4LMLA

Glic double mutant i9'a t25'a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLAAHIAFNILVETNLPKAPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gating of the proton-gated ion channel from Gloeobacter violaceus at pH 4 as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 82
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4lmlA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4lmlA01
3UUBA 3PMZA 4DBMA 2XQ7A 2BJ0A 3SQ6A 4QH1A 3TLWA 5LXBA 4ZR6A 5L47A 2BG9C 5HEJA 3PEOA 3UQ7A 2BR7A 3ZDHA 3SH1A 4ZJTA 4ZK1A 2XQ9A 2XZ6A 3TLUA 2X00A 2Y54A 4HFEA 4HFDA 4TWHA 5KE4A 2Y7YA 2BG9E 5LG3A 2WNJA 4ZZBA 3GUAA 3UU6A 4ILBA 4BFQA 5AFKA 2PH9A 3EAMA 3WIPA 2ZJVA 2Y56A 4ZK4A 2M6BA 2XNUA 4IREA 1UW6A 3WTNA 4QAAA 3JAFA 2X00D 2Y58A 3U8NA 3ZKRA 4ILAA 2YMEA 3SQ9A 3C79A 3U8JA 3WTOA 2XQ5A 4NZBA 5SYOA 4AFTA 4ZZCA 2XNVA 3WTMA 1I9BA 4XK9A 5J5GA 5J5IA 1OEDC 5HEUA 3JAEA 5AFJA 4UM3P 4LMKA 2XZ5A 4FRRA 2BG9A 2LLYA 3U8KA 4UXUA 2XNTA 4D01A 4ILCA 3U8LA 4TWFA 2XQ8A 3RI5A 5FJVA 4QH5A 3EI0A 4LMJA 4QH4A 4AFGA 2UZ6A 4TWDA 5HCMA 2XYSA 4AFHA 4A97A 1OEDE 2XQAA 3UU4A 5J0ZA 4UM3A 4IL4A 4Z91A 5AFHA 2M6IA 2YKSA 2YN6A 2XYTA 4QACA 2BYRA 2C9TA 2WN9A 4WV9A 4A98A 4BQTA 5AFLA 1UV6A 2BYSA 5TVCA 2XQ4A 4HFBA 2BYPA 2WZYA 2MAWA 3TLTA 4UM3S 2ZJUA 4TNVA 5L4EA 5HEOA 3WTKA 2W8FA 4X5TA 4XHEA 4ZRUA 3RQUA 4LMLA 4TNWA 5CO5A 3TLVA 5HCJA 3IGQA 5AFNA 5J5HA 3P4WA 2YMDA 3WTHA 5CFBA 3RIFA 5AFMB 5BP0A 2BG9B 3UU8A 4PIRA 3UU3A 4IL9A 1OEDB 3RIAA 3RQWA 4UM1A 3WTLA 1UX2A 5HEHA 3UU5A 2WNLA 3SIOA 2XQ6A 3JADA 2PGZA 5BRXA 4QABA 5AINA 5AFMA 1OEDA 2BYNA 2LM2A 2VL0A 4ALXA 3WTIA 2KSRA 2BYQA 4B5DA 2YOEA 4UY2A 4EZ1A 3T4MA 5JMEA 2BR8A 4HQPA 5IUXA 2QC1B 3EHZA 4HFHA 5BW2A 4HFCA 2LKGA 4COFA 4ZJSA 2LKHA 3C84A 5KZUA 2XQ3A 5HEGA 5L4HA 3RHWA 4HFIA 3LSVA 5J5FA 3ZDGA 2W8GA 3U8MA 3UQ4A 2WNCA 3TLSA 4NPPA 4Z90A 4F8HA 3WTJA 3P50A 2Y57A
chains in the Genus database with same CATH superfamily
2DWKA 3UUBA 4QH1A 1CUNA 3P4PA 3ONXA 5H6RB 1HNZT 4ZK1A 2IIUA 4EZ4A 2LM9A 3ZMSB 4ZZBA 1HX1B 3EAMA 2Y56A 4OYKA 4ADZA 4LF7T 4BAYB 4OFZA 2A72A 2YMEA 3WTOA 1U4QA 2KWHA 5J5GA 4MBQA 4FRRA 5L3DB 1WYBA 3VR8A 4D01A 1BR1A 1QSDA 2HN1A 4DR3T 4LMJA 4HEAA 4AFGA 2X9XA 4UXNB 2WDQA 4K0KT 1T98A 2QVAA 1OEDE 1MNEA 2YDRA 5J0ZA 2H7OA 4A5XA 1KNPA 3OBVE 2XZEA 2YU2A 2WAUA 5FXVA 1HG2A 2DNXA 3ZEFB 2BVLA 4OK0A 4DV4T 4QKNA 3RIFA 2BG9B 3AA0B 3I0QA 1W09A 4I4TE 2IW5B 3P4QA 4IE6A 5FP3A 4ANJA 4EAHA 4CXWA 2V7IA 4EZ1A 3T4MA 5AQRB 4COFA 5AQTB 4GYSA 3L09A 4XBFB 2WMNA 5FL1A 2BG9C 2EHOC 4J2CA 2IAKA 3PU3A 2LOSA 4HFDA 3UFGA 3KBTA 4KP3C 4GYRA 3V5UA 4ISSA 3SFDA 2W00A 1SHZC 1G8XA 1VCSA 2XZ5A 3HKBE 3TKLB 2EHOB 4UXUA 2P9BA 1S35A 4DV3T 3RI5A 2CCQA 5LYJE 2A9UA 4H63H 4MALA 4X64T 2LRLA 2YN6A 2XYTA 2BYRA 1UV6A 2FJEA 4WBOA 1V9DA 3AE5A 5TAOA 3DP7A 1W0AA 5J5HA 3Q5DA 2Z6EA 3RQWA 1J1JA 4IDPA 5JQGE 4CN4A 5JREA 2BDEA 2LM2A 4HWDA 4O2AE 4OX9T 2FBWA 4JI3T 5HWYA 5FKYA 1WYCA 4YSYA 3CQCB 5HXRA 5E0OA 4LF4T 3AE4A 3PMZA 4EGWA 4O4JE 1QUUA 4TV8E 4ZR6A 4ZJTA 2XHEB 2XZ6A 4I50E 2E9XA 3OPCA 2CWOA 3DJBA 3FBLA 4DV6T 3A5XA 2HH7A 1MIVA 2WWUA 3N2KE 2A3DA 4JI7T 3AEAA 3U8NA 3A8YC 1N34T 4N78D 3QK6A 3MZKB 1OEDC 3FBZA 2LLYA 2C5IT 1D0ZA 2N1GA 3C4ZA 2QRXA 2UZ6A 1E2AA 2JMKA 3U3IA 3NWIA 1NAFA 4A97A 3UUNA 4IL4A 4AXPA 2W63A 3AE8A 2WN9A 3RX6A 5HXCA 1XZYA 2WZHA 2BYPA 2VKHA 2C5JA 4DR5T 4CZZB 4XHEA 3T1HT 2H89A 2WU2A 2K3WA 3EDVA 2BYNA 2VL0A 2VVNA 5JRCA 2E9XD 1D0YA 5ABFB 3SOLA 5FY0A 1OXZA 5LXBA 2CA5A 4XZCA 3X1DA 1YXRA 2XAJB 3KBUA 4PJLA 4E7ZA 3L3PA 4CXYA 2VKDA 2XASB 1BR0A 4JI0T 3ZMVB 4IREA 4ILUA 3PDYA 2F4VT 3FZMB 3LBXA 2M67A 3UUMA 3PUQA 3FZLB 1I9BA 4CN6A 4ZEYA 2BBJA 3SWHA 2VK9A 4ILCA 5JH7E 2E9XB 3EVYA 4YHJA 3N2OA 3KFWX 5HAXA 2MBGA 2VASA 3PUGA 3C98B 2MYSA 5AFLA 1YW0A 5LHIB 3ZN0B 2E2AA 4AQGA 3RIUC 1D0XA 1UUSA 3AEEA 3LDQB 5JDMA 3CIRA 3HR0A 1R8IA 1OEDB 2YDQA 3UU5A 