AENB 5IJVA 3RBGA 2EYSA 4OI8A 2FLBT 4X9FA 3DNKA 3QUYC 3EDJA 1T22B 4U7SA 2QR0B 4X6BA 3ULSB 2VH5L 4I3SH 4LSSH 4P48A 4Z7WA 5JW5A 1GGTA 3VXMB 3VRLE 4LF3A 2B1HL 3BVNA 3IDNB 3L3HA 3TH2T 3QO0A 4LLYB 1XF5A 4ALAL 2VXSL 2R1YA 5C07B 3RDTC 4JO1H 4QYOA 3GRWL 3FQRB 1GHFL 2APXA 1A14H 5F6HI 5EIIA 3KLHD 1WCQA 1QUNA 1R3KB 3ARXA 2Z91A 3IKKA 5CEZE 1J18A 1EPFA 1MHHB 1S7TB 4O2FA 4ZOAA 3RWGA 4NBZB 5T33H 1UVQB 3QDMD 3QDHA 2DICA 2JCCE 5CD3A 1I8IA 2H6PA 4PY8I 3D3VD 4GFTB 2HTLD 4OZIA 2EDWA 2CRIA 5GS1B 4MAUH 3NH7H 1B4JH 5L2KE 1EGJH 4PRHE 3AMLA 4XHJC 5C0ND 4X6DE 1Q9WB 2E5EA 4LLVA 1FHGA 5IVXB 3DX9A 3MLZL 4MNGA 1SEQL 4XPHL 3GMNB 1T4KA 1WISA 3JV6B 5BCAA 1MREH 1ES0B 3HTLX 1MFCL 1J1XL 3VXQB 1A3QA 5J1SC 4KDTA 1HHKA 3OQ3B 3KPLA 4RGOL 4LRIA 3V6FB 1UB5A 4R7DB 5L2KB 3BE1H 2P5EA 4PRHB 4IEFB 4HWEL 1UJ3A 4XNQA 1YDPA 3HPJB 4YHZH 1KCUH 5FKAA 5KOMC 4JDZB 2KH2B 4FQQA 3DETD 1KLGB 3FT3A 2FJGB 4MB5A 2ICWA 2HVJB 1UM5H 3GSNB 5FAAA 2KQMA 4P4KD 3C9NA 4LU5L 3SE3A 5ANMA 1IGFL 3L6FA 1OAYL 3INUL 3GSVA 4LSPL 1T6WA 5D8JH 5HSFA 3HAEH 5C3TA 1LO2H 4P4RB 1FG2A 1II4E 1R3HB 3GMRA 4EIGB 1CFTB 4NQDE 4P5TB 2H41A 1C1EL 1NCBH 4MX7B 4M43H 1EERB 3PXHA 1GGYA 4MXWH 3AB0B 4KHTL 5GQBA 5E5UB 1MRCL 5BZWB 3VXPA 1CDGA 1VGEH 1QLEL 4IHOB 3B2VL 4NNPL 2V5RA 5D2NB 5I8KL 3RA7H 4N5ED 2IAMA 2ZWLT 5BS0D 3E6HA 5BO1H 3G9VA 4P59H 4G9DB 3IDXL 3Q0HA 4K94H 4KXZH 1NBZB 4RAUB 1FL3A 1OTUD 3VXSE 5MEPA 3OG6B 4PIRF 4FABH 2E7MA 3DV6A 3KR3H 3V4UH 3MR9A 3E6FB 3ZDYF 2P24B 2X4OB 4M3KB 1PJ9A 1IQDB 1BREA 4CDGC 1YQVH 1MIEH 4FQLL 4OQTH 5EU3A 3RUGA 3NCYS 4PD4K 4XP9L 1B0WA 4BFIB 3D0VA 2H32H 4Y4HD 1T2QH 3OAZH 4LCWA 3O9WD 2XTJE 3S96A 2W0FB 3GNMH 4JQIH 2JKXA 3TM6A 2M2DA 1AGCA 3NZ8A 4G9FD 5E2VL 1LE5B 4U4BA 5EDXA 1NGQL 1WAAA 4A2LA 3OG4B 2VIRB 4QT5A 1VKXB 5IBLD 5L7XL 4M61A 1CD0A 3QFDA 1H5BA 1MF2H 5EWIL 1I4FB 2PYFA 4R90L 2DIBA 5DJ6B 1I8MA 3TN0A 2D9QB 3V5KA 4S0TD 3B3IB 2ARJA 5B38G 4F8TA 4KZDL 2ITCA 4KDWA 3VW3L 4IRSA 1DLFH 3HLAB 3FFCD 5AZEH 2N1KA 1E4JA 4XP6H 2PO6B 1LEGB 4PPTA 5H8DA 4KY1H 2W60B 4U31A 4YR6B 3ZYOA 5BV7L 3EDKA 1JN6B 4HPOH 2EO1A 2I9LB 3ARBB 5GRYA 4YHYC 5CJQL 1IILE 4UT7L 1G6RH 4XPTL 5F7FA 3PWJB 3THML 1J05B 1A1OA 3CMGA 4RQQA 3EJYD 4WO4B 3QDJE 3MV01 5TDPA 3V0VB 4EUPG 3MV8B 3W0WA 3ZZ1A 1DQJB 4X80H 3DGCR 5FUZH 3FAXA 3LQAH 4NOFA 2X4RB 4XGZA 4XNYL 3O45A 5SX4I 3MOAH 2BX5A 4HCRA 5IMKB 2DIAA 3IFLL 4P0DA 4L4VB 3RVTC 4S1QL 1EO7A 4PJCF 3ARFA 1JPTL 3LQAC 1M7IA 3ULVL 1JMXA 5C1MB 4Z7VF 3OGCA 3T0ED 5A43C 4KUZH 4JFQA 1FFPA 1AP2A 4NNXB 3HI1B 4WEUD 5KVDL 5IHUL 4I0CC 2ARJQ 4V1DD 2VDOL 2XZQL 1I3RA 4FQXB 2HH0L 1ETZB 3CUPB 4N0UE 4NN6B 3SJVB 2HLFD 1VESA 1XGPA 5EU4B 3GHEL 5FM8A 1CD8A 1WWCA 4GG8A 2X9XA 3FN9A 3ARGA 2BOCB 3D39A 3EYFB 2KZWA 2DLIA 1WBYA 1QVOB 2OP4L 4L3EB 4NQEE 1TTGA 4NO5A 4OTXL 3SDDD 2WWKT 1VGKB 1CFBA 5IKCB 1NGXB 2YR3A 4NUGH 1U8MA 1Y18B 5C08E 2OTPA 4M5ZH 4KKBC 2DI8A 3VGGA 4N0UB 2E9WA 4U0RC 1IGYB 4XH2B 2HJFB 2X1PA 1J8HD 2DWEB 1PQZB 2YSSA 4O00A 3ZE2F 5TDNA 1WIUA 2AK1L 5SWSE 3X12B 2NY6B 1ZA6A 3QEQE 1MCWW 3L5IA 4IJ3C 4HUXB 2DDQH 4KKLD 3KLSA 4XB8A 1QHOA 3G6DH 1F4HA 4J3VA 3M17A 3HE6C 5EBMA 3VFGH 4DVBA 2D7TL 4ACPA 1TZIA 1OF2A 2XWBA 1MCFA 5SWSB 4LHUB 2YKLH 5I8OH 5JUEH 4JRXE 4UV4H 2RCSH 4LBEB 1DCLA 4QRUA 2CDFB 4BSWB 4HSQA 3ROOA 4AEIL 4JCMA 4PRDB 4QHNA 5EU6D 2QSTA 4R2GD 2YEZB 4OUUA 3CXDH 4KK6C 4J12A 4NKIH 1D5XA 3ZDYE 4Y5YB 1ZHNA 2X4PB 5A2JH 1FNFA 3TVMC 1I8LC 3WL9A 4I0PB 1FCGA 4NRYB 4JDVA 2W1NA 5DT1H 3BIKB 3RWCA 4OLUL 4NO3A 2VL5B 4U1JB 3G6JA 1UJTA 2NW3B 3BZEB 1S5IH 2FBJH 2VXVH 2J8UB 4RA0C 1S9WB 4JFXB 4OJFL 3IFNH 3HI6L 1HK6A 5FYJH 1SJXA 1P1ZB 4ZS7H 5ISZB 4G7VH 2C26A 1CDIA 4HUWA 1AXTH 2ZUQB 2XZCH 3L1OL 4GBXC 4ONHB 2YC1A 4NZRH 1CIUA 