4LMJA

Glic liganded-closed-channel conformation, mutant t25'a
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKAPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Gating of the proton-gated ion channel from Gloeobacter violaceus at pH 4 as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 86
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4lmjA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4lmjA01
3UUBA 2XQAA 2XYSA 3U8JA 4IL4A 5AFMA 3UU4A 3TLVA 3U8KA 3EAMA 5HEGA 4TWDA 4IREA 2XQ6A 4QH5A 5J0ZA 2XNUA 4UY2A 5SYOA 3SQ9A 5CFBA 2BG9A 4LMJA 2LKHA 3ZDGA 4LMLA 4A97A 5IUXA 4UXUA 2BYQA 5BW2A 5AFMB 2WNCA 4ZR6A 2BYNA 2WZYA 4IL9A 3TLTA 2LLYA 5HEUA 4X5TA 2VL0A 2YOEA 2XYTA 3WTHA 5LG3A 3C84A 4DBMA 3TLSA 4ZK1A 3UU5A 3WTJA 5L47A 4QH1A 5J5HA 4Z91A 2PH9A 2BG9E 3TLUA 3P4WA 2XQ9A 4Z90A 5HEOA 2Y58A 2ZJVA 2KSRA 5AFNA 3JAEA 5LXBA 3IGQA 4TWHA 2BR7A 2WN9A 4HFHA 4QAAA 4XHEA 3PEOA 2XQ8A 4EZ1A 4BFQA 5HEJA 4ZRUA 4AFHA 2XQ5A 3U8MA 3WTKA 4ALXA 4ILBA 4ILAA 3RQUA 2BYRA 1UX2A 2XNVA 2Y57A 4UM1A 4XK9A 5J5IA 2Y54A 3SH1A 4ZJTA 3U8NA 3WTLA 4QACA 4HFIA 5J5FA 4FRRA 5FJVA 4HFDA 5HEHA 2BG9C 4WV9A 2BYSA 2BG9B 2YN6A 5BP0A 3SQ6A 4A98A 1OEDA 4PIRA 2C9TA 2UZ6A 2W8GA 3EI0A 2WNLA 3C79A 4HFBA 4NPPA 4ZZCA 3P50A 3UQ7A 4F8HA 5J5GA 4NZBA 3ZKRA 3SIOA 5KE4A 3RHWA 4ZK4A 1I9BA 2X00D 3GUAA 3WTMA 2XZ5A 4COFA 2BR8A 3PMZA 3WTIA 2PGZA 2W8FA 4B5DA 4LMKA 2Y56A 4QH4A 3UU8A 4AFGA 2M6BA 4UM3S 4TWFA 4ZZBA 2XNTA 3RQWA 5TVCA 4QABA 4TNVA 2M6IA 2XZ6A 3RIFA 3WIPA 2BYPA 3WTNA 2ZJUA 5AFHA 1UW6A 4BQTA 4HFCA 2WNJA 5L4EA 4AFTA 3JADA 3LSVA 4HFEA 2YMDA 2YMEA 2XQ3A 4UM3A 5HCJA 3UU6A 5CO5A 3RIAA 2LM2A 2XQ4A 4HQPA 4UM3P 5AINA 5BRXA 4ILCA 5HCMA 2XQ7A 5AFKA 2YKSA 3UQ4A 2LKGA 2QC1B 3WTOA 3ZDHA 3U8LA 3T4MA 1OEDC 5L4HA 4D01A 5AFLA 4ZJSA 5AFJA 3RI5A 1OEDB 2Y7YA 2MAWA 3TLWA 3JAFA 5JMEA 3EHZA 5KZUA 1OEDE 4TNWA 2BJ0A 3UU3A 1UV6A 2X00A
chains in the Genus database with same CATH superfamily
2NW8A 4PK6A 3FZMB 4LFBT 4TWDA 2Y6XA 4OK0A 1N33T 2W00A 2CLYC 1KNPA 2HPJA 3NWIA 2WQYA 2H3RA 4I0UA 2BYNA 4L5GA 3CK6A 2YOEA 1WR6A 1JNRA 5L47A 2HHHT 4QWNB 2WU2A 1E7PA 2KSRA 4YTPA 5AQRB 5AQIB 4AQGA 3E22E 2X51A 5FXXA 2Q9QC 5J2TE 3AE6A 4HFVA 2Y8DA 2Y57A 4JLEA 4XBFB 1X79A 4JI7T 3KVAA 3AAAB 3CIRA 5ABGA 5AQGB 2P9BA 2ZMAA 1AJ3A 3QB5K 3FB2A 2PTFA 3L39A 2ZM0A 2W8GA 3JC6C 2E9XC 2V5CA 3CVRA 5JDLA 2JMHA 2MPKA 4DV7T 2BR8A 3NBXX 5JDMA 5KDMC 3AE1A 5TVCA 2HH7A 2JQKA 4WBOA 3AE7A 2ZLYA 2WNJA 3UU6A 4UF0A 4OFZA 3ANWA 3X1DA 5CJ5A 2XY8B 1IAPA 1YD8G 1OEDC 4D01A 2QVAA 4JBWF 3UUBA 5EK3A 2XQAA 4LF8T 5HEGA 3FBLA 4NUVA 4QH5A 5L3DB 4BJNA 3N9PA 3RIUA 5LNKA 4H63V 1KF6A 1CUNA 4YTMA 4EB6E 5J2UE 1OWAA 5LHHB 4EXTA 3IF8B 4U72A 2WNCA 1LVKA 2IMLA 3ZYLA 3V5UA 3UU5A 5H6RB 4DV4T 4DUYT 2VKHA 4EOZB 3WI3A 3RYHE 3RKOA 3N5LA 2H89A 4EZ1A 4CN6A 1YXRA 5HEJA 4BFQA 3O1HA 2IDOB 1MMNA 5BMVE 1T8BA 1MMGA 2BG9B 5JDHA 1D1AA 2CWYA 2EHOC 4I4TE 2LSKA 2WNLA 3OJAA 1YKEB 5F8PA 3RYFE 3N9MA 4AKHA 3BK9A 2XZ5A 2G0UA 2BS4A 2FUPA 2WWVA 1VRBA 4HWFA 3ZSSA 2VQET 4ERRA 2K48A 4DVDA 2RPAA 2H7VC 4ISTA 2XUEA 1T7SA 5JR9B 4U7IA 2CLYB 5CA1E 4O2BE 2PJQA 2X68A 4LF6T 1NWMX 4X20E 2UUBT 4JI8T 3OVUA 2XZEA 2X00A 3I9YA 3UUXB 3KBTA 3PUXF 4X1YE 4NIQA 4EGWA 3PUVF 2H7OA 3I0OA 1LKXA 3FZLB 2YEVC 4MALA 3HKBE 5AQOB 3ZYKA 1WYBA 3L09A 3TLTA 2LLYA 4AQFC 1U4QA 3KV6A 4DV3T 1HG5A 3WTJA 2BG9E 3SS1A 4IIJE 5LBMA 3HI2A 3IGQA 1SE7A 2BR7A 4HFHA 4TZ4C 2NR4A 1EZ3A 1CHUA 1D0ZA 3AECA 5AQVB 3UFEA 2X0LB 2LSGA 1MIVA 2LT3A 3I1AA 3SIOA 3UU8A 5KMGP 3PTRB 3RX6A 4KUMB 1UW6A 3RC3A 3WAJA 4WZXA 4L9IA 2ODVA 1L0VA 3QNUA 2MTQA 1ZOYA 2KZ7B 3FZFB 3T4MA 5F5WA 4IE6A 3UU3A 4U31A 1WYCA 4TUYE 4DMWA 3CQCB 1XZYA 2DHRA 4ZI7E 3AE4A 4YHJA 2RP4A 4H9NC 2XM1A 5JDGA 3AB3B 5LHGB 2JMKA 4I50E 4A5XA 4GKJT 4UF0B 2W63A 2BBHA 2PH9A 1KNZA 2DWGA 3HR0A 2ZJVA 4TWHA 5DJQC 4DR6T 3CKDA 1S35A 3ONLC 3K3NA 1HX1B 