2NW9A 4YTMA 3ZC0A 2PJQA 2UUAT 4DV2T 2V26A 5IHYA 5JMEA 3QB5K 1J5WA 2MPKA 3HL6A 4GIWA 5HXEA 2VL8A 3N9MA 4HWHA 5HEGA 3CX6B 3M3ZB 5DQWA 1KFYA 1YQ3A 1ZKEA 3JC6D 5C8YE 5LBQB 1XMOT 5LOVE 3ZT5A 4DBMA 5JDGA 2H88A 4B3RT 3PEOA 4TV9E 1ZOYA 1WRDA 4UVAB 3QC9A 2XM2A 2FJAA 5AFKA 3CX7B 3O1JA 2ZJVA 3BQIA 4DIDB 2Q9QA 1FJGT 3AVSA 4WYVA 5LHHB 2C5KT 2XSBA 3O9XA 2JQKA 4CI1B 1XNQT 4XK9A 3EABA 5J5IA 4IT4A 2DI4A 5ETWA 2KMFA 4JI4T 4X65T 4YT0A 4ZS2A 3N2GE 5C2TA 5BR8T 2HPJA 5AQUB 3SRZA 3Q9DA 2JQ9A 2J4GA 3ZMZB 3GWHA 5TVCA 4HFBA 2ZLYA 4UF0A 4X1IE 5FVKA 5A1LA 4DNDA 3P4WA 3AE3A 2V6XA 5KDMC 1JNZA 5HEHA 3R6NA 3AE2A 3CX8B 2PGZA 1SA0E 5AINA 4C90A 1IBLT 1MNDA 3AA1B 4L0RA 4IDZA 4DMWA 3ZCJA 3NRXA 2NWBA 4OYJA 4AQYT 2XM1A 3AEFA 4NUUA 4QX7B 1NENA 3OKQA 3ETVA 5JR9C 1UX5A 1HS7A 3AXJB 4AKRB 4HFEA 4AKIA 2WNJA 5FNVE 4Z8XA 4LFCT 4FJOA 4TUYE 2W2UA 5L3BB 1BR2A 4KI0F 4UF0B 3A7MA 1XMQT 3C79A 2CHNA 4F6RC 3RC3A 5L3CB 3LK2B 3NZQA 4EEBA 2WU5A 2I0MA 4AFHA 3RLFF 4ZI3C 2LSYA 2CMRA 4A98A 1US7B 5C3JA 2UXCT 4UR9A 2XAFB 4BA9A 2W8FA 3E08A 5AQNB 1YQ4A 1WR0A 3L8RA 4UV9B 2CLYB 4YHHT 2BVMA 5BP0A 4P1NA 2LOPA 4QXBB 3UU8A 2E5LT 2FJBA 2X0LB 5AQGB 3CVRA 2LSGA 4B3TT 4ALXA 1HCIA 2BZBA 2BR8A 4Q25A 5AQJB 2WDRA 3IEEA 2CXLA 5AQMB 2IDOB 2UXXB 1E1HB 4CI2B 2WNCA 3AEGA 1J5ET 4EB6E 3GA8A 3SH1A 4EIWA 2X00A 2LJLA 1YKEB 4CXXA 2UXBT 4IE7A 4O2BE 3NKZA 4ILBA 4YSZA 1HNWT 4WW0A 4YFSA 2Y8DA 4ILAA 1E7PA 5AQOB 3PJAA 5SYOA 4AFTA 5JDHA 5L3FB 3I9YA 1T8BA 2CXFA 2JQHA 4PJMA 5CGMA 4ZI2D 4DBRA 4HE8A 1UURA 4JI2T 2V7MA 3BK9A 5LA6E 3PUYF 3PUAA 2VQFT 1T7SA 3N9LA 1Z8UA 1Y64B 3UU4A 4Z91A 2M6IA 4WV9A 4DR4T 3HA4A 3AE6A 4JBWF 2H7VC 3H3MA 3B13A 3L39A 4G63A 2V1DB 4WBNE 4DBQA 3UU3A 1KNRA 2EHOA 2CPTA 1S94A 2UUBT 2WNLA 2ODUA 3F31A 3Q5WA 1XDPA 2WMOA 3R84B 3WAKA 4DV7T 2QC1B 4U31A 3UTKA 5KZUA 2I6HA 2PG8A 3LSVA 3LK3B 2W8GA 3AB3B 4KMCA 4PFPA 4AI6A 3SQ6A 5LP6E 2CRBA 4HWFA 1WCRA 3OVUA 2HN2A 3FZHB 4LFAT 4IE4A 2WM9A 3O4XE 2XPKA 2WWVA 2BBHA 4HFVA 3AEBA 4JI8T 5AQVB 4U3CA 2WCAA 1UX4A 2I59A 3ANWA 2XJ7A 2W61A 3MJXA 4JI1T 2XUEA 4CI3B 2N9DA 2FJDA 3MACA 1XWMA 2XAQB 5KXJA 1FIOA 4YTNA 2DCFA 4AQFC 5GONE 2LRKA 4AKHA 3ZMUB 2E5VA 3ZMTB 2DHRA 5JVDE 3PJAJ 3ZSSA 3D0TA 3ZC1A 4JUYA 3H37A 4QABA 3ZYMA 1OWAA 5AQKB 4IDNA 4ZXLA 3RYIE 5IUXA 2WZIA 3P4SA 1WLXA 2CHOA 4ZJSA 3KV6A 3C84A 1MMAA 3OJAA 1LVFA 3DTOA 4JV5T 3ZPOA 4JI5T 4NPPA 4IIJE 4P0BA 3RIUA 2BJ0A 2Q9QC 4NXMT 4YSXA 3UQ7A 2QYWA 2ZM0A 2X66A 1B7TA 5KX5E 2WY2A 4BJMA 3UU6A 1GQEA 5J1GA 3SS1A 2V7JA 2Y48B 4KHPT 2XQYA 2JIWA 4PK4A 3I1AA 2L8KA 2VURA 5IWAT 3SQ9A 4X66T 3NRYA 3PU8A 5LCYA 5FY1A 3NZPA 3PUZF 1NWMX 1IBMT 2VKOA 3VRAA 4UM3P 2W67A 4EEDA 2K9AA 2OV9A 1BR4A 3V5SA 3IA3A 3OYZA 1MMDA 3K3OA 1ZP0A 3LJCA 4UM3A 3ZSTA 2GK9A 4PJJA 4HWCA 3AAEB 5F8PA 4UM3S 4GKKT 4KX6A 5HEOA 4ZRUA 2LSIA 1FMVA 3AE7A 2J47A 4YLHA 2YK0A 2ZM2A 2ZMAA 3RIAA 1UX2A 3U78A 3SIOA 4LF5T 2VWAA 3RYHE 5JDQA 5JDNA 4TZ4C 2KSRA 4UY2A 5HXHA 3EHZA 2C0SA 3Q5XA 3IHRA 5EK3A 4HFIA 3N9QA 3KV9A 2B76A 2HPLA 4O4LE 4DR7T 3WTJA 5FL0A 3WI3A 4UVCB 2X68A 5L47A 4U72A 2BS4A 3SFEA 3PV0F 4AQFA 1CHUA 1W0BA 1LRZA 3AECA 2PH9A 4ZK4A 1YD8G 5LHGB 4EOZB 2XNUA 2ZM8A 3RKGA 2IMLA 3ZKRA 2K5BB 2WP9A 1NEKA 3RPUA 1MMGA 4CN1A 3MK7C 4V1Av 3KVAA 2XNTA 3U8LA 2BS3A 1HTJF 4BJNA 4QH4A 3P4RA 5LBMA 3AE9A 3FZKB 2UUCT 3P8CD 2YKSA 4QACA 5LXTE 4QHOA 2LHRA 3FZFB 2WZYA 1ZEEA 2CWYA 3T1YT 2EHOD 1KF6A 4O4IE 1X9BA 3UULA 4H9QC 1Z0PA 5LGTB 4IL9A 1HR0T 3WTLA 2KINB 3ZN1B 2NTXA 1VOMA 2KT9A 4B5DA 2YOEA 4YY3T 4OHFA 1KK7A 4IDOA 5HXSA 2OLTA 5ADXL 3RHWA 4O4HE 5LJMA 1T72A 1MIWA 3CKDA 3PUSA 4Z90A 4H9PC 1DU2A 3B57A 3ZT6A 3UFEA 5CA1E 2BKOA 3VKGA 2X9YA 3PUWF 5ABHA 2JMHA 2BG9E 5LG3A 3WIPA 3NVOA 1XDOA 3IF8B 5FMNA 4LF6T 3S4UA 2X00D 3RC8A 2LHNA 5DJQC 4NZBA 2V7LA 1N33T 5DQVA 3RYFE 2KZ7B 5HEUA 5AFJA 1W9RA 3AAIA 3ZLIA 4PAGA 4EV6A 4QH5A 3I0OA 2V7KA 3K8PC 4IE5A 4ZI3D 3FHNA 4MLKA 3PE0A 