4LMJA

Glic liganded-closed-channel conformation, mutant t25'a
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKAPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Gating of the proton-gated ion channel from Gloeobacter violaceus at pH 4 as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 86
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4lmjA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4lmjA01
4XK9A 4TNVA 2ZJVA 4TWHA 2PH9A 2Y7YA 3C79A 3WTJA 3SH1A 5HCJA 4XHEA 5J5GA 3C84A 5HCMA 3SIOA 5J5IA 4TWFA 3P4WA 5LXBA 2WN9A 2WZYA 3U8MA 2PGZA 3UU6A 4QABA 3WTHA 4DBMA 5AINA 3JAEA 4Z90A 2XYTA 3UQ4A 4HFEA 2X00D 4QAAA 3U8KA 5HEHA 2UZ6A 4ILCA 4ZZCA 2XNVA 2W8GA 2Y54A 4HFBA 3JAFA 2WNLA 2BJ0A 3EI0A 4IREA 3U8NA 2LLYA 5J5FA 4LMLA 5BRXA 2BYRA 3UQ7A 4X5TA 2XQ8A 2XQ5A 5AFNA 5AFKA 5LG3A 2BG9E 2VL0A 4HFDA 2M6IA 2BYSA 4A97A 2X00A 2BG9B 5TVCA 5AFHA 2XNUA 2BG9C 3IGQA 4LMKA 5L4HA 2YN6A 2XZ6A 3GUAA 2LKGA 3RQUA 3P50A 3RI5A 1UX2A 4ILAA 4QH5A 4QH1A 4QACA 3TLVA 2XQ3A 2KSRA 1UV6A 2BR8A 5AFMA 4TWDA 4PIRA 3PMZA 4UM3P 3U8LA 4ZK1A 3ZDHA 4BQTA 4NZBA 3ZDGA 2XQ6A 3WTIA 5AFMB 5BP0A 5BW2A 4FRRA 3ZKRA 2W8FA 4BFQA 3UU3A 1OEDE 4HFCA 2BG9A 3WIPA 3SQ6A 3EAMA 2BYPA 3WTOA 5JMEA 4COFA 1OEDC 5HEJA 5HEGA 4UM1A 3TLTA 2QC1B 2XQ9A 4ZJSA 3SQ9A 2M6BA 4UY2A 5AFLA 4AFHA 2YKSA 5HEOA 5AFJA 4ZJTA 2LM2A 3TLSA 4HQPA 4AFTA 2XYSA 3U8JA 2XQ4A 2YOEA 4IL9A 4WV9A 4HFHA 4HFIA 3RIAA 5KE4A 3UUBA 4ZK4A 3WTKA 3PEOA 4IL4A 2YMDA 4QH4A 4AFGA 3JADA 2Y56A 2C9TA 2BR7A 5J0ZA 3TLWA 1OEDB 2WNJA 5SYOA 4F8HA 4ZZBA 3WTMA 3UU4A 2XQ7A 5CFBA 5FJVA 4ALXA 1UW6A 4EZ1A 4Z91A 2XNTA 3UU8A 4NPPA 2YMEA 5J5HA 4UM3A 2BYQA 5L4EA 3WTNA 4TNWA 2Y58A 5CO5A 4B5DA 4A98A 2LKHA 2XZ5A 3WTLA 5IUXA 2ZJUA 2WNCA 4D01A 4UM3S 1I9BA 3TLUA 2BYNA 3LSVA 5HEUA 4UXUA 3EHZA 2XQAA 1OEDA 5KZUA 3RIFA 3T4MA 3UU5A 4ZR6A 4ZRUA 4ILBA 3RQWA 2MAWA 2Y57A 5L47A 3RHWA 4LMJA
chains in the Genus database with same CATH superfamily
1MIYA 4ZXLA 3LBXB 2XM1A 4NXMT 5H6RB 2YK0A 1VRBA 2C5JA 3AEBA 1YW0A 4GYSA 3AEFA 4JEHB 3JAEA 5HEHA 3FZHB 3PUXF 3ZMUB 2FBWA 2FJEA 5AQPB 4LFCT 3PUVF 3N9NA 3KVAA 4B6XA 5JR9A 4EIWA 5AQUB 4AISA 3ZDGA 1HTJF 5L3FB 5BW2A 3OKQA 4KHPT 3C51A 2ZM6T 2XQYA 5LHIB 1V9DA 2WDRA 2XSBA 5LP6E 4IE7A 1QSDA 1FIOA 3WTKA 1LKXA 3H3AA 2NWBA 3EABA 1YKEB 1W09A 1OEDB 5ADXL 2E9XA 3WTMA 4LFAT 3PUQA 4ISSA 4IHJE 2LKHA 3NWIA 3SWHA 3RC8A 4AKRB 4PK6A 2KT9A 4L0RA 4B3ST 3EHZA 5KXJA 2A9UA 4ZRUA 2DHRA 2I59A 3AA6B 3N9QA 4UV9B 2N9DA 3WTHA 3KINB 2CRBA 1KK7A 2PBIA 1T98A 4U2ZA 5AFNA 2PTFA 5TVCA 1IJ5A 2BBJA 4A5XA 3AAEB 2DLRA 2PG8A 5L3DB 5AQFB 4WZXA 3U8LA 2B76A 1W0BA 5LYJE 2WY2A 2X68A 4HFCA 1KEYA 1R8IA 5JMEA 3FB2A 4HEAA 2QC1B 4FI5A 2EHOC 3C4WA 5C2TA 3N2GE 4MLKA 3A7MA 3KVBA 4AI6A 3N9PA 4LF6T 3EUHA 5AFUL 2BKOA 2XQ4A 4BJMA 2CCQA 3BQLA 3AE6A 4DNDA 3AE1A 4U74A 3LK3B 3P4PA 5J0ZA 4NUVA 2KINB 2WSSV 1VOMA 4MALA 2K24A 1B7TA 1QLBA 2CXDA 2NTYA 4CI2B 3V5UA 2EHOD 1MMDA 4UEMA 3AAAB 1CHUA 4PJNA 4UXUA 2XTLA 4E7ZA 2X51A 4AQFC 2QA7A 2D0UA 4WW0A 3RHWA 5JRCA 3C79A 4MBQA 2W0GA 3E08A 2K9AA 5KMGP 3NZQA 5F3JA 1E1HB 3PU8A 5FNVE 4HFBA 2K5BB 5J5FA 3U8NA 5BRXA 3KFWX 2JPFA 5AQLB 3C4XA 3LDQB 1W0AA 3ZJ2A 1J5WA 3ETVA 2LKGA 5AQGB 4LF8T 4KUMB 3DJBA 2BR8A 2WZHA 1NWMX 2JIWA 2IC9A 2DCFA 3RC3A 4OYKA 1BR1A 1WYCA 3EAMA 5IHYA 3KBUA 4C90A 1UGOA 3SFEA 5AFJA 2YDQA 4H63V 1UUSA 3Q5XA 4HFVA 1JNRA 2YINA 3L09A 4HWDA 2D0TA 2RP4A 3MJXA 2VL8A 5TAOA 2CM0A 2BVLA 2XQ7A 2Q9QA 4ALXA 3AVRA 4EZ1A 4LF5T 3VHLA 5J2TE 1SE7A 3BK9A 4KX6A 4HWFA 2XAGB 3ZSTA 3O1HA 5ABFB 2ZM2A 4DV4T 3T4MA 5HXHA 3T8OA 5AQIB 3ONXA 2VKOA 2JQ9A 3C84A 3MA9A 3RYIE 1XNQT 3AEGA 3RRWA 3C50A 4O8SA 5IWAT 4U31A 3UULA 2LSYA 2IW5B 3NRYA 3MKDA 3IGQA 3KV6A 4PNIA 2MYSA 5CJ5A 4TUYE 4QACA 1J5ET 4C91A 2WS3A 3AE2A 2L9QA 4EYYR 2WWUA 1ZOYA 3ZDHA 4BQTA 5AQHB 5AQMB 4K0UA 3ZKRA 3ZN0B 2W8FA 4A56A 1SA0E 3N5LA 2FJDA 