3R6NA 3SH1A 4QACA 5J5FA 4B3TT 4WW0A 3KBUA 1B7TA 3O4XE 4GKKT 4KHPT 3C4WA 2C9TA 5EK4A 3IHRA 4YT0A 4PK5A 3EI0A 1VOMA 2WU5A 1HNXT 2XSAA 5L3BB 3UQ7A 1KNRA 4ZI2C 1KEYA 4I43B 3SRZA 2E8IA 5FKYA 4BQTA 4HFCA 1WR0A 1D1CA 3NRYA 4UVAB 3ZLIA 2DL1A 3P4RA 4ILCA 2YKSA 1VCSA 2KWIB 2CWOA 3K3OA 1GQEA 5FXVA 5LMUT 1E2AA 1MNEA 4UEMA 4DMVA 3F31A 1S94A 5AQNB 3ZYMA 3U8JA 3EAMA 1VCTA 4IREA 1W0AA 4L0RA 3ZN0B 3EABA 2VL8A 2CA5A 2FJEA 2X9HA 1BR1A 2BYQA 2IAKA 4IL9A 1T98A 2VL0A 5HEUA 1R8IA 2LSIA 2M67A 5L2LA 3CX8B 3EUHA 4QAAA 2LJLA 5ABEA 1MNDA 2DNXA 3L8RA 3U8NA 4EAHA 3ZEFB 5HXSA 4U33A 4XZCA 4O4JE 3UT5E 2VKOA 4GIWA 4O4HE 3T1HT 4YJ2E 2W4XA 3ZC1A 3RGLA 3OTOT 4NZBA 3PMZA 2QGSA 5KX5E 4UV9B 4LMKA 5JR9A 2XM2A 4P0BA 3LK42 3KVBA 2XQYA 4JI6T 2A9UA 1QSDA 5C2TA 3G06A 2QC1B 2W62A 3U8LA 3UFGA 2RA1A 4ZJSA 2X9YA 4TNWA 2Q9QA 3BQLA 4CQIA 4LFAT 3U8KA 2WDRA 4LMJA 4DR4T 1IJ5A 3ONXA 1SHZC 5LOVE 3GN5B 4TX5A 3JCFA 4ZHQE 1LRZA 5JDQA 2JPFA 2WSSV 2YU1A 5AQLB 2CPTA 2KINB 1I6ZA 3KFWX 2WDVA 2WWUA 5DABA 4PJNA 2LHNA 2XQ8A 3KDSE 1UX5A 3ZT7A 5FJVA 4ZXLA 1G73A 4DV6T 3KV4A 1OEDA 2W2UA 3FXDB 3MA9A 1WFDA 2XSBA 3H3AA 1HG2A 2BDEA 2W67A 2D0TA 3Q9DA 3ZKRA 2V7JA 2JJ9A 1MIYA 2I6HA 4U7YA 3E08A 4GK5E 2LOSA 4IDZA 2PBIA 4YTNA 1UGOA 2XZ6A 4UVBB 1Y01A 4JYAT 4KX6A 5AQHB 3QK6A 2CXLA 4PAGA 4QKNA 2Y48B 3B57A 4AISA 4TN7B 2SPCA 2UXDT 2MAWA 4KMCA 5HWXA 3A5XA 3AVRA 2XAFB 3ETVA 4DR2T 5J0ZA 4ZS2A 4U3CA 4OX9T 3FBZA 4PJMA 4K0KT 3AE5A 3AVSA 2BBJA 1J5WA 2F4VT 4Q25A 2EHOA 2J47A 1N34T 2E5LT 2WP9A 5FP3A 4JUYA 2L8KA 4XHEA 3OKQA 2XHEB 3Q2MA 5HXRA 3UTKA 3N9LA 4FI5A 4YLHA 2WZIA 2HN1A 3I9WA 2UXXB 1ZKEA 2V5DA 3ZJ1A 5J1GA 3N2GE 2YU2A 2QRXA 4IE0A 2B1EA 5HYAA 3Q5XA 4QXCB 2V1DB 4X1IE 5J5GA 1D0YA 4AKGA 3VRBA 2X00D 5BR8T 2OLTA 2K24A 4QXBB 1FIOA 3C64A 1Z8UA 2VWAA 4EYYR 2VURA 5LMNT 2XAGB 5AQKB 2MBGA 4HGAA 4EIWA 2ZJUA 2ACZA 3AA1B 4HFEA 3LBXA 4HQPA 3RF1A 4IHJE 5FL1A 3NVOA 5JDFA 3PUGA 3MXZA 2CBJA 3TLWA 2ACXA 2WZHA 3RKGA 2LRKA 2HPLA 2WBLA 4IL4A 2NW7A 1UX4A 5LHIB 3CX7B 4EZHA 3C4ZA 5IWAT 5IUXA 4AQYT 3PUWF 2LM9A 3AAIA 4UIGA 4ZR6A 4DR1T 3QUJA 5L3GB 4DBMA 4ZK1A 4HWIB 4QH1A 3F57A 1WLXA 3DP7A 4Z90A 2Y58A 3PUQA 3ZCIA 1BR4A 4IE5A 4IE4A 5LCYA 2D5UA 2OA5A 3WTKA 2Q9QB 4EZ4A 4ILAA 4ADZA 2UXBT 2JIWA 4UM1A 2WM9A 2Y54A 3DTOA 3T8OA 1JNZA 3LJCA 3C51A 2BS3A 3E0ZA 3RYCE 4PIRA 2ODUA 4NPPA 3AAEB 2E9XB 4E7SA 4DV2T 4DV5T 2W0GA 2VASA 3PJAJ 4DNDA 4XAXB 4WNKA 4OHFA 1HS7A 3FZKB 5C3JA 3P4QA 2XQ3A 2LM2A 5LXTE 1SUMB 4QXHB 2E2AA 5FVKA 3N9QA 3D0TA 1OEDB 3P4SA 5A1LA 5IHYA 2LHRA 3WAKA 2K3WA 3AEGA 3GN5A 2IC9A 3P8CD 3C98B 2LKHA 3S4UA 2L9QA 3C50A 4FJOA 5AFUL 3AEBA 3FXEB 4DUZT 4P09A 3C84A 5FXWA 3MJXA 3P4WA 3RPUA 2AXDS 3JAEA 3PE0A 2X0HA 1J1JA 1BR0A 5FYMA 4AFHA 2JQHA 2BYRA 3ZCJA 4ZJTA 3HA4A 2C5KT 2BVLA 2NTXA 3VR8A 2HN2A 4MHCA 3O1IA 2YN6A 3PUAA 5LG4A 5C8YE 5L3FB 2EHOB 4O4IE 5JRCB 3J7Yq 1M62A 4KI0F 2VKJA 3IA3A 4ZZCA 2VK9A 3P50A 2X9WA 2ZM6T 4H63H 3ZJ2A 4B5DA 2IW5B 4TWFA 4ZZBA 1IBLT 1NENA 3I0QA 3SWHA 4TNVA 3B13A 4CN1A 2WMOA 5L3CB 3CX6B 2YMDA 5JVDE 4UR9A 2XPKA 4X64T 1HR0T 4WBNE 3CWZB 3UQ4A 2CEAA 2UXCT 2JQQA 1HCIA 3JAFA 4AKLA 3MKDA 3Q5WA 4QX8B 4BA9A 2CHNA 5ABFA 3NRXA 2XNUA 5SYOA 4ISSA 3A8YC 2CXFA 1ZV4X 4UXUA 3CPZA 2XJ7A 3ZMVB 3N9NA 2WCAA 5LJNA 3LBXB 5JH7E 2JRKA 3EDVA 3NZQA 5LXBA 4WYVA 4Z8XA 3ZMTB 3ZMUB 2LSYA 1DU2A 4GOUA 5AQJB 5HEHA 5CB4E 2N2NA 2CE7A 1D0XA 3C4XA 4QX7B 3SQ6A 3GWHA 3ZSTA 3HKDE 3QOFA 4KBMB 2LOPA 1U5PA 2I59A 2NW9A 4HWHA 1XDOA 2Q9QD 4ZK4A 1XDPA 3KINB 3AE9A 2VB6A 3WTIA 2W8FA 1OXZA 4IDNA 5H6QB 1FMWA 1M7KA 5EZYE 2XNTA 1I94T 4QABA 2D2SA 2BYPA 1Z0PA 3P7IA 4HWDA 3VU7H 4GYRA 4PW8A 3AA7B 5HCJA 2XQ4A 2MYSA 4QHOA 2XQ7A 3KV9A 2V6YA 5M4YA 4IDOA 5AQTB 4CI3B 3RLFF 2XTLA 5KZUA 3OBVE 1HF8A 4TV8E 3OYZA 2V7LA 3H3MA 4DR3T 3IEEA 4PJJA 4LMLA 3AXJB 3ZPOA 1HX8A 3IBPA 2H88A 2AE9A 2WZYA 4B3ST 4JI1T 2BZBA 4TV9E 4ZI3D 2KXPB 3LK2B 3TLUA 2PFVA 1NAFA 