4H9SE 2CE7A 2RPAA 2WDVA 5J5FA 1EZ3A 4BQTA 4G2AA 1WR6A 1QLBA 2KXPB 5H6QB 4DV1T 3AAAB 1VRBA 4EYYR 3RQUA 3JCFA 3IGQA 2IHR1 2NP9A 5IYZE 2YMDA 4QWNB 1Y01A 1KNZA 1M7KA 4H9RC 3LFMA 5BRXA 3QOFA 2W62A 2UU9T 2NOXA 3WAJA 2SPCA 3K1SA 3QB5A 2L9QA 5BW2A 1XNRT 3N9NA 5EK4A 5AFUL 4AKLA 3MXZA 3U8MA 5ABFA 3PURA 3MKDA 4L5GA 3AA7B 3ZYLA 2BR7A 3FXEB 3P7IA 2ODVA 2D0UA 2YU1A 2D0TA 4EZHA 1X79A 3W15B 4ZHQE 4HTEA 1MIYA 5LJNA 2M6BA 3UUXB 3NBXX 3CK6A 2ACXA 2Y58A 5AQQB 3U8JA 2KLQA 2NW8A 4A56A 5JDLA 1HG5A 2BG9A 4X1YE 4TWFA 5JR9A 4H9OC 4UEMA 4TWDA 5HCMA 4DUZT 4JYAT 2QA7A 3GN5A 1FMWA 5LMNT 4XAXB 4DR6T 5AFHA 2YEVC 4HN9A 4YJ3E 2QGSA 2V5DA 2Y6XA 4QXCB 1IBKT 3J7Yq 3TLTA 1IZNB 4TNVA 3PTRB 4PNIA 1SUMB 2D2SA 2JRKA 2VQET 3J9X1 3RF1A 3C4XA 5CFBA 4PIRA 4DMVA 3RYCE 2V5CA 4LF9T 4IE0A 1HNXT 4DR1T 3JADA 1D1BA 3WTIA 4X20E 4IGUA 4U2ZA 1HFAA 2K24A 4GOUA 3ZDGA 3TLSA 5FXWA 4F8HA 5AQSB 2CXDA 3P50A 4JLEA 4WZXA 2H3RA 5JTGA 4NXNT 4JEUB 3HKEE 3TLUA 2V6YA 1M62A 5J2UE 4FI5A 2WS3A 4TWHA 4B3MT 1IJ5A 3GUAA 3CQGB 2HHHT 3AXJA 1MMNA 5CJ5A 2YINA 2YDSA 4K0UA 4QAAA 4MHCA 5JDFA 2UXNB 3T8OA 4ZZCA 3OTOT 1N36T 2X51A 1I94T 2LT3A 2XY8B 2XAHB 3U8KA 3KVBA 3N9PA 1G73A 3EI0A 3VRBA 5FXZA 5FXXA 2XAGB 5M4YA 2DLRA 4QX8B 4X1KE 1ZV4X 2C9TA 2JPFA 4AKGA 5L3EB 4U7IA 2A2FX 5L4EA 3EDUA 3O1IA 4PJNA 2L3LA 4TNWA 3TLVA 3HKDE 2W66A 2MOZA 4UM1A 5ABEA 3ESLA 4E7SA 2NW7A 2IC6A 3LK42 5AQIB 1VCTA 3AEDA 2XSAA 2VKJA 5CB4E 2ZM6T 2KWIB 3LBXB 4UIGA 3C64A 1D1CA 2JJ9A 4HFHA 2LKGA 4C91A 1SE7A 4PK5A 2V6YB 1YKHB 1UK5A 2Q9QD 3K3NA 2XQ7A 4GKJT 4TX5A 1L0VA 2X0HA 4B3ST 2X9HA 3C50A 2ACZA 1LKXA 5KE4A 2Y7YA 3G06A 5L3GB 1HX8A 3ZCIA 3RGLA 3BQLA 5FYMA 4U7YA 2X0YA 2OA5A 4HKAA 3KINB 5LG4A 2R6GF 3KV4A 2IC9A 2XQ5A 1U5PA 2J1DG 5LGUB 3JAEA 2KNDA 4M1PA 3RH3A 4U33A 2X9WA 1FEWA 2PBIA 2XQ8A 4JEHB 3VHLA 4YTPA 4DR2T 2DL1A 2LE8A 2LSKA 2XQAA 4LFBT 4ZS3A 3PUVF 1UGOA 2K48A 4B6XA 2LEHA 2N2NA 1HF8A 3AA6B 2NTYA 2MAWA 2ZJUA 4X62T 5CO5A 2LSJA 4P09A 2JQQA 4EXTA 3E0ZA 2BKPA 2WSSV 3WTHA 3OYXA 4ASKA 2DWGA 1AJ3A 5LNKA 3Q5EA 3C4WA 2XQ6A 1IJ6A 4ZI2C 5DABA 3GN5B 2ES0A 2FUPA 3N5LA 3M65A 4HFCA 1D1AA 2E8IA 5L4HA 3ONJA 4TN7B 2CBJA 4EYUA 4O8SA 5LGNB 2E9XC 4ISTA 4PK6A 2X67A 4ZI7E 4PFOA 5KMGP 4UV8B 4NIQA 1H7CA 4CQIA 3TLWA 3AE1A 2G0UA 5HEJA 2XQ9A 1KEYA 4YXDA 3Q2MA 1WFDA 2CM0A 4BFQA 5L2LA 4JI6T 1IAPA 3KDSE 2W4XA 4DV0T 2XTLA 3VU7H 1UW6A 3JAFA 2CLYC 4IDQA 5F5WA 3F57A 3HKCE 2XNVA 3WTMA 3ABVA 5FVLA 3KV5A 2CBIA 5FJVA 1I6ZA 3HI2A 3VR9A 3PUXF 3RKOA 3UT5E 3CMLA 1N32T 2V8SV 4I43B 2VVSA 2XQ4A 5AQPB 3MA9A 4ERRA 4P0AA 1LVKA 5HWXA 4QXHB 4X5TA 3CWZB 4LMLA 3ETUA 5HCJA 3CQXC 3H3AA 3K3QC 2RA1A 5EK2A 5AFMB 2J62A 2MTQA 4AISA 3N9OA 4MFRA 5AQLB 3VKHA 1OEDA 3ONLC 3ZYKA 2B1EA 1UCUA 2BYQA 4HQPA 5JR9B 4UELA 4H63V 2IUBA 4HGAA 1O3XA 3FXDB 2XQ3A 5FY7A 2D9DA 4KUMB 2WB5A 3LG7A 2VB6A 3RRWA 4H9NC 3GMIA 3ZT7A 3QNUA 3UQ4A 2Y57A 2BS2A 4DUYT 3I9WA 3JC6C 4DVDA 4U74A 3ZDHA 3EUHA 3QUJA 2D5UA 3CPZA 5LB7B 2Y54A 4IHJE 4WNKA 3AVRA 3BQKA 3WTNA 5AQFB 2CEAA 3C51A 2RP4A 4I0UA 3O1HA 3E22E 4KBMB 5AQHB 5ABGA 1JNRA 2NR4A 4LMKA 2PTFA 5EZYE 2PFVA 4NUVA 4U2YA 4ZOLE 2UXDT 5JRCB 4PW8A 5J2TE 2XYSA 4GK5E 3RRCA 4UVBB 4HWIB 2Q9QB 4L9IA 4I55E 2BYSA 2AXDS 4AIUA 3WTKA 2WBLA 3ZJ2A 5LMUT 4LF8T 5AFNA 2AE9A 3FB2A 3IBPA 3ZJ1A 5HYAA 5AFMA 3B5MA 5F3JA 3F2EA 4KHZF 4YJ2E 5CA0E 4DV5T 3ANWB 2LKHA 4GK0E 2W0GA 1ZHCA 2WQYA 2BKNA 4DO0A 5BMVE
chains in the Genus database with same CATH topology