4UM1A 1OEDC 2CHNA 4DBRA 5HXSA 2UUAT 2XQ9A 3X1DA 4ZI7E 2LM9A 1KF6A 2UXBT 4ZJTA 4AKLA 3PUZF 4NUUA 4DR3T 2XYSA 3HI2A 3U8JA 2VK9A 2R6GF 5C3JA 3PEOA 3ONJA 4LF9T 1KNZA 2X0YA 3TLWA 5JH7E 4JI1T 1XDPA 3CIRA 4XAXB 2VQET 2QVAA 3PTRB 1XMOT 1HG2A 5DQVA 2W62A 2E5VA 4O4HE 3U3IA 3QUJA 4QXHB 2JJ9A 2KWHA 3PJAA 1YQ3A 1MMGA 4L5GA 2IMLA 2CWOA 3IBPA 1LVKA 5HWYA 3SQ9A 4AIUA 3ZYMA 3TKLB 4TWHA 3AECA 4N78D 5EZYE 3SIOA 2J1DG 2WZYA 3U8MA 2NR4A 2UXCT 2CBIA 4HFEA 3FZKB 2LSJA 3IEEA 1WFDA 2WNLA 3FHNA 3EI0A 4UVBB 4EZHA 2X67A 3KBTA 4AKGA 2MTQA 3B57A 3FXEB 2AXDS 3O1JA 4QH5A 3EDUA 4KP3C 2WAUA 4PW8A 4KI0F 2BKNA 2C5IT 2BYPA 4QKNA 5LB7B 2J62A 3P4SA 1NEKA 2IAKA 3R84B 1Z0PA 3F31A 2HPJA 3CQCB 5LOVE 4ZS2A 1T7SA 3UU4A 3PJAJ 5J1GA 5KDMC 3M65A 2J47A 2A3DA 4NPPA 4UM3A 3A8YC 2PFVA 5L3CB 1NAFA 3LK42 4EOZB 2BS4A 1E2AA 2XY8B 2GK9A 5KZUA 4YSZA 2BDEA 3RRCA 1VCTA 2YDRA 2WMOA 2ZJVA 3HR0A 2ACZA 4UVCB 1AJ3A 3NVOA 4U7IA 2YU2A 3UTKA 5JR9B 2LSKA 2Y8DA 2V6XA 2A72A 3PE0A 3J7Yq 5L3BB 2V5CA 5F5WA 3AVSA 4I43B 4AQYT 3FZLB 3NBXX 2D2SA 3ZT6A 2V6YA 4HE8A 2UXDT 3WAJA 5AFHA 4LMKA 3RI5A 3K3NA 2XQ3A 4ISTA 4G2AA 2BBHA 1HNWT 5AFMA 4EZ4A 1N33T 2XSAA 1O3XA 2A2FX 4CXXA 4YY3T 5JREA 4NZBA 5AQRB 4EXTA 3CVRA 1T8BA 2WQYA 3SOLA 3WTOA 1D1BA 5HEGA 3VU7H 1GQEA 1Z8UA 3AA7B 4JI4T 5CA0E 5L3GB 5DABA 4O4JE 5JDHA 1XMQT 2ZLYA 1WRDA 4ZK4A 1XWMA 4Z8XA 3ZMSB 2DWGA 2XZEA 2FJAA 4GOUA 4LFBT 1HF8A 5SYOA 4TV9E 4X64T 2IC6A 3ONLC 1S35A 4Z91A 4YFSA 3UU8A 4YHJA 5L4EA 4DV7T 3WTNA 3ZMZB 3PURA 3I0OA 3PUGA 4HTEA 3OBVE 4MFRA 2FUPA 4P0AA 4H9QC 2LRKA 4IDNA 3LBXA 5FMNA 2MAWA 3N2KE 2VKDA 3K3OA 4UR9A 2VKHA 4AKIA 3C64A 3ZT7A 2E8IA 3PUSA 4J2CA 1MIWA 5JDGA 4U72A 2W2UA 3VR8A 4UVAB 2BS2A 2LOSA 4ILCA 4WNKA 4JV5T 1IZNB 2CA5A 2PJQA 2XQ8A 4X5TA 5LG3A 2X00A 5JDLA 1IBLT 3ESLA 3ANWA 3L39A 5LCYA 2LHRA 2ES0A 2XQ6A 3HA4A 1DU2A 1OEDE 1WYBA 5HEJA 4CZZB 2AE9A 4IDZA 4QX7B 3VR9A 3KV9A 3H3MA 3AE7A 4BAYB 3IHRA 3N9LA 3LFMA 1ZKEA 1HFAA 2H88A 4QH4A 4AFGA 1G73A 2C9TA 4UF0B 3C98B 1LVFA 2WNJA 2Z6EA 3AE9A 2V7IA 4CN1A 2YMEA 5JRCB 3CPZA 3VRBA 4PJJA 4HKAA 2WP9A 1ZHCA 2WZIA 3FBZA 1ZV4X 3ZN1B 3WI3A 5IYZE 3PV0F 3ZT5A 5HCMA 2PGZA 3AEAA 2XYTA 4JEUB 4ZZCA 4PK5A 2LLYA 2V8SV 2I0MA 2YEVC 1FEWA 4X66T 2VL0A 2WBLA 2LEHA 1FMWA 4EEBA 1UX5A 2BG9C 4UELA 4DV0T 1MNDA 4QH1A 4QXBB 1I94T 3O1IA 3B13A 4DBQA 5GONE 2WDQA 3RYHE 2J4GA 4XBFB 4ZS3A 3VRAA 5DQWA 3AE5A 1M62A 3OVUA 3AXJA 2Q9QB 4FJOA 4HQPA 4YJ3E 2YOEA 4IGUA 4P0BA 3QOFA 1UCUA 4F8HA 4IDQA 5FJVA 2HHHT 3QC9A 2ODVA 2CHOA 1Y01A 3SFDA 4IT4A 3AA0B 4EEDA 4B3MT 1US7B 2MBGA 4DVDA 4DV1T 2WU5A 2W4XA 3GN5A 1H7CA 4BA9A 2Y54A 4O2BE 3E22E 4O4LE 5ABEA 4JI6T 5FVKA 5LHHB 3DTOA 4ZI3C 5J5IA 2W67A 3UUXB 1D0XA 2WN9A 4JI8T 1UURA 4DBMA 5ABGA 2ZMAA 1MIVA 4WBOA 3V5SA 3RKGA 3PUAA 5L2LA 2DNXA 4UV8B 2JQHA 2UUBT 3ZC1A 3O4XE 4NXNT 4O4IE 2NW8A 2XNUA 2OLTA 3RLFF 4K0KT 2VKJA 2CPTA 4JLEA 5LBQB 4YT0A 5LJNA 4ZI3D 1UX4A 4G63A 1HNZT 3I1AA 4IDPA 3K3QC 2G0UA 3Q5EA 3PUYF 4DR1T 5FY0A 3AE8A 2YKSA 3UUNA 4DV6T 5BR8T 4HGAA 3W15B 4IDOA 2DI4A 5HAXA 5HWXA 4KBMB 5AQKB 4EB6E 3GA8A 2XAQB 4H9SE 4WYVA 4X65T 1HG5A 2H7VC 2XASB 1YKHB 3ZMTB 2VVSA 2XHEB 4DV2T 4GKKT 5HXRA 4DR6T 3HKBE 4QXCB 3SS1A 3WTLA 4YJ2E 5ABFA 4D01A 4JI0T 1N36T 4ZR6A 3RQWA 2Y57A 4EAHA 5L47A 4YTPA 2C0SA 5FKYA 2ODUA 1BR2A 5C8YE 5HCJA 5AQVB 1KNRA 3NKZA 5AINA 4IE5A 3U8KA 1ZP0A 1NENA 2UZ6A 2VB6A 2W8GA 3N9MA 3JAFA 4IREA 2KXPB 1G8XA 1KFYA 2XQ5A 5AQTB 3WAKA 2BYSA 2HH7A 2VASA 4B3RT 5HYAA 2V7KA 2ZM0A 2KSRA 4U3CA 2XUEA 2HN1A 4X1KE 3KDSE 5FXZA 3C4ZA 3PU3A 3CWZB 3SQ6A 4YTNA 3ZEFB 4COFA 1FMVA 2JQKA 2C5KT 2KWIB 5AQSB 3NZPA 4IL9A 1CUNA 1L0VA 2YMDA 5FVLA 1X79A 3PDYA 2LE8A 5LA6E 3ZMVB 2IIUA 1MMNA 5LBMA 3FZFB 1KNPA 4U2YA 4QHOA 4B5DA 2CEAA 2I6HA 2WNCA 1VCSA 4JI7T 2XPKA 2F4VT 3RIFA 2EHOA 2XAHB 2HN2A 4JYAT 3LG7A 2RPAA 2V6YB 3RPUA 1YXRA 4JI2T 5FP3A 1WR6A 4H9RC 4OFZA 3EDVA 5LGNB 2LHNA 4OYJA 3AB3B 