4LMJA

Glic liganded-closed-channel conformation, mutant t25'a
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKAPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gating of the proton-gated ion channel from Gloeobacter violaceus at pH 4 as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 86
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4lmjA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4lmjA01
2BR7A 2WNCA 4HFCA 4HQPA 3RQWA 4ZJSA 3GUAA 4UY2A 4ZK4A 3WTJA 3UQ4A 2YKSA 4BFQA 2YOEA 3U8NA 3UU6A 2WNLA 4ZRUA 3UU4A 3JAFA 5J5HA 1UX2A 4TWDA 2Y56A 3C84A 2XQ8A 4ALXA 2BG9C 2XNTA 4BQTA 4AFTA 5JMEA 3TLTA 4LMLA 4HFDA 2LLYA 5L47A 2M6BA 5CO5A 3SQ9A 2XNVA 2UZ6A 3TLVA 3TLWA 3WTMA 2PH9A 3ZKRA 2BG9E 4TNWA 4A98A 1I9BA 1UV6A 4UM3A 5CFBA 3P4WA 3PEOA 3JADA 3P50A 2C9TA 5J5FA 5HEOA 4TWFA 3U8KA 2XYSA 2PGZA 4IREA 5AFKA 4QH5A 2YN6A 5KE4A 5AFLA 2Y7YA 5LXBA 5J5GA 4IL9A 3U8MA 2Y54A 5J5IA 2XYTA 3RQUA 2WNJA 2VL0A 3SH1A 4X5TA 5BW2A 4ILAA 3RI5A 1OEDE 2BJ0A 2XQ9A 4LMKA 2QC1B 2ZJUA 3UU8A 3SIOA 3TLSA 4IL4A 4ILBA 4ZJTA 3U8LA 4EZ1A 2LKGA 4ZZCA 3EAMA 2MAWA 5IUXA 3WIPA 2BYSA 2WZYA 3TLUA 4Z91A 3WTLA 3WTHA 2XZ5A 2LKHA 4QH1A 4FRRA 5SYOA 5BP0A 4QH4A 4TWHA 3UU3A 4TNVA 5TVCA 4XK9A 5HCJA 4PIRA 4XHEA 4B5DA 2W8FA 4D01A 4ZK1A 4HFBA 4HFEA 4DBMA 3UQ7A 3T4MA 5LG3A 4LMJA 4COFA 3EI0A 4QACA 2W8GA 2ZJVA 3WTIA 3JAEA 4F8HA 3WTOA 3ZDGA 4UXUA 5J0ZA 2BYPA 3WTNA 5HEJA 3RIFA 5L4EA 5BRXA 2XQ3A 3C79A 2BYQA 5AFHA 3UUBA 2XQ5A 5KZUA 4ZZBA 1OEDC 2YMEA 5AFMB 4NPPA 5HEGA 2M6IA 2XNUA 2BG9A 2WN9A 5AFJA 2XQAA 5L4HA 2Y58A 2BYNA 4HFHA 5HEHA 4UM3P 4ZR6A 5FJVA 3RIAA 2LM2A 4AFGA 5AFNA 2XQ4A 4QAAA 2XQ7A 2Y57A 2YMDA 2KSRA 4WV9A 4QABA 1OEDA 4ILCA 2XZ6A 3ZDHA 2BYRA 4AFHA 4NZBA 2X00A 4Z90A 3LSVA 2X00D 5AFMA 3SQ6A 3UU5A 4HFIA 3RHWA 5AINA 3U8JA 3EHZA 5HCMA 4A97A 1UW6A 2BR8A 3PMZA 3IGQA 3WTKA 4UM3S 2XQ6A 5HEUA 4UM1A 2BG9B 1OEDB
chains in the Genus database with same CATH superfamily
4HQPA 4BFQA 3WTJA 3ANWA 4YLHA 4ZRUA 3HKCE 3T1YT 3RIUC 5JMEA 3ESLA 1XDPA 3C4ZA 5L47A 4AISA 3SQ9A 3MA9A 2J62A 3PE0A 1I9BA 5LB7B 2JJ9A 1QUUA 1YW0A 4JBWF 2PGZA 5LNKA 5C8YE 2XYTA 3U78A 4HEAA 3IBPA 1XWMA 2PFVA 1UX4A 2XSAA 3TLSA 3AEDA 2J47A 3Q5DA 3OJAA 2DL1A 3ZJ1A 4Z91A 1IJ5A 1SUMB 2LE8A 3K3QC 2WP9A 4YXDA 3VU7H 5LOVE 4XHEA 2OLTA 4IDPA 4COFA 2E9XB 4P09A 3AE6A 2UXXB 1SA0E 3B5MA 4U74A 5LP6E 3T1HT 2FJBA 4DNDA 4X1IE 2L8KA 2MOZA 4OK0A 5DJQC 1MNEA 4PW8A 2XSBA 3RYIE 3RIAA 2MPKA 2YMDA 2DHRA 5IWAT 1BR1A 1L0VA 3OYXA 4JI7T 5H6RB 3T8OA 4ZS3A 2MTQA 3NVOA 1KEYA 4DV7T 2BDEA 3AA0B 3FZKB 3CQCB 4JLEA 3AAEB 2NR4A 3DTOA 2X68A 4PFPA 3RC8A 3NZQA 2YKSA 2KNDA 4KX6A 3B13A 5E0OA 5L3DB 2PBIA 2V1DB 4FJOA 2Q9QD 2LSKA 2ACZA 4H9NC 2CWYA 4A98A 3LBXA 4AXPA 2WQYA 4UF0B 3UFEA 2RA1A 5HXCA 5KE4A 1KNPA 5LBMA 3U8MA 5BR8T 4X1YE 4BJMA 3RQUA 2X67A 2RPAA 4KP3C 3BQLA 1VCTA 2VKJA 3ZCIA 4EV6A 3FZHB 2IW5B 4P1NA 3A5XA 5LGTB 5JH7E 5FKYA 5LG3A 3O1JA 3RX6A 4EIWA 4LF8T 2W8GA 2Y6XA 4QWNB 3P4PA 4H9PC 4X64T 5J0ZA 4H63H 4O4JE 4EEBA 2VVNA 2FJDA 2KWHA 3NWIA 2UUAT 3PU3A 2MBGA 5FY1A 3MKDA 4CXXA 4JI5T 4CN4A 2UXNB 5J2TE 4ANJA 3LFMA 4L5GA 3EHZA 2X0YA 4I43B 5JDLA 1ZV4X 2H3RA 4HGAA 2JMKA 2OA5A 3PUVF 4DBRA 1OEDB 3EVYA 3I0OA 4DR4T 3UU6A 3N2OA 3QB5K 1U5PA 3AE8A 2IC6A 3HKDE 1ZP0A 4C91A 3H37A 2CBJA 2JIWA 2KXPB 4JYAT 5J5FA 4P0AA 2UXDT 3P50A 2L9QA 5AFKA 4ZOLE 5DABA 5L3CB 1O3XA 2ZM0A 3ABVA 4ILAA 4YSXA 5L3EB 4IL4A 3ETUA 4EZ1A 3N2GE 3F2EA 1WRDA 4QH1A 3ZMSB 3PTRB 2KINB 4JUYA 5LCYA 2LHNA 4GKKT 2CHOA 4IDNA 4TN7B 4F8HA 3AA7B 5AQOB 5AQUB 3AVSA 4PJLA 3R84B 3FB2A 5EK2A 3FXDB 3ZLIA 1GQEA 1KNZA 4LF5T 5L4HA 1IBLT 5IYZE 4IDZA 2XTLA 2XQYA 2X00D 3PUZF 1LRZA 4PJJA 4B6XA 2XPKA 2A72A 3P4QA 5IHYA 1FIOA 2LJLA 1D0XA 4UY2A 2WZHA 2A3DA 3KBTA 3C51A 4U2YA 4ALXA 3N9OA 2NWBA 3A7MA 2M6BA 1CHUA 3SFEA 4NUVA 1MIYA 1J5ET 4K0UA 2FUPA 3JADA 1N36T 5A1LA 4IREA 5FXWA 4DR2T 