3UUBA 3PMZA 4DBMA 2XQ7A 2BJ0A 3SQ6A 4QH1A 3TLWA 5LXBA 4ZR6A 5L47A 2BG9C 5HEJA 3PEOA 3UQ7A 2BR7A 3ZDHA 3SH1A 4ZJTA 4ZK1A 2XQ9A 2XZ6A 3TLUA 2X00A 2Y54A 4HFEA 4HFDA 4TWHA 5KE4A 2Y7YA 2BG9E 5LG3A 2WNJA 4ZZBA 3GUAA 3UU6A 4ILBA 4BFQA 5AFKA 2PH9A 3EAMA 3WIPA 2ZJVA 2Y56A 4ZK4A 2M6BA 2XNUA 4IREA 1UW6A 3WTNA 4QAAA 3JAFA 2X00D 2Y58A 3U8NA 3ZKRA 4ILAA 2YMEA 3SQ9A 3C79A 3U8JA 3WTOA 2XQ5A 4NZBA 5SYOA 4AFTA 4ZZCA 2XNVA 3WTMA 1I9BA 4XK9A 5J5GA 5J5IA 1OEDC 5HEUA 3JAEA 5AFJA 4UM3P 4LMKA 2XZ5A 4FRRA 2BG9A 2LLYA 3U8KA 4UXUA 2XNTA 4D01A 4ILCA 3U8LA 4TWFA 2XQ8A 3RI5A 5FJVA 4QH5A 3EI0A 4LMJA 4QH4A 4AFGA 2UZ6A 4TWDA 5HCMA 2XYSA 4AFHA 4A97A 1OEDE 2XQAA 3UU4A 5J0ZA 4UM3A 4IL4A 4Z91A 5AFHA 2M6IA 2YKSA 2YN6A 2XYTA 4QACA 2BYRA 2C9TA 2WN9A 4WV9A 4A98A 4BQTA 5AFLA 1UV6A 2BYSA 5TVCA 2XQ4A 4HFBA 2BYPA 2WZYA 2MAWA 3TLTA 4UM3S 2ZJUA 4TNVA 5L4EA 5HEOA 3WTKA 2W8FA 4X5TA 4XHEA 4ZRUA 3RQUA 4LMLA 4TNWA 5CO5A 3TLVA 5HCJA 3IGQA 5AFNA 5J5HA 3P4WA 2YMDA 3WTHA 5CFBA 3RIFA 5AFMB 5BP0A 2BG9B 3UU8A 4PIRA 3UU3A 4IL9A 1OEDB 3RIAA 3RQWA 4UM1A 3WTLA 1UX2A 5HEHA 3UU5A 2WNLA 3SIOA 2XQ6A 3JADA 2PGZA 5BRXA 4QABA 5AINA 5AFMA 1OEDA 2BYNA 2LM2A 2VL0A 4ALXA 3WTIA 2KSRA 2BYQA 4B5DA 2YOEA 4UY2A 4EZ1A 3T4MA 5JMEA 2BR8A 4HQPA 5IUXA 2QC1B 3EHZA 4HFHA 5BW2A 4HFCA 2LKGA 4COFA 4ZJSA 2LKHA 3C84A 5KZUA 2XQ3A 5HEGA 5L4HA 3RHWA 4HFIA 3LSVA 5J5FA 3ZDGA 2W8GA 3U8MA 3UQ4A 2WNCA 3TLSA 4NPPA 4Z90A 4F8HA 3WTJA 3P50A 2Y57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UUB A;  3PMZ A;  4DBM A;  2XQ7 A;  2BJ0 A;  3SQ6 A;  4QH1 A;  3TLW A;  5LXB A;  4ZR6 A;  5L47 A;  2BG9 C;  5HEJ A;  3PEO A;  3UQ7 A;  2BR7 A;  3ZDH A;  3SH1 A;  4ZJT A;  4ZK1 A;  2XQ9 A;  2XZ6 A;  3TLU A;  2X00 A;  2Y54 A;  4HFE A;  4HFD A;  4TWH A;  5KE4 A;  2Y7Y A;  2BG9 E;  5LG3 A;  2WNJ A;  4ZZB A;  3GUA A;  3UU6 A;  4ILB A;  4BFQ A;  5AFK A;  2PH9 A;  3EAM A;  3WIP A;  2ZJV A;  2Y56 A;  4ZK4 A;  2M6B A;  2XNU A;  4IRE A;  1UW6 A;  3WTN A;  4QAA A;  3JAF A;  2X00 D;  2Y58 A;  3U8N A;  3ZKR A;  4ILA A;  2YME A;  3SQ9 A;  3C79 A;  3U8J A;  3WTO A;  2XQ5 A;  4NZB A;  5SYO A;  4AFT A;  4ZZC A;  2XNV A;  3WTM A;  1I9B A;  4XK9 A;  5J5G A;  5J5I A;  1OED C;  5HEU A;  3JAE A;  5AFJ A;  4UM3 P;  4LMK A;  2XZ5 A;  4FRR A;  2BG9 A;  2LLY A;  3U8K A;  4UXU A;  2XNT A;  4D01 A;  4ILC A;  3U8L A;  4TWF A;  2XQ8 A;  3RI5 A;  5FJV A;  4QH5 A;  3EI0 A;  4LMJ A;  4QH4 A;  4AFG A;  2UZ6 A;  4TWD A;  5HCM A;  2XYS A;  4AFH A;  4A97 A;  1OED E;  2XQA A;  3UU4 A;  5J0Z A;  4UM3 A;  4IL4 A;  4Z91 A;  5AFH A;  2M6I A;  2YKS A;  2YN6 A;  2XYT A;  4QAC A;  2BYR A;  2C9T A;  2WN9 A;  4WV9 A;  4A98 A;  4BQT A;  5AFL A;  1UV6 A;  2BYS A;  5TVC A;  2XQ4 A;  4HFB A;  2BYP A;  2WZY A;  2MAW A;  3TLT A;  4UM3 S;  2ZJU A;  4TNV A;  5L4E A;  5HEO A;  3WTK A;  2W8F A;  4X5T A;  4XHE A;  4ZRU A;  3RQU A;  4LML A;  4TNW A;  5CO5 A;  3TLV A;  5HCJ A;  3IGQ A;  5AFN A;  5J5H A;  3P4W A;  2YMD A;  3WTH A;  5CFB A;  3RIF A;  5AFM B;  5BP0 A;  2BG9 B;  3UU8 A;  4PIR A;  3UU3 A;  4IL9 A;  1OED B;  3RIA A;  3RQW A;  4UM1 A;  3WTL A;  1UX2 A;  5HEH A;  3UU5 A;  2WNL A;  3SIO A;  2XQ6 A;  3JAD A;  2PGZ A;  5BRX A;  4QAB A;  5AIN A;  5AFM A;  1OED A;  2BYN A;  2LM2 A;  2VL0 A;  4ALX A;  3WTI A;  2KSR A;  2BYQ A;  4B5D A;  2YOE A;  4UY2 A;  4EZ1 A;  3T4M A;  5JME A;  2BR8 A;  4HQP A;  5IUX A;  2QC1 B;  3EHZ A;  4HFH A;  5BW2 A;  4HFC A;  2LKG A;  4COF A;  4ZJS A;  2LKH A;  3C84 A;  5KZU A;  2XQ3 A;  5HEG A;  5L4H A;  3RHW A;  4HFI A;  3LSV A;  5J5F A;  3ZDG A;  2W8G A;  3U8M A;  3UQ4 A;  2WNC A;  3TLS A;  4NPP A;  4Z90 A;  4F8H A;  3WTJ A;  3P50 A;  2Y57 A; 
#chains in the Genus database with same CATH topology