2C0SA 2WN9A 2KT9A 4I55E 4ZRUA 2XQ5A 1D1BA 1O3XA 2CBIA 4ZS3A 2V26A 4JI0T 2A3DA 1UCUA 2BG9C 4O8SA 2E9XA 4JI5T 5JQGE 2XASB 2UZ6A 3AEAA 4OYJA 2GK9A 1WCRA 2LEHA 1HTJF 2BKNA 4LF7T 2Y56A 2M6BA 1MMAA 2KNDA 4DV0T 3RIFA 3R84B 2EHOD 5LB7B 4EV6A 3V5SA 2YMEA 5JR9C 3VR9A 4PFOA 2FBWA 4JEHB 4N78D 2WS3A 5AFLA 2DCFA 2C5JA 3RI5A 2NWBA 4HE8A 5JMEA 4NUUA 3PU3A 4DR5T 2C5IT 2WAUA 3PUSA 4CXWA 1T72A 5DQWA 2X67A 1HFAA 3RC8A 5BW2A 1X9BA 5AFMB 4X5TA 3J9X1 4UV8B 1IJ6A 4YY3T 2WY2A 4M1PA 4P1NA 2J1DG 3VHLA 4GYSA 4H9OC 2FJDA 5HWYA 1BR2A 1XNQT 1Y64B 3NZPA 5LGTB 3L3PA 3ZT5A 5LJMA 2R6GF 4V1Av 5J5IA 2WDQA 4JI2T 4PFPA 5JRCA 2LSJA 4HFIA 4H9SE 4FRRA 5ABFB 2BVMA 3K3QC 4HFDA 1MMDA 1NEKA 2BYSA 4U74A 5LA6E 3HKCE 1XMQT 3PJAA 4DBRA 2CM0A 2DLRA 4YJ3E 4BAYB 3VRAA 2KMFA 3RHWA 3OPCA 3ZMZB 2XAHB 5FY0A 3SOLA 4QH4A 4ZI3C 2NOXA 3RQWA 2XAQB 1HNWT 4PJLA 3WTNA 4JV5T 5L4EA 3PU8A 3PUZF 2CMRA 3ZC0A 4B3MT 1XMOT 3RIAA 3QC9A 3N2OA 2WB5A 3RRCA 1N36T 3EDUA 4DR7T 5L4HA 1KK7A 1V9DA 1IZNB 3EHZA 3LFMA 3HL6A 4X1KE 4YHHT 1UV6A 3CQGB 3CQXC 2XYSA 4OYKA 4IE7A 4AQFA 2IC6A 3T1YT 2OV9A 4A97A 1XNRT 3F2EA 4LF4T 2X0YA 2JQ9A 3FZHB 3LG7A 5AQQB 1US7B 1FEWA 2XYTA 1IBKT 4EEDA 3TLSA 5J5HA 4Z91A 2V6YB 2XQ9A 1SA0E 3AEFA 5HEOA 2BKOA 3AEEA 4AKRB 5HAXA 3PURA 2UUCT 3RH3A 4U2YA 2KWHA 2DI4A 3U8MA 3GA8A 3K8PC 4CN4A 5HXHA 3WTLA 3RIUC 4WV9A 3UULA 2VQFT 4LF5T 3NKZA 5FY7A 4H9RC 5JTGA 3UUMA 4YFSA 5KE4A 3LDQB 1I9BA 3WTMA 4IDQA 5FMNA 4IT4A 4AFGA 1ZEEA 3WIPA 3ZT6A 5AFHA 4IGUA 3AE2A 5EK2A 4AFTA 3HKEE 4G2AA 3OYXA 4HEAA 5AINA 3A7MA 3BQKA 4ILUA 2K5BB 4ZI2D 5AQUB 2E5VA 5IYZE 2Y7YA 3AXJA 3SFEA 2BJ0A 1YQ4A 2YK0A 4UY2A 3KV5A 3ESLA 2N1GA 5ETWA 4JEUB 3ZDGA 5FVLA 2YDSA 2V7IA 4PK4A 2X9XA 1YQ3A 5LYJE 2YINA 2YDRA 4DBQA 3U3IA 5CA0E 4K0UA 5AQFB 3DJBA 5AFNA 4CXYA 2V8SV 5F3JA 2MOZA 4ILBA 4XK9A 5FNVE 4X66T 4ZEYA 3N2KE 3U78A 4CI1B 5BP0A 4A98A 3UUNA 1FJGT 1ZP0A 4UELA 2B76A 3QB5A 2NP9A 4AI6A 3C79A 4HKAA 2IHR1 1QUUA 2UXNB 2I0MA 4CI2B 4HN9A 3GUAA 3MK7C 5LBQB 3PDYA 4EYUA 2V7KA 3AEDA 2M6IA 5AQPB 4C90A 2BKPA 2FJAA 4MFRA 2Z6EA 5CO5A 2W61A 2LRLA 2VVSA 1KFYA 4U2ZA 4YXDA 3WTOA 3MACA 1XWMA 4LF9T 4JI3T 2WMNA 1YKHB 2L3LA 2VVNA 4KP3C 1OEDE 4BJMA 4DIDB 3ANWB 5AFMA 2A72A 3TLVA 2YDQA 3SQ9A 2XQ6A 4C91A 5CFBA 3GMIA 2UU9T 1N32T 1UUSA 3ABVA 2ZM8A 4O4LE 2IUBA 3AE3A 4CZZB 1ZHCA 5FXZA 4AXPA 5LG3A 1LVFA 3PV0F 4ZOLE 3K1SA 3O9XA 4NXNT 3M3ZB 4YSXA 2D0UA 4X65T 3VKGA 5L3EB 1W0BA 3PEOA 2X66A 3VKHA 4ALXA 2J4GA 4ASKA 2FJBA 3LK3B 5TAOA 4MBQA 3AA6B 2CHOA 4DO0A 2KLQA 1IBMT 1E1HB 4YSYA 1W9RA 4KHZF 4MLKA 4O2AE 4H9PC 5ABHA 4COFA 1HNZT 2DWKA 2PGZA 3FHNA 4UM3S 5KXJA 4F6RC 3SFDA 3B5MA 5LP6E 3JADA 4NXMT 1YW0A 2LKGA 3ZDHA 2PG8A 4B3RT 5HXEA 5AFJA 4IDPA 2UUAT 3ETUA 3UU4A 3ZN1B 5E0OA 3Q5DA 1H7CA 4JI4T 2QYWA 3ONJA 2J62A 2BG9A 4YSZA 2VKDA 3RRWA 4G63A 3JC6D 1FMVA 3EVYA 2E9XD 5DQVA 2A2FX 1UK5A 3H37A 5HXCA 3WTHA 5GONE 3M65A 4E7ZA 4H9QC 2LE8A 3PUYF 2QA7A 3AE8A 1J5ET 3W15B 5ADXL 5FL0A 2IIUA 5AQMB 1QLBA 4A56A 4P0AA 2V6XA 3RQUA 2XNVA 1UX2A 2N9DA 3CMLA 2BS2A 4UXNB 3O1JA 1WRDA 2CCQA 4PNIA 4LFCT 3Q5EA 4HWCA 2K9AA 4UVCB 3AA0B 5FY1A 4HFBA 3P4PA 4HTEA 4EEBA 4J2CA 4F8HA 3BQIA 5LGNB 1W09A 3RYIE 2W66A 5AQSB 4AKIA 2ES0A 2ZM2A 2D9DA 2V7MA 2CRBA 5JREA 3LSVA 2XAJB 3MZKB 2NTYA 5CGMA 4ANJA 4AIUA 4UM3A 3N9OA 1MIWA 4UM3P 5BRXA 5HCMA 4B6XA 3TKLB 5AFKA 4DV1T 4GK0E 1UURA 2CXDA 1G8XA 5JDNA 4X62T 5LGUB 3ZMSB 4CXXA
chains in the Genus database with same CATH topology