5LXBA 2YU2A 4IE7A 2LSGA 2E9XD 1US7B 2WY2A 5AQTB 3PJAA 3UU8A 2ZM8A 4LF4T 1MMAA 2BYSA 4XAXB 4TX5A 4EZ4A 4ZI2D 2CM0A 2WM9A 2XAFB 2XM2A 2NW7A 5ABFA 3ZYLA 2NTXA 2I6HA 1VOMA 4AI6A 3WTIA 1YQ4A 4UXUA 1WLXA 5C3JA 3SWHA 1HG5A 3C4WA 1G73A 5AFHA 5JDNA 1OEDC 5DQVA 2EHOA 4O4IE 2XNUA 1ZEEA 2BBHA 2XQAA 3WI3A 2E9XA 5EZYE 2V7MA 2Y57A 4DVDA 4CN6A 3L09A 3ONLC 4B3MT 4EEDA 1D1CA 5FL1A 3L39A 3WTKA 4WW0A 2NP9A 2L3LA 3C50A 2VVSA 4I4TE 2CXLA 5LG4A 2YOEA 3U8NA 3FZFB 2CBIA 3MACA 3O1IA 1FEWA 2JQ9A 2LSYA 2DNXA 2XNTA 3O1HA 2QVAA 3M65A 2E8IA 4Z8XA 4LF6T 4N78D 4MBQA 1QLBA 2X0HA 3WTMA 4H9RC 2PH9A 2VASA 4JI2T 3AEFA 3V5SA 3LK2B 5FVKA 2V5CA 4ZHQE 1HS7A 1XMOT 5J5IA 3E22E 3AE4A 2Q9QB 4ISSA 1OEDE 3AAAB 2BVMA 4HWIB 2CE7A 3AXJB 4ZJTA 3I9WA 2J1DG 3LBXB 5SYOA 3NZPA 4TV8E 4MHCA 2NW9A 4UELA 2Y48B 4ZXLA 1J5WA 1IAPA 1BR2A 3ZC1A 3X1DA 2BYPA 3K3NA 2XQ3A 2ZMAA 3N2KE 2A2FX 4IDOA 2WMOA 1H7CA 4UV8B 4EB6E 5L3GB 4O2AE 5CJ5A 5AFJA 3PUGA 4NXMT 2BYNA 4HFHA 2YDSA 3VRAA 4UM3P 2J4GA 4I55E 2KLQA 4QABA 2HPLA 3SFDA 4DMVA 3GMIA 3OYZA 4ZS2A 3EABA 4UVBB 2WMNA 2BKPA 4GKJT 5HEUA 1ZHCA 3AEEA 2JQHA 1B7TA 3RLFF 1XMQT 4HWDA 4JI4T 3PV0F 2BG9C 4PNIA 4YHHT 4LMLA 3MK7C 4NXNT 2VKHA 3Q5WA 3Q5EA 5CO5A 4EZHA 3UUMA 3VHLA 4AQFC 3CPZA 3P4WA 4EYUA 4H9OC 2JMHA 4P0BA 3I0QA 3C4XA 5J1GA 5AQHB 2B1EA 1N33T 4WBNE 2QC1B 4DIDB 4QXBB 2X9HA 2V6YA 2G0UA 3ZMTB 2WBLA 4JEHB 3UU3A 4B5DA 4IGUA 5JVDE 3PUYF 1XNQT 1W0AA 3K1SA 1XDOA 4PK4A 2H7VC 2H7OA 2X66A 5JDQA 4CI1B 2CA5A 4GYRA 2UUCT 1MNDA 4QHOA 5AFMB 4ERRA 1G8XA 2XY8B 3HL6A 3JCFA 2UXCT 3RRWA 4I0UA 4E7ZA 2KSRA 1Z0PA 5JR9B 4UVAB 5ABHA 3CX7B 4OYKA 1IBMT 2XQ6A 3UULA 4JI1T 2IDOB 4LFBT 2BR7A 4ZK4A 4QX7B 1WR6A 2WWVA 2D9DA 4JI3T 5CA1E 1E7PA 3UTKA 5LJNA 3IF8B 5JRCA 3TLWA 3QC9A 2JRKA 3P4RA 1YXRA 4UM3A 4O8SA 4DV2T 4CQIA 2LT3A 1HCIA 2KMFA 5AQJB 3L8RA 1E2AA 3HKEE 2VL0A 5BW2A 5F5WA 3O9XA 3SIOA 5LBQB 2AXDS 3AE1A 1LKXA 5IUXA 3EUHA 3QNUA 3GN5A 4O2BE 1NWMX 4M1PA 2N9DA 4PIRA 4D01A 1CUNA 3ZN1B 4LMJA 3ZN0B 3ONXA 1WYBA 4FI5A 1UUSA 4ADZA 3C64A 5FXZA 3PUWF 2ES0A 2E9XC 2JQQA 2C5KT 2E2AA 2XQ4A 5LJMA 2X9YA 2V26A 5ETWA 2RP4A 2CWOA 4HFVA 4CZZB 4F6RC 5JDHA 4HWFA 4AFHA 2X00A 3UU5A 1J1JA 4NIQA 2BR8A 3GA8A 1HFAA 4LF7T 3CX8B 2EHOB 3KV9A 4UIGA 5L3FB 3QK6A 4TZ4C 3CWZB 4JI0T 2W0GA 2WAUA 1UX2A 4IIJE 1HR0T 5FXVA 5LA6E 1EZ3A 1WFDA 3PEOA 3NRXA 1T72A 3O4XE 4EYYR 4UV9B 4ZI3C 4KBMB 2QA7A 3N5LA 4U72A 3ZYKA 2BJ0A 2W67A 2UU9T 1T8BA 5KXJA 2WU2A 2WZYA 3FBLA 2XZ5A 2R6GF 3VR8A 3RF1A 1W9RA 4CI3B 3CK6A 3RGLA 5HEJA 3AXJA 5LHHB 4GYSA 2XQ5A 1OWAA 1N34T 3AVRA 2YMEA 4NPPA 4HKAA 4QXHB 3UUXB 3VKHA 3AE2A 1UGOA 2IIUA 4WBOA 4DV6T 4DUZT 4DUYT 4ZI2C 2YU1A 3KDSE 3EDUA 5FVLA 4UEMA 5AFNA 2I59A 5AQMB 2BYRA 3ANWB 1XNRT 1D0YA 3D0TA 4GK0E 2PG8A 4DO0A 3LG7A 4GK5E 1YQ3A 4UM1A 2FBWA 5LHGB 1I94T 5JDFA 4TWDA 1S35A 3RC3A 3N9MA 1JNRA 4AFTA 5AFUL 3VKGA 3PJAJ 5KX5E 3E0ZA 2UZ6A 4TV9E 3VRBA 4B3TT 5JR9C 2Y8DA 4QH5A 4DV4T 2NTYA 4AIUA 2LRKA 3K3OA 3SH1A 4QX8B 3RI5A 2WDRA 2VQET 2KWIB 2CMRA 5JTGA 2LKGA 2MAWA 5LXTE 4JI6T 4LF9T 1E1HB 5HCJA 5AQQB 4HFBA 4DR6T 4YTPA 1HF8A 3M3ZB 3ZDGA 4O4HE 4LFAT 1KF6A 3KV5A 4DV0T 5EK3A 2X9XA 2QGSA 5AQFB 2H89A 5FNVE 2W00A 2JQKA 4O4LE 5HYAA 1UURA 2K9AA 4AFGA 4DR3T 4I50E 3F57A 2IAKA 4L0RA 3OPCA 2XZ6A 1W09A 5AINA 5ABEA 2IMLA 5M4YA 3FZMB 5AQPB 3Q9DA 1T7SA 2N2NA 4G63A 3CMLA 4V1Av 5JREA 2WNCA 3KBUA 3K8PC 3UQ4A 2ZM6T 1DU2A 4X65T 2V6XA 4HE8A 2VB6A 3DP7A 3F31A 2DLRA 3ZKRA 2CCQA 3QOFA 5HEOA 4EXTA 3CKDA 4JEUB 3RRCA 2FJAA 2QYWA 5J2UE 1KNRA 2D2SA 2I0MA 1MMNA 1AJ3A 4JV5T 1LVFA 4UF0A 4UR9A 3EDVA 1YKHB 5JRCB 1SHZC 3ZSTA 1NAFA 4BAYB 4TWHA 1KK7A 2VURA 1HNWT 2XHEB 2W2UA 3CX6B 5AQSB 1MMDA 3ZT6A 4DV5T 4PK5A 1WCRA 2WU5A 5FY7A 2M6IA 2BG9A 3NKZA 3FZLB 3LK3B 5FJVA 2LM2A 3VR9A 1OEDA 2K24A 2BZBA 1D1AA 4OFZA 5FY0A 4YJ2E 2K48A 5F3JA 2XM1A 4ASKA 4HFCA 2UXBT 2B76A 1UX5A 2CXDA 2XZEA 2BS3A 2VKOA 2ZM2A 4B3ST 