 2DWK A;  3UUB A;  4QH1 A;  1CUN A;  3P4P A;  3ONX A;  5H6R B;  1HNZ T;  4ZK1 A;  2IIU A;  4EZ4 A;  2LM9 A;  3ZMS B;  4ZZB A;  1HX1 B;  3EAM A;  2Y56 A;  4OYK A;  4ADZ A;  4LF7 T;  4BAY B;  4OFZ A;  2A72 A;  2YME A;  3WTO A;  1U4Q A;  2KWH A;  5J5G A;  4MBQ A;  4FRR A;  5L3D B;  1WYB A;  3VR8 A;  4D01 A;  1BR1 A;  1QSD A;  2HN1 A;  4DR3 T;  4LMJ A;  4HEA A;  4AFG A;  2X9X A;  4UXN B;  2WDQ A;  4K0K T;  1T98 A;  2QVA A;  1OED E;  1MNE A;  2YDR A;  5J0Z A;  2H7O A;  4A5X A;  1KNP A;  3OBV E;  2XZE A;  2YU2 A;  2WAU A;  5FXV A;  1HG2 A;  2DNX A;  3ZEF B;  2BVL A;  4OK0 A;  4DV4 T;  4QKN A;  3RIF A;  2BG9 B;  3AA0 B;  3I0Q A;  1W09 A;  4I4T E;  2IW5 B;  3P4Q A;  4IE6 A;  5FP3 A;  4ANJ A;  4EAH A;  4CXW A;  2V7I A;  4EZ1 A;  3T4M A;  5AQR B;  4COF A;  5AQT B;  4GYS A;  3L09 A;  4XBF B;  2WMN A;  5FL1 A;  2BG9 C;  2EHO C;  4J2C A;  2IAK A;  3PU3 A;  2LOS A;  4HFD A;  3UFG A;  3KBT A;  4KP3 C;  4GYR A;  3V5U A;  4ISS A;  3SFD A;  2W00 A;  1SHZ C;  1G8X A;  1VCS A;  2XZ5 A;  3HKB E;  3TKL B;  2EHO B;  4UXU A;  2P9B A;  1S35 A;  4DV3 T;  3RI5 A;  2CCQ A;  5LYJ E;  2A9U A;  4H63 H;  4MAL A;  4X64 T;  2LRL A;  2YN6 A;  2XYT A;  2BYR A;  1UV6 A;  2FJE A;  4WBO A;  1V9D A;  3AE5 A;  5TAO A;  3DP7 A;  1W0A A;  5J5H A;  3Q5D A;  2Z6E A;  3RQW A;  1J1J A;  4IDP A;  5JQG E;  4CN4 A;  5JRE A;  2BDE A;  2LM2 A;  4HWD A;  4O2A E;  4OX9 T;  2FBW A;  4JI3 T;  5HWY A;  5FKY A;  1WYC A;  4YSY A;  3CQC B;  5HXR A;  5E0O A;  4LF4 T;  3AE4 A;  3PMZ A;  4EGW A;  4O4J E;  1QUU A;  4TV8 E;  4ZR6 A;  4ZJT A;  2XHE B;  2XZ6 A;  4I50 E;  2E9X A;  3OPC A;  2CWO A;  3DJB A;  3FBL A;  4DV6 T;  3A5X A;  2HH7 A;  1MIV A;  2WWU A;  3N2K E;  2A3D A;  4JI7 T;  3AEA A;  3U8N A;  3A8Y C;  1N34 T;  4N78 D;  3QK6 A;  3MZK B;  1OED C;  3FBZ A;  2LLY A;  2C5I T;  1D0Z A;  2N1G A;  3C4Z A;  2QRX A;  2UZ6 A;  1E2A A;  2JMK A;  3U3I A;  3NWI A;  1NAF A;  4A97 A;  3UUN A;  4IL4 A;  4AXP A;  2W63 A;  3AE8 A;  2WN9 A;  3RX6 A;  5HXC A;  1XZY A;  2WZH A;  2BYP A;  2VKH A;  2C5J A;  4DR5 T;  4CZZ B;  4XHE A;  3T1H T;  2H89 A;  2WU2 A;  2K3W A;  3EDV A;  2BYN A;  2VL0 A;  2VVN A;  5JRC A;  2E9X D;  1D0Y A;  5ABF B;  3SOL A;  5FY0 A;  1OXZ A;  5LXB A;  2CA5 A;  4XZC A;  3X1D A;  1YXR A;  2XAJ B;  3KBU A;  4PJL A;  4E7Z A;  3L3P A;  4CXY A;  2VKD A;  2XAS B;  1BR0 A;  4JI0 T;  3ZMV B;  4IRE A;  4ILU A;  3PDY A;  2F4V T;  3FZM B;  3LBX A;  2M67 A;  3UUM A;  3PUQ A;  3FZL B;  1I9B A;  4CN6 A;  4ZEY A;  2BBJ A;  3SWH A;  2VK9 A;  4ILC A;  5JH7 E;  2E9X B;  3EVY A;  4YHJ A;  3N2O A;  3KFW X;  5HAX A;  2MBG A;  2VAS A;  3PUG A;  3C98 B;  2MYS A;  5AFL A;  1YW0 A;  5LHI B;  3ZN0 B;  2E2A A;  4AQG A;  3RIU C;  1D0X A;  1UUS A;  3AEE A;  3LDQ B;  5JDM A;  3CIR A;  3HR0 A;  1R8I A;  1OED B;  2YDQ A;  3UU5 A;  2NW9 A;  4YTM A;  3ZC0 A;  2PJQ A;  2UUA T;  4DV2 T;  2V26 A;  5IHY A;  5JME A;  3QB5 K;  1J5W A;  2MPK A;  3HL6 A;  4GIW A;  5HXE A;  2VL8 A;  3N9M A;  4HWH A;  5HEG A;  3CX6 B;  3M3Z B;  5DQW A;  1KFY A;  1YQ3 A;  1ZKE A;  3JC6 D;  5C8Y E;  5LBQ B;  1XMO T;  5LOV E;  3ZT5 A;  4DBM A;  5JDG A;  2H88 A;  4B3R T;  3PEO A;  4TV9 E;  1ZOY A;  1WRD A;  4UVA B;  3QC9 A;  2XM2 A;  2FJA A;  5AFK A;  3CX7 B;  3O1J A;  2ZJV A;  3BQI A;  4DID B;  2Q9Q A;  1FJG T;  3AVS A;  4WYV A;  5LHH B;  2C5K T;  2XSB A;  3O9X A;  2JQK A;  4CI1 B;  1XNQ T;  4XK9 A;  3EAB A;  5J5I A;  4IT4 A;  2DI4 A;  5ETW A;  2KMF A;  4JI4 T;  4X65 T;  4YT0 A;  4ZS2 A;  3N2G E;  5C2T A;  5BR8 T;  2HPJ A;  5AQU B;  3SRZ A;  3Q9D A;  2JQ9 A;  2J4G A;  3ZMZ B;  3GWH A;  5TVC A;  4HFB A;  2ZLY A;  4UF0 A;  4X1I E;  5FVK A;  5A1L A;  4DND A;  3P4W A;  3AE3 A;  2V6X A;  5KDM C;  1JNZ A;  5HEH A;  3R6N A;  3AE2 A;  3CX8 B;  2PGZ A;  1SA0 E;  5AIN A;  4C90 A;  1IBL T;  1MND A;  3AA1 B;  4L0R A;  4IDZ A;  4DMW A;  3ZCJ A;  3NRX A;  2NWB A;  4OYJ A;  4AQY T;  2XM1 A;  3AEF A;  4NUU A;  4QX7 B;  1NEN A;  3OKQ A;  3ETV A;  5JR9 C;  1UX5 A;  1HS7 A;  3AXJ B;  4AKR B;  4HFE A;  4AKI A;  2WNJ A;  5FNV E;  4Z8X A;  4LFC T;  4FJO A;  4TUY E;  2W2U A;  5L3B B;  1BR2 A;  4KI0 F;  4UF0 B;  3A7M A;  1XMQ T;  3C79 A;  2CHN A;  4F6R C;  3RC3 A;  5L3C B;  3LK2 B;  3NZQ A;  4EEB A;  2WU5 A;  2I0M A;  4AFH A;  3RLF F;  4ZI3 C;  2LSY A;  2CMR A;  4A98 A;  1US7 B;  5C3J A;  2UXC T;  4UR9 A;  2XAF B;  