2BG9E 2L8KA 2M6IA 3ZPOA 2QYWA 3N2OA 3ZLIA 3G06A 5LNKA 4QWNB 2W00A 3PMZA 4AQFA 4UIGA 3QB5A 3RYCE 1U5PA 4KHZF 5JDFA 2ZM8A 5EK4A 4BFQA 1WR0A 2X9WA 2BG9A 4TV8E 3JC6C 4QX8B 4YXDA 4AXPA 1I6ZA 2LM2A 3RF1A 3FBLA 2H89A 4DUYT 4TZ4C 4CN6A 2Q9QD 4GKJT 1D1CA 2KLQA 2E2AA 2V7JA 3IF8B 3CX7B 3HKCE 4HN9A 1HS7A 4LF7T 4OHFA 2LOPA 2E9XB 3JC6D 3O9XA 2ZJUA 3RH3A 2V7LA 3LSVA 4I50E 5DJQC 4Q25A 3OPCA 2K3WA 3ZYLA 4TNVA 3Q5DA 3N9OA 5JDMA 3AEDA 3WTJA 2V26A 4PJLA 1XDOA 4HWCA 4TWFA 2W63A 4ANJA 4DUZT 4QABA 3SRZA 4Z90A 4QAAA 3ANWB 3UFEA 3RYFE 2UXXB 3KV4A 2N2NA 4A97A 4MHCA 4ZOLE 4E7SA 5LJMA 5L4HA 2XZ6A 1IBKT 1YQ4A 5BMVE 2D5UA 2JQQA 1M7KA 3Q2MA 1XNRT 4UXNB 3ETUA 2QRXA 3CX8B 5EK3A 1SHZC 2X9YA 4I55E 1Y64B 2E5LT 2Y48B 3Q9DA 2VWAA 2VVNA 2LSIA 3PUWF 3T1HT 4ZJSA 1IJ6A 5HEOA 2BS3A 5FYMA 5KX5E 4U7YA 5HXCA 3AE3A 4HFHA 2NOXA 1W9RA 1BR4A 2KMFA 1T72A 2LJLA 2BR7A 4AQGA 3M3ZB 3RIUC 4PFPA 3MXZA 3ZJ1A 5CA1E 3MZKB 2CMRA 2XNTA 2BKPA 3EVYA 2VQFT 2WB5A 4X62T 1HNXT 2CWYA 4TNWA 3H37A 2NTXA 4YSYA 2FJBA 2BYNA 3ZCJA 1WLXA 1OEDA 4GYRA 1HCIA 4DV3T 4TX5A 3UFGA 2DL1A 3OYZA 2OV9A 5L3EB 3F2EA 4DR7T 2BZBA 3UQ4A 5FXWA 4GIWA 1N32T 4DR2T 3P8CD 2BJ0A 5AQQB 2BYRA 4XZCA 4HFDA 5JVDE 2IDOB 4HWIB 4HWHA 1X9BA 3VKGA 4H9PC 1ZEEA 2UU9T 2YN6A 1IAPA 2WM9A 3HKEE 5AQJB 1OXZA 2NP9A 3AXJB 4JI5T 1UK5A 4CQIA 4PIRA 4ZK1A 4ERRA 2CE7A 3F57A 4CXWA 2N1GA 4DMWA 4DR4T 2NW9A 4UY2A 4AFHA 3ZYKA 2BVMA 5LMUT 4PAGA 2OA5A 2B1EA 4HFIA 5LGTB 4UF0A 4X1IE 4ZHQE 3J9X1 4EV6A 2Y56A 3UUMA 1FJGT 4IE0A 4PJMA 2W66A 3GN5B 1UW6A 3K1SA 4EGWA 1IBMT 4TN7B 4DR5T 2Y58A 1J1JA 3BQKA 5JDNA 4CN4A 3E0ZA 4IE6A 3AEEA 2LSGA 2XQAA 4JBWF 3OTOT 3UU5A 2V7MA 4CXYA 3QK6A 4LMJA 4AKHA 2LT3A 5FY7A 3SH1A 2H3RA 4XHEA 3NRXA 2V1DB 3A5XA 5JR9C 2CLYB 5F8PA 2P9BA 2WWVA 5H6QB 5AQNB 1WCRA 4JUYA 2M67A 1HR0T 3D0TA 3OYXA 3RQUA 4BJNA 4ILAA 2W61A 5FXVA 4UM3P 1D1AA 3ZC0A 4PFOA 3UT5E 5BP0A 4FRRA 2IHR1 3UU3A 4I4TE 2WMNA 4ZEYA 2CBJA 5M4YA 2JMHA 5CB4E 2XAFB 5J2UE 5AFLA 2JRKA 4GK5E 5HXEA 2KZ7B 2E9XC 5LGUB 4B3TT 1LRZA 2UXNB 1D0YA 3I9WA 4I0UA 3HKDE 3UUBA 3KV5A 3R6NA 4PK4A 4OK0A 4P09A 4DO0A 3JADA 4YSXA 5ABHA 3L3PA 4U33A 4LF4T 1S94A 5LG4A 2LRLA 2D9DA 5CO5A 1YD8G 4CI3B 1MNEA 4UM3S 1D0ZA 2KNDA 2E9XD 3I0QA 2JMKA 3Q5WA 4GK0E 4ASKA 2XJ7A 4ILBA 3U78A 3RX6A 4CI1B 3GMIA 3RKOA 5J5GA 3QB5K 3BQIA 3UU6A 3CMLA 3T1YT 4WBNE 2X00D 3P4QA 2XNVA 3FXDB 2CXFA 4ILUA 4YTMA 2ACXA 3JCFA 2X66A 3UQ7A 5JQGE 1SUMB 5E0OA 3CK6A 4NIQA 2WCAA 3P50A 1UX2A 3TLVA 1N34T 1U4QA 1UV6A 1QUUA 1HX1B 3VKHA 5EK2A 4H9NC 3WIPA 4EYUA 2HPLA 2IUBA 1MMAA 2X9XA 3ZCIA 2V5DA 3AE4A 3LJCA 3TLSA 3CQGB 4V1Av 4KMCA 4WV9A 3IA3A 5KE4A 2YU1A 3S4UA 4P1NA 3AAIA 5LMNT 3GWHA 3I9YA 2Y6XA 2K48A 4ZZBA 1BR0A 2SPCA 3K8PC 3CKDA 5CFBA 2EHOB 3ZSSA 2NW7A 5J5HA 2BYQA 2UUCT 4M1PA 4DV5T 2XZ5A 4YLHA 2MPKA 2H7OA 4IIJE 3RIUA 5HEUA 5FXXA 5A1LA 3OJAA 4ADZA 5JDQA 3QNUA 2X0LB 2MOZA 1E7PA 4JI3T 2QGSA 4ZI2C 4XK9A 5AQOB 2PH9A 2Y7YA 3MACA 5FY1A 3FZMB 3LK2B 3P4RA 2XAJB 3P4WA 5LXBA 4X20E 5CGMA 5ETWA 2L3LA 2YDSA 3MK7C 2DWKA 5LXTE 4DIDB 4LMLA 4L9IA 5AFKA 3RGLA 3HL6A 2BG9B 3CX6B 1OWAA 4ZI2D 3GUAA 4OX9T 5FL1A 4X1YE 4TWDA 3WTIA 5AFMB 2X9HA 2XM2A 4F6RC 3B5MA 3TLTA 3CQXC 2M6BA 5JTGA 4IE4A 2Q9QC 4AFTA 3L8RA 2RA1A 3RIAA 4YHHT 4IL4A 2WDVA 2CXLA 3P7IA 3ABVA 1XZYA 4O2AE 4DMVA 5LHGB 3AA1B 2X0HA 1EZ3A 4H63H 4A98A 2WU2A 5IUXA 1I9BA 2CLYC 3TLUA 1JNZA 4H9OC 2VURA 1HX8A 5FL0A 3DP7A
chains in the Genus database with same CATH topology