3UUBA 2XQAA 2XYSA 3U8JA 4IL4A 5AFMA 3UU4A 3TLVA 3U8KA 3EAMA 5HEGA 4TWDA 4IREA 2XQ6A 4QH5A 5J0ZA 2XNUA 4UY2A 5SYOA 3SQ9A 5CFBA 2BG9A 4LMJA 2LKHA 3ZDGA 4LMLA 4A97A 5IUXA 4UXUA 2BYQA 5BW2A 5AFMB 2WNCA 4ZR6A 2BYNA 2WZYA 4IL9A 3TLTA 2LLYA 5HEUA 4X5TA 2VL0A 2YOEA 2XYTA 3WTHA 5LG3A 3C84A 4DBMA 3TLSA 4ZK1A 3UU5A 3WTJA 5L47A 4QH1A 5J5HA 4Z91A 2PH9A 2BG9E 3TLUA 3P4WA 2XQ9A 4Z90A 5HEOA 2Y58A 2ZJVA 2KSRA 5AFNA 3JAEA 5LXBA 3IGQA 4TWHA 2BR7A 2WN9A 4HFHA 4QAAA 4XHEA 3PEOA 2XQ8A 4EZ1A 4BFQA 5HEJA 4ZRUA 4AFHA 2XQ5A 3U8MA 3WTKA 4ALXA 4ILBA 4ILAA 3RQUA 2BYRA 1UX2A 2XNVA 2Y57A 4UM1A 4XK9A 5J5IA 2Y54A 3SH1A 4ZJTA 3U8NA 3WTLA 4QACA 4HFIA 5J5FA 4FRRA 5FJVA 4HFDA 5HEHA 2BG9C 4WV9A 2BYSA 2BG9B 2YN6A 5BP0A 3SQ6A 4A98A 1OEDA 4PIRA 2C9TA 2UZ6A 2W8GA 3EI0A 2WNLA 3C79A 4HFBA 4NPPA 4ZZCA 3P50A 3UQ7A 4F8HA 5J5GA 4NZBA 3ZKRA 3SIOA 5KE4A 3RHWA 4ZK4A 1I9BA 2X00D 3GUAA 3WTMA 2XZ5A 4COFA 2BR8A 3PMZA 3WTIA 2PGZA 2W8FA 4B5DA 4LMKA 2Y56A 4QH4A 3UU8A 4AFGA 2M6BA 4UM3S 4TWFA 4ZZBA 2XNTA 3RQWA 5TVCA 4QABA 4TNVA 2M6IA 2XZ6A 3RIFA 3WIPA 2BYPA 3WTNA 2ZJUA 5AFHA 1UW6A 4BQTA 4HFCA 2WNJA 5L4EA 4AFTA 3JADA 3LSVA 4HFEA 2YMDA 2YMEA 2XQ3A 4UM3A 5HCJA 3UU6A 5CO5A 3RIAA 2LM2A 2XQ4A 4HQPA 4UM3P 5AINA 5BRXA 4ILCA 5HCMA 2XQ7A 5AFKA 2YKSA 3UQ4A 2LKGA 2QC1B 3WTOA 3ZDHA 3U8LA 3T4MA 1OEDC 5L4HA 4D01A 5AFLA 4ZJSA 5AFJA 3RI5A 1OEDB 2Y7YA 2MAWA 3TLWA 3JAFA 5JMEA 3EHZA 5KZUA 1OEDE 4TNWA 2BJ0A 3UU3A 1UV6A 2X00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UUB A;  2XQA A;  2XYS A;  3U8J A;  4IL4 A;  5AFM A;  3UU4 A;  3TLV A;  3U8K A;  3EAM A;  5HEG A;  4TWD A;  4IRE A;  2XQ6 A;  4QH5 A;  5J0Z A;  2XNU A;  4UY2 A;  5SYO A;  3SQ9 A;  5CFB A;  2BG9 A;  4LMJ A;  2LKH A;  3ZDG A;  4LML A;  4A97 A;  5IUX A;  4UXU A;  2BYQ A;  5BW2 A;  5AFM B;  2WNC A;  4ZR6 A;  2BYN A;  2WZY A;  4IL9 A;  3TLT A;  2LLY A;  5HEU A;  4X5T A;  2VL0 A;  2YOE A;  2XYT A;  3WTH A;  5LG3 A;  3C84 A;  4DBM A;  3TLS A;  4ZK1 A;  3UU5 A;  3WTJ A;  5L47 A;  4QH1 A;  5J5H A;  4Z91 A;  2PH9 A;  2BG9 E;  3TLU A;  3P4W A;  2XQ9 A;  4Z90 A;  5HEO A;  2Y58 A;  2ZJV A;  2KSR A;  5AFN A;  3JAE A;  5LXB A;  3IGQ A;  4TWH A;  2BR7 A;  2WN9 A;  4HFH A;  4QAA A;  4XHE A;  3PEO A;  2XQ8 A;  4EZ1 A;  4BFQ A;  5HEJ A;  4ZRU A;  4AFH A;  2XQ5 A;  3U8M A;  3WTK A;  4ALX A;  4ILB A;  4ILA A;  3RQU A;  2BYR A;  1UX2 A;  2XNV A;  2Y57 A;  4UM1 A;  4XK9 A;  5J5I A;  2Y54 A;  3SH1 A;  4ZJT A;  3U8N A;  3WTL A;  4QAC A;  4HFI A;  5J5F A;  4FRR A;  5FJV A;  4HFD A;  5HEH A;  2BG9 C;  4WV9 A;  2BYS A;  2BG9 B;  2YN6 A;  5BP0 A;  3SQ6 A;  4A98 A;  1OED A;  4PIR A;  2C9T A;  2UZ6 A;  2W8G A;  3EI0 A;  2WNL A;  3C79 A;  4HFB A;  4NPP A;  4ZZC A;  3P50 A;  3UQ7 A;  4F8H A;  5J5G A;  4NZB A;  3ZKR A;  3SIO A;  5KE4 A;  3RHW A;  4ZK4 A;  1I9B A;  2X00 D;  3GUA A;  3WTM A;  2XZ5 A;  4COF A;  2BR8 A;  3PMZ A;  3WTI A;  2PGZ A;  2W8F A;  4B5D A;  4LMK A;  2Y56 A;  4QH4 A;  3UU8 A;  4AFG A;  2M6B A;  4UM3 S;  4TWF A;  4ZZB A;  2XNT A;  3RQW A;  5TVC A;  4QAB A;  4TNV A;  2M6I A;  2XZ6 A;  3RIF A;  3WIP A;  2BYP A;  3WTN A;  2ZJU A;  5AFH A;  1UW6 A;  4BQT A;  4HFC A;  2WNJ A;  5L4E A;  4AFT A;  3JAD A;  3LSV A;  4HFE A;  2YMD A;  2YME A;  2XQ3 A;  4UM3 A;  5HCJ A;  3UU6 A;  5CO5 A;  3RIA A;  2LM2 A;  2XQ4 A;  4HQP A;  4UM3 P;  5AIN A;  5BRX A;  4ILC A;  5HCM A;  2XQ7 A;  5AFK A;  2YKS A;  3UQ4 A;  2LKG A;  2QC1 B;  3WTO A;  3ZDH A;  3U8L A;  3T4M A;  1OED C;  5L4H A;  4D01 A;  5AFL A;  4ZJS A;  5AFJ A;  3RI5 A;  1OED B;  2Y7Y A;  2MAW A;  3TLW A;  3JAF A;  5JME A;  3EHZ A;  5KZU A;  1OED E;  4TNW A;  2BJ0 A;  3UU3 A;  1UV6 A;  2X00 A; 
#chains in the Genus database with same CATH topology