4BA9 A;  2W8F A;  3E08 A;  5AQN B;  1YQ4 A;  1WR0 A;  3L8R A;  4UV9 B;  2CLY B;  4YHH T;  2BVM A;  5BP0 A;  4P1N A;  2LOP A;  4QXB B;  3UU8 A;  2E5L T;  2FJB A;  2X0L B;  5AQG B;  3CVR A;  2LSG A;  4B3T T;  4ALX A;  1HCI A;  2BZB A;  2BR8 A;  4Q25 A;  5AQJ B;  2WDR A;  3IEE A;  2CXL A;  5AQM B;  2IDO B;  2UXX B;  1E1H B;  4CI2 B;  2WNC A;  3AEG A;  1J5E T;  4EB6 E;  3GA8 A;  3SH1 A;  4EIW A;  2X00 A;  2LJL A;  1YKE B;  4CXX A;  2UXB T;  4IE7 A;  4O2B E;  3NKZ A;  4ILB A;  4YSZ A;  1HNW T;  4WW0 A;  4YFS A;  2Y8D A;  4ILA A;  1E7P A;  5AQO B;  3PJA A;  5SYO A;  4AFT A;  5JDH A;  5L3F B;  3I9Y A;  1T8B A;  2CXF A;  2JQH A;  4PJM A;  5CGM A;  4ZI2 D;  4DBR A;  4HE8 A;  1UUR A;  4JI2 T;  2V7M A;  3BK9 A;  5LA6 E;  3PUY F;  3PUA A;  2VQF T;  1T7S A;  3N9L A;  1Z8U A;  1Y64 B;  3UU4 A;  4Z91 A;  2M6I A;  4WV9 A;  4DR4 T;  3HA4 A;  3AE6 A;  4JBW F;  2H7V C;  3H3M A;  3B13 A;  3L39 A;  4G63 A;  2V1D B;  4WBN E;  4DBQ A;  3UU3 A;  1KNR A;  2EHO A;  2CPT A;  1S94 A;  2UUB T;  2WNL A;  2ODU A;  3F31 A;  3Q5W A;  1XDP A;  2WMO A;  3R84 B;  3WAK A;  4DV7 T;  2QC1 B;  4U31 A;  3UTK A;  5KZU A;  2I6H A;  2PG8 A;  3LSV A;  3LK3 B;  2W8G A;  3AB3 B;  4KMC A;  4PFP A;  4AI6 A;  3SQ6 A;  5LP6 E;  2CRB A;  4HWF A;  1WCR A;  3OVU A;  2HN2 A;  3FZH B;  4LFA T;  4IE4 A;  2WM9 A;  3O4X E;  2XPK A;  2WWV A;  2BBH A;  4HFV A;  3AEB A;  4JI8 T;  5AQV B;  4U3C A;  2WCA A;  1UX4 A;  2I59 A;  3ANW A;  2XJ7 A;  2W61 A;  3MJX A;  4JI1 T;  2XUE A;  4CI3 B;  2N9D A;  2FJD A;  3MAC A;  1XWM A;  2XAQ B;  5KXJ A;  1FIO A;  4YTN A;  2DCF A;  4AQF C;  5GON E;  2LRK A;  4AKH A;  3ZMU B;  2E5V A;  3ZMT B;  2DHR A;  5JVD E;  3PJA J;  3ZSS A;  3D0T A;  3ZC1 A;  4JUY A;  3H37 A;  4QAB A;  3ZYM A;  1OWA A;  5AQK B;  4IDN A;  4ZXL A;  3RYI E;  5IUX A;  2WZI A;  3P4S A;  1WLX A;  2CHO A;  4ZJS A;  3KV6 A;  3C84 A;  1MMA A;  3OJA A;  1LVF A;  3DTO A;  4JV5 T;  3ZPO A;  4JI5 T;  4NPP A;  4IIJ E;  4P0B A;  3RIU A;  2BJ0 A;  2Q9Q C;  4NXM T;  4YSX A;  3UQ7 A;  2QYW A;  2ZM0 A;  2X66 A;  1B7T A;  5KX5 E;  2WY2 A;  4BJM A;  3UU6 A;  1GQE A;  5J1G A;  3SS1 A;  2V7J A;  2Y48 B;  4KHP T;  2XQY A;  2JIW A;  4PK4 A;  3I1A A;  2L8K A;  2VUR A;  5IWA T;  3SQ9 A;  4X66 T;  3NRY A;  3PU8 A;  5LCY A;  5FY1 A;  3NZP A;  3PUZ F;  1NWM X;  1IBM T;  2VKO A;  3VRA A;  4UM3 P;  2W67 A;  4EED A;  2K9A A;  2OV9 A;  1BR4 A;  3V5S A;  3IA3 A;  3OYZ A;  1MMD A;  3K3O A;  1ZP0 A;  3LJC A;  4UM3 A;  3ZST A;  2GK9 A;  4PJJ A;  4HWC A;  3AAE B;  5F8P A;  4UM3 S;  4GKK T;  4KX6 A;  5HEO A;  4ZRU A;  2LSI A;  1FMV A;  3AE7 A;  2J47 A;  4YLH A;  2YK0 A;  2ZM2 A;  2ZMA A;  3RIA A;  1UX2 A;  3U78 A;  3SIO A;  4LF5 T;  2VWA A;  3RYH E;  5JDQ A;  5JDN A;  4TZ4 C;  2KSR A;  4UY2 A;  5HXH A;  3EHZ A;  2C0S A;  3Q5X A;  3IHR A;  5EK3 A;  4HFI A;  3N9Q A;  3KV9 A;  2B76 A;  2HPL A;  4O4L E;  4DR7 T;  3WTJ A;  5FL0 A;  3WI3 A;  4UVC B;  2X68 A;  5L47 A;  4U72 A;  2BS4 A;  3SFE A;  3PV0 F;  4AQF A;  1CHU A;  1W0B A;  1LRZ A;  3AEC A;  2PH9 A;  4ZK4 A;  1YD8 G;  5LHG B;  4EOZ B;  2XNU A;  2ZM8 A;  3RKG A;  2IML A;  3ZKR A;  2K5B B;  2WP9 A;  1NEK A;  3RPU A;  1MMG A;  4CN1 A;  3MK7 C;  4V1A v;  3KVA A;  2XNT A;  3U8L A;  2BS3 A;  1HTJ F;  4BJN A;  4QH4 A;  3P4R A;  5LBM A;  3AE9 A;  3FZK B;  2UUC T;  3P8C D;  2YKS A;  4QAC A;  5LXT E;  4QHO A;  2LHR A;  3FZF B;  2WZY A;  1ZEE A;  2CWY A;  3T1Y T;  2EHO D;  1KF6 A;  4O4I E;  1X9B A;  3UUL A;  4H9Q C;  1Z0P A;  5LGT B;  4IL9 A;  1HR0 T;  3WTL A;  2KIN B;  3ZN1 B;  2NTX A;  1VOM A;  2KT9 A;  4B5D A;  2YOE A;  4YY3 T;  4OHF A;  1KK7 A;  4IDO A;  5HXS A;  2OLT A;  5ADX L;  3RHW A;  4O4H E;  5LJM A;  1T72 A;  1MIW A;  3CKD A;  3PUS A;  4Z90 A;  4H9P C;  1DU2 A;  3B57 A;  3ZT6 A;  3UFE A;  5CA1 E;  2BKO A;  3VKG