4XK9A 4TNVA 2ZJVA 4TWHA 2PH9A 2Y7YA 3C79A 3WTJA 3SH1A 5HCJA 4XHEA 5J5GA 3C84A 5HCMA 3SIOA 5J5IA 4TWFA 3P4WA 5LXBA 2WN9A 2WZYA 3U8MA 2PGZA 3UU6A 4QABA 3WTHA 4DBMA 5AINA 3JAEA 4Z90A 2XYTA 3UQ4A 4HFEA 2X00D 4QAAA 3U8KA 5HEHA 2UZ6A 4ILCA 4ZZCA 2XNVA 2W8GA 2Y54A 4HFBA 3JAFA 2WNLA 2BJ0A 3EI0A 4IREA 3U8NA 2LLYA 5J5FA 4LMLA 5BRXA 2BYRA 3UQ7A 4X5TA 2XQ8A 2XQ5A 5AFNA 5AFKA 5LG3A 2BG9E 2VL0A 4HFDA 2M6IA 2BYSA 4A97A 2X00A 2BG9B 5TVCA 5AFHA 2XNUA 2BG9C 3IGQA 4LMKA 5L4HA 2YN6A 2XZ6A 3GUAA 2LKGA 3RQUA 3P50A 3RI5A 1UX2A 4ILAA 4QH5A 4QH1A 4QACA 3TLVA 2XQ3A 2KSRA 1UV6A 2BR8A 5AFMA 4TWDA 4PIRA 3PMZA 4UM3P 3U8LA 4ZK1A 3ZDHA 4BQTA 4NZBA 3ZDGA 2XQ6A 3WTIA 5AFMB 5BP0A 5BW2A 4FRRA 3ZKRA 2W8FA 4BFQA 3UU3A 1OEDE 4HFCA 2BG9A 3WIPA 3SQ6A 3EAMA 2BYPA 3WTOA 5JMEA 4COFA 1OEDC 5HEJA 5HEGA 4UM1A 3TLTA 2QC1B 2XQ9A 4ZJSA 3SQ9A 2M6BA 4UY2A 5AFLA 4AFHA 2YKSA 5HEOA 5AFJA 4ZJTA 2LM2A 3TLSA 4HQPA 4AFTA 2XYSA 3U8JA 2XQ4A 2YOEA 4IL9A 4WV9A 4HFHA 4HFIA 3RIAA 5KE4A 3UUBA 4ZK4A 3WTKA 3PEOA 4IL4A 2YMDA 4QH4A 4AFGA 3JADA 2Y56A 2C9TA 2BR7A 5J0ZA 3TLWA 1OEDB 2WNJA 5SYOA 4F8HA 4ZZBA 3WTMA 3UU4A 2XQ7A 5CFBA 5FJVA 4ALXA 1UW6A 4EZ1A 4Z91A 2XNTA 3UU8A 4NPPA 2YMEA 5J5HA 4UM3A 2BYQA 5L4EA 3WTNA 4TNWA 2Y58A 5CO5A 4B5DA 4A98A 2LKHA 2XZ5A 3WTLA 5IUXA 2ZJUA 2WNCA 4D01A 4UM3S 1I9BA 3TLUA 2BYNA 3LSVA 5HEUA 4UXUA 3EHZA 2XQAA 1OEDA 5KZUA 3RIFA 3T4MA 3UU5A 4ZR6A 4ZRUA 4ILBA 3RQWA 2MAWA 2Y57A 5L47A 3RHWA 4LMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XK9 A;  4TNV A;  2ZJV A;  4TWH A;  2PH9 A;  2Y7Y A;  3C79 A;  3WTJ A;  3SH1 A;  5HCJ A;  4XHE A;  5J5G A;  3C84 A;  5HCM A;  3SIO A;  5J5I A;  4TWF A;  3P4W A;  5LXB A;  2WN9 A;  2WZY A;  3U8M A;  2PGZ A;  3UU6 A;  4QAB A;  3WTH A;  4DBM A;  5AIN A;  3JAE A;  4Z90 A;  2XYT A;  3UQ4 A;  4HFE A;  2X00 D;  4QAA A;  3U8K A;  5HEH A;  2UZ6 A;  4ILC A;  4ZZC A;  2XNV A;  2W8G A;  2Y54 A;  4HFB A;  3JAF A;  2WNL A;  2BJ0 A;  3EI0 A;  4IRE A;  3U8N A;  2LLY A;  5J5F A;  4LML A;  5BRX A;  2BYR A;  3UQ7 A;  4X5T A;  2XQ8 A;  2XQ5 A;  5AFN A;  5AFK A;  5LG3 A;  2BG9 E;  2VL0 A;  4HFD A;  2M6I A;  2BYS A;  4A97 A;  2X00 A;  2BG9 B;  5TVC A;  5AFH A;  2XNU A;  2BG9 C;  3IGQ A;  4LMK A;  5L4H A;  2YN6 A;  2XZ6 A;  3GUA A;  2LKG A;  3RQU A;  3P50 A;  3RI5 A;  1UX2 A;  4ILA A;  4QH5 A;  4QH1 A;  4QAC A;  3TLV A;  2XQ3 A;  2KSR A;  1UV6 A;  2BR8 A;  5AFM A;  4TWD A;  4PIR A;  3PMZ A;  4UM3 P;  3U8L A;  4ZK1 A;  3ZDH A;  4BQT A;  4NZB A;  3ZDG A;  2XQ6 A;  3WTI A;  5AFM B;  5BP0 A;  5BW2 A;  4FRR A;  3ZKR A;  2W8F A;  4BFQ A;  3UU3 A;  1OED E;  4HFC A;  2BG9 A;  3WIP A;  3SQ6 A;  3EAM A;  2BYP A;  3WTO A;  5JME A;  4COF A;  1OED C;  5HEJ A;  5HEG A;  4UM1 A;  3TLT A;  2QC1 B;  2XQ9 A;  4ZJS A;  3SQ9 A;  2M6B A;  4UY2 A;  5AFL A;  4AFH A;  2YKS A;  5HEO A;  5AFJ A;  4ZJT A;  2LM2 A;  3TLS A;  4HQP A;  4AFT A;  2XYS A;  3U8J A;  2XQ4 A;  2YOE A;  4IL9 A;  4WV9 A;  4HFH A;  4HFI A;  3RIA A;  5KE4 A;  3UUB A;  4ZK4 A;  3WTK A;  3PEO A;  4IL4 A;  2YMD A;  4QH4 A;  4AFG A;  3JAD A;  2Y56 A;  2C9T A;  2BR7 A;  5J0Z A;  3TLW A;  1OED B;  2WNJ A;  5SYO A;  4F8H A;  4ZZB A;  3WTM A;  3UU4 A;  2XQ7 A;  5CFB A;  5FJV A;  4ALX A;  1UW6 A;  4EZ1 A;  4Z91 A;  2XNT A;  3UU8 A;  4NPP A;  2YME A;  5J5H A;  4UM3 A;  2BYQ A;  5L4E A;  3WTN A;  4TNW A;  2Y58 A;  5CO5 A;  4B5D A;  4A98 A;  2LKH A;  2XZ5 A;  3WTL A;  5IUX A;  2ZJU A;  2WNC A;  4D01 A;  4UM3 S;  1I9B A;  3TLU A;  2BYN A;  3LSV A;  5HEU A;  4UXU A;  3EHZ A;  2XQA A;  1OED A;  5KZU A;  3RIF A;  3T4M A;  3UU5 A;  4ZR6 A;  4ZRU A;  4ILB A;  3RQW A;  2MAW A;  2Y57 A;  5L47 A;  3RHW A;  4LMJ A; 
#chains in the Genus database with same CATH topology