 2NW8 A;  4PK6 A;  3FZM B;  4LFB T;  4TWD A;  2Y6X A;  4OK0 A;  1N33 T;  2W00 A;  2CLY C;  1KNP A;  2HPJ A;  3NWI A;  2WQY A;  2H3R A;  4I0U A;  2BYN A;  4L5G A;  3CK6 A;  2YOE A;  1WR6 A;  1JNR A;  5L47 A;  2HHH T;  4QWN B;  2WU2 A;  1E7P A;  2KSR A;  4YTP A;  5AQR B;  5AQI B;  4AQG A;  3E22 E;  2X51 A;  5FXX A;  2Q9Q C;  5J2T E;  3AE6 A;  4HFV A;  2Y8D A;  2Y57 A;  4JLE A;  4XBF B;  1X79 A;  4JI7 T;  3KVA A;  3AAA B;  3CIR A;  5ABG A;  5AQG B;  2P9B A;  2ZMA A;  1AJ3 A;  3QB5 K;  3FB2 A;  2PTF A;  3L39 A;  2ZM0 A;  2W8G A;  3JC6 C;  2E9X C;  2V5C A;  3CVR A;  5JDL A;  2JMH A;  2MPK A;  4DV7 T;  2BR8 A;  3NBX X;  5JDM A;  5KDM C;  3AE1 A;  5TVC A;  2HH7 A;  2JQK A;  4WBO A;  3AE7 A;  2ZLY A;  2WNJ A;  3UU6 A;  4UF0 A;  4OFZ A;  3ANW A;  3X1D A;  5CJ5 A;  2XY8 B;  1IAP A;  1YD8 G;  1OED C;  4D01 A;  2QVA A;  4JBW F;  3UUB A;  5EK3 A;  2XQA A;  4LF8 T;  5HEG A;  3FBL A;  4NUV A;  4QH5 A;  5L3D B;  4BJN A;  3N9P A;  3RIU A;  5LNK A;  4H63 V;  1KF6 A;  1CUN A;  4YTM A;  4EB6 E;  5J2U E;  1OWA A;  5LHH B;  4EXT A;  3IF8 B;  4U72 A;  2WNC A;  1LVK A;  2IML A;  3ZYL A;  3V5U A;  3UU5 A;  5H6R B;  4DV4 T;  4DUY T;  2VKH A;  4EOZ B;  3WI3 A;  3RYH E;  3RKO A;  3N5L A;  2H89 A;  4EZ1 A;  4CN6 A;  1YXR A;  5HEJ A;  4BFQ A;  3O1H A;  2IDO B;  1MMN A;  5BMV E;  1T8B A;  1MMG A;  2BG9 B;  5JDH A;  1D1A A;  2CWY A;  2EHO C;  4I4T E;  2LSK A;  2WNL A;  3OJA A;  1YKE B;  5F8P A;  3RYF E;  3N9M A;  4AKH A;  3BK9 A;  2XZ5 A;  2G0U A;  2BS4 A;  2FUP A;  2WWV A;  1VRB A;  4HWF A;  3ZSS A;  2VQE T;  4ERR A;  2K48 A;  4DVD A;  2RPA A;  2H7V C;  4IST A;  2XUE A;  1T7S A;  5JR9 B;  4U7I A;  2CLY B;  5CA1 E;  4O2B E;  2PJQ A;  2X68 A;  4LF6 T;  1NWM X;  4X20 E;  2UUB T;  4JI8 T;  3OVU A;  2XZE A;  2X00 A;  3I9Y A;  3UUX B;  3KBT A;  3PUX F;  4X1Y E;  4NIQ A;  4EGW A;  3PUV F;  2H7O A;  3I0O A;  1LKX A;  3FZL B;  2YEV C;  4MAL A;  3HKB E;  5AQO B;  3ZYK A;  1WYB A;  3L09 A;  3TLT A;  2LLY A;  4AQF C;  1U4Q A;  3KV6 A;  4DV3 T;  1HG5 A;  3WTJ A;  2BG9 E;  3SS1 A;  4IIJ E;  5LBM A;  3HI2 A;  3IGQ A;  1SE7 A;  2BR7 A;  4HFH A;  4TZ4 C;  2NR4 A;  1EZ3 A;  1CHU A;  1D0Z A;  3AEC A;  5AQV B;  3UFE A;  2X0L B;  2LSG A;  1MIV A;  2LT3 A;  3I1A A;  3SIO A;  3UU8 A;  5KMG P;  3PTR B;  3RX6 A;  4KUM B;  1UW6 A;  3RC3 A;  3WAJ A;  4WZX A;  4L9I A;  2ODV A;  1L0V A;  3QNU A;  2MTQ A;  1ZOY A;  2KZ7 B;  3FZF B;  3T4M A;  5F5W A;  4IE6 A;  3UU3 A;  4U31 A;  1WYC A;  4TUY E;  4DMW A;  3CQC B;  1XZY A;  2DHR A;  4ZI7 E;  3AE4 A;  4YHJ A;  2RP4 A;  4H9N C;  2XM1 A;  5JDG A;  3AB3 B;  5LHG B;  2JMK A;  4I50 E;  4A5X A;  4GKJ T;  4UF0 B;  2W63 A;  2BBH A;  2PH9 A;  1KNZ A;  2DWG A;  3HR0 A;  2ZJV A;  4TWH A;  5DJQ C;  4DR6 T;  3CKD A;  1S35 A;  3ONL C;  3K3N A;  1HX1 B;  3R6N A;  3SH1 A;  4QAC A;  5J5F A;  4B3T T;  4WW0 A;  3KBU A;  1B7T A;  3O4X E;  4GKK T;  4KHP T;  3C4W A;  2C9T A;  5EK4 A;  3IHR A;  4YT0 A;  4PK5 A;  3EI0 A;  1VOM A;  2WU5 A;  1HNX T;  2XSA A;  5L3B B;  3UQ7 A;  1KNR A;  4ZI2 C;  1KEY A;  4I43 B;  3SRZ A;  2E8I A;  5FKY A;  4BQT A;  4HFC A;  1WR0 A;  1D1C A;  3NRY A;  4UVA B;  3ZLI A;  2DL1 A;  3P4R A;  4ILC A;  2YKS A;  1VCS A;  2KWI B;  2CWO A;  3K3O A;  1GQE A;  5FXV A;  5LMU T;  1E2A A;  1MNE A;  4UEM A;  4DMV A;  3F31 A;  1S94 A;  5AQN B;  3ZYM A;  3U8J A;  3EAM A;  1VCT A;  4IRE A;  1W0A A;  4L0R A;  3ZN0 B;  3EAB A;  2VL8 A;  2CA5 A;  2FJE A;  2X9H A;  1BR1 A;  2BYQ A;  2IAK A;  4IL9 A;  1T98 A;  2VL0 A;  5HEU A;  1R8I A;  2LSI A;  2M67 A;  5L2L A;  3CX8 B;  3EUH A;  4QAA A;  2LJL A;  5ABE A;  1MND A;  2DNX A;  3L8R A;  3U8N A;  4EAH A;  3ZEF B;  5HXS A;  4U33 A;  4XZC A;  4O4J E;  3UT5 E;  2VKO A;  4GIW A;  4O4H E;  3T1H T;  4YJ2 E;  2W4X A;  3ZC1 A;  3RGL A;  3OTO T;  4NZB A;  3PMZ A;  2QGS A;  5KX5 E;  4UV9 B;  4LMK A;  5JR9 A;  2XM2 A;  4P0B A;  3LK4 2;  3KVB A;  2XQY A;  4JI6 T;  2A9U A;  1QSD A;  5C2T A;  3G06 A;  2QC1 B;  2W62 A;  3U8L A;  3UFG A;  2RA1 A;  4ZJS A;  2X9Y A;  4TNW A;  2Q9Q A;  3BQL A;  4CQI A;  4LFA T;  3U8K A;  2WDR A;  4LMJ A;  4DR4 T;  1IJ5 A;  3ONX A;  1SHZ C;  5LOV E;  3GN5 B;  4TX5 A;  3JCF A;  4ZHQ E;  1LRZ A;  5JDQ A;  2JPF A;  2WSS V;  2YU1 A;  5AQL B;  2CPT A;  2KIN B;  1I6Z A;  3KFW X;  2WDV A;  2WWU A;  5DAB A;  4PJN A;  2LHN A;  2XQ8 A;  3KDS E;  1UX5 