3UTTE 1T5XA 4KZEH 1V7NL 2XWTB 4NPYB 4R0LA 2WMPA 4R4ND 2Q87A 2OMNA 3KNBB 2GTWA 2NXYC 3QR2A 4QXGH 4LGPB 1TJIL 1Q1JL 3ZLQC 5FECA 1YEDA 4ZAKD 1J88A 2LV4A 3NGBC 5A2KH 2ATPB 1KNOA 3WIFB 4U0QB 2GT9A 4KRPD 2P44B 2XWJB 3TNMA 3SGJC 3SQOH 3BP7A 3JV0A 1ZHKB 4LCYB 4BSVB 2GTZB 1NLDL 1ZWIB 2R1WB 4WEBH 4PJFF 1OTSD 1L0XA 1KJMB 4LFHD 1BAFH 2MOVA 1B0RA 5I6XC 3TA3C 3O3BA 3MPCA 3LHPL 1CK0H 3UTQB 3RWIA 4MAYD 3DYOA 1QQDB 4WU7B 4PLJD 5F1OB 3OL2A 1OSPL 3QXWA 4PP2A 4WUUE 5C0EA 1JGEA 3T8XA 5DK0A 2AK4B 3JWOL 3ARVA 1W72B 3T0DA 4O2CA 3S37L 1GGIL 3GMQB 1U0QA 4F15B 1R3LB 3QWRD 1T83C 2W9EL 3QXTA 4G5ZH 2H8PA 3R8QA 3UJJL 5ACZA 4YBLC 1QBLH 4Y1AB 2R0WL 1N5YL 3LVEA 4EKXA 4PJCE 4KK5D 3TJEL 1NCDH 2NZIA 1MRDH 4FZEL 1L6XA 5MEOA 2AABH 4ELMF 2OM5A 3TBWB 4FZ8H 5IIEA 2E7CA 3VXOA 4C56D 2DLHA 2OR7A 4OZ4B 5FYLE 1YMHA 4L9LB 4NNYA 1BQHB 2VMFA 4OZHF 3RRQA 4PV8A 1SY6L 1T1ZB 5F7DB 3BESR 2YPKA 4JFYB 1RAMA 1FAIH 1YEHH 4I5BB 4ZPTB 1R3IL 1YPZB 4KJWC 4I48A 3ARDD 5AAMA 2AI0H 1JZ6A 5J57B 3CSYA 3IFPB 3C8HA 2HJKB 4Z7VB 2EXYD 4PGJA 5J13C 2Y6SC 4CGTA 5CEZH 2ESVE 4E42A 5JORA 1D9KA 4LHQB 4QRRA 4Z76B 3B4NA 2FGWL 1JHLH 4OM0H 3U7YL 2FBOJ 3BPLB 2C4FT 2DI9A 5GS1C 1NMAH 3VFSA 3ZE2E 3W82A 3MLUL 1U3JA 4GS7C 4AG4H 3NTCH 3V6ZB 3ME0A 2J4WL 4XVSH 4H5SA 4JJ5B 1QRNA 3D85D 5F1KC 3U4EA 3SKJL 2VR5A 4Z0XA 4NN5C 1IBGL 5DD3H 1A3LH 2ESVB 3LD8C 4OZFH 3QT2A 4DKEL 4LVNC 3MCKA 4YFDB 4TUKH 4MS8D 4QWWC 4TRPH 1YZZA 2F74B 4G8GA 1BIIA 1DBJL 3HB3C 3D2UA 4KGLA 5F7HA 1OGAA 1G7JB 4MMZC 2BDNL 4G43B 1DEEB 5IG7A 1AD0A 1CFSB 2DKSA 2DLFL 2DB8A 2YPLA 3MNVB 1Y6MR 5E8DH 3I6KA 1X44A 3T1FA 1KCSL 4HIHB 3MLVL 3NPZB 2F58H 3STBA 3WFEH 2X05A 4HKXA 4ZFFB 4YHPB 2NLJA 5KTEH 1V3LA 2R0LL 3MBEC 5GZOC 4RMTA 5J4MA 1CGYA 4F9LA 1JNLH 3SDCC 1YECL 1R5WB 3PP4L 5D1ZA 4HIJB 4NQSA 5HHVL 1D6EB 5E94A 3MV9B 4H0GA 3PQYD 4WVRA 4JG1H 3QCTL 3C5ZD 5F6HJ 2QKIB 4Q9RH 2WIIA 1UZ6F 1I1AA 3AB0C 3UJTH 1T1XA 1WC7B 3QUZA 1HH9B 1AQKL 4P2OA 3E3QE 5E2TH 5EO1B 1E0OB 3PWPE 4Y2DA 4E5XB 2YD5A 3EYVA 2FJFA 5CMAB 1M71A 1F45A 3GGWA 5JHDA 1XGYH 4N0CD 4PJ8D 3P0VL 4OI7A 2VLLB 3P9LB 1Z9MA 1HOCB 2UVFA 4H8WH 3VWKB 1IJ9A 1AXSA 1FRGL 3IETA 1AIFA 1K4DA 4RGMB 3OKDB 2WBJC 1YEJL 3L95A 3VFOA 1GC1C 4HKJB 3RWFA 3WIHL 1BQLL 1BVLA 1WFUA 3PABA 4LVOB 4NBYB 1YN7B 4RNRA 5HGAA 3GBML 3FFDA 5JW3H 4H8WC 4HFWB 2E6JA 1G7HA 3DUUB 2HKFH 4NM4H 4U1KB 2IALB 4WI2A 2J3SA 1RJLB 3RVVD 2Y23A 3BAEH 4CMMB 4PJFB 1JPST 3N1MC 4H1LH 2X4QB 3HPLB 3MROA 1GYAA 3I6GA 3JV4A 2CKBA 4LSUH 1CE1H 3QZWG 3CK0L 5HYSA 4QRPA 3WJLA 1EBAA 2UWEF 3AU1B 4PB9H 1GRWA 3RI5F 4WHTB 1WJ3A 5FUOL 1QSVA 4MA1B 3CDGA 2XTJC 3TESA 1HXYB 4ELME 1P84K 1U3YA 4HH9A 1KBGH 4D9QD 3ILQC 2AVGA 4XTRD 5FHBL 5LBSL 1VDGA 3NFNB 4OCLC 12E8L 1T1YA 5DJXB 3ULUF 4PUBH 4OZHE 5LXGH 4IRSD 3ROLB 4RZCA 5EO0B 5DJDB 3U1SL 4KVNH 1A7RH 3C2AL 4YGAB 3HZVB 4X4MA 4XMLH 4E41E 1K2DA 3ARBC 2PYED 4G8FB 4NC2B 5FF6A 2NR6C 4LEOB 4PJEF 3BQUB 4TULH 4OCSL 4CRPA 1DN2A 3QG6B 4LNRA 3PHOB 4P3DB 5FGSA 1CG9B 5FUCE 1RZFL 2E6QA 4P2RD 4A2MA 3ARQA 1AO7B 1VACB 1U8NA 3LPWA 4EBQH 4Q0XL 1TQBB 1N3NB 1DANU 1JJUA 1YY9D 3NCEB 1OSZA 1J0JA 4O58L 3IB4A 4ELKB 4UTAL 1S7VB 5IJKC 2WUCL 2KKQA 5JXED 1OAUH 5ESQA 5GS0D 3L9RA 3EYOB 5I15H 2G60L 3W9EB 4RGND 1RVFH 2NY2C 3U36B 3U46B 4X83A 1U93A 4MA3B 1JIBA 3IVKB 4OD3L 2DQUH 4P9ML 4NN6C 4P5KB 5JLZA 1CYGA 1R5IB 4K71B 2CSPA 1FDLL 3SE8L 4E0RB 4OGXL 4OF5A 3BZ4B 2OK0L 3S4SB 3GJEA 4P2QB 3JV5A 5I0ZA 2E27L 3SHSA 4WI8A 4TVPD 4L4TB 1QPXA 4KAQH 3TCLB 4NCDA 1QSEE 3VXUD 4YNYB 1KT2B 3FKUS 1DVFC 4JO4H 1JGLL 2VN4A 4JFOA 5JDSB 4L8SB 5C09B 5JOFB 1ED3B 3G5VB 3GM8A 4YC2B 3OX8B 2NY6C 3HAEA 4WDIB 1T7ZA 5JPNA 1BD2D 3L7FB 4HXBL 1PG7L 3WFDL 1XIWD 4LVHB 4U2YA 4BUHA 5HHOE 4YHNB 2X4UB 