 1MIY A;  4ZXL A;  3LBX B;  2XM1 A;  4NXM T;  5H6R B;  2YK0 A;  1VRB A;  2C5J A;  3AEB A;  1YW0 A;  4GYS A;  3AEF A;  4JEH B;  3JAE A;  5HEH A;  3FZH B;  3PUX F;  3ZMU B;  2FBW A;  2FJE A;  5AQP B;  4LFC T;  3PUV F;  3N9N A;  3KVA A;  4B6X A;  5JR9 A;  4EIW A;  5AQU B;  4AIS A;  3ZDG A;  1HTJ F;  5L3F B;  5BW2 A;  3OKQ A;  4KHP T;  3C51 A;  2ZM6 T;  2XQY A;  5LHI B;  1V9D A;  2WDR A;  2XSB A;  5LP6 E;  4IE7 A;  1QSD A;  1FIO A;  3WTK A;  1LKX A;  3H3A A;  2NWB A;  3EAB A;  1YKE B;  1W09 A;  1OED B;  5ADX L;  2E9X A;  3WTM A;  4LFA T;  3PUQ A;  4ISS A;  4IHJ E;  2LKH A;  3NWI A;  3SWH A;  3RC8 A;  4AKR B;  4PK6 A;  2KT9 A;  4L0R A;  4B3S T;  3EHZ A;  5KXJ A;  2A9U A;  4ZRU A;  2DHR A;  2I59 A;  3AA6 B;  3N9Q A;  4UV9 B;  2N9D A;  3WTH A;  3KIN B;  2CRB A;  1KK7 A;  2PBI A;  1T98 A;  4U2Z A;  5AFN A;  2PTF A;  5TVC A;  1IJ5 A;  2BBJ A;  4A5X A;  3AAE B;  2DLR A;  2PG8 A;  5L3D B;  5AQF B;  4WZX A;  3U8L A;  2B76 A;  1W0B A;  5LYJ E;  2WY2 A;  2X68 A;  4HFC A;  1KEY A;  1R8I A;  5JME A;  3FB2 A;  4HEA A;  2QC1 B;  4FI5 A;  2EHO C;  3C4W A;  5C2T A;  3N2G E;  4MLK A;  3A7M A;  3KVB A;  4AI6 A;  3N9P A;  4LF6 T;  3EUH A;  5AFU L;  2BKO A;  2XQ4 A;  4BJM A;  2CCQ A;  3BQL A;  3AE6 A;  4DND A;  3AE1 A;  4U74 A;  3LK3 B;  3P4P A;  5J0Z A;  4NUV A;  2KIN B;  2WSS V;  1VOM A;  4MAL A;  2K24 A;  1B7T A;  1QLB A;  2CXD A;  2NTY A;  4CI2 B;  3V5U A;  2EHO D;  1MMD A;  4UEM A;  3AAA B;  1CHU A;  4PJN A;  4UXU A;  2XTL A;  4E7Z A;  2X51 A;  4AQF C;  2QA7 A;  2D0U A;  4WW0 A;  3RHW A;  5JRC A;  3C79 A;  4MBQ A;  2W0G A;  3E08 A;  2K9A A;  5KMG P;  3NZQ A;  5F3J A;  1E1H B;  3PU8 A;  5FNV E;  4HFB A;  2K5B B;  5J5F A;  3U8N A;  5BRX A;  3KFW X;  2JPF A;  5AQL B;  3C4X A;  3LDQ B;  1W0A A;  3ZJ2 A;  1J5W A;  3ETV A;  2LKG A;  5AQG B;  4LF8 T;  4KUM B;  3DJB A;  2BR8 A;  2WZH A;  1NWM X;  2JIW A;  2IC9 A;  2DCF A;  3RC3 A;  4OYK A;  1BR1 A;  1WYC A;  3EAM A;  5IHY A;  3KBU A;  4C90 A;  1UGO A;  3SFE A;  5AFJ A;  2YDQ A;  4H63 V;  1UUS A;  3Q5X A;  4HFV A;  1JNR A;  2YIN A;  3L09 A;  4HWD A;  2D0T A;  2RP4 A;  3MJX A;  2VL8 A;  5TAO A;  2CM0 A;  2BVL A;  2XQ7 A;  2Q9Q A;  4ALX A;  3AVR A;  4EZ1 A;  4LF5 T;  3VHL A;  5J2T E;  1SE7 A;  3BK9 A;  4KX6 A;  4HWF A;  2XAG B;  3ZST A;  3O1H A;  5ABF B;  2ZM2 A;  4DV4 T;  3T4M A;  5HXH A;  3T8O A;  5AQI B;  3ONX A;  2VKO A;  2JQ9 A;  3C84 A;  3MA9 A;  3RYI E;  1XNQ T;  3AEG A;  3RRW A;  3C50 A;  4O8S A;  5IWA T;  4U31 A;  3UUL A;  2LSY A;  2IW5 B;  3NRY A;  3MKD A;  3IGQ A;  3KV6 A;  4PNI A;  2MYS A;  5CJ5 A;  4TUY E;  4QAC A;  1J5E T;  4C91 A;  2WS3 A;  3AE2 A;  2L9Q A;  4EYY R;  2WWU A;  1ZOY A;  3ZDH A;  4BQT A;  5AQH B;  5AQM B;  4K0U A;  3ZKR A;  3ZN0 B;  2W8F A;  4A56 A;  1SA0 E;  3N5L A;  2FJD A;  4UM1 A;  1OED C;  2CHN A;  4DBR A;  5HXS A;  2UUA T;  2XQ9 A;  3X1D A;  4ZI7 E;  2LM9 A;  1KF6 A;  2UXB T;  4ZJT A;  4AKL A;  3PUZ F;  4NUU A;  4DR3 T;  2XYS A;  3HI2 A;  3U8J A;  2VK9 A;  2R6G F;  5C3J A;  3PEO A;  3ONJ A;  4LF9 T;  1KNZ A;  2X0Y A;  3TLW A;  5JH7 E;  4JI1 T;  1XDP A;  3CIR A;  4XAX B;  2VQE T;  2QVA A;  3PTR B;  1XMO T;  1HG2 A;  5DQV A;  2W62 A;  2E5V A;  4O4H E;  3U3I A;  3QUJ A;  4QXH B;  2JJ9 A;  2KWH A;  3PJA A;  1YQ3 A;  1MMG A;  4L5G A;  2IML A;  2CWO A;  3IBP A;  1LVK A;  5HWY A;  3SQ9 A;  4AIU A;  3ZYM A;  3TKL B;  4TWH A;  3AEC A;  4N78 D;  5EZY E;  3SIO A;  2J1D G;  2WZY A;  3U8M A;  2NR4 A;  2UXC T;  2CBI A;  4HFE A;  3FZK B;  2LSJ A;  3IEE A;  1WFD A;  2WNL A;  3FHN A;  3EI0 A;  4UVB B;  4EZH A;  2X67 A;  3KBT A;  4AKG A;  2MTQ A;  3B57 A;  3FXE B;  2AXD S;  3O1J A;  4QH5 A;  3EDU A;  4KP3 C;  2WAU A;  4PW8 A;  4KI0 F;  2BKN A;  2C5I T;  2BYP A;  4QKN A;  5LB7 B;  2J62 A;  3P4S A;  1NEK A;  2IAK A;  3R84 B;  1Z0P A;  3F31 A;  2HPJ A;  3CQC B;  5LOV E;  4ZS2 A;  1T7S A;  3UU4 A;  3PJA J;  5J1G A;  5KDM C;  3M65 A;  2J47 A;  2A3D A;  4NPP A;  4UM3 A;  3A8Y C;  2PFV A;  5L3C B;  1NAF A;  3LK4 2;  4EOZ B;  2BS4 A;  1E2A A;  2XY8 B;  2GK9 A;  5KZU A;  4YSZ A;  2BDE A;  3RRC A;  1VCT A;  2YDR A;  2WMO A;  2ZJV A;  3HR0 A;  2ACZ A;  4UVC B;  1AJ3 A;  3NVO A;  4U7I A;  2YU2 A;  3UTK A;  5JR9 B;  2LSK A;  2Y8D A;  2V6X A;  2A72 A;  3PE0 A;  3J7Y q;  5L3B B;  2V5C A;  5F5W A;  3AVS A;  4I43 B;  4AQY T;  3FZL B;  3NBX X;  2D2S