A;  3ZT7 A;  5FJV A;  4ZXL A;  1G73 A;  4DV6 T;  3KV4 A;  1OED A;  2W2U A;  3FXD B;  3MA9 A;  1WFD A;  2XSB A;  3H3A A;  1HG2 A;  2BDE A;  2W67 A;  2D0T A;  3Q9D A;  3ZKR A;  2V7J A;  2JJ9 A;  1MIY A;  2I6H A;  4U7Y A;  3E08 A;  4GK5 E;  2LOS A;  4IDZ A;  2PBI A;  4YTN A;  1UGO A;  2XZ6 A;  4UVB B;  1Y01 A;  4JYA T;  4KX6 A;  5AQH B;  3QK6 A;  2CXL A;  4PAG A;  4QKN A;  2Y48 B;  3B57 A;  4AIS A;  4TN7 B;  2SPC A;  2UXD T;  2MAW A;  4KMC A;  5HWX A;  3A5X A;  3AVR A;  2XAF B;  3ETV A;  4DR2 T;  5J0Z A;  4ZS2 A;  4U3C A;  4OX9 T;  3FBZ A;  4PJM A;  4K0K T;  3AE5 A;  3AVS A;  2BBJ A;  1J5W A;  2F4V T;  4Q25 A;  2EHO A;  2J47 A;  1N34 T;  2E5L T;  2WP9 A;  5FP3 A;  4JUY A;  2L8K A;  4XHE A;  3OKQ A;  2XHE B;  3Q2M A;  5HXR A;  3UTK A;  3N9L A;  4FI5 A;  4YLH A;  2WZI A;  2HN1 A;  3I9W A;  2UXX B;  1ZKE A;  2V5D A;  3ZJ1 A;  5J1G A;  3N2G E;  2YU2 A;  2QRX A;  4IE0 A;  2B1E A;  5HYA A;  3Q5X A;  4QXC B;  2V1D B;  4X1I E;  5J5G A;  1D0Y A;  4AKG A;  3VRB A;  2X00 D;  5BR8 T;  2OLT A;  2K24 A;  4QXB B;  1FIO A;  3C64 A;  1Z8U A;  2VWA A;  4EYY R;  2VUR A;  5LMN T;  2XAG B;  5AQK B;  2MBG A;  4HGA A;  4EIW A;  2ZJU A;  2ACZ A;  3AA1 B;  4HFE A;  3LBX A;  4HQP A;  3RF1 A;  4IHJ E;  5FL1 A;  3NVO A;  5JDF A;  3PUG A;  3MXZ A;  2CBJ A;  3TLW A;  2ACX A;  2WZH A;  3RKG A;  2LRK A;  2HPL A;  2WBL A;  4IL4 A;  2NW7 A;  1UX4 A;  5LHI B;  3CX7 B;  4EZH A;  3C4Z A;  5IWA T;  5IUX A;  4AQY T;  3PUW F;  2LM9 A;  3AAI A;  4UIG A;  4ZR6 A;  4DR1 T;  3QUJ A;  5L3G B;  4DBM A;  4ZK1 A;  4HWI B;  4QH1 A;  3F57 A;  1WLX A;  3DP7 A;  4Z90 A;  2Y58 A;  3PUQ A;  3ZCI A;  1BR4 A;  4IE5 A;  4IE4 A;  5LCY A;  2D5U A;  2OA5 A;  3WTK A;  2Q9Q B;  4EZ4 A;  4ILA A;  4ADZ A;  2UXB T;  2JIW A;  4UM1 A;  2WM9 A;  2Y54 A;  3DTO A;  3T8O A;  1JNZ A;  3LJC A;  3C51 A;  2BS3 A;  3E0Z A;  3RYC E;  4PIR A;  2ODU A;  4NPP A;  3AAE B;  2E9X B;  4E7S A;  4DV2 T;  4DV5 T;  2W0G A;  2VAS A;  3PJA J;  4DND A;  4XAX B;  4WNK A;  4OHF A;  1HS7 A;  3FZK B;  5C3J A;  3P4Q A;  2XQ3 A;  2LM2 A;  5LXT E;  1SUM B;  4QXH B;  2E2A A;  5FVK A;  3N9Q A;  3D0T A;  1OED B;  3P4S A;  5A1L A;  5IHY A;  2LHR A;  3WAK A;  2K3W A;  3AEG A;  3GN5 A;  2IC9 A;  3P8C D;  3C98 B;  2LKH A;  3S4U A;  2L9Q A;  3C50 A;  4FJO A;  5AFU L;  3AEB A;  3FXE B;  4DUZ T;  4P09 A;  3C84 A;  5FXW A;  3MJX A;  3P4W A;  3RPU A;  2AXD S;  3JAE A;  3PE0 A;  2X0H A;  1J1J A;  1BR0 A;  5FYM A;  4AFH A;  2JQH A;  2BYR A;  3ZCJ A;  4ZJT A;  3HA4 A;  2C5K T;  2BVL A;  2NTX A;  3VR8 A;  2HN2 A;  4MHC A;  3O1I A;  2YN6 A;  3PUA A;  5LG4 A;  5C8Y E;  5L3F B;  2EHO B;  4O4I E;  5JRC B;  3J7Y q;  1M62 A;  4KI0 F;  2VKJ A;  3IA3 A;  4ZZC A;  2VK9 A;  3P50 A;  2X9W A;  2ZM6 T;  4H63 H;  3ZJ2 A;  4B5D A;  2IW5 B;  4TWF A;  4ZZB A;  1IBL T;  1NEN A;  3I0Q A;  3SWH A;  4TNV A;  3B13 A;  4CN1 A;  2WMO A;  5L3C B;  3CX6 B;  2YMD A;  5JVD E;  4UR9 A;  2XPK A;  4X64 T;  1HR0 T;  4WBN E;  3CWZ B;  3UQ4 A;  2CEA A;  2UXC T;  2JQQ A;  1HCI A;  3JAF A;  4AKL A;  3MKD A;  3Q5W A;  4QX8 B;  4BA9 A;  2CHN A;  5ABF A;  3NRX A;  2XNU A;  5SYO A;  4ISS A;  3A8Y C;  2CXF A;  1ZV4 X;  4UXU A;  3CPZ A;  2XJ7 A;  3ZMV B;  3N9N A;  2WCA A;  5LJN A;  3LBX B;  5JH7 E;  2JRK A;  3EDV A;  3NZQ A;  5LXB A;  4WYV A;  4Z8X A;  3ZMT B;  3ZMU B;  2LSY A;  1DU2 A;  4GOU A;  5AQJ B;  5HEH A;  5CB4 E;  2N2N A;  2CE7 A;  1D0X A;  3C4X A;  4QX7 B;  3SQ6 A;  3GWH A;  3ZST A;  3HKD E;  3QOF A;  4KBM B;  2LOP A;  1U5P A;  2I59 A;  2NW9 A;  4HWH A;  1XDO A;  2Q9Q D;  4ZK4 A;  1XDP A;  3KIN B;  3AE9 A;  2VB6 A;  3WTI A;  2W8F A;  1OXZ A;  4IDN A;  5H6Q B;  1FMW A;  1M7K A;  5EZY E;  2XNT A;  1I94 T;  4QAB A;  2D2S A;  2BYP A;  1Z0P A;  3P7I A;  4HWD A;  3VU7 H;  4GYR A;  4PW8 A;  3AA7 B;  5HCJ A;  2XQ4 A;  2MYS