5FGRA 3PWUB 3SCMD 4NOBA 2OI9B 1K6QH 2Y06H 4U6TA 2WLZA 1UGNA 3NABH 4OFDA 5GXBB 4BK4A 2X89A 2VE6B 3KLAA 3CSGA 1ZHLA 5F9WC 4AIOA 1XCQB 4HWBH 1KXTB 4KRMB 4NUJA 3EJZD 1HHGA 5FOJA 4UI2A 2DQGH 2W38A 2GCYB 3QQ9D 4JM2A 3SKNB 3LKQA 4LSQL 1KOAA 2VKXA 2MCPL 1FBIL 3Q48A 3MOBH 5HHOB 3LKPB 3QDAA 4RFEA 2XZZA 2F54D 2JB5H 3REVB 3V95A 1MAML 3JWDH 5E7BA 4U3HA 3RGVB 5IB2B 4XNUH 1ZVHA 3UXFA 4G7YH 2VABA 4PR5A 3MRHB 3QIBA 4LARL 3JWDC 4XCCL 2MFNA 2F53E 4HV8B 5C2BH 4OQTA 4K9EH 1F3JB 5DD1L 4HGWA 3EO9L 4MDJB 5TF0A 1FO0L 3MMEB 1MJ7L 2H32A 2ZUQC 1RUPL 5KANI 1RZ7H 2DQTL 4FQ1L 4LLAA 4AK1A 4M7ZB 2LAAA 1T20B 3FT2A 4K9EC 2L0DA 3OBAA 4WUKH 3LZFH 3PV7A 2UWEE 3FT4B 4POZD 2R4SH 3CH8A 4UILH 2R1XB 4WI6A 5I8CB 1L7IH 5CAYB 3MTRA 4QHLB 1RJYB 2WP3T 1NL0H 4JQVA 1IC4L 3FB6A 3VWJA 3WS6A 1G7IB 5KBNC 3IAQA 5HYEA 3VGBA 1C12B 1VERA 1P53A 2ADIB 3TBTB 4X5XB 2IG2H 3ULUE 4OZGA 5F7EH 3HUJF 5GRWA 4UDUB 2OL3L 1A3RH 3O11B 3TJHC 2WWMC 4I2XB 5E9DE 2FDBP 1U3HA 2VDQH 2VQ1A 3IJYA 3IJHA 2ILLA 3O3UN 2AERT 4PJEE 5D7JB 1URLA 2V5TA 3WS3A 2EIZB 3QNYA 3W39A 3OAUL 1U8PA 5C6TH 1S9XB 1MPAL 4CVZA 2HLAA 4AYFA 1XF2A 1YJDL 1UWXK 3SO3B 4PJGA 3QI9D 5DWUL 4I3GA 1K8DB 2XFXA 5JXAH 5L2JB 1CLZH 4ISVB 5GSRB 2HWZH 3TO4B 3FB7B 3CC5B 5E9DB 1RJCA 1M4KA 3K4ZA 2J6EH 5T3XD 3AVEA 4X8JB 3QHTC 1NDGB 5I71C 5EOQL 5I1GH 2DBJA 2B1AH 4UZGA 3SOBL 3PGFH 3KXFD 1VENA 2V17H 2MTPA 1S5HB 4EI5B 4LK4A 4DEPC 5E2UL 2AJXL 5BVJA 2CLRB 5EBWB 4I9WD 4CKVX 5DJ2A 5D7IA 1OW0A 3RVWC 1TJHH 1I9JL 1JPGA 4NO2B 4GKNA 1QR1B 5FYLH 2Z92A 5TQ2L 3BUTA 2IH1B 4GUPB 2R56H 1LDPL 1F11B 3CLEL 3UBXI 1HILB 2M1KA 5I73B 3GIVB 1UWGL 2CPCA 1A7PH 3RIFK 1F4XH 2FX8L 3KWWB 1TLKA 4HUMB 4ZPVB 5D1QA 5D5MA 2DS4A 1NLBH 4ZUVB 4PJIA 3Q3GA 4HG4K 5T5NG 3QEHB 2DD8L 4R8WH 3WXVL 2R69L 3D69B 4NKQB 5AWNL 3VXRA 4R4BA 1KPRB 5CUSL 2VQUA 3LQZB 3K7UA 1A6PA 4F7PB 2GY5A 3CDFA 5ITBL 5CP7A 3V52L 2HTKD 5E2JA 4KMLB 2E7BA 2F19H 3TZVD 2JIXB 3K4AA 4CDHA 1S7WB 4GW1A 2FHCA 2XOTA 4G6MH 1UWEL 1RI8A 1FIGH 3CZJA 1FC2D 5EC1A 3OXSB 3H2WA 2MQ3A 3OKEA 3PV6B 5CZVH 4KQ3H 5DGRA 3L3OA 4DK3A 3R0MA 2PTUA 5EUOB 3X11A 3AXLA 4Q6IB 3BPCB 1M7DA 4ORGB 4ODSL 2VDMH 2P8PA 3H9SE 2YPLD 3R1GH 3L3JA 1LO5A 4JB9H 3TVMA 4PJ5E 4Y16A 3WEXA 3IYLW 4XBEL 4PJXF 2VWEE 2W91A 2WK2A 2YN5A 5ICXA 4P23A 3SGKC 7FABH 1OB1A 4JGMA 4LLUB 5HHPB 5BMFL 2Q76B 4N8VA 1U42A 2FD6L 3EYSH 3F7VA 5E5MA 4HJJH 4GBXA 3B83A 3HAEG 3MLRH 3BWAA 4DQOH 3O4LB 2A0LD 4DUXA 1WZMA 1A6AA 1UM6L 2EKJA 4HEPG 3I3EA 4WFHD 4UBDD 5IEHA 4AIXA 4N90D 4XAWH 3HCVB 2JK5B 2JTDA 1BZ9B 3M1BB 4XVTL 1IT9H 2VLRB 1TXKA 3CVIL 4GXUN 1T03L 1SQ2N 4I77L 5C0GA 3P77A 4YUEH 3MXVH 2I25N 5DD5H 5FYKL 3OKNA 3U0TB 5IT2L 4XWOD 2QTEA 1WWBX 4M48L 1DBAH 3BN9D 5TE7L 3SKOB 4HZLA 3CFEA 5LGHH 5DYOB 4HD9A 5AUMA 3QDGE 5D9SB 4ETQA 3HUJE 3TH3T 3TA3A 1QNZH 1BBJB 1JGUH 2BNRE 4RGMC 1UWXH 3E3QC 4GW5A 3QRFM 3LEYH 4XWGH 25C8H 3K80A 3GMOB 4TVPL 3JSSA 4LVOC 1OHQA 3GMPA 3UZVB 4HJ0D 5J11C 1H3VA 2Y25A 2C3GA 1DL7H 4HJGA 3B5TA 3EAKA 4DAGL 1KUMA 3LKRB 1T83A 4RX4D 1R24A 3QDGB 4LLWA 3AREC 3VMNA 3TV3L 2AKRA 2FGZA 3L3KB 1GOGA 4NM8L 2EDEA 5LCVH 1VFAA 4AENA 5I18H 4PLOB 5F1NB 5C0BB 4K7PH 4M5YH 7CGTA 1NAKH 2EZ0D 2PF6A 2C9AA 1T22A 4O2EB 2QR0A 1NKOA 3ULSA 1UXWB 5JPMA 4ZD3L 4IS6B 1J0KA 3IDNA 2OR9H 4LLYA 4F7CB 1MRFL 3L7EB 1EO8L 2PXYB 1C8PA 1S8DB 1GPOL 3FQRA 3PL6D 4JHWL 5K9KB 5HY9A 4LMQE 3WD5L 4KK8C 5FCUL 4BZ1L 3RL2B 4Y4FD 1RUML 1YN6A 4NHUB 4LASL 1SYVB 4LCCC 2COQA 3W9DB 2R29L 1MHHA 4X5WB 2MMXA 4J8RA 1S7TA 2ICEB 3BQUC 3RI5K 1GIGH 1L4IA 1UVQA 1PAMA 3JTTB 3W81A 2DF3A 5CS7A 1TETL 4L4JA 1AQDB 3P11L 4ZO9A 4MD5B 5L88H 6FABH 1IKFH 5IB3B 1D5IL 1KPUB 1NC2B 5GS1A 4UQ3B 2O26U 4UNVA 2R2EB 2O5ZH 1Q72H 4N0YH 4WJ5B 1G7LB 1Q9WA 5C92A 