A;  3ZT6 A;  2V6Y A;  4HE8 A;  2UXD T;  3WAJ A;  5AFH A;  4LMK A;  3RI5 A;  3K3N A;  2XQ3 A;  4IST A;  4G2A A;  2BBH A;  1HNW T;  5AFM A;  4EZ4 A;  1N33 T;  2XSA A;  1O3X A;  2A2F X;  4CXX A;  4YY3 T;  5JRE A;  4NZB A;  5AQR B;  4EXT A;  3CVR A;  1T8B A;  2WQY A;  3SOL A;  3WTO A;  1D1B A;  5HEG A;  3VU7 H;  1GQE A;  1Z8U A;  3AA7 B;  4JI4 T;  5CA0 E;  5L3G B;  5DAB A;  4O4J E;  5JDH A;  1XMQ T;  2ZLY A;  1WRD A;  4ZK4 A;  1XWM A;  4Z8X A;  3ZMS B;  2DWG A;  2XZE A;  2FJA A;  4GOU A;  4LFB T;  1HF8 A;  5SYO A;  4TV9 E;  4X64 T;  2IC6 A;  3ONL C;  1S35 A;  4Z91 A;  4YFS A;  3UU8 A;  4YHJ A;  5L4E A;  4DV7 T;  3WTN A;  3ZMZ B;  3PUR A;  3I0O A;  3PUG A;  4HTE A;  3OBV E;  4MFR A;  2FUP A;  4P0A A;  4H9Q C;  2LRK A;  4IDN A;  3LBX A;  5FMN A;  2MAW A;  3N2K E;  2VKD A;  3K3O A;  4UR9 A;  2VKH A;  4AKI A;  3C64 A;  3ZT7 A;  2E8I A;  3PUS A;  4J2C A;  1MIW A;  5JDG A;  4U72 A;  2W2U A;  3VR8 A;  4UVA B;  2BS2 A;  2LOS A;  4ILC A;  4WNK A;  4JV5 T;  1IZN B;  2CA5 A;  2PJQ A;  2XQ8 A;  4X5T A;  5LG3 A;  2X00 A;  5JDL A;  1IBL T;  3ESL A;  3ANW A;  3L39 A;  5LCY A;  2LHR A;  2ES0 A;  2XQ6 A;  3HA4 A;  1DU2 A;  1OED E;  1WYB A;  5HEJ A;  4CZZ B;  2AE9 A;  4IDZ A;  4QX7 B;  3VR9 A;  3KV9 A;  3H3M A;  3AE7 A;  4BAY B;  3IHR A;  3N9L A;  3LFM A;  1ZKE A;  1HFA A;  2H88 A;  4QH4 A;  4AFG A;  1G73 A;  2C9T A;  4UF0 B;  3C98 B;  1LVF A;  2WNJ A;  2Z6E A;  3AE9 A;  2V7I A;  4CN1 A;  2YME A;  5JRC B;  3CPZ A;  3VRB A;  4PJJ A;  4HKA A;  2WP9 A;  1ZHC A;  2WZI A;  3FBZ A;  1ZV4 X;  3ZN1 B;  3WI3 A;  5IYZ E;  3PV0 F;  3ZT5 A;  5HCM A;  2PGZ A;  3AEA A;  2XYT A;  4JEU B;  4ZZC A;  4PK5 A;  2LLY A;  2V8S V;  2I0M A;  2YEV C;  1FEW A;  4X66 T;  2VL0 A;  2WBL A;  2LEH A;  1FMW A;  4EEB A;  1UX5 A;  2BG9 C;  4UEL A;  4DV0 T;  1MND A;  4QH1 A;  4QXB B;  1I94 T;  3O1I A;  3B13 A;  4DBQ A;  5GON E;  2WDQ A;  3RYH E;  2J4G A;  4XBF B;  4ZS3 A;  3VRA A;  5DQW A;  3AE5 A;  1M62 A;  3OVU A;  3AXJ A;  2Q9Q B;  4FJO A;  4HQP A;  4YJ3 E;  2YOE A;  4IGU A;  4P0B A;  3QOF A;  1UCU A;  4F8H A;  4IDQ A;  5FJV A;  2HHH T;  3QC9 A;  2ODV A;  2CHO A;  1Y01 A;  3SFD A;  4IT4 A;  3AA0 B;  4EED A;  4B3M T;  1US7 B;  2MBG A;  4DVD A;  4DV1 T;  2WU5 A;  2W4X A;  3GN5 A;  1H7C A;  4BA9 A;  2Y54 A;  4O2B E;  3E22 E;  4O4L E;  5ABE A;  4JI6 T;  5FVK A;  5LHH B;  3DTO A;  4ZI3 C;  5J5I A;  2W67 A;  3UUX B;  1D0X A;  2WN9 A;  4JI8 T;  1UUR A;  4DBM A;  5ABG A;  2ZMA A;  1MIV A;  4WBO A;  3V5S A;  3RKG A;  3PUA A;  5L2L A;  2DNX A;  4UV8 B;  2JQH A;  2UUB T;  3ZC1 A;  3O4X E;  4NXN T;  4O4I E;  2NW8 A;  2XNU A;  2OLT A;  3RLF F;  4K0K T;  2VKJ A;  2CPT A;  4JLE A;  5LBQ B;  4YT0 A;  5LJN A;  4ZI3 D;  1UX4 A;  4G63 A;  1HNZ T;  3I1A A;  4IDP A;  3K3Q C;  2G0U A;  3Q5E A;  3PUY F;  4DR1 T;  5FY0 A;  3AE8 A;  2YKS A;  3UUN A;  4DV6 T;  5BR8 T;  4HGA A;  3W15 B;  4IDO A;  2DI4 A;  5HAX A;  5HWX A;  4KBM B;  5AQK B;  4EB6 E;  3GA8 A;  2XAQ B;  4H9S E;  4WYV A;  4X65 T;  1HG5 A;  2H7V C;  2XAS B;  1YKH B;  3ZMT B;  2VVS A;  2XHE B;  4DV2 T;  4GKK T;  5HXR A;  4DR6 T;  3HKB E;  4QXC B;  3SS1 A;  3WTL A;  4YJ2 E;  5ABF A;  4D01 A;  4JI0 T;  1N36 T;  4ZR6 A;  3RQW A;  2Y57 A;  4EAH A;  5L47 A;  4YTP A;  2C0S A;  5FKY A;  2ODU A;  1BR2 A;  5C8Y E;  5HCJ A;  5AQV B;  1KNR A;  3NKZ A;  5AIN A;  4IE5 A;  3U8K A;  1ZP0 A;  1NEN A;  2UZ6 A;  2VB6 A;  2W8G A;  3N9M A;  3JAF A;  4IRE A;  2KXP B;  1G8X A;  1KFY A;  2XQ5 A;  5AQT B;  3WAK A;  2BYS A;  2HH7 A;  2VAS A;  4B3R T;  5HYA A;  2V7K A;  2ZM0 A;  2KSR A;  4U3C A;  2XUE A;  2HN1 A;  4X1K E;  3KDS E;  5FXZ A;  3C4Z A;  3PU3 A;  3CWZ B;  3SQ6 A;  4YTN A;  3ZEF B;  4COF A;  1FMV A;  2JQK A;  2C5K T;  2KWI B;  5AQS B;  3NZP A;  4IL9 A;  1CUN A;  1L0V A;  2YMD A;  5FVL A;  1X79 A;  3PDY