A;  4QHO A;  2XQ7 A;  3KV9 A;  2V6Y A;  5M4Y A;  4IDO A;  5AQT B;  4CI3 B;  3RLF F;  2XTL A;  5KZU A;  3OBV E;  1HF8 A;  4TV8 E;  3OYZ A;  2V7L A;  3H3M A;  4DR3 T;  3IEE A;  4PJJ A;  4LML A;  3AXJ B;  3ZPO A;  1HX8 A;  3IBP A;  2H88 A;  2AE9 A;  2WZY A;  4B3S T;  4JI1 T;  2BZB A;  4TV9 E;  4ZI3 D;  2KXP B;  3LK2 B;  3TLU A;  2PFV A;  1NAF A;  2C0S A;  2WN9 A;  2KT9 A;  4I55 E;  4ZRU A;  2XQ5 A;  1D1B A;  1O3X A;  2CBI A;  4ZS3 A;  2V26 A;  4JI0 T;  2A3D A;  1UCU A;  2BG9 C;  4O8S A;  2E9X A;  4JI5 T;  5JQG E;  2XAS B;  2UZ6 A;  3AEA A;  4OYJ A;  2GK9 A;  1WCR A;  2LEH A;  1HTJ F;  2BKN A;  4LF7 T;  2Y56 A;  2M6B A;  1MMA A;  2KND A;  4DV0 T;  3RIF A;  3R84 B;  2EHO D;  5LB7 B;  4EV6 A;  3V5S A;  2YME A;  5JR9 C;  3VR9 A;  4PFO A;  2FBW A;  4JEH B;  4N78 D;  2WS3 A;  5AFL A;  2DCF A;  2C5J A;  3RI5 A;  2NWB A;  4HE8 A;  5JME A;  4NUU A;  3PU3 A;  4DR5 T;  2C5I T;  2WAU A;  3PUS A;  4CXW A;  1T72 A;  5DQW A;  2X67 A;  1HFA A;  3RC8 A;  5BW2 A;  1X9B A;  5AFM B;  4X5T A;  3J9X 1;  4UV8 B;  1IJ6 A;  4YY3 T;  2WY2 A;  4M1P A;  4P1N A;  2J1D G;  3VHL A;  4GYS A;  4H9O C;  2FJD A;  5HWY A;  1BR2 A;  1XNQ T;  1Y64 B;  3NZP A;  5LGT B;  3L3P A;  3ZT5 A;  5LJM A;  2R6G F;  4V1A v;  5J5I A;  2WDQ A;  4JI2 T;  4PFP A;  5JRC A;  2LSJ A;  4HFI A;  4H9S E;  4FRR A;  5ABF B;  2BVM A;  3K3Q C;  4HFD A;  1MMD A;  1NEK A;  2BYS A;  4U74 A;  5LA6 E;  3HKC E;  1XMQ T;  3PJA A;  4DBR A;  2CM0 A;  2DLR A;  4YJ3 E;  4BAY B;  3VRA A;  2KMF A;  3RHW A;  3OPC A;  3ZMZ B;  2XAH B;  5FY0 A;  3SOL A;  4QH4 A;  4ZI3 C;  2NOX A;  3RQW A;  2XAQ B;  1HNW T;  4PJL A;  3WTN A;  4JV5 T;  5L4E A;  3PU8 A;  3PUZ F;  2CMR A;  3ZC0 A;  4B3M T;  1XMO T;  3RIA A;  3QC9 A;  3N2O A;  2WB5 A;  3RRC A;  1N36 T;  3EDU A;  4DR7 T;  5L4H A;  1KK7 A;  1V9D A;  1IZN B;  3EHZ A;  3LFM A;  3HL6 A;  4X1K E;  4YHH T;  1UV6 A;  3CQG B;  3CQX C;  2XYS A;  4OYK A;  4IE7 A;  4AQF A;  2IC6 A;  3T1Y T;  2OV9 A;  4A97 A;  1XNR T;  3F2E A;  4LF4 T;  2X0Y A;  2JQ9 A;  3FZH B;  3LG7 A;  5AQQ B;  1US7 B;  1FEW A;  2XYT A;  1IBK T;  4EED A;  3TLS A;  5J5H A;  4Z91 A;  2V6Y B;  2XQ9 A;  1SA0 E;  3AEF A;  5HEO A;  2BKO A;  3AEE A;  4AKR B;  5HAX A;  3PUR A;  2UUC T;  3RH3 A;  4U2Y A;  2KWH A;  2DI4 A;  3U8M A;  3GA8 A;  3K8P C;  4CN4 A;  5HXH A;  3WTL A;  3RIU C;  4WV9 A;  3UUL A;  2VQF T;  4LF5 T;  3NKZ A;  5FY7 A;  4H9R C;  5JTG A;  3UUM A;  4YFS A;  5KE4 A;  3LDQ B;  1I9B A;  3WTM A;  4IDQ A;  5FMN A;  4IT4 A;  4AFG A;  1ZEE A;  3WIP A;  3ZT6 A;  5AFH A;  4IGU A;  3AE2 A;  5EK2 A;  4AFT A;  3HKE E;  4G2A A;  3OYX A;  4HEA A;  5AIN A;  3A7M A;  3BQK A;  4ILU A;  2K5B B;  4ZI2 D;  5AQU B;  2E5V A;  5IYZ E;  2Y7Y A;  3AXJ A;  3SFE A;  2BJ0 A;  1YQ4 A;  2YK0 A;  4UY2 A;  3KV5 A;  3ESL A;  2N1G A;  5ETW A;  4JEU B;  3ZDG A;  5FVL A;  2YDS A;  2V7I A;  4PK4 A;  2X9X A;  1YQ3 A;  5LYJ E;  2YIN A;  2YDR A;  4DBQ A;  3U3I A;  5CA0 E;  4K0U A;  5AQF B;  3DJB A;  5AFN A;  4CXY A;  2V8S V;  5F3J A;  2MOZ A;  4ILB A;  4XK9 A;  5FNV E;  4X66 T;  4ZEY A;  3N2K E;  3U78 A;  4CI1 B;  5BP0 A;  4A98 A;  3UUN A;  1FJG T;  1ZP0 A;  4UEL A;  2B76 A;  3QB5 A;  2NP9 A;  4AI6 A;  3C79 A;  4HKA A;  2IHR 1;  1QUU A;  2UXN B;  2I0M A;  4CI2 B;  4HN9 A;  3GUA A;  3MK7 C;  5LBQ B;  3PDY A;  4EYU A;  2V7K A;  3AED A;  2M6I A;  5AQP B;  4C90 A;  2BKP A;  2FJA A;  4MFR A;  2Z6E A;  5CO5 A;  2W61 A;  2LRL A;  2VVS A;  1KFY A;  4U2Z A;  4YXD A;  3WTO A;  3MAC A;  1XWM A;  4LF9 T;  4JI3 T;  2WMN A;  1YKH B;  2L3L A;  2VVN A;  4KP3 C;  1OED E;  4BJM A;  4DID B;  3ANW B;  5AFM A;  2A72 A;  3TLV A;  2YDQ A;  3SQ9 A;  2XQ6 A;  4C91 A;  5CFB A;  3GMI A;  2UU9 T;  1N32 T;  1UUS A;  3ABV A;  2ZM8 A;  4O4L E;  2IUB A;  3AE3 A;  4CZZ B;  1ZHC A;  5FXZ A;  4AXP A;  5LG3 A;  