4HFDA 2LRLA 3RPUA 4EGWA 3AE3A 1D1BA 3RYFE 2N1GA 4QKNA 2F4VT 5CFBA 4YFSA 4DMWA 3U8KA 2YN6A 3H3MA 2K3WA 3BK9A 3P7IA 4X1KE 2Y54A 1I6ZA 5JDMA 2AE9A 4Q25A 4U3CA 2ZJUA 4H63V 3ZPOA 4ILBA 3OVUA 2LOPA 4ZZCA 3PU8A 3WTLA 4AKGA 2EHOD 5BP0A 4XK9A 2VKDA 4YSYA 3T4MA 4TUYE 3EI0A 4QACA 2W61A 2K5BB 4KHPT 3WTOA 1N32T 3BQKA 2CHNA 3N9QA 3HR0A 2WB5A 3Q5XA 1MIVA 3WAKA 1FJGT 5C2TA 4U2ZA 3ZCJA 3ZT7A 3RIUA 3TKLB 4A5XA 4CI2B 2Y58A 5TAOA 3UUNA 3NRYA 4AKRB 5CA0E 4WV9A 5LMNT 2XJ7A 2DCFA 3S4UA 3SQ6A 2DI4A 2XASB 3IHRA 4H9QC 1ZOYA 4J2CA 4L9IA 5ABGA 4ZJSA 3JAFA 2Y56A 4BA9A 2EHOC 3AA6B 5HXRA 3PUSA 3RYHE 3WAJA 2D5UA 3R6NA 3SS1A 3H3AA 2C9TA 2LSJA 5AQNB 4XBFB 2XYSA 2IC9A 3HI2A 4HN9A 2WZIA 4IL9A 2YK0A 1U4QA 3LDQB 4X5TA 2V7JA 4IHJE 4DR1T 4LFCT 3Q2MA 4CXWA 3EAMA 5LHIB 3AEGA 3LJCA 1WYCA 4G2AA 4OHFA 5DQWA 4DBMA 2WCAA 2HHHT 2SPCA 5FMNA 4GOUA 5HAXA 1XZYA 3WTNA 3LK42 5L4EA 3JC6C 2V8SV 2MYSA 2YDQA 3N9PA 5ABFB 3AE9A 3OBVE 4AKLA 5LGUB 2WN9A 2VL8A 4DR5T 4QAAA 2XQ7A 5L3BB 1QSDA 2CEAA 4CXYA 1HX1B 3CVRA 3U8JA 2XUEA 3ZYMA 4U33A 1SE7A 1NEKA 4X66T 2W66A 4AQGA 2XAQB 4YT0A 3KV4A 5J5HA 2XQ8A 5L2LA 4BQTA 4HWCA 5AQRB 2W63A 3ZMUB 2IHR1 1S94A 3CQXC 4YSZA 1WR0A 2BG9E 4TNWA 1Y64B 2Q9QA 1IJ6A 2ZLYA 1YKEB 5H6QB 4OX9T 3PUXF 4DV1T 3ZMZB 3C98B 2LSIA 3FHNA 4B3RT 2D0TA 4WNKA 4KI0F 3KINB 4TNVA 3QUJA 3UFGA 4PK6A 3AEBA 2LEHA 5AQIB 3JAEA 3RKGA 3ZT5A 3J7Yq 5BRXA 3C79A 2BYQA 4UVCB 3KFWX 4PAGA 2GK9A 5HEGA 3MZKB 4IE4A 4K0KT 2ODUA 3CIRA 5CGMA 2W62A 2DWGA 3ONJA 3HKBE 4ILCA 3SRZA 3RHWA 2HPJA 4U7YA 1HTJF 2HN2A 2PTFA 1BR0A 5LMUT 3IA3A 2BG9B 5KDMC 4HTEA 4WZXA 4IDQA 4YJ3E 2DWKA 3CQGB 2BKNA 2CLYC 2KT9A 3AEAA 3V5UA 4H9SE 4PJNA 3BQIA 4X20E 5AQKB 3RKOA 5HXEA 2XAJB 2CLYB 1HX8A 5EK4A 4IE6A 3PUQA 5AFLA 2PJQA 4ZEYA 2WS3A 5J5GA 2V7KA 4U7IA 2XQ9A 4ILUA 3MXZA 3N9LA 3RYCE 3N9NA 3U8LA 1M62A 4C90A 2X51A 4ISTA 2IUBA 2VWAA 4JI8T 3KVAA 3OTOT 1NENA 2FJEA 5ADXL 2P9BA 2M67A 2BVLA 2V7LA 3JC6D 2V6YB 3A8YC 2ZJVA 2HH7A 5AQVB 5FP3A 3AE7A 2ODVA 1OXZA 3RIFA 3SOLA 4E7SA 3DJBA 1LVKA 5JR9A 4AQFA 3AE5A 2CXFA 2ACXA 5BMVE 4AKIA 5HXHA 3B57A 1HG2A 3AECA 4HWHA 3FBZA 2H88A 5AFMA 4HFIA 2YINA 1UCUA 1IZNB 5HCMA 1UW6A 4MALA 3PMZA 3IGQA 2BS2A 1JNZA 1MMGA 4EOZB 1YD8G 4IE5A 5CB4E 2LHRA 1HNXT 3RH3A 2C0SA 2W4XA 4KUMB 4ZI3D 3I9YA 4DBQA 3J9X1 5LYJE 2OV9A 2XNVA 1X79A 2UUBT 2A9UA 4YY3T 4KMCA 4GIWA 1BR4A 4TWFA 3IEEA 3P8CD 2Y7YA 2JPFA 3L3PA 3ZMVB 3AAIA 2Q9QC 3GN5B 3ETVA 2QRXA 4LMKA 4MLKA 2NOXA 1FMVA 1M7KA 4A56A 5GONE 3WIPA 5FYMA 3TLUA 3WTHA 2LKHA 4ZI7E 2LOSA 1Z8UA 4QH4A 2BS4A 2XAGB 3ZSSA 2HN1A 2WDVA 2Z6EA 3UQ7A 4YTNA 4BJNA 5KMGP 4YHJA 3KVBA 4QXCB 2WSSV 5JDGA 5KZUA 4ZZBA 2E5VA 4DV3T 3ZC0A 2CPTA 2D0UA 4AQYT 4YTMA 4ZR6A 1MIWA 2YEVC 5AQGB 3ZDHA 4NZBA 4DR7T 4AKHA 3UT5E 1X9BA 4UM3S 5HWXA 4CN1A 2C5IT 1FMWA 4EAHA 1T98A 5FXXA 3RQWA 2X0LB 3GUAA 4IT4A 3HA4A 2WNLA 4IE0A 4MFRA 3UU4A 4X62T 2X9WA 3C84A 3PDYA 2KZ7B 1VCSA 3TLTA 3MJXA 5HWYA 1VRBA 3AB3B 2LLYA 1V9DA 3TLVA 3ZEFB 3E08A 1UV6A 5HXSA 3G06A 1IBKT 3AA1B 3QB5A 2VQFT 2E5LT 2LM9A 1W0BA 2WNJA 3KV6A 1Y01A 4PFOA 4KHZF 4UXNB 3W15B 5JQGE 3GWHA 1HNZT 1D0ZA 4XZCA 4FRRA 1ZKEA 2BBJA 5TVCA 2W8FA 4ZK1A 3U3IA 4HFEA 5LGNB 4OYJA 3P4SA 3ZJ2A 1KFYA 2V7IA 5F8PA 4PJMA 5FL0A 2VK9A 2WDQA 4WYVA 1UK5A 3UUBA 3OKQA 2NW8A 3I1AA 2YDRA 5HEHA 4NUUA 1R8IA 3FXEB 3PUAA 4Z90A 3LSVA 2BKOA 4A97A 2XAHB 2C5JA 2V5DA 4U31A 2WWUA 3PURA 3NBXX 2CRBA 5AQLB
chains in the Genus database with same CATH topology