A;  2LE8 A;  5LA6 E;  3ZMV B;  2IIU A;  1MMN A;  5LBM A;  3FZF B;  1KNP A;  4U2Y A;  4QHO A;  4B5D A;  2CEA A;  2I6H A;  2WNC A;  1VCS A;  4JI7 T;  2XPK A;  2F4V T;  3RIF A;  2EHO A;  2XAH B;  2HN2 A;  4JYA T;  3LG7 A;  2RPA A;  2V6Y B;  3RPU A;  1YXR A;  4JI2 T;  5FP3 A;  1WR6 A;  4H9R C;  4OFZ A;  3EDV A;  5LGN B;  2LHN A;  4OYJ A;  3AB3 B;  2BG9 E;  2L8K A;  2M6I A;  3ZPO A;  2QYW A;  3N2O A;  3ZLI A;  3G06 A;  5LNK A;  4QWN B;  2W00 A;  3PMZ A;  4AQF A;  4UIG A;  3QB5 A;  3RYC E;  1U5P A;  4KHZ F;  5JDF A;  2ZM8 A;  5EK4 A;  4BFQ A;  1WR0 A;  2X9W A;  2BG9 A;  4TV8 E;  3JC6 C;  4QX8 B;  4YXD A;  4AXP A;  1I6Z A;  2LM2 A;  3RF1 A;  3FBL A;  2H89 A;  4DUY T;  4TZ4 C;  4CN6 A;  2Q9Q D;  4GKJ T;  1D1C A;  2KLQ A;  2E2A A;  2V7J A;  3IF8 B;  3CX7 B;  3HKC E;  4HN9 A;  1HS7 A;  4LF7 T;  4OHF A;  2LOP A;  2E9X B;  3JC6 D;  3O9X A;  2ZJU A;  3RH3 A;  2V7L A;  3LSV A;  4I50 E;  5DJQ C;  4Q25 A;  3OPC A;  2K3W A;  3ZYL A;  4TNV A;  3Q5D A;  3N9O A;  5JDM A;  3AED A;  3WTJ A;  2V26 A;  4PJL A;  1XDO A;  4HWC A;  4TWF A;  2W63 A;  4ANJ A;  4DUZ T;  4QAB A;  3SRZ A;  4Z90 A;  4QAA A;  3ANW B;  3UFE A;  3RYF E;  2UXX B;  3KV4 A;  2N2N A;  4A97 A;  4MHC A;  4ZOL E;  4E7S A;  5LJM A;  5L4H A;  2XZ6 A;  1IBK T;  1YQ4 A;  5BMV E;  2D5U A;  2JQQ A;  1M7K A;  3Q2M A;  1XNR T;  4UXN B;  3ETU A;  2QRX A;  3CX8 B;  5EK3 A;  1SHZ C;  2X9Y A;  4I55 E;  1Y64 B;  2E5L T;  2Y48 B;  3Q9D A;  2VWA A;  2VVN A;  2LSI A;  3PUW F;  3T1H T;  4ZJS A;  1IJ6 A;  5HEO A;  2BS3 A;  5FYM A;  5KX5 E;  4U7Y A;  5HXC A;  3AE3 A;  4HFH A;  2NOX A;  1W9R A;  1BR4 A;  2KMF A;  1T72 A;  2LJL A;  2BR7 A;  4AQG A;  3M3Z B;  3RIU C;  4PFP A;  3MXZ A;  3ZJ1 A;  5CA1 E;  3MZK B;  2CMR A;  2XNT A;  2BKP A;  3EVY A;  2VQF T;  2WB5 A;  4X62 T;  1HNX T;  2CWY A;  4TNW A;  3H37 A;  2NTX A;  4YSY A;  2FJB A;  2BYN A;  3ZCJ A;  1WLX A;  1OED A;  4GYR A;  1HCI A;  4DV3 T;  4TX5 A;  3UFG A;  2DL1 A;  3OYZ A;  2OV9 A;  5L3E B;  3F2E A;  4DR7 T;  2BZB A;  3UQ4 A;  5FXW A;  4GIW A;  1N32 T;  4DR2 T;  3P8C D;  2BJ0 A;  5AQQ B;  2BYR A;  4XZC A;  4HFD A;  5JVD E;  2IDO B;  4HWI B;  4HWH A;  1X9B A;  3VKG A;  4H9P C;  1ZEE A;  2UU9 T;  2YN6 A;  1IAP A;  2WM9 A;  3HKE E;  5AQJ B;  1OXZ A;  2NP9 A;  3AXJ B;  4JI5 T;  1UK5 A;  4CQI A;  4PIR A;  4ZK1 A;  4ERR A;  2CE7 A;  3F57 A;  4CXW A;  2N1G A;  4DMW A;  4DR4 T;  2NW9 A;  4UY2 A;  4AFH A;  3ZYK A;  2BVM A;  5LMU T;  4PAG A;  2OA5 A;  2B1E A;  4HFI A;  5LGT B;  4UF0 A;  4X1I E;  4ZHQ E;  3J9X 1;  4EV6 A;  2Y56 A;  3UUM A;  1FJG T;  4IE0 A;  4PJM A;  2W66 A;  3GN5 B;  1UW6 A;  3K1S A;  4EGW A;  1IBM T;  4TN7 B;  4DR5 T;  2Y58 A;  1J1J A;  3BQK A;  5JDN A;  4CN4 A;  3E0Z A;  4IE6 A;  3AEE A;  2LSG A;  2XQA A;  4JBW F;  3OTO T;  3UU5 A;  2V7M A;  4CXY A;  3QK6 A;  4LMJ A;  4AKH A;  2LT3 A;  5FY7 A;  3SH1 A;  2H3R A;  4XHE A;  3NRX A;  2V1D B;  3A5X A;  5JR9 C;  2CLY B;  5F8P A;  2P9B A;  2WWV A;  5H6Q B;  5AQN B;  1WCR A;  4JUY A;  2M67 A;  1HR0 T;  3D0T A;  3OYX A;  3RQU A;  4BJN A;  4ILA A;  2W61 A;  5FXV A;  4UM3 P;  1D1A A;  3ZC0 A;  4PFO A;  3UT5 E;  5BP0 A;  4FRR A;  2IHR 1;  3UU3 A;  4I4T E;  2WMN A;  4ZEY A;  2CBJ A;  5M4Y A;  2JMH A;  5CB4 E;  2XAF B;  5J2U E;  5AFL A;  2JRK A;  4GK5 E;  5HXE A;  2KZ7 B;  2E9X C;  5LGU B;  4B3T T;  1LRZ A;  2UXN B;  1D0Y A;  3I9W A;  4I0U A;  3HKD E;  3UUB A;  3KV5 A;  3R6N A;  4PK4 A;  4OK0 A;  4P09 A;  4DO0 A;  3JAD A;  4YSX A;  5ABH A;  3L3P A;  4U33 A;  4LF4 T;  1S94 A;  5LG4 A;  2LRL A;  2D9D A;  5CO5 A;  1YD8 G;  4CI3 B;  1MNE A;  4UM3 S;  1D0Z A;  2KND A;  2E9X D;  3I0Q A;  2JMK A;  3Q5W A;  4GK0 E;  4ASK A;  2XJ7 A;  4ILB A;  3U78 A;  3RX6 A;  4CI1 B;  3GMI A;  3RKO A;  5J5G A;  3QB5 K;  3BQI A;  3UU6 A;  3CML A;  3T1Y T;  4WBN E;  