1LVF A;  3PV0 F;  4ZOL E;  3K1S A;  3O9X A;  4NXN T;  3M3Z B;  4YSX A;  2D0U A;  4X65 T;  3VKG A;  5L3E B;  1W0B A;  3PEO A;  2X66 A;  3VKH A;  4ALX A;  2J4G A;  4ASK A;  2FJB A;  3LK3 B;  5TAO A;  4MBQ A;  3AA6 B;  2CHO A;  4DO0 A;  2KLQ A;  1IBM T;  1E1H B;  4YSY A;  1W9R A;  4KHZ F;  4MLK A;  4O2A E;  4H9P C;  5ABH A;  4COF A;  1HNZ T;  2DWK A;  2PGZ A;  3FHN A;  4UM3 S;  5KXJ A;  4F6R C;  3SFD A;  3B5M A;  5LP6 E;  3JAD A;  4NXM T;  1YW0 A;  2LKG A;  3ZDH A;  2PG8 A;  4B3R T;  5HXE A;  5AFJ A;  4IDP A;  2UUA T;  3ETU A;  3UU4 A;  3ZN1 B;  5E0O A;  3Q5D A;  1H7C A;  4JI4 T;  2QYW A;  3ONJ A;  2J62 A;  2BG9 A;  4YSZ A;  2VKD A;  3RRW A;  4G63 A;  3JC6 D;  1FMV A;  3EVY A;  2E9X D;  5DQV A;  2A2F X;  1UK5 A;  3H37 A;  5HXC A;  3WTH A;  5GON E;  3M65 A;  4E7Z A;  4H9Q C;  2LE8 A;  3PUY F;  2QA7 A;  3AE8 A;  1J5E T;  3W15 B;  5ADX L;  5FL0 A;  2IIU A;  5AQM B;  1QLB A;  4A56 A;  4P0A A;  2V6X A;  3RQU A;  2XNV A;  1UX2 A;  2N9D A;  3CML A;  2BS2 A;  4UXN B;  3O1J A;  1WRD A;  2CCQ A;  4PNI A;  4LFC T;  3Q5E A;  4HWC A;  2K9A A;  4UVC B;  3AA0 B;  5FY1 A;  4HFB A;  3P4P A;  4HTE A;  4EEB A;  4J2C A;  4F8H A;  3BQI A;  5LGN B;  1W09 A;  3RYI E;  2W66 A;  5AQS B;  4AKI A;  2ES0 A;  2ZM2 A;  2D9D A;  2V7M A;  2CRB A;  5JRE A;  3LSV A;  2XAJ B;  3MZK B;  2NTY A;  5CGM A;  4ANJ A;  4AIU A;  4UM3 A;  3N9O A;  1MIW A;  4UM3 P;  5BRX A;  5HCM A;  4B6X A;  3TKL B;  5AFK A;  4DV1 T;  4GK0 E;  1UUR A;  2CXD A;  1G8X A;  5JDN A;  4X62 T;  5LGU B;  3ZMS B;  4CXX A; 
#chains in the Genus database with same CATH homology
 3UUB A;  2XQA A;  2XYS A;  3U8J A;  4IL4 A;  5AFM A;  3UU4 A;  3TLV A;  3U8K A;  3EAM A;  5HEG A;  4TWD A;  4IRE A;  2XQ6 A;  4QH5 A;  5J0Z A;  2XNU A;  4UY2 A;  5SYO A;  3SQ9 A;  5CFB A;  2BG9 A;  4LMJ A;  2LKH A;  3ZDG A;  4LML A;  4A97 A;  5IUX A;  4UXU A;  2BYQ A;  5BW2 A;  5AFM B;  2WNC A;  4ZR6 A;  2BYN A;  2WZY A;  4IL9 A;  3TLT A;  2LLY A;  5HEU A;  4X5T A;  2VL0 A;  2YOE A;  2XYT A;  3WTH A;  5LG3 A;  3C84 A;  4DBM A;  3TLS A;  4ZK1 A;  3UU5 A;  3WTJ A;  5L47 A;  4QH1 A;  5J5H A;  4Z91 A;  2PH9 A;  2BG9 E;  3TLU A;  3P4W A;  2XQ9 A;  4Z90 A;  5HEO A;  2Y58 A;  2ZJV A;  2KSR A;  5AFN A;  3JAE A;  5LXB A;  3IGQ A;  4TWH A;  2BR7 A;  2WN9 A;  4HFH A;  4QAA A;  4XHE A;  3PEO A;  2XQ8 A;  4EZ1 A;  4BFQ A;  5HEJ A;  4ZRU A;  4AFH A;  2XQ5 A;  3U8M A;  3WTK A;  4ALX A;  4ILB A;  4ILA A;  3RQU A;  2BYR A;  1UX2 A;  2XNV A;  2Y57 A;  4UM1 A;  4XK9 A;  5J5I A;  2Y54 A;  3SH1 A;  4ZJT A;  3U8N A;  3WTL A;  4QAC A;  4HFI A;  5J5F A;  4FRR A;  5FJV A;  4HFD A;  5HEH A;  2BG9 C;  4WV9 A;  2BYS A;  2BG9 B;  2YN6 A;  5BP0 A;  3SQ6 A;  4A98 A;  1OED A;  4PIR A;  2C9T A;  2UZ6 A;  2W8G A;  3EI0 A;  2WNL A;  3C79 A;  4HFB A;  4NPP A;  4ZZC A;  3P50 A;  3UQ7 A;  4F8H A;  5J5G A;  4NZB A;  3ZKR A;  3SIO A;  5KE4 A;  3RHW A;  4ZK4 A;  1I9B A;  2X00 D;  3GUA A;  3WTM A;  2XZ5 A;  4COF A;  2BR8 A;  3PMZ A;  3WTI A;  2PGZ A;  2W8F A;  4B5D A;  4LMK A;  2Y56 A;  4QH4 A;  3UU8 A;  4AFG A;  2M6B A;  4UM3 S;  4TWF A;  4ZZB A;  2XNT A;  3RQW A;  5TVC A;  4QAB A;  4TNV A;  2M6I A;  2XZ6 A;  3RIF A;  3WIP A;  2BYP A;  3WTN A;  2ZJU A;  5AFH A;  1UW6 A;  4BQT A;  4HFC A;  2WNJ A;  5L4E A;  4AFT A;  3JAD A;  3LSV A;  4HFE A;  2YMD A;  2YME A;  2XQ3 A;  4UM3 A;  5HCJ A;  3UU6 A;  5CO5 A;  3RIA A;  2LM2 A;  2XQ4 A;  4HQP A;  4UM3 P;  5AIN A;  5BRX A;  4ILC A;  5HCM A;  2XQ7 A;  5AFK A;  2YKS A;  3UQ4 A;  2LKG A;  2QC1 B;  3WTO A;  3ZDH A;  3U8L A;  3T4M A;  1OED C;  5L4H A;  4D01 A;  5AFL A;  4ZJS A;  5AFJ A;  3RI5 A;  1OED B;  2Y7Y A;  2MAW A;  3TLW A;  3JAF A;  5JME A;  3EHZ A;  5KZU A;  1OED E;  4TNW A;  2BJ0 A;  3UU3 A;  1UV6 A;  2X00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...