2BR7A 2WNCA 4HFCA 4HQPA 3RQWA 4ZJSA 3GUAA 4UY2A 4ZK4A 3WTJA 3UQ4A 2YKSA 4BFQA 2YOEA 3U8NA 3UU6A 2WNLA 4ZRUA 3UU4A 3JAFA 5J5HA 1UX2A 4TWDA 2Y56A 3C84A 2XQ8A 4ALXA 2BG9C 2XNTA 4BQTA 4AFTA 5JMEA 3TLTA 4LMLA 4HFDA 2LLYA 5L47A 2M6BA 5CO5A 3SQ9A 2XNVA 2UZ6A 3TLVA 3TLWA 3WTMA 2PH9A 3ZKRA 2BG9E 4TNWA 4A98A 1I9BA 1UV6A 4UM3A 5CFBA 3P4WA 3PEOA 3JADA 3P50A 2C9TA 5J5FA 5HEOA 4TWFA 3U8KA 2XYSA 2PGZA 4IREA 5AFKA 4QH5A 2YN6A 5KE4A 5AFLA 2Y7YA 5LXBA 5J5GA 4IL9A 3U8MA 2Y54A 5J5IA 2XYTA 3RQUA 2WNJA 2VL0A 3SH1A 4X5TA 5BW2A 4ILAA 3RI5A 1OEDE 2BJ0A 2XQ9A 4LMKA 2QC1B 2ZJUA 3UU8A 3SIOA 3TLSA 4IL4A 4ILBA 4ZJTA 3U8LA 4EZ1A 2LKGA 4ZZCA 3EAMA 2MAWA 5IUXA 3WIPA 2BYSA 2WZYA 3TLUA 4Z91A 3WTLA 3WTHA 2XZ5A 2LKHA 4QH1A 4FRRA 5SYOA 5BP0A 4QH4A 4TWHA 3UU3A 4TNVA 5TVCA 4XK9A 5HCJA 4PIRA 4XHEA 4B5DA 2W8FA 4D01A 4ZK1A 4HFBA 4HFEA 4DBMA 3UQ7A 3T4MA 5LG3A 4LMJA 4COFA 3EI0A 4QACA 2W8GA 2ZJVA 3WTIA 3JAEA 4F8HA 3WTOA 3ZDGA 4UXUA 5J0ZA 2BYPA 3WTNA 5HEJA 3RIFA 5L4EA 5BRXA 2XQ3A 3C79A 2BYQA 5AFHA 3UUBA 2XQ5A 5KZUA 4ZZBA 1OEDC 2YMEA 5AFMB 4NPPA 5HEGA 2M6IA 2XNUA 2BG9A 2WN9A 5AFJA 2XQAA 5L4HA 2Y58A 2BYNA 4HFHA 5HEHA 4UM3P 4ZR6A 5FJVA 3RIAA 2LM2A 4AFGA 5AFNA 2XQ4A 4QAAA 2XQ7A 2Y57A 2YMDA 2KSRA 4WV9A 4QABA 1OEDA 4ILCA 2XZ6A 3ZDHA 2BYRA 4AFHA 4NZBA 2X00A 4Z90A 3LSVA 2X00D 5AFMA 3SQ6A 3UU5A 4HFIA 3RHWA 5AINA 3U8JA 3EHZA 5HCMA 4A97A 1UW6A 2BR8A 3PMZA 3IGQA 3WTKA 4UM3S 2XQ6A 5HEUA 4UM1A 2BG9B 1OEDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BR7 A;  2WNC A;  4HFC A;  4HQP A;  3RQW A;  4ZJS A;  3GUA A;  4UY2 A;  4ZK4 A;  3WTJ A;  3UQ4 A;  2YKS A;  4BFQ A;  2YOE A;  3U8N A;  3UU6 A;  2WNL A;  4ZRU A;  3UU4 A;  3JAF A;  5J5H A;  1UX2 A;  4TWD A;  2Y56 A;  3C84 A;  2XQ8 A;  4ALX A;  2BG9 C;  2XNT A;  4BQT A;  4AFT A;  5JME A;  3TLT A;  4LML A;  4HFD A;  2LLY A;  5L47 A;  2M6B A;  5CO5 A;  3SQ9 A;  2XNV A;  2UZ6 A;  3TLV A;  3TLW A;  3WTM A;  2PH9 A;  3ZKR A;  2BG9 E;  4TNW A;  4A98 A;  1I9B A;  1UV6 A;  4UM3 A;  5CFB A;  3P4W A;  3PEO A;  3JAD A;  3P50 A;  2C9T A;  5J5F A;  5HEO A;  4TWF A;  3U8K A;  2XYS A;  2PGZ A;  4IRE A;  5AFK A;  4QH5 A;  2YN6 A;  5KE4 A;  5AFL A;  2Y7Y A;  5LXB A;  5J5G A;  4IL9 A;  3U8M A;  2Y54 A;  5J5I A;  2XYT A;  3RQU A;  2WNJ A;  2VL0 A;  3SH1 A;  4X5T A;  5BW2 A;  4ILA A;  3RI5 A;  1OED E;  2BJ0 A;  2XQ9 A;  4LMK A;  2QC1 B;  2ZJU A;  3UU8 A;  3SIO A;  3TLS A;  4IL4 A;  4ILB A;  4ZJT A;  3U8L A;  4EZ1 A;  2LKG A;  4ZZC A;  3EAM A;  2MAW A;  5IUX A;  3WIP A;  2BYS A;  2WZY A;  3TLU A;  4Z91 A;  3WTL A;  3WTH A;  2XZ5 A;  2LKH A;  4QH1 A;  4FRR A;  5SYO A;  5BP0 A;  4QH4 A;  4TWH A;  3UU3 A;  4TNV A;  5TVC A;  4XK9 A;  5HCJ A;  4PIR A;  4XHE A;  4B5D A;  2W8F A;  4D01 A;  4ZK1 A;  4HFB A;  4HFE A;  4DBM A;  3UQ7 A;  3T4M A;  5LG3 A;  4LMJ A;  4COF A;  3EI0 A;  4QAC A;  2W8G A;  2ZJV A;  3WTI A;  3JAE A;  4F8H A;  3WTO A;  3ZDG A;  4UXU A;  5J0Z A;  2BYP A;  3WTN A;  5HEJ A;  3RIF A;  5L4E A;  5BRX A;  2XQ3 A;  3C79 A;  2BYQ A;  5AFH A;  3UUB A;  2XQ5 A;  5KZU A;  4ZZB A;  1OED C;  2YME A;  5AFM B;  4NPP A;  5HEG A;  2M6I A;  2XNU A;  2BG9 A;  2WN9 A;  5AFJ A;  2XQA A;  5L4H A;  2Y58 A;  2BYN A;  4HFH A;  5HEH A;  4UM3 P;  4ZR6 A;  5FJV A;  3RIA A;  2LM2 A;  4AFG A;  5AFN A;  2XQ4 A;  4QAA A;  2XQ7 A;  2Y57 A;  2YMD A;  2KSR A;  4WV9 A;  4QAB A;  1OED A;  4ILC A;  2XZ6 A;  3ZDH A;  2BYR A;  4AFH A;  4NZB A;  2X00 A;  4Z90 A;  3LSV A;  2X00 D;  5AFM A;  3SQ6 A;  3UU5 A;  4HFI A;  3RHW A;  5AIN A;  3U8J A;  3EHZ A;  5HCM A;  4A97 A;  1UW6 A;  2BR8 A;  3PMZ A;  3IGQ A;  3WTK A;  4UM3 S;  2XQ6 A;  5HEU A;  4UM1 A;  2BG9 B;  1OED B; 
#chains in the Genus database with same CATH topology