A;  2X9Y A;  3PUW F;  5ABH A;  2JMH A;  2BG9 E;  5LG3 A;  3WIP A;  3NVO A;  1XDO A;  3IF8 B;  5FMN A;  4LF6 T;  3S4U A;  2X00 D;  3RC8 A;  2LHN A;  5DJQ C;  4NZB A;  2V7L A;  1N33 T;  5DQV A;  3RYF E;  2KZ7 B;  5HEU A;  5AFJ A;  1W9R A;  3AAI A;  3ZLI A;  4PAG A;  4EV6 A;  4QH5 A;  3I0O A;  2V7K A;  3K8P C;  4IE5 A;  4ZI3 D;  3FHN A;  4MLK A;  3PE0 A;  4H9S E;  2CE7 A;  2RPA A;  2WDV A;  5J5F A;  1EZ3 A;  4BQT A;  4G2A A;  1WR6 A;  1QLB A;  2KXP B;  5H6Q B;  4DV1 T;  3AAA B;  1VRB A;  4EYY R;  3RQU A;  3JCF A;  3IGQ A;  2IHR 1;  2NP9 A;  5IYZ E;  2YMD A;  4QWN B;  1Y01 A;  1KNZ A;  1M7K A;  4H9R C;  3LFM A;  5BRX A;  3QOF A;  2W62 A;  2UU9 T;  2NOX A;  3WAJ A;  2SPC A;  3K1S A;  3QB5 A;  2L9Q A;  5BW2 A;  1XNR T;  3N9N A;  5EK4 A;  5AFU L;  4AKL A;  3MXZ A;  3U8M A;  5ABF A;  3PUR A;  3MKD A;  4L5G A;  3AA7 B;  3ZYL A;  2BR7 A;  3FXE B;  3P7I A;  2ODV A;  2D0U A;  2YU1 A;  2D0T A;  4EZH A;  1X79 A;  3W15 B;  4ZHQ E;  4HTE A;  1MIY A;  5LJN A;  2M6B A;  3UUX B;  3NBX X;  3CK6 A;  2ACX A;  2Y58 A;  5AQQ B;  3U8J A;  2KLQ A;  2NW8 A;  4A56 A;  5JDL A;  1HG5 A;  2BG9 A;  4X1Y E;  4TWF A;  5JR9 A;  4H9O C;  4UEM A;  4TWD A;  5HCM A;  4DUZ T;  4JYA T;  2QA7 A;  3GN5 A;  1FMW A;  5LMN T;  4XAX B;  4DR6 T;  5AFH A;  2YEV C;  4HN9 A;  4YJ3 E;  2QGS A;  2V5D A;  2Y6X A;  4QXC B;  1IBK T;  3J7Y q;  3TLT A;  1IZN B;  4TNV A;  3PTR B;  4PNI A;  1SUM B;  2D2S A;  2JRK A;  2VQE T;  3J9X 1;  3RF1 A;  3C4X A;  5CFB A;  4PIR A;  4DMV A;  3RYC E;  2V5C A;  4LF9 T;  4IE0 A;  1HNX T;  4DR1 T;  3JAD A;  1D1B A;  3WTI A;  4X20 E;  4IGU A;  4U2Z A;  1HFA A;  2K24 A;  4GOU A;  3ZDG A;  3TLS A;  5FXW A;  4F8H A;  5AQS B;  2CXD A;  3P50 A;  4JLE A;  4WZX A;  2H3R A;  5JTG A;  4NXN T;  4JEU B;  3HKE E;  3TLU A;  2V6Y A;  1M62 A;  5J2U E;  4FI5 A;  2WS3 A;  4TWH A;  4B3M T;  1IJ5 A;  3GUA A;  3CQG B;  2HHH T;  3AXJ A;  1MMN A;  5CJ5 A;  2YIN A;  2YDS A;  4K0U A;  4QAA A;  4MHC A;  5JDF A;  2UXN B;  3T8O A;  4ZZC A;  3OTO T;  1N36 T;  2X51 A;  1I94 T;  2LT3 A;  2XY8 B;  2XAH B;  3U8K A;  3KVB A;  3N9P A;  1G73 A;  3EI0 A;  3VRB A;  5FXZ A;  5FXX A;  2XAG B;  5M4Y A;  2DLR A;  4QX8 B;  4X1K E;  1ZV4 X;  2C9T A;  2JPF A;  4AKG A;  5L3E B;  4U7I A;  2A2F X;  5L4E A;  3EDU A;  3O1I A;  4PJN A;  2L3L A;  4TNW A;  3TLV A;  3HKD E;  2W66 A;  2MOZ A;  4UM1 A;  5ABE A;  3ESL A;  4E7S A;  2NW7 A;  2IC6 A;  3LK4 2;  5AQI B;  1VCT A;  3AED A;  2XSA A;  2VKJ A;  5CB4 E;  2ZM6 T;  2KWI B;  3LBX B;  4UIG A;  3C64 A;  1D1C A;  2JJ9 A;  4HFH A;  2LKG A;  4C91 A;  1SE7 A;  4PK5 A;  2V6Y B;  1YKH B;  1UK5 A;  2Q9Q D;  3K3N A;  2XQ7 A;  4GKJ T;  4TX5 A;  1L0V A;  2X0H A;  4B3S T;  2X9H A;  3C50 A;  2ACZ A;  1LKX A;  5KE4 A;  2Y7Y A;  3G06 A;  5L3G B;  1HX8 A;  3ZCI A;  3RGL A;  3BQL A;  5FYM A;  4U7Y A;  2X0Y A;  2OA5 A;  4HKA A;  3KIN B;  5LG4 A;  2R6G F;  3KV4 A;  2IC9 A;  2XQ5 A;  1U5P A;  2J1D G;  5LGU B;  3JAE A;  2KND A;  4M1P A;  3RH3 A;  4U33 A;  2X9W A;  1FEW A;  2PBI A;  2XQ8 A;  4JEH B;  3VHL A;  4YTP A;  4DR2 T;  2DL1 A;  2LE8 A;  2LSK A;  2XQA A;  4LFB T;  4ZS3 A;  3PUV F;  1UGO A;  2K48 A;  4B6X A;  2LEH A;  2N2N A;  1HF8 A;  3AA6 B;  2NTY A;  2MAW A;  2ZJU A;  4X62 T;  5CO5 A;  2LSJ A;  4P09 A;  2JQQ A;  4EXT A;  3E0Z A;  2BKP A;  2WSS V;  3WTH A;  3OYX A;  4ASK A;  2DWG A;  1AJ3 A;  5LNK A;  3Q5E A;  3C4W A;  2XQ6 A;  1IJ6 A;  4ZI2 C;  5DAB A;  3GN5 B;  2ES0 A;  2FUP A;  3N5L A;  3M65 A;  4HFC A;  1D1A A;  2E8I A;  5L4H A;  3ONJ A;  4TN7 B;  2CBJ A;  4EYU A;  4O8S A;  5LGN B;  2E9X C;  4IST A;  4PK6 A;  2X67 A;  4ZI7 E;  4PFO A;  5KMG P;  4UV8 B;  4NIQ A;  1H7C A;  4CQI A;  3TLW A;  3AE1 A;  2G0U A;  5HEJ A;  2XQ9 A;  1KEY A;  4YXD A;  3Q2M A;  1WFD A;  2CM0 A;  4BFQ A;  5L2L A;  4JI6 T;  1IAP A;  