2E3VA 1FPTL 3CFCH 5IVXA 2B4CH 5CGMA 1NH6A 4KROD 4WWKD 1KJ2H 4DVRL 3GMNA 4FFWD 3JV6A 2ZNWA 5J7CC 1ES0A 3PIQB 5FUCC 2JCCA 3QCVH 3OKMB 1F42A 4LSRH 4XBGA 2EDLA 3VXQA 3K81A 1SVZA 1JTTA 4QXWA 5IWLC 2B4CC 3QH3B 3OKYA 2FHFA 2FEDD 5FDWB 4QXUL 3QNZA 1HKFA 3IGAB 5ITFA 2BFVL 3V6FA 4F7TB 4R7DA 3NZHL 5L2KA 4PRHA 1QLFB 1XAUA 5EN2B 4X6DA 4L3AA 4OLEA 3HPJA 4PJHB 4YHOH 2CR6A 1C5DB 4JDZA 4YHLL 1FH5H 1NFDF 3D3VE 1KLGA 5IFJB 2FJGA 1WCBA 1T6VN 2I9TB 1ZTXH 1SBBA 2HVJA 4XNXL 1CGWA 1X7QA 1HNFA 3MBEA 4EEEA 4ZFOA 5KW9H 1RZIA 2CIIB 1JCKA 5J8OA 4PJXE 1R3HA 1H3WM 3QDMB 1N59A 1MCPH 3T2NH 3T09A 2XA3A 1B0GB 4RMRA 1CFTA 3PP3K 2XYCA 3D3VB 2BSTA 4MX7A 2CUMA 1SVCP 3FN0L 2QQQA 4C4KO 1HIML 2XNAB 4PRID 2YD8A 4UV7H 2XY1A 4X0KB 5T3XL 2BRRH 4XCNB 5BZWA 2BSSB 3V6BR 4IHOA 3S97C 5D2NA 2VLJD 4D0DB 4JKWA 5EORH 4NSKB 4NQDA 4G9DA 3G08B 1RHHB 5INDB 4RAUA 1MAKA 4RMQA 4WHYH 1VEPA 2DQCH 4TOYL 1Q8MA 4JFPB 2Z31D 3ES6B 5D7SH 1XZ0B 5IGXH 3E6FA 1WGOA 4JM2D 2X4OA 2IC2A 1BFOB 3MV11 4R3SB 5DDHB 1IQDA 3RGVC 1EUTA 1Q9KB 1DJSA 4JFDE 1LO3L 4PBWD 4XP4L 2ERJC 2AJYH 4FFZL 3V4PL 3C60D 4BFIA 3MRRB 4P4KB 1FV1B 3IT8D 4WFFD 1OCWH 3DROB 2W0FA 2NY0D 1LVEA 1PYWB 1ZT4B 1PDKA 1LE5A 5SWZB 2BC4B 1TPXC 1KLFA 1DQDL 4DK6A 3IDUA 4N8VG 2VIRA 5EOCL 1E4KC 1NCCL 3IF1B 2WW8A 5BS0E 5E1AB 5IQ7L 1CTNA 4M7ZC 3VRJA 2Y7QA 5JOEA 2FH6A 5T1DH 2MCG1 1Q9OA 1I4FA 4NKOA 5I17B 1MCRA 2EIEA 3DPBA 3GKWH 3B3IA 1IAKB 5GRZA 2C1PB 1ITBB 1MJ8H 3GRWH 5DC0A 1OARL 4CN6A 2Q8AH 2V2XB 1FZMA 3W11C 4YDIL 3LB6C 4GXVH 5DRZB 5BS0B 1IGJA 1LEGA 5JA8B 2W60A 4YR6A 4YE4L 4J23A 1BECA 1JN6A 4NJ9H 4TSAH 2A1WH 1FNSH 3ZKMC 3KYAA 3ARBA 5MI0B 3F7QA 4QNPF 2R4RH 3BT2H 4G9FE 4FP8L 1J05A 1JF5A 4XC1L 5DVNA 1JPSH 3ULUH 1JF1B 3N85H 4JGUA 1DLHA 1KCRH 4ODXA 4ODVH 4FNLH 4XXCC 3V0VA 3KJ6L 3MV8A 4UT9L 1A21A 2DL2A 2D7PA 5EH1A 3SO3C 3BW9A 2H1PH 2X4RA 4OCWL 3ULUC 4Y4HB 1JGDB 3O9WB 3QHZL 3HZKB 4GAJL 4L4VA 4G9FB 4Z0BL 5IJKA 4WWID 1N5AB 4E9LA 1UCBL 4V2CB 1FN4B 3VGEA 1J11A 3HE7D 3QDJA 4NCC1 3FOMA 2K9UA 3HI1A 4NNXA 3UTPD 43C9B 1Z9LA 2AS5M 3GBLA 4OF8A 1D5ZB 3H9YA 4FQXA 1UACH 4OLXH 1ETZA 3CUPA 2JJSC 5GS3A 3SJVA 2I60L 1AI1L 1RZ8B 2OSLB 5EU4A 4D2NA 1NANI 2I5YL 3T0WA 2BJMH 2VC2L 3HZYA 3FFCB 2H26B 3EYFA 2BOCA 3BPOB 3EZJB 3SDXB 1NFDE 1QVOA 5MEND 5F9JB 3S35L 3WNNA 1FQ9C 1VGKA 5IR1B 2MHAA 2NY7L 1E6OH 1Y18A 1P4LA 4FXGA 3VDCA 3RJDA 5F44A 3LPFA 3BZFA 4N0UA 1IGYA 3EFFB 2HJFA 1DVFA 1PQZA 2DWEA 1RMFL 3ALPA 1A4KB 1PKQB 3QJHB 1DQTA 2QHRL 2VITB 3QIWD 4L8BA 4HK0B 2FATH 2XT1B 1CR9H 2VXUL 3X12A 4FFVD 5D1QD 1MCNA 4M02A 5L8JB 4HUXA 4NQEA 5C2UB 3IDIB 3RTQD 3Q6GL 3SE4C 1QFUL 1U8LB 3MLYH 2X09A 3RBSA 4AEHH 4F8QA 4XMPL 3WDJA 2ORBL 5C08A 5I1CL 3U0WH 1IARB 4YK4B 3FN3A 4HPYL 3LN5B 3WIIH 2HVKB 4HS8H 4FG6D 4Y4KD 1A0QH 2VXTL 4ONGL 3T0EB 4OGAC 1X6LA 1NGZB 4GRLD 5SWSA 4LP5A 5T1LA 3HHRB 4V1DB 4LBEA 1G9ML 1P7QD 4LSDA 3B9KD 3TC9A 4OD1L 1M6OB 2BMKB 4PRDA 4Q6IC 4HWBA 4OFYA 1RIHL 1J8HE 1BZQK 2YEZA 3UPCA 4D9LH 4RCAA 4XXDA 1N26A 5FO8A 3BEWB 4Y5YA 2UZYB 4JO3H 1T66D 4FXLA 2NY3D 4JANB 4WIQA 1U9KA 3PWNA 3PHQA 2QQLH 4NRYA 4HXAH 3BIKA 4NP4H 2VL5A 4U1JA 5FFLA 3S88L 3SPVB 4QY8B 2FEEI 2LTQC 2NW3A 3BZEA 3PNWB 3UC0H 1NC4B 5KAQF 2J8UA 1S9WA 4OGYL 4JFXA 1X4ZA 3FOLA 3QAZB 1J8HB 4G3YH 1MWAH 1ZOXA 3GK8H 4P23D 5ALCL 4GRWF 4U3CA 4ONHA 4NO0D 1QA9B 5DD0L 4PG9B 2XWTA 4S1DD 2CJUL 4NPYA 3KS0H 2VUYA 1T0NA 4UTBH 3FRUA 1H3PL 4DN4H 1IEBB 2VWEC 3KNBA 3IDGB 2GJ6D 1NGWA 1RIVH 1V7MH 2VL4A 1RFDL 5EU6E 2EEBA 5D93B 3PWLB 5LQBH 1X5AA 2ATPA 1PFCA 3T65B 3WIFA 1U58A 2KQNA 4I8DA 2XWJA 5LG1A 1BM3H 3MQIA 4N8CH 3FO0L 1ZHKA 4BSVA 2GTZA 1CZ8L 1ZWIA 2ZCHL 1W8NA 4MXVF 1ONQB 1KJMA 3WXWL 3IXAB 2A9NL 3EYQD 3GSOB 4JY6A 3DYPA 5EU6B 3UTQA 1IKNC 