 4HQP A;  4BFQ A;  3WTJ A;  3ANW A;  4YLH A;  4ZRU A;  3HKC E;  3T1Y T;  3RIU C;  5JME A;  3ESL A;  1XDP A;  3C4Z A;  5L47 A;  4AIS A;  3SQ9 A;  3MA9 A;  2J62 A;  3PE0 A;  1I9B A;  5LB7 B;  2JJ9 A;  1QUU A;  1YW0 A;  4JBW F;  2PGZ A;  5LNK A;  5C8Y E;  2XYT A;  3U78 A;  4HEA A;  3IBP A;  1XWM A;  2PFV A;  1UX4 A;  2XSA A;  3TLS A;  3AED A;  2J47 A;  3Q5D A;  3OJA A;  2DL1 A;  3ZJ1 A;  4Z91 A;  1IJ5 A;  1SUM B;  2LE8 A;  3K3Q C;  2WP9 A;  4YXD A;  3VU7 H;  5LOV E;  4XHE A;  2OLT A;  4IDP A;  4COF A;  2E9X B;  4P09 A;  3AE6 A;  2UXX B;  1SA0 E;  3B5M A;  4U74 A;  5LP6 E;  3T1H T;  2FJB A;  4DND A;  4X1I E;  2L8K A;  2MOZ A;  4OK0 A;  5DJQ C;  1MNE A;  4PW8 A;  2XSB A;  3RYI E;  3RIA A;  2MPK A;  2YMD A;  2DHR A;  5IWA T;  1BR1 A;  1L0V A;  3OYX A;  4JI7 T;  5H6R B;  3T8O A;  4ZS3 A;  2MTQ A;  3NVO A;  1KEY A;  4DV7 T;  2BDE A;  3AA0 B;  3FZK B;  3CQC B;  4JLE A;  3AAE B;  2NR4 A;  3DTO A;  2X68 A;  4PFP A;  3RC8 A;  3NZQ A;  2YKS A;  2KND A;  4KX6 A;  3B13 A;  5E0O A;  5L3D B;  2PBI A;  2V1D B;  4FJO A;  2Q9Q D;  2LSK A;  2ACZ A;  4H9N C;  2CWY A;  4A98 A;  3LBX A;  4AXP A;  2WQY A;  4UF0 B;  3UFE A;  2RA1 A;  5HXC A;  5KE4 A;  1KNP A;  5LBM A;  3U8M A;  5BR8 T;  4X1Y E;  4BJM A;  3RQU A;  2X67 A;  2RPA A;  4KP3 C;  3BQL A;  1VCT A;  2VKJ A;  3ZCI A;  4EV6 A;  3FZH B;  2IW5 B;  4P1N A;  3A5X A;  5LGT B;  5JH7 E;  5FKY A;  5LG3 A;  3O1J A;  3RX6 A;  4EIW A;  4LF8 T;  2W8G A;  2Y6X A;  4QWN B;  3P4P A;  4H9P C;  4X64 T;  5J0Z A;  4H63 H;  4O4J E;  4EEB A;  2VVN A;  2FJD A;  2KWH A;  3NWI A;  2UUA T;  3PU3 A;  2MBG A;  5FY1 A;  3MKD A;  4CXX A;  4JI5 T;  4CN4 A;  2UXN B;  5J2T E;  4ANJ A;  3LFM A;  4L5G A;  3EHZ A;  2X0Y A;  4I43 B;  5JDL A;  1ZV4 X;  2H3R A;  4HGA A;  2JMK A;  2OA5 A;  3PUV F;  4DBR A;  1OED B;  3EVY A;  3I0O A;  4DR4 T;  3UU6 A;  3N2O A;  3QB5 K;  1U5P A;  3AE8 A;  2IC6 A;  3HKD E;  1ZP0 A;  4C91 A;  3H37 A;  2CBJ A;  2JIW A;  2KXP B;  4JYA T;  5J5F A;  4P0A A;  2UXD T;  3P50 A;  2L9Q A;  5AFK A;  4ZOL E;  5DAB A;  5L3C B;  1O3X A;  2ZM0 A;  3ABV A;  4ILA A;  4YSX A;  5L3E B;  4IL4 A;  3ETU A;  4EZ1 A;  3N2G E;  3F2E A;  1WRD A;  4QH1 A;  3ZMS B;  3PTR B;  2KIN B;  4JUY A;  5LCY A;  2LHN A;  4GKK T;  2CHO A;  4IDN A;  4TN7 B;  4F8H A;  3AA7 B;  5AQO B;  5AQU B;  3AVS A;  4PJL A;  3R84 B;  3FB2 A;  5EK2 A;  3FXD B;  3ZLI A;  1GQE A;  1KNZ A;  4LF5 T;  5L4H A;  1IBL T;  5IYZ E;  4IDZ A;  2XTL A;  2XQY A;  2X00 D;  3PUZ F;  1LRZ A;  4PJJ A;  4B6X A;  2XPK A;  2A72 A;  3P4Q A;  5IHY A;  1FIO A;  2LJL A;  1D0X A;  4UY2 A;  2WZH A;  2A3D A;  3KBT A;  3C51 A;  4U2Y A;  4ALX A;  3N9O A;  2NWB A;  3A7M A;  2M6B A;  1CHU A;  3SFE A;  4NUV A;  1MIY A;  1J5E T;  4K0U A;  2FUP A;  3JAD A;  1N36 T;  5A1L A;  4IRE A;  5FXW A;  4DR2 T;  5LXB A;  2YU2 A;  4IE7 A;  2LSG A;  2E9X D;  1US7 B;  2WY2 A;  5AQT B;  3PJA A;  3UU8 A;  2ZM8 A;  4LF4 T;  1MMA A;  2BYS A;  4XAX B;  4TX5 A;  4EZ4 A;  4ZI2 D;  2CM0 A;  2WM9 A;  2XAF B;  2XM2 A;  2NW7 A;  5ABF A;  3ZYL A;  2NTX A;  2I6H A;  1VOM A;  4AI6 A;  3WTI A;  1YQ4 A;  4UXU A;  1WLX A;  5C3J A;  3SWH A;  1HG5 A;  3C4W A;  1G73 A;  5AFH A;  5JDN A;  1OED C;  5DQV A;  2EHO A;  4O4I E;  2XNU A;  1ZEE A;  2BBH A;  2XQA A;  3WI3 A;  2E9X A;  5EZY E;  2V7M A;  2Y57 A;  4DVD A;  4CN6 A;  3L09 A;  3ONL C;  4B3M T;  4EED A;  1D1C A;  5FL1 A;  3L39 A;  3WTK A;  4WW0 A;  2NP9 A;  2L3L A;  3C50 A;  2VVS A;  4I4T E;  2CXL A;  5LG4 A;  2YOE A;  3U8N A;  3FZF B;  2CBI A;  3MAC A;  3O1I A;  1FEW A;  2JQ9 A;  2LSY A;  2DNX A;  2XNT A;  3O1H A;  2QVA A;  3M65 A;  2E8I A;  4Z8X A;  4LF6 T;  4N78 D;  4MBQ A;  1QLB A;  2X0H A;  3WTM A;  4H9R C;  2PH9 A;  2VAS A;  4JI2 T;  3AEF A;  3V5S A;  3LK2 B;  5FVK A;  2V5C A;  4ZHQ E;  1HS7 A;  1XMO T;  5J5I A;  3E22 E;  3AE4 A;  2Q9Q B;  4ISS A;  1OED E;  3AAA B;  2BVM A;  4HWI B;  2CE7 A;  3AXJ B;  4ZJT A;  3I9W A;  2J1D G;  3LBX B;  5SYO A;  3NZP A;  4TV8 E;  4MHC A;  2NW9 A;  4UEL A;  2Y48 B;  4ZXL A;  1J5W A;  1IAP A;  1BR2 A;  3ZC1 A;  3X1D A;  2BYP A;  3K3N A;  2XQ3 A;  2ZMA A;  3N2K E;  2A2F X;  4IDO A;  2WMO A;  1H7C A;  4UV8 B;  4EB6 E;  5L3G B;  4O2A E;  5CJ5 A;  5AFJ A;  3PUG A;  4NXM T;  2BYN A;  4HFH A;  2YDS A;  3VRA A;  4UM3 P;  2J4G A;  4I55 E;  2KLQ A;  4QAB A;  2HPL A;  3SFD A;  4DMV A;  3GMI A;  