3KDS E;  2W4X A;  4DV0 T;  2XTL A;  3VU7 H;  1UW6 A;  3JAF A;  2CLY C;  4IDQ A;  5F5W A;  3F57 A;  3HKC E;  2XNV A;  3WTM A;  3ABV A;  5FVL A;  3KV5 A;  2CBI A;  5FJV A;  1I6Z A;  3HI2 A;  3VR9 A;  3PUX F;  3RKO A;  3UT5 E;  3CML A;  1N32 T;  2V8S V;  4I43 B;  2VVS A;  2XQ4 A;  5AQP B;  3MA9 A;  4ERR A;  4P0A A;  1LVK A;  5HWX A;  4QXH B;  4X5T A;  3CWZ B;  4LML A;  3ETU A;  5HCJ A;  3CQX C;  3H3A A;  3K3Q C;  2RA1 A;  5EK2 A;  5AFM B;  2J62 A;  2MTQ A;  4AIS A;  3N9O A;  4MFR A;  5AQL B;  3VKH A;  1OED A;  3ONL C;  3ZYK A;  2B1E A;  1UCU A;  2BYQ A;  4HQP A;  5JR9 B;  4UEL A;  4H63 V;  2IUB A;  4HGA A;  1O3X A;  3FXD B;  2XQ3 A;  5FY7 A;  2D9D A;  4KUM B;  2WB5 A;  3LG7 A;  2VB6 A;  3RRW A;  4H9N C;  3GMI A;  3ZT7 A;  3QNU A;  3UQ4 A;  2Y57 A;  2BS2 A;  4DUY T;  3I9W A;  3JC6 C;  4DVD A;  4U74 A;  3ZDH A;  3EUH A;  3QUJ A;  2D5U A;  3CPZ A;  5LB7 B;  2Y54 A;  4IHJ E;  4WNK A;  3AVR A;  3BQK A;  3WTN A;  5AQF B;  2CEA A;  3C51 A;  2RP4 A;  4I0U A;  3O1H A;  3E22 E;  4KBM B;  5AQH B;  5ABG A;  1JNR A;  2NR4 A;  4LMK A;  2PTF A;  5EZY E;  2PFV A;  4NUV A;  4U2Y A;  4ZOL E;  2UXD T;  5JRC B;  4PW8 A;  5J2T E;  2XYS A;  4GK5 E;  3RRC A;  4UVB B;  4HWI B;  2Q9Q B;  4L9I A;  4I55 E;  2BYS A;  2AXD S;  4AIU A;  3WTK A;  2WBL A;  3ZJ2 A;  5LMU T;  4LF8 T;  5AFN A;  2AE9 A;  3FB2 A;  3IBP A;  3ZJ1 A;  5HYA A;  5AFM A;  3B5M A;  5F3J A;  3F2E A;  4KHZ F;  4YJ2 E;  5CA0 E;  4DV5 T;  3ANW B;  2LKH A;  4GK0 E;  2W0G A;  1ZHC A;  2WQY A;  2BKN A;  4DO0 A;  5BMV E; 
#chains in the Genus database with same CATH homology
 3UUB A;  3PMZ A;  4DBM A;  2XQ7 A;  2BJ0 A;  3SQ6 A;  4QH1 A;  3TLW A;  5LXB A;  4ZR6 A;  5L47 A;  2BG9 C;  5HEJ A;  3PEO A;  3UQ7 A;  2BR7 A;  3ZDH A;  3SH1 A;  4ZJT A;  4ZK1 A;  2XQ9 A;  2XZ6 A;  3TLU A;  2X00 A;  2Y54 A;  4HFE A;  4HFD A;  4TWH A;  5KE4 A;  2Y7Y A;  2BG9 E;  5LG3 A;  2WNJ A;  4ZZB A;  3GUA A;  3UU6 A;  4ILB A;  4BFQ A;  5AFK A;  2PH9 A;  3EAM A;  3WIP A;  2ZJV A;  2Y56 A;  4ZK4 A;  2M6B A;  2XNU A;  4IRE A;  1UW6 A;  3WTN A;  4QAA A;  3JAF A;  2X00 D;  2Y58 A;  3U8N A;  3ZKR A;  4ILA A;  2YME A;  3SQ9 A;  3C79 A;  3U8J A;  3WTO A;  2XQ5 A;  4NZB A;  5SYO A;  4AFT A;  4ZZC A;  2XNV A;  3WTM A;  1I9B A;  4XK9 A;  5J5G A;  5J5I A;  1OED C;  5HEU A;  3JAE A;  5AFJ A;  4UM3 P;  4LMK A;  2XZ5 A;  4FRR A;  2BG9 A;  2LLY A;  3U8K A;  4UXU A;  2XNT A;  4D01 A;  4ILC A;  3U8L A;  4TWF A;  2XQ8 A;  3RI5 A;  5FJV A;  4QH5 A;  3EI0 A;  4LMJ A;  4QH4 A;  4AFG A;  2UZ6 A;  4TWD A;  5HCM A;  2XYS A;  4AFH A;  4A97 A;  1OED E;  2XQA A;  3UU4 A;  5J0Z A;  4UM3 A;  4IL4 A;  4Z91 A;  5AFH A;  2M6I A;  2YKS A;  2YN6 A;  2XYT A;  4QAC A;  2BYR A;  2C9T A;  2WN9 A;  4WV9 A;  4A98 A;  4BQT A;  5AFL A;  1UV6 A;  2BYS A;  5TVC A;  2XQ4 A;  4HFB A;  2BYP A;  2WZY A;  2MAW A;  3TLT A;  4UM3 S;  2ZJU A;  4TNV A;  5L4E A;  5HEO A;  3WTK A;  2W8F A;  4X5T A;  4XHE A;  4ZRU A;  3RQU A;  4LML A;  4TNW A;  5CO5 A;  3TLV A;  5HCJ A;  3IGQ A;  5AFN A;  5J5H A;  3P4W A;  2YMD A;  3WTH A;  5CFB A;  3RIF A;  5AFM B;  5BP0 A;  2BG9 B;  3UU8 A;  4PIR A;  3UU3 A;  4IL9 A;  1OED B;  3RIA A;  3RQW A;  4UM1 A;  3WTL A;  1UX2 A;  5HEH A;  3UU5 A;  2WNL A;  3SIO A;  2XQ6 A;  3JAD A;  2PGZ A;  5BRX A;  4QAB A;  5AIN A;  5AFM A;  1OED A;  2BYN A;  2LM2 A;  2VL0 A;  4ALX A;  3WTI A;  2KSR A;  2BYQ A;  4B5D A;  2YOE A;  4UY2 A;  4EZ1 A;  3T4M A;  5JME A;  2BR8 A;  4HQP A;  5IUX A;  2QC1 B;  3EHZ A;  4HFH A;  5BW2 A;  4HFC A;  2LKG A;  4COF A;  4ZJS A;  2LKH A;  3C84 A;  5KZU A;  2XQ3 A;  5HEG A;  5L4H A;  3RHW A;  4HFI A;  3LSV A;  5J5F A;  3ZDG A;  2W8G A;  3U8M A;  3UQ4 A;  2WNC A;  3TLS A;  4NPP A;  4Z90 A;  4F8H A;  3WTJ A;  3P50 A;  2Y57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...