1QQDA 2K3TA 2H2PC 4LCIL 3NIDF 3ESVF 2HA1A 3UYRH 2AK4A 2IMNA 4Z95L 1OAQH 1W72A 5DF0A 1UQSA 4ENEC 1U95B 1K3IA 4HT1L 5E8NB 5CZKA 3GMQA 1E27B 1OP5K 1DQLH 2UZXB 5JQHC 4JPWH 5DRXB 1UH4A 1CXLA 3P4OB 1JP5A 1WZKA 1DQQB 2DMKA 5A2IH 3N9GH 4Y1AA 1MFAH 4R7NB 4ODHH 3U6RB 5DJCB 4NC0B 5HGHB 2B0SH 4M7JH 4PREA 5IB4B 2FEEL 1X9QA 3V9FA 1EA9C 3TBWA 1YYMH 2J6EA 2YD1A 3SY0B 2D31B 4NFDA 4B50A 2OR8A 2UUDK 3VXNB 4UNTA 3W2DL 1DBKL 4L9LA 3HNSH 1N6QL 1BQHA 4NGHH 3VXMD 2IFGA 5F93C 1T1ZA 2ZCLH 4LRNH 2CIKB 5F7DA 4K7PY 5ALBH 4KRPB 5C07D 4ZPTA 1BJ1H 3LV3B 4RISH 3MNZB 3ZYJA 2VO5A 2IPTL 5CFHA 3L5JA 3U7WL 3IFPA 4Z7VA 2HJKA 5DURD 5FV1L 2V9QA 5TE4L 3RVUD 1FNAA 3M8OH 4GMTH 4NQTA 2VUOA 5DZLA 2ADGB 1VEOA 2UVEA 1RUAL 3V4VH 5HVHB 4MAYB 3C6SA 2GSGB 4JPIB 1E6JL 2ADFH 1IAII 2DJUA 5A3ID 4HUVA 3K74B 5I19H 1EHLL 5F96L 1J0IA 4R96B 2HAZA 1KCVH 2CK0H 3DVNB 3I50H 5I30L 5A40E 1AD9B 4JJ5A 4C56E 1OD9A 5D96B 1N64H 2NY4D 2E6PA 4Z7WE 4X6CB 3UTSB 1SYSB 2ESVA 2NCMA 1KELL 2CD0A 4GQPH 2RBLA 5E95B 4EDWL 4G80B 5IB1B 1F58H 3K8LA 5IBTL 1MLBB 5TQ0H 3DV4B 5D2LF 3HMXL 5EZOH 3OKOA 1F5WA 4BZYA 1DBML 1UYWL 4G43A 1CFSA 5GGQH 4LCUA 2X4SA 4DWHA 2BSRB 2AXFB 3D48R 4IDJL 5C0AD 2XICA 1ZVYA 4ZFFA 4YHPA 3KLHC 3NCJL 4JZOB 1MHEA 1LNUB 2FIRT 4OZIE 1QKZH 4KJYA 3ECBB 3MYJB 4FS0A 5FIEA 3QUXB 5HHQB 3SGKA 4HIJA 3BDBA 5HPMA 1DSFH 1D6EA 1ACYH 3MV9A 4XCEB 4MNGE 2HRPH 2FCBA 3BRFA 1V7NH 1PG7W 2HTLC 3BKCH 5ID1A 3G04B 1IC5H 1FO0B 2P4AB 4GRWE 4G8EB 5DQJB 1XMWA 4P5TD 1J7VR 5C0NC 4I18B 4OM1H 1WC7A 3FAWA 3VE0B 1OD7A 4LKCB 3D85B 1HH9A 1IAIL 4X4YB 1LHZA 1RZJH 3U30B 5JW4N 5C0CD 2P5EE 2EYRB 5IBUB 1B88A 4E5XA 1F4AA 1C7SA 4K8RH 2DYPD 2K7PA 5CMAA 3ELAT 1CLOH 3P0GB 1A6UL 4LHUG 2HFGH 3FTGB 1KENH 2VLLA 4H25B 2MPAL 1J0HA 1MJUL 4K8RC 1GL4B 4M7LL 4GLRI 1EMTH 4DGIH 4M1CD 4MXVE 1U8QB 2N7AA 2OL3B 3OKDA 5T3ZL 3DETC 4HKJA 3PQYE 1OP5H 1CFQB 5IROC 4K3HA 4AL8H 3FCTB 4JRWA 3ZTNL 1CN4A 1YN7A 35C8H 2X9WA 4HFWA 4P4KC 3DUUA 3FO1B 3NIDE 1AY1H 2Q7YB 4A6YL 4U1KA 4I3RL 2Q8BL 3MGOB 2IALA 3WUZA 4DUWA 3TFKD 1V8HA 3STZB 5HI4D 3AREA 4PJFA 1EVUA 2X4QA 3HPLA 3KPQA 1HINH 3SDAD 3WFHA 1FYTD 3K2UL 1MIML 2W9DH 4X7SL 5JIIA 3H7BB 3PQYB 4CAGA 2UUDH 2VZSA 1I1FB 3KJ4B 3EYUH 3AU1A 5F6IC 1TNNA 5EOCJ 1WIOA 3NMEA 4WHTA 5EA0H 3J8F7 1TVHB 1A6VH 1Z0MA 5JTWA 4PRBB 4TPRL 3KPNB 1T21B 5FGCE 3ZE0F 1WBZB 4W81A 3MNWB 3QXAB 3NFNA 3QBTB 5C8JB 2Z4QB 4N5EC 5DJXA 4J6RL 1G9EA 1A6WH 3HC4H 3OGOE 3PJSA 3ROLA 3TNNA 3O6KH 5DJDA 5GRJL 2CMRL 4PJ8B 3HZVA 4UIKH 1OTUC 4LCCA 3RUGE 5L9DL 2PO6D 4LEOA 1A7OL 3BQUA 2Q20A 2JJTC 1AKJD 4GSDH 3QG6A 5HVWA 1CQKA 3PHOA 1CG9A 4LCWE 4ELMA 5HYFA 4YDKL 2BVUA 1AO7A 1VACA 3P30L 1KB5H 4JLRA 2EE2A 3DIFB 4OZHA 4L29B 4WO4D 4FQ2H 4XB7A 2HT2D 4Y4HC 5CEXB 2HKHH 4JFZL 4LPTA 3O9WC 4JVPA 1OAXL 3C6LD 4X8XA 4GKZB 4GQ9L 4H88L 5DQDL 1S7VA 3F8UB 4D9QE 2Y07H 3O2DH 1LEIB 3Q1SH 4MD0B 3T4YB 3SGEH 3EYOA 5IBLC 3TIDB 4YEEA 1YQ2A 3G5ZB 1HZHL 3HG1B 4K23H 3U36A 4F37K 5IWLA 3VDBA 5E08H 4LQFL 4MA3A 3IVKA 4O51A 3GI8H 5M7QA 2AEIT 2XACC 4P5KA 4JZNB 4APQC 5D2LE 1ZANH 1FORH 4NCC2 1BQHG 1R5IA 2IJ0C 3NFSH 5KJRH 1QACA 3FB8B 1LWRA 1KFAH 2Z9TA 4JY4A 3S4SA 1EHNA 5JOPD 3QPXL 3DRQB 2EH7L 3QCUH 1ZVSA 2A77L 4YWGL 1JFQL 3PDGA 2PYEB 4L3ED 3O8XD 4NQCD 3EFDL 4YNYA 1KT2A 5D2LB 4P5MB 4EI6B 5CJ8A 1O5DT 4GAGL 2AV7B 1S7UA 3QEUB 2VDLL 3EJYC 3G5VA 3QUMH 4P2RB 5KS9F 4HQQH 4RGNE 3BP6B 1MCHA 2YWZA 3DXAD 4WV1C 4WDIA 3L7FA 1QYGH 4G6JH 2VERN 4CU8A 2UZIL 4YHNA 2IGFL 2X4UA 3UBXB 2X7LB 1PZ5B 2YZ1A 4YK4C 3KYKL 4XCYB 1QSEA 2WINB 4G8IB 4MJIB 3LEVL 4CJ1A 5C6PB 3RWHB 2VE6A 3HNTH 2V2WB 1XCQA 5L6YH 2YUXA 3CFDA 5HHXH 1X5GA 1AFVH 2QL1A 2ZUSA 1NCTA 4DN3H 3D39E 1EJOH 3DBXB 2BERA 3SKNA 4OLVH 1EIBA 1OQXA 1E4WL 4LPXA 