3OYZ A;  4ZS2 A;  3EAB A;  4UVB B;  2WMN A;  2BKP A;  4GKJ T;  5HEU A;  1ZHC A;  3AEE A;  2JQH A;  1B7T A;  3RLF F;  1XMQ T;  4HWD A;  4JI4 T;  3PV0 F;  2BG9 C;  4PNI A;  4YHH T;  4LML A;  3MK7 C;  4NXN T;  2VKH A;  3Q5W A;  3Q5E A;  5CO5 A;  4EZH A;  3UUM A;  3VHL A;  4AQF C;  3CPZ A;  3P4W A;  4EYU A;  4H9O C;  2JMH A;  4P0B A;  3I0Q A;  3C4X A;  5J1G A;  5AQH B;  2B1E A;  1N33 T;  4WBN E;  2QC1 B;  4DID B;  4QXB B;  2X9H A;  2V6Y A;  2G0U A;  3ZMT B;  2WBL A;  4JEH B;  3UU3 A;  4B5D A;  4IGU A;  5JVD E;  3PUY F;  1XNQ T;  1W0A A;  3K1S A;  1XDO A;  4PK4 A;  2H7V C;  2H7O A;  2X66 A;  5JDQ A;  4CI1 B;  2CA5 A;  4GYR A;  2UUC T;  1MND A;  4QHO A;  5AFM B;  4ERR A;  1G8X A;  2XY8 B;  3HL6 A;  3JCF A;  2UXC T;  3RRW A;  4I0U A;  4E7Z A;  2KSR A;  1Z0P A;  5JR9 B;  4UVA B;  5ABH A;  3CX7 B;  4OYK A;  1IBM T;  2XQ6 A;  3UUL A;  4JI1 T;  2IDO B;  4LFB T;  2BR7 A;  4ZK4 A;  4QX7 B;  1WR6 A;  2WWV A;  2D9D A;  4JI3 T;  5CA1 E;  1E7P A;  3UTK A;  5LJN A;  3IF8 B;  5JRC A;  3TLW A;  3QC9 A;  2JRK A;  3P4R A;  1YXR A;  4UM3 A;  4O8S A;  4DV2 T;  4CQI A;  2LT3 A;  1HCI A;  2KMF A;  5AQJ B;  3L8R A;  1E2A A;  3HKE E;  2VL0 A;  5BW2 A;  5F5W A;  3O9X A;  3SIO A;  5LBQ B;  2AXD S;  3AE1 A;  1LKX A;  5IUX A;  3EUH A;  3QNU A;  3GN5 A;  4O2B E;  1NWM X;  4M1P A;  2N9D A;  4PIR A;  4D01 A;  1CUN A;  3ZN1 B;  4LMJ A;  3ZN0 B;  3ONX A;  1WYB A;  4FI5 A;  1UUS A;  4ADZ A;  3C64 A;  5FXZ A;  3PUW F;  2ES0 A;  2E9X C;  2JQQ A;  2C5K T;  2E2A A;  2XQ4 A;  5LJM A;  2X9Y A;  2V26 A;  5ETW A;  2RP4 A;  2CWO A;  4HFV A;  4CZZ B;  4F6R C;  5JDH A;  4HWF A;  4AFH A;  2X00 A;  3UU5 A;  1J1J A;  4NIQ A;  2BR8 A;  3GA8 A;  1HFA A;  4LF7 T;  3CX8 B;  2EHO B;  3KV9 A;  4UIG A;  5L3F B;  3QK6 A;  4TZ4 C;  3CWZ B;  4JI0 T;  2W0G A;  2WAU A;  1UX2 A;  4IIJ E;  1HR0 T;  5FXV A;  5LA6 E;  1EZ3 A;  1WFD A;  3PEO A;  3NRX A;  1T72 A;  3O4X E;  4EYY R;  4UV9 B;  4ZI3 C;  4KBM B;  2QA7 A;  3N5L A;  4U72 A;  3ZYK A;  2BJ0 A;  2W67 A;  2UU9 T;  1T8B A;  5KXJ A;  2WU2 A;  2WZY A;  3FBL A;  2XZ5 A;  2R6G F;  3VR8 A;  3RF1 A;  1W9R A;  4CI3 B;  3CK6 A;  3RGL A;  5HEJ A;  3AXJ A;  5LHH B;  4GYS A;  2XQ5 A;  1OWA A;  1N34 T;  3AVR A;  2YME A;  4NPP A;  4HKA A;  4QXH B;  3UUX B;  3VKH A;  3AE2 A;  1UGO A;  2IIU A;  4WBO A;  4DV6 T;  4DUZ T;  4DUY T;  4ZI2 C;  2YU1 A;  3KDS E;  3EDU A;  5FVL A;  4UEM A;  5AFN A;  2I59 A;  5AQM B;  2BYR A;  3ANW B;  1XNR T;  1D0Y A;  3D0T A;  4GK0 E;  2PG8 A;  4DO0 A;  3LG7 A;  4GK5 E;  1YQ3 A;  4UM1 A;  2FBW A;  5LHG B;  1I94 T;  5JDF A;  4TWD A;  1S35 A;  3RC3 A;  3N9M A;  1JNR A;  4AFT A;  5AFU L;  3VKG A;  3PJA J;  5KX5 E;  3E0Z A;  2UZ6 A;  4TV9 E;  3VRB A;  4B3T T;  5JR9 C;  2Y8D A;  4QH5 A;  4DV4 T;  2NTY A;  4AIU A;  2LRK A;  3K3O A;  3SH1 A;  4QX8 B;  3RI5 A;  2WDR A;  2VQE T;  2KWI B;  2CMR A;  5JTG A;  2LKG A;  2MAW A;  5LXT E;  4JI6 T;  4LF9 T;  1E1H B;  5HCJ A;  5AQQ B;  4HFB A;  4DR6 T;  4YTP A;  1HF8 A;  3M3Z B;  3ZDG A;  4O4H E;  4LFA T;  1KF6 A;  3KV5 A;  4DV0 T;  5EK3 A;  2X9X A;  2QGS A;  5AQF B;  2H89 A;  5FNV E;  2W00 A;  2JQK A;  4O4L E;  5HYA A;  1UUR A;  2K9A A;  4AFG A;  4DR3 T;  4I50 E;  3F57 A;  2IAK A;  4L0R A;  3OPC A;  2XZ6 A;  1W09 A;  5AIN A;  5ABE A;  2IML A;  5M4Y A;  3FZM B;  5AQP B;  3Q9D A;  1T7S A;  2N2N A;  4G63 A;  3CML A;  4V1A v;  5JRE A;  2WNC A;  3KBU A;  3K8P C;  3UQ4 A;  2ZM6 T;  1DU2 A;  4X65 T;  2V6X A;  4HE8 A;  2VB6 A;  3DP7 A;  3F31 A;  2DLR A;  3ZKR A;  2CCQ A;  3QOF A;  5HEO A;  4EXT A;  3CKD A;  4JEU B;  3RRC A;  2FJA A;  2QYW A;  5J2U E;  1KNR A;  2D2S A;  2I0M A;  1MMN A;  1AJ3 A;  4JV5 T;  1LVF A;  4UF0 A;  4UR9 A;  3EDV A;  1YKH B;  5JRC B;  1SHZ C;  3ZST A;  1NAF A;  4BAY B;  4TWH A;  1KK7 A;  2VUR A;  1HNW T;  2XHE B;  2W2U