2X00 D;  3P4Q A;  2XNV A;  3FXD B;  2CXF A;  4ILU A;  4YTM A;  2ACX A;  3JCF A;  2X66 A;  3UQ7 A;  5JQG E;  1SUM B;  5E0O A;  3CK6 A;  4NIQ A;  2WCA A;  3P50 A;  1UX2 A;  3TLV A;  1N34 T;  1U4Q A;  1UV6 A;  1QUU A;  1HX1 B;  3VKH A;  5EK2 A;  4H9N C;  3WIP A;  4EYU A;  2HPL A;  2IUB A;  1MMA A;  2X9X A;  3ZCI A;  2V5D A;  3AE4 A;  3LJC A;  3TLS A;  3CQG B;  4V1A v;  4KMC A;  4WV9 A;  3IA3 A;  5KE4 A;  2YU1 A;  3S4U A;  4P1N A;  3AAI A;  5LMN T;  3GWH A;  3I9Y A;  2Y6X A;  2K48 A;  4ZZB A;  1BR0 A;  2SPC A;  3K8P C;  3CKD A;  5CFB A;  2EHO B;  3ZSS A;  2NW7 A;  5J5H A;  2BYQ A;  2UUC T;  4M1P A;  4DV5 T;  2XZ5 A;  4YLH A;  2MPK A;  2H7O A;  4IIJ E;  3RIU A;  5HEU A;  5FXX A;  5A1L A;  3OJA A;  4ADZ A;  5JDQ A;  3QNU A;  2X0L B;  2MOZ A;  1E7P A;  4JI3 T;  2QGS A;  4ZI2 C;  4XK9 A;  5AQO B;  2PH9 A;  2Y7Y A;  3MAC A;  5FY1 A;  3FZM B;  3LK2 B;  3P4R A;  2XAJ B;  3P4W A;  5LXB A;  4X20 E;  5CGM A;  5ETW A;  2L3L A;  2YDS A;  3MK7 C;  2DWK A;  5LXT E;  4DID B;  4LML A;  4L9I A;  5AFK A;  3RGL A;  3HL6 A;  2BG9 B;  3CX6 B;  1OWA A;  4ZI2 D;  3GUA A;  4OX9 T;  5FL1 A;  4X1Y E;  4TWD A;  3WTI A;  5AFM B;  2X9H A;  2XM2 A;  4F6R C;  3B5M A;  3TLT A;  3CQX C;  2M6B A;  5JTG A;  4IE4 A;  2Q9Q C;  4AFT A;  3L8R A;  2RA1 A;  3RIA A;  4YHH T;  4IL4 A;  2WDV A;  2CXL A;  3P7I A;  3ABV A;  1XZY A;  4O2A E;  4DMV A;  5LHG B;  3AA1 B;  2X0H A;  1EZ3 A;  4H63 H;  4A98 A;  2WU2 A;  5IUX A;  1I9B A;  2CLY C;  3TLU A;  1JNZ A;  4H9O C;  2VUR A;  1HX8 A;  5FL0 A;  3DP7 A; 
#chains in the Genus database with same CATH homology
 4XK9 A;  4TNV A;  2ZJV A;  4TWH A;  2PH9 A;  2Y7Y A;  3C79 A;  3WTJ A;  3SH1 A;  5HCJ A;  4XHE A;  5J5G A;  3C84 A;  5HCM A;  3SIO A;  5J5I A;  4TWF A;  3P4W A;  5LXB A;  2WN9 A;  2WZY A;  3U8M A;  2PGZ A;  3UU6 A;  4QAB A;  3WTH A;  4DBM A;  5AIN A;  3JAE A;  4Z90 A;  2XYT A;  3UQ4 A;  4HFE A;  2X00 D;  4QAA A;  3U8K A;  5HEH A;  2UZ6 A;  4ILC A;  4ZZC A;  2XNV A;  2W8G A;  2Y54 A;  4HFB A;  3JAF A;  2WNL A;  2BJ0 A;  3EI0 A;  4IRE A;  3U8N A;  2LLY A;  5J5F A;  4LML A;  5BRX A;  2BYR A;  3UQ7 A;  4X5T A;  2XQ8 A;  2XQ5 A;  5AFN A;  5AFK A;  5LG3 A;  2BG9 E;  2VL0 A;  4HFD A;  2M6I A;  2BYS A;  4A97 A;  2X00 A;  2BG9 B;  5TVC A;  5AFH A;  2XNU A;  2BG9 C;  3IGQ A;  4LMK A;  5L4H A;  2YN6 A;  2XZ6 A;  3GUA A;  2LKG A;  3RQU A;  3P50 A;  3RI5 A;  1UX2 A;  4ILA A;  4QH5 A;  4QH1 A;  4QAC A;  3TLV A;  2XQ3 A;  2KSR A;  1UV6 A;  2BR8 A;  5AFM A;  4TWD A;  4PIR A;  3PMZ A;  4UM3 P;  3U8L A;  4ZK1 A;  3ZDH A;  4BQT A;  4NZB A;  3ZDG A;  2XQ6 A;  3WTI A;  5AFM B;  5BP0 A;  5BW2 A;  4FRR A;  3ZKR A;  2W8F A;  4BFQ A;  3UU3 A;  1OED E;  4HFC A;  2BG9 A;  3WIP A;  3SQ6 A;  3EAM A;  2BYP A;  3WTO A;  5JME A;  4COF A;  1OED C;  5HEJ A;  5HEG A;  4UM1 A;  3TLT A;  2QC1 B;  2XQ9 A;  4ZJS A;  3SQ9 A;  2M6B A;  4UY2 A;  5AFL A;  4AFH A;  2YKS A;  5HEO A;  5AFJ A;  4ZJT A;  2LM2 A;  3TLS A;  4HQP A;  4AFT A;  2XYS A;  3U8J A;  2XQ4 A;  2YOE A;  4IL9 A;  4WV9 A;  4HFH A;  4HFI A;  3RIA A;  5KE4 A;  3UUB A;  4ZK4 A;  3WTK A;  3PEO A;  4IL4 A;  2YMD A;  4QH4 A;  4AFG A;  3JAD A;  2Y56 A;  2C9T A;  2BR7 A;  5J0Z A;  3TLW A;  1OED B;  2WNJ A;  5SYO A;  4F8H A;  4ZZB A;  3WTM A;  3UU4 A;  2XQ7 A;  5CFB A;  5FJV A;  4ALX A;  1UW6 A;  4EZ1 A;  4Z91 A;  2XNT A;  3UU8 A;  4NPP A;  2YME A;  5J5H A;  4UM3 A;  2BYQ A;  5L4E A;  3WTN A;  4TNW A;  2Y58 A;  5CO5 A;  4B5D A;  4A98 A;  2LKH A;  2XZ5 A;  3WTL A;  5IUX A;  2ZJU A;  2WNC A;  4D01 A;  4UM3 S;  1I9B A;  3TLU A;  2BYN A;  3LSV A;  5HEU A;  4UXU A;  3EHZ A;  2XQA A;  1OED A;  5KZU A;  3RIF A;  3T4M A;  3UU5 A;  4ZR6 A;  4ZRU A;  4ILB A;  3RQW A;  2MAW A;  2Y57 A;  5L47 A;  3RHW A;  4LMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...