4JFHD 4D9RD 1H9VA 1CE6B 1X6NA 3LDBC 4LHUD 5HHOA 3LKPA 3VXUE 2YBRB 1J5OL 2QHLA 5BRZD 1MEXH 3FB5B 1GCFA 4HUUB 3EGSB 3RGVA 5IB2A 1MELA 1IGMH 2EIBA 2ZPKL 5F8RC 3WFBH 1BD2E 4K3JH 4LSTH 3MRHA 3SDDC 1H8OA 2Y36H 4I0PD 4LSVH 2JJVA 4HV8A 3BXNA 3VXUB 2UV3A 3WSQH 4MDJA 5FHAL 4RFNB 2J88L 4C57C 3ZKNC 4RFOL 3MBXL 3I02B 4EDXB 4ZO7A 1GOFA 5JR1H 4JM4H 3H9ZA 1T20A 5ISZD 4PRPD 2Q1EA 1XIWB 2APWA 4KKLC 1NBVH 2NY5H 3FT4A 1ZLVK 1P7KB 1YC7A 3P0YH 3SCMB 1FGNH 1G9NL 2F53A 1F3DJ 2KDGA 1RJYA 3ZE0E 4YX2L 3QRGL 4Z7OE 1IC7H 4OGZA 2NY5C 1C12A 2DIJA 5IV2B 2ADIA 3TBTA 2VQTA 1UA6H 3GRWA 1P4IL 4U1MB 4UDUA 1E4XI 3O11A 1P69B 4RA3A 1F4YL 1U8HA 4I2XA 5EZIH 2UWEA 4YFEA 2DWDB 4YQXH 4R2GC 2P5WB 4J2XA 2F54B 3G6JE 2UY6A 5D7JA 1YY8B 2EIZA 2B5IB 5DVMA 3RY5A 1S9XA 4NZTH 2Q6WA 5HDQH 5L2JA 1Q9LB 2IWGA 4ISVA 4KTEH 2VR9A 5F71A 3QXDB 5GSRA 4QXTA 3FB7A 1R5VB 3CC5A 5E9DA 4WU5A 2HT4C 5HVFB 1CF8L 1NDGA 1CL7I 4PJEA 3TGXA 3UTOA 3I9GH 1FSKB 3OJDB 3WFCH 1A6TB 2VXQH 1QFWI 1MFDL 4RMVA 4RWYH 4R4NC 1S5HA 1BZ7B 1X5IA 4EI5A 8FABB 1JL8A 1NPUA 4WFGD 2CLRA 5EBWA 4ZAKC 2VZ3A 1T3FA 2B20A 3NN8B 4KRPC 4TQEL 4NO2A 1E28B 4L8CB 1GZPB 4K3DL 4Y0GA 1QR1A 1TQCB 3JVGA 4DKDC 3EJJX 5FYJU 4L1HA 5ADPL 2IH1A 3ARUA 5JIPA 2DLGA 3KPOB 4ONFL 3VJ6B 1UCTA 3OJ2C 3GIVA 1A2YB 2HN7A 4U7KA 3KWWA 5B8CC 4ZPVA 4MAYC 4X4XA 3ZHKA 4ZUVA 1D6VL 1E4XL 5IESL 1BGXH 1O7VA 3QWOA 3QEHA 4F2MB 4WGVB 2AEPL 3D69A 1HN1A 1DBBH 3WNKA 1T04B 1C5BH 3EHBD 3QI9B 1KPRA 1CWVA 1G0DA 4F7PA 5D96C 3SE4A 1N4XL 3BEVB 4CUCA 5DMKB 3GO1H 4JFED 3RNKB 1LK3H 1HWHB 3LRSB 3I2CH 3P40A 4I9WE 2CDGB 3QUKB 1S7WA 2HT3C 4PLKD 2ZG2A 3SE9H 2VOTA 2A38A 3A6CL 1X5LA 4KK5C 3OXSA 4X7EC 3B9VA 5GGTH 4M6NH 3O2WH 5FO7A 4JFFD 5ETUA 1KACB 2VN7A 3PV6A 4O9HH 3U2SB 5BOPA 5CSZA 3DVFA 5KS9B 1WZ1L 4IRZH 4RIRB 1CL7L 2GUOB 5EUOA 3KXFB 1CVSC 1S9YA 4Q6IA 1QD0A 1GGBH 5I16B 4ORGA 2DQIH 3DGGA 3QA3B 5GGVH 3RZCB 1I7TB 4FQCL 1QFWL 3VDAA 3S4SG 3GJFB 2J5LB 5T5NF 4MQTB 4QRRE 3ARDC 1NAMH 4PFEA 4I4WB 2EXYC 1I1CA 2HP4A 3HRPA 2YUZA 1PZUB 1A9BB 4MVBD 4LEXL 5BVPH 4KTDL 5HHPA 1TCRB 2Q76A 4WNQB 4Y7MA 3KYMB 1L9NA 1ZLVH 1SBSH 4N9GB 4Z7UB 4YO0A 2EC8A 2OJZL 3O4LA 5CJOH 3WO3B 5DA0B 1F6AB 1MCEA 9CGTA 1MWAA 4G8GE 3C09B 1YEFL 2AJSL 2BNUB 4GRWH 1BZ9A 3M1BA 3GM0A 2VLRA 3N50A 1RPQA 4TSCL 3OZ9H 1BLNB 2YPLE 1WWAX 1SJEB 2P46B 4LAQL 4G6KL 3ILPA 3U0TA 3MV7D 3O4OB 5DMIH 5IF0B 5HYQB 1AH1A 3DSNA 4ZUUB 5DYOA 1OLZA 5D9SA 3DURB 1NDMB 3V7AG 5DVLA 1BBJA 3ZO0A 1YNKH 1IKNA 3JXAA 1Q0XL 1UJ3C 4JO2H 4OAWB 32C2B 5DLML 3VWKD 3GMOA 5LAXB 2KUTA 1BJMA 1ND0B 4GMSH 1CDBA 3CJJA 5DQ9B 4U1IA 1QG3A 2ZUTA 1PD6A 4WFHE 3LKRA 4F9PC 3QUYD 4N90E 4HIXL 3QDGA 5I76B 2BNRA 4DFHA 1EEZB 3L3KA 1A8JH 1FLRL 3UJIL 4HWUA 1AGEB 3VD5A 3MRBB 5C0BA 1HQ4B 2IFFH 3C5ZC 4M7KH 5K59F 4JAMA 4MSWA 1KIUA 3RDTD 4O2EA 4JRYB 3V2AR 1YYLL 2Z0BA 4GOSA 4IS6A 4JM2F 5JHDE 3K46A 1A7QL 1FZKB 4RBPK 3K3QA 1SEBB 4H20L 4F7CA 3ZHDA 4G6AC 3L7EA 2PXYA 3SKUD 4EQ3A 1S8DA 5K9KA 2BVOB 5T5FL 4ZXBB 2DMCA 4N0CC 4NHUA 1N0LA 4OI9A 3D18B 3LMJL 4X5WA 2R39A 4DTGL 2ICEA 1OLLA 3GFUA 3LIZH 3MX0A 3IDJB 3JTTA 2YS4A 1AQDA 3D6GA 5I1JL 4N9OB 1JZ8A 3VFVB 3L5XH 5KVGL 3KPSD 4MD5A 2P1YA 3MRDB 4M9OA 5IB3A 1P6AB 1ZKAA 4S1RL 1KPUA 5EO9B 3MRFB 4LKXB 1HKLL 1GH7A 3LN4A 4UQ3A 2DQHL 2R2EA 4WJ5A 2R0KH 3GUTB 5J6HB 1G7LA 4QRPE 1ZEAL 1YNLL 3DMMB 1C5CH 1CICD 2R15A 1ADQH 1WLHA 3PIQA 5F9OH 3V5HA 3STLA 3OKMA 1INDL 5I1IH 3FONB 1CLYL 5ID0B 4Y5VB 3QH3A 1PSKL 1GVIA 3BI9X 5FEBA 1A9EB 3B8SA 4MD4B 1JZ4A 3EO1B 4R4FL 4F7TA 1BEYH 1H5BC 1FYHB 1KLUB 2XQBL 3BP4B 3T1WA 3HC0B 2BP3A 2QQKH 4PJHA 1C5DA 3A6BH 1UENA 1DFBH 2IBZY 3VG0L 3G9AB 3CMOL 3VFNB 4XTRC 5IFJA 1NCAH 3PL6B 4JQXC 1JNNH 3WNLA 1JI1A 5J3HC 1A5FH 1HCFX 4IRSC 4Y4FB 