A;  3CX6 B;  5AQS B;  1MMD A;  3ZT6 A;  4DV5 T;  4PK5 A;  1WCR A;  2WU5 A;  5FY7 A;  2M6I A;  2BG9 A;  3NKZ A;  3FZL B;  3LK3 B;  5FJV A;  2LM2 A;  3VR9 A;  1OED A;  2K24 A;  2BZB A;  1D1A A;  4OFZ A;  5FY0 A;  4YJ2 E;  2K48 A;  5F3J A;  2XM1 A;  4ASK A;  4HFC A;  2UXB T;  2B76 A;  1UX5 A;  2CXD A;  2XZE A;  2BS3 A;  2VKO A;  2ZM2 A;  4B3S T;  4HFD A;  2LRL A;  3RPU A;  4EGW A;  3AE3 A;  1D1B A;  3RYF E;  2N1G A;  4QKN A;  2F4V T;  5CFB A;  4YFS A;  4DMW A;  3U8K A;  2YN6 A;  3H3M A;  2K3W A;  3BK9 A;  3P7I A;  4X1K E;  2Y54 A;  1I6Z A;  5JDM A;  2AE9 A;  4Q25 A;  4U3C A;  2ZJU A;  4H63 V;  3ZPO A;  4ILB A;  3OVU A;  2LOP A;  4ZZC A;  3PU8 A;  3WTL A;  4AKG A;  2EHO D;  5BP0 A;  4XK9 A;  2VKD A;  4YSY A;  3T4M A;  4TUY E;  3EI0 A;  4QAC A;  2W61 A;  2K5B B;  4KHP T;  3WTO A;  1N32 T;  3BQK A;  2CHN A;  3N9Q A;  3HR0 A;  2WB5 A;  3Q5X A;  1MIV A;  3WAK A;  1FJG T;  5C2T A;  4U2Z A;  3ZCJ A;  3ZT7 A;  3RIU A;  3TKL B;  4A5X A;  4CI2 B;  2Y58 A;  5TAO A;  3UUN A;  3NRY A;  4AKR B;  5CA0 E;  4WV9 A;  5LMN T;  2XJ7 A;  2DCF A;  3S4U A;  3SQ6 A;  2DI4 A;  2XAS B;  3IHR A;  4H9Q C;  1ZOY A;  4J2C A;  4L9I A;  5ABG A;  4ZJS A;  3JAF A;  2Y56 A;  4BA9 A;  2EHO C;  3AA6 B;  5HXR A;  3PUS A;  3RYH E;  3WAJ A;  2D5U A;  3R6N A;  3SS1 A;  3H3A A;  2C9T A;  2LSJ A;  5AQN B;  4XBF B;  2XYS A;  2IC9 A;  3HI2 A;  4HN9 A;  2WZI A;  4IL9 A;  2YK0 A;  1U4Q A;  3LDQ B;  4X5T A;  2V7J A;  4IHJ E;  4DR1 T;  4LFC T;  3Q2M A;  4CXW A;  3EAM A;  5LHI B;  3AEG A;  3LJC A;  1WYC A;  4G2A A;  4OHF A;  5DQW A;  4DBM A;  2WCA A;  2HHH T;  2SPC A;  5FMN A;  4GOU A;  5HAX A;  1XZY A;  3WTN A;  3LK4 2;  5L4E A;  3JC6 C;  2V8S V;  2MYS A;  2YDQ A;  3N9P A;  5ABF B;  3AE9 A;  3OBV E;  4AKL A;  5LGU B;  2WN9 A;  2VL8 A;  4DR5 T;  4QAA A;  2XQ7 A;  5L3B B;  1QSD A;  2CEA A;  4CXY A;  1HX1 B;  3CVR A;  3U8J A;  2XUE A;  3ZYM A;  4U33 A;  1SE7 A;  1NEK A;  4X66 T;  2W66 A;  4AQG A;  2XAQ B;  4YT0 A;  3KV4 A;  5J5H A;  2XQ8 A;  5L2L A;  4BQT A;  4HWC A;  5AQR B;  2W63 A;  3ZMU B;  2IHR 1;  1S94 A;  3CQX C;  4YSZ A;  1WR0 A;  2BG9 E;  4TNW A;  1Y64 B;  2Q9Q A;  1IJ6 A;  2ZLY A;  1YKE B;  5H6Q B;  4OX9 T;  3PUX F;  4DV1 T;  3ZMZ B;  3C98 B;  2LSI A;  3FHN A;  4B3R T;  2D0T A;  4WNK A;  4KI0 F;  3KIN B;  4TNV A;  3QUJ A;  3UFG A;  4PK6 A;  3AEB A;  2LEH A;  5AQI B;  3JAE A;  3RKG A;  3ZT5 A;  3J7Y q;  5BRX A;  3C79 A;  2BYQ A;  4UVC B;  3KFW X;  4PAG A;  2GK9 A;  5HEG A;  3MZK B;  4IE4 A;  4K0K T;  2ODU A;  3CIR A;  5CGM A;  2W62 A;  2DWG A;  3ONJ A;  3HKB E;  4ILC A;  3SRZ A;  3RHW A;  2HPJ A;  4U7Y A;  1HTJ F;  2HN2 A;  2PTF A;  1BR0 A;  5LMU T;  3IA3 A;  2BG9 B;  5KDM C;  4HTE A;  4WZX A;  4IDQ A;  4YJ3 E;  2DWK A;  3CQG B;  2BKN A;  2CLY C;  2KT9 A;  3AEA A;  3V5U A;  4H9S E;  4PJN A;  3BQI A;  4X20 E;  5AQK B;  3RKO A;  5HXE A;  2XAJ B;  2CLY B;  1HX8 A;  5EK4 A;  4IE6 A;  3PUQ A;  5AFL A;  2PJQ A;  4ZEY A;  2WS3 A;  5J5G A;  2V7K A;  4U7I A;  2XQ9 A;  4ILU A;  3MXZ A;  3N9L A;  3RYC E;  3N9N A;  3U8L A;  1M62 A;  4C90 A;  2X51 A;  4IST A;  2IUB A;  2VWA A;  4JI8 T;  3KVA A;  3OTO T;  1NEN A;  2FJE A;  5ADX L;  2P9B A;  2M67 A;  2BVL A;  2V7L A;  3JC6 D;  2V6Y B;  3A8Y C;  2ZJV A;  2HH7 A;  5AQV B;  5FP3 A;  3AE7 A;  2ODV A;  1OXZ A;  3RIF A;  3SOL A;  4E7S A;  3DJB A;  1LVK A;  5JR9 A;  4AQF A;  3AE5 A;  2CXF A;  2ACX A;  5BMV E;  4AKI A;  5HXH A;  3B57 A;  1HG2 A;  3AEC A;  4HWH A;  3FBZ A;  2H88 A;  5AFM A;  4HFI A;  2YIN A;  1UCU A;  1IZN B;  5HCM A;  1UW6 A;  4MAL A;  3PMZ A;  3IGQ A;  2BS2 A;  1JNZ A;  1MMG A;  4EOZ B;  1YD8 G;  4IE5 A;  5CB4 E;  2LHR A;  1HNX T;  3RH3 A;  2C0S A;  2W4X A;  4KUM B;  4ZI3 D;  3I9Y A;  4DBQ A;  3J9X 1;  5LYJ E;  2OV9 A;  2XNV A;  1X79 A;  2UUB T;  2A9U A;  4YY3 T;  4KMC A;  4GIW A;  1BR4 A;  4TWF A;  3IEE A;  3P8C D;  2Y7Y A;  2JPF A;  3L3P A;  3ZMV B;  3AAI A;  2Q9Q C;  3GN5 B;  3ETV A;  2QRX A;  4LMK A;  4MLK A;  2NOX A;  1FMV A;  1M7K A;  4A56 A;  5GON E;  3WIP A;  5FYM A;  3TLU A;  3WTH A;  2LKH A;  4ZI7 E;  2LOS A;  1Z8U A;  4QH4 A;  2BS4 A;  2XAG B;  3ZSS A;  2HN1 A;  2WDV A;  2Z6E A;  3UQ7 A;  4YTN A;  4BJN A;  5KMG P;  4YHJ A;  3KVB A;  4QXC B;  2WSS V;  5JDG A;  5KZU A;  4ZZB A;  2E5V A;  4DV3 T;  3ZC0 A;  2CPT A;  2D0U A;  4AQY T;  4YTM A;  4ZR6 A;  1MIW A;  2YEV C;  5AQG B;  3ZDH A;  4NZB A;  4DR7 T;  4AKH A;  3UT5 E;  1X9B A;  4UM3 S;  5HWX A;  4CN1 A;  2C5I T;  1FMW A;  4EAH A;  1T98 A;  5FXX A;  3RQW A;  2X0L B;  3GUA A;  4IT4 A;  3HA4 A;  2WNL A;  4IE0 A;  4MFR A;  3UU4 A;  4X62 T;  2X9W A;  3C84 A;  3PDY A;  2KZ7 B;  1VCS A;  3TLT A;  3MJX A;  5HWY A;  1VRB A;  3AB3 B;  2LLY A;  1V9D A;  3TLV A;  3ZEF B;  3E08 A;  1UV6 A;  5HXS A;  3G06 A;  1IBK T;  3AA1 B;  3QB5 A;  2VQF T;  2E5L T;  2LM9 A;  1W0B A;  2WNJ A;  3KV6 A;  1Y01 A;  4PFO A;  4KHZ F;  4UXN B;  3W15 B;  5JQG E;  3GWH A;  1HNZ T;  1D0Z A;  4XZC A;  4FRR A;  1ZKE A;  2BBJ A;  5TVC A;  2W8F A;  4ZK1 A;  3U3I A;  4HFE A;  5LGN B;  4OYJ A;  3P4S A;  3ZJ2 A;  1KFY A;  2V7I A;  5F8P A;  4PJM A;  5FL0 A;  2VK9 A;  2WDQ A;  4WYV A;  1UK5 A;  3UUB A;  3OKQ A;  2NW8 A;  3I1A A;  2YDR A;  5HEH A;  4NUU A;  1R8I A;  3FXE B;  3PUA A;  4Z90 A;  3LSV A;  2BKO A;  4A97 A;  2XAH B;  2C5J A;  2V5D A;  4U31 A;  2WWU A;  3PUR A;  3NBX X;  2CRB A;  5AQL B; 
#chains in the Genus database with same CATH homology
 2BR7 A;  2WNC A;  4HFC A;  4HQP A;  3RQW A;  4ZJS A;  3GUA A;  4UY2 A;  4ZK4 A;  3WTJ A;  3UQ4 A;  2YKS A;  4BFQ A;  2YOE A;  3U8N A;  3UU6 A;  2WNL A;  4ZRU A;  3UU4 A;  3JAF A;  5J5H A;  1UX2 A;  4TWD A;  2Y56 A;  3C84 A;  2XQ8 A;  4ALX A;  2BG9 C;  2XNT A;  4BQT A;  4AFT A;  5JME A;  3TLT A;  4LML A;  4HFD A;  2LLY A;  5L47 A;  2M6B A;  5CO5 A;  3SQ9 A;  2XNV A;  2UZ6 A;  3TLV A;  3TLW A;  3WTM A;  2PH9 A;  3ZKR A;  2BG9 E;  4TNW A;  4A98 A;  1I9B A;  1UV6 A;  4UM3 A;  5CFB A;  3P4W A;  3PEO A;  3JAD A;  3P50 A;  2C9T A;  5J5F A;  5HEO A;  4TWF A;  3U8K A;  2XYS A;  2PGZ A;  4IRE A;  5AFK A;  4QH5 A;  2YN6 A;  5KE4 A;  5AFL A;  2Y7Y A;  5LXB A;  5J5G A;  4IL9 A;  3U8M A;  2Y54 A;  5J5I A;  2XYT A;  3RQU A;  2WNJ A;  2VL0 A;  3SH1 A;  4X5T A;  5BW2 A;  4ILA A;  3RI5 A;  1OED E;  2BJ0 A;  2XQ9 A;  4LMK A;  2QC1 B;  2ZJU A;  3UU8 A;  3SIO A;  3TLS A;  4IL4 A;  4ILB A;  4ZJT A;  3U8L A;  4EZ1 A;  2LKG A;  4ZZC A;  3EAM A;  2MAW A;  5IUX A;  3WIP A;  2BYS A;  2WZY A;  3TLU A;  4Z91 A;  3WTL A;  3WTH A;  2XZ5 A;  2LKH A;  4QH1 A;  4FRR A;  5SYO A;  5BP0 A;  4QH4 A;  4TWH A;  3UU3 A;  4TNV A;  5TVC A;  4XK9 A;  5HCJ A;  4PIR A;  4XHE A;  4B5D A;  2W8F A;  4D01 A;  4ZK1 A;  4HFB A;  4HFE A;  4DBM A;  3UQ7 A;  3T4M A;  5LG3 A;  4LMJ A;  4COF A;  3EI0 A;  4QAC A;  2W8G A;  2ZJV A;  3WTI A;  3JAE A;  4F8H A;  3WTO A;  3ZDG A;  4UXU A;  5J0Z A;  2BYP A;  3WTN A;  5HEJ A;  3RIF A;  5L4E A;  5BRX A;  2XQ3 A;  3C79 A;  2BYQ A;  5AFH A;  3UUB A;  2XQ5 A;  5KZU A;  4ZZB A;  1OED C;  2YME A;  5AFM B;  4NPP A;  5HEG A;  2M6I A;  2XNU A;  2BG9 A;  2WN9 A;  5AFJ A;  2XQA A;  5L4H A;  2Y58 A;  2BYN A;  4HFH A;  5HEH A;  4UM3 P;  4ZR6 A;  5FJV A;  3RIA A;  2LM2 A;  4AFG A;  5AFN A;  2XQ4 A;  4QAA A;  2XQ7 A;  2Y57 A;  2YMD A;  2KSR A;  4WV9 A;  4QAB A;  1OED A;  4ILC A;  2XZ6 A;  3ZDH A;  2BYR A;  4AFH A;  4NZB A;  2X00 A;  4Z90 A;  3LSV A;  2X00 D;  5AFM A;  3SQ6 A;  3UU5 A;  4HFI A;  3RHW A;  5AIN A;  3U8J A;  3EHZ A;  5HCM A;  4A97 A;  1UW6 A;  2BR8 A;  3PMZ A;  3IGQ A;  3WTK A;  4UM3 S;  2XQ6 A;  5HEU A;  4UM1 A;  2BG9 B;  1OED B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...