2A6KB 3F7YB 4JDTH 1XH3B 1MCQA 4PJGF 4P2QD 1CU4H 1IEAB 3QDMA 2ZOLA 1LD9B 4L4TD 3WNMA 1B0GA 4X6EB 4O02L 2VISB 4XPGH 4UNUA 3D3VA 3TYGH 1BFVH 1U2CA 3UTZB 4NKDA 4GW4B 5C09D 4HCRH 5GS0H 2O5XH 2XNAA 5IFHH 4L5FL 4X0KA 2D7OA 1UC6A 1YY9C 5MP6L 1FNEA 2XV6B 3IKCB 4ZG1A 4XCNA 5GRXG 1WWWX 2X44D 4KROB 4WWKB 3H42L 2BSSA 4OB5H 2D0FA 1MCLA 5CEYB 3MGAA 5GS0C 5CBAB 1VFOA 4D0DA 3P4NB 5HYJD 3EOYG 5DEGB 4NSKA 1XF4B 4FA8A 3G08A 4RGNC 1RHHA 5GPRA 5INDA 3F6IA 3N1FC 2FX7H 3EIFA 3SGDH 3IU3A 2ZKHL 3ES6A 1R3JA 1XZ0A 2C3VB 4NFBA 3BKMH 4F3FB 4HHAB 1BFOA 4R3SA 5DDHA 5K9JL 4F80A 4Q9BA 2UY7A 3SEPA 3OB0K 1Q9KA 3OR7B 2R8SL 1MQ8A 4PJIF 4L3CB 3VI4F 3WBDA 2WSKA 4AEFA 1JZ3A 5ESAB 1F8TH 4MA7H 3MRRA 4P4KA 1FV1A 4PRIE 3DROA 5CCKH 1MCOL 4HF5H 2HFFB 2QV2A 1ZT4A 4POUB 2BC4A 3B6SB 2AQ3A 1I9RH 1L0QA 2VLJE 1H8SA 1GAFH 2GEEA 4FTVD 5E1AA 2X5PA 3HR5B 1QLRB 1DR9A 2VLMD 4RBPH 3QIUB 5TDOA 2CXGA 3HNVH 1NCWH 1D3CA 3GI9H 3ZT6A 5K59E 1IAKA 4J1UA 3MUGB 3B5HA 4OLWL 3SCMC 1WTGT 1FGVL 4CADB 2V2XA 2BVQB 4B0MM 5BS0A 1RUQL 1N0XH 1FZJA 4JY5H 3DUHA 3NFPB 1SY6A 4WFFE 6CGTA 5I2IB 2Z31B 5IHLB 2ED8A 2DQJL 5CGYD 2JJTA 3QHFL 3UROR 4DCQB 2ICWJ 4Z8FL 4DJMA 2MKWA 1KSRA 1XEDA 1FFNB 1BPVA 3RVTD 1KYOK 1DZBA 5D71L 5D7JD 1JGVH 2CUIA 3DI3B 3D25B 3MA9H 4Y4HA 1FNGB 4PJ7F 1JGDA 5H37G 1Q94B 5HJ3B 3O9WA 3HZKA 2NY0B 1TITA 4G9FA 2QSCL 3WMSA 2EECA 2ICCA 1N5AA 1GGCL 3TO4D 1FN4A 5TH2B 2IH3B 4NRZB 1BBDL 1F90L 3U4BH 2OTWB 43C9A 1JK8B 1HEZB 5D72L 5TF1H 3O2DA 4DKFL 3SDYH 2R0ZL 4FQIH 2Q86B 4POZC 4UINH 2ZSVB 2OLDA 4PP1D 1RZ8A 2OSLA 4R0LC 5B39B 4W6WB 3FFCA 4XPBH 2H26A 5DUPL 1TQCC 1KJ3L 5TFSH 4WRLA 3REWB 4FMKA 4M1GH 3DSFH 1KIPB 5IR1A 5TE6L 3EDEA 4XP5H 1SM3L 1MQKH 3DRTB 3MODH 3F62A 1JV5B 3TIEB 4X7DC 5BJTB 3O0RL 5GJTH 5AG8A 1LGVA 1JHTA 4PJGE 4QHMA 5JIHA 5K9OB 3EFFA 4PTTB 1RULL 4WW2F 4YHIA 4URTB 1X5FA 1A4KA 3QJHA 1KULA 2VITA 1ZHBB 4CN1A 4HK0A 2OYPA 4O4YL 2FX9H 4Z5RB 2CKBL 4LIQL 1OL0A 2DQDH 1BJ8A 3JUZA 4WV1A 1EO5A 3HE6D 4OCXL 1NFDA 4YIQA 3T08A 3RX5A 2BXYA 1KIQA 3QI9C 5DHVB 1MFEH 3L3DB 1VPOH 2FSEB 3ZL4H 5CHNB 4M62H 1HXMB 2HVKA 2AGJH 3BD3A 3ARPA 5J0BA 3T0EA 4I3SL 2JIXD 4LSSL 3IAGC 3HE7B 2BOBA 1INEL 1NGZA 5CIPH 3IRZA 3WFZA 4V1DA 5AD0B 1J1PH 1QBAA 4S1SH 5LGKA 1PBYA 3ZSTA 3OB0H 4JO1L 1M6OA 2BMKA 4EXPX 2H9GB 1A14L 1CVRA 5F3HB 2F8VA 4OKVB 1PX4A 4HFUH 5DJAB 3O6MH 4XVUD 4ZUSB 2IPKB 4JANA 1J8KA 2ZCKH 5MENB 4OKDA 4PJIE 5T33L 3SDDA 3C5JB 3BJLA 1WV7T 4ZQKB 1NJ9A 3WIHA 1OGTB 2LU3A 4QY8A 3SPVA 2PW1B 4HBCH 4HKZA 5E8OB 5IVXF 1XGUB 1B3JA 4A6YB 4KUCD 4NDMB 4IIQB 3UCRA 5FYJD 1J8HA 5GGVY 2ED9A 3ZT5A 4MAUL 3CGTA 3NH7L 1A4JB 1B4JL 4WI7A 1EGJL 1QA9A 4YDLB 2V5YA 5E8PB 4MCYB 2DKUA 4NKMB 5DEFA 4KXZI 1IEBA 4PY7B 5FA4A 2CK2A 1MREL 3IDGA 2GK2A 4TTDD 3RTQB 5JW4Q 3TZVC 4YHMH 4M6MH 4MZ2A 1UEYA 3P9MB 1MI5D 5C0IB 4D3CH 3G5XB 3R0NA 1V5JA 2D4DA 3O4OC 3BE1L 4GRLB 1K5NB 4U1GB 4YHZL 1KCUL 4Y19D 4YXKH 1ONQA 1P7QB 5JNYB 3IXAA 2ZNXA 3GSOA 1XCTA 5EU6A 2BXZA 3OHXB 4MA8H 4DW2H 1UM5L 5H94B 3X13A 1CBVH 2V7HB 4GKSB 1X5YA 4LL9A 3PUCA 5D8JL 1NUNB 3TO2A 3ZKQD 2AAVA 2D2OA 4KKCC 1LO2L 1U91A 5E8NA 1E27A 2OTUB 4Q9QH 1KTKE 5CINH 2GJ6E 5DRXA 3OPZH 4JN2B 5B21A 4P46B 3P4OA 5GRUH 4LHJB 2OXGA 4PJ7E 5IW6B 4TUJB 3HC3L 3MUY1 1NCBL 4M43L 5DFVD 4IMLB 4R7NA 2VB5A 5F8QC 5DJCA 2FB4H 4KHXH 5HGHA 4MXWL 2NYYD 5D1ZC 4NO0B 3GSUB 3VCLB 4ZNEA 5JIKA 3MJ9H 1A6ZA 3SY0A 5CLWA 4W4NA 5D7LD 1VGEL 5DUMH 3VXNA 2GJ6B 4UBDC 3RA7L 3ULVD 4F7MB 5BO1L 4P59L 1OPGH 4ZAKA 4K94L 3WJJC 2CIKA 2Y6SD 1RUKH 3IFOB 4FN0A 4ZFGH 1CGSH 3MRQB 3S8WA 3R8BB 3U9PH 3LV3A 1KCLA 4FABL 3KR3L 4WY7H 3V4UL 4F33B 3BN9C 3AC0A 3H7LA 3WV0A 1U2HA 4WTWA 4RWHA 2ENSA 4XZUA 1YQVL 1MIEL 4YAQA 3BISA 2ADGA 4OQTL 1NKRA 3NCFB 2DTMH 5CEZD 4Y89A 4MAYA 1JWUB 4JPIA 1P5VA 4IDLA 3MJ7B 2YUWA 1T2QL 3PDOB 3X17A 3GNML 1I9IH 3K0WA 5KVMC 2D03H 3CXHK 3P73B 1PLGH 5KG9B 4M4PA 5L8LB 1NC2D 5FB8A 3DUSB 4U6XA 2EYSB 3QWRA 4QWWD 2X42A 3RVXC 1CDHA 2Z8RA 2VJXA 4X6CA 4X6BB 2EH8H 3VXME 2A73A 4KI5F 5KSUB 5IVNA 3I3BA 1MF2L 1FVCB 3BVNB 3L3HB 5C07E 4WW2B 1XF5B 5IB1A 2NY1B 5L0QC 2CR3A 4R97C 1DLFL 1F00I 3WJLC 1WK0A 5AZEL 3B2UD 4C56A 5IHBA 1QOKA 4XP6L 4YZFF 3EZ8A 2W0KA 5GGTA 4KY1L 1OAKH 3PL6C 3RWGB 4O2FB 4NJAH 3SDCD 1H8NA 4HPOL 4Y4FC 3DJ9A 3ARDA 1G6RL 1KJVB 1CD9B 1LNUA 2H6PB 3E2HB 5D4QA 3ECBA 5DURB 2DM3A 3E8UH 1BHGA 3BYYA 5IFAH 4UU9B 5HHQA 3MRMB 1YEKL 2CGRH 1RZKH 2IQAB 4FXKB 4OIBA 4X80L 4XCEA 5IVXE 4XI5D 5FUZL 1NAMA 3LQAL 4LLVB 3TCXA 4U1LB 3MOAL 1FO0A 5DQJA 5DD6B 2RFXB 1XT5A 1RZKC 4FMFA 4U1HB 1H3TA 3VE0A 4LKCA 3D85A 4X4YA 2CH8A 4RMWA 4WWKC 2R9HD 1OAZH 2NY4B 4FQHA 2APBA 3LS5H 4KUZL 2I07B 4YBHA 2EYRA 4ESKA 5C0AE 1CXHA 4Q74A 4OF7A 5E8EA 1MY5A 3O2VH 2C3WA 5HHMD 3MLPA 1IAMA 4UDTB 2YA2A 3FTGA 2IAND 4H25A 4HS3A 2FEDC 2WBJD 1HHJA 4IM8A 4X5LA 2PCPA 4OIIH 4DGYH 2D7MA 1TTUA 3PDDA 4YH6A 1U8QA 2OL3A 3VA6A 3VXSD 1EEYA 3DO3A 1CFQA 5C0AB 3HFMH 3S34H 1GOHA 2GK0B 3EBAA 2YXMA 4NUGL 4ODWB 2Q7YA 3FO1A 4M5ZL 3GMRB 4M8QB 3MGOA 2ID5A 2PETA 3QSKB 4F9PA 2EC9T 3STZA 4JN1H 3BSZH 3MLSH 5JW4R 5H35B 4KFZC 2AQ1A 5LGJA 2BY2A 5SWZD 3H7BA 3PQYA 2DDQL 1B9ZA 1I1FA 3C5ZA 5D2NE 1MSPA 3CU1A 3VXPB 3ILQD 3G6DL 2YK1H 1TVHA 1T0MB 2IAMB 3NA9H 4PRBA 3KPNA 1T21A 5DJYA 3VFGL 5BZDB 1CTOA 3KPPB 4UOW1 1CDCA 4CL7A 3G6AB 5C0CB 4MLIA 3QXAA 2YKLL 5I8OL 3MUZ1 4UV4L 5JUEL 2DYPB 2RCSL 4ERSH 1OM3H 3SKMA 2EDKA 4W68A 5I75B 2AJVH 4PJ8A 2FRGP 3MRGB 3O81A 5JQ6H 4BJLA 1MCSA 4KGJA 2Z31C 1G1YA 4GRMB 5E4EC 5J12B 2M8XA 3CXDL 1TIUA 2CLZB 4NKIL 5MEQB 3TT3H 3MRPB 3WE6B 2J8UF 3D0VB 4JM2C 3CVHH 5C70A 1J0ZA 3ZYZA 1P2CB 2NZ9C 3JUYA 1FYTE 1IM3B 1MCJA 4KI1A 1T89A 4OBRA 5DT1L 2WUBH 4ZOEA 5I1LA 3DIFA 5T1KB 3C60C 4L29A 3F7PC 2VRAA 1S5IL 2FBJL 2VXVL 4ZDHB 4BFEA 5CEXA 3IFNL 5FYJL 4ZYKB 2NY0C 4GKZA 4ZS7L 3C8KB 15C8H 4G7VL 2NX5D 1ZSDB 2JE8A 5EFIB 1AXTL 2XZCL 3QIBC 4YFLI 5J1TC 4MNHA 3I84A 4NZRL 4LLQB 4MD0A 3T4YA 1I8MB 4KZEL 3SDAB 3TIDA 3G5ZA 1FYTB 3HG1A 1G0YR 2GY7B 4KI5E 2O5YH 2ARJB 4CW1B 5ILTH 4YDVB 2ITCB 5FYKU 5DFTA 1ADQA 1MY7A 4QXGL 4JKPH 3AUVA 5F7WC 3BGFC 4JZNA 2BRQA 2APVA 4LLDB 3H8NA 3SQOL 1MOEA 4ZSOE 4YZFE 4JQXA 2DL9A 1P9MC 4KMTH 4OSUH 5EZJB 3DRQA 4WEBL 1QPPA 1BAFL 2AJUH 1UADC 4JQVC 3VWJC 3WS6C 3MV8E 1CK0L 2PYEA 4LFHG 4S11A 4EI6A 5D2LA 4P5MA 1AKJB 2AV7A 4XGZB 1CFVH 4JVWA 5E2WH 3QEUA 1LO4H 5AZ2H 3LH2H 5EULV 4L4VE 4P2RA 5E99H 3T04D 1U3HC 4ZSOB 2JELH 3F5WB 1R0AH 1UKSA 4QCIA 2VLKD 1JNHB 2H2SD 4G5ZL 4XVJH 2MJWA 5CILH 5ESVB 3DVGA 3UBXA 1QBLL 3OGCB 4PJDF 2X7LA 1YEIH 1PZ5A 3C6LB 3WNOA 2JLLA 3O3DB 4XCYA 2WINA 5EZLB 4G8IA 4UT6H 3QEQD 1NCDL 1T1WB 2X4NA 5AEAA 3D0LB 1MRDL 5JXEA 3RWHA 3SJVE 1BOGB 2V2WA 5JOPE 2AABL 3HE7C 4Q97A 4U1NA 4FZ8L 1YPZF 1XGPB 3MZGB 1MJUH 2DAVA 4GG8B 2UYLB 1XGTA 4OQ1A 1NMBH 4L3EE 1CE6A 2XN9D 1L7TH 2YBRA 3CFBB 1C16B 1FAIL 1YEHL 4JRXD 4HUUA 3EGSA 2AI0L 4NHCH 4KQ4H 5CZXD 4NN7B 2XZAH 1OW0C 3AAZB 3V0WH 5CBEB 4PJ9D 1T5WB 3PGDB 5CEZL 2VDNH 4KV5F 1TZHA 3O8XB 1JHLL 3VXUA 4OM0L 1ZA6B 4NQCB 4HAFA 3AM8C 1JUFB 1NMAL 1CFNB 3M45A 3QPQD 4K2UH 4AG4L 1NC4D 3QIWC 3NTCL 4EDXA 2FHBA 4XVSL 3M17B 4FFVC 2QQNH 3DXAB 5D1QC 1HDMB 3E1F1 1BD2A 3BH8B 2V7NA 1XIWA 3RTQC 1M7XA 4JFHE 4D9RE 1K85A 1P7KA 5DD3L 2DLEA 1A3LL 3SCMA 5BQ7A 5C0RH 3ZE1F 3UTTD 5BRZE 1YEEH 1CDUA 1KN4H 2E8ZA 3BHBA 4FG6C 4TUKL 4TRPL 2QADD 1W0WA 4Y4KC 8CGTA 5KAQG 3TJHD 2WWMD 1TJGH 1MAJA 4WI3A 5IV2A 4X98B 4GRLC 5KN5B 3C2SA 1FP5A 4U1MA 1BMGA 5E8DL 3B9KC 1ZHNB 4ZFOL 2DWDA 2F58L 3BKJH 3WFEL 4X6FB