4LMLA

Glic double mutant i9'a t25'a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLAAHIAFNILVETNLPKAPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gating of the proton-gated ion channel from Gloeobacter violaceus at pH 4 as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 82
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4lmlA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4lmlA01
3IGQA 4UM3P 4BQTA 5BP0A 2PGZA 4HFBA 1I9BA 2BYQA 3C84A 4XHEA 4HFIA 5HEUA 2BG9C 3TLTA 4COFA 4IREA 2C9TA 2M6BA 4ZZCA 3P50A 2QC1B 2XZ6A 5AFMA 4UM1A 5J5HA 3WTOA 3ZKRA 2XYSA 2BG9E 5AFMB 5CFBA 3C79A 2WNLA 3RIFA 5AFHA 2LM2A 5J5GA 2KSRA 4A97A 3U8NA 2BG9B 5HEGA 5AFNA 3SIOA 3WTIA 4BFQA 2BYRA 3JAEA 5BW2A 2Y7YA 3SH1A 2XQ5A 3T4MA 4TNWA 2Y54A 5LG3A 2YN6A 3U8JA 1OEDE 2XNUA 3WTNA 3ZDGA 4UXUA 4X5TA 2WNCA 3UQ7A 2WN9A 3U8KA 3RIAA 2XQ8A 4LMKA 1UW6A 2BG9A 2MAWA 5L4EA 3WTMA 4TWHA 4DBMA 4UM3S 3TLVA 3RHWA 1UX2A 5IUXA 2BJ0A 4QAAA 4NPPA 4ILAA 3WTJA 5L47A 4Z90A 4HFEA 2XQAA 2YMEA 2YOEA 4A98A 5FJVA 2BYPA 4ZRUA 4D01A 4HQPA 5KZUA 5HEJA 3UU5A 3RI5A 2BR8A 2WNJA 2XNVA 3PMZA 4QH4A 5SYOA 4ZK4A 3TLUA 4HFDA 2X00A 2Y58A 5AFLA 4ZK1A 4LMLA 3ZDHA 5HCMA 2YMDA 2XNTA 4ZR6A 4PIRA 3WIPA 2W8GA 2XQ4A 3JADA 4ALXA 4ILCA 5J5IA 1OEDA 3EHZA 2ZJUA 5TVCA 4TWFA 4ZJSA 3EI0A 2BYSA 4NZBA 2LKGA 4ZZBA 3UQ4A 3LSVA 2XQ9A 1OEDC 5J0ZA 5HCJA 5CO5A 5J5FA 4QACA 4EZ1A 4B5DA 2BYNA 3UU6A 5HEOA 1OEDB 4WV9A 2XQ3A 3WTKA 2Y56A 5AFJA 2M6IA 4HFHA 3UUBA 2PH9A 4TNVA 4QABA 2LKHA 3GUAA 2X00D 2XQ6A 2BR7A 2YKSA 2VL0A 2LLYA 4UM3A 2XYTA 5BRXA 5HEHA 3U8MA 4TWDA 5AFKA 2W8FA 4Z91A 4ZJTA 4FRRA 2Y57A 3P4WA 5AINA 4HFCA 4IL9A 1UV6A 4XK9A 5LXBA 4ILBA 3PEOA 4UY2A 4AFTA 3WTHA 4QH1A 4QH5A 3U8LA 2UZ6A 3TLSA 3SQ6A 5JMEA 5L4HA 2ZJVA 3UU4A 3WTLA 5KE4A 3RQUA 3SQ9A 4AFGA 4LMJA 4AFHA 3JAFA 3EAMA 4F8HA 3UU8A 3TLWA 4IL4A 3RQWA 2WZYA 2XZ5A 3UU3A 2XQ7A
chains in the Genus database with same CATH superfamily
3QB5K 4I55E 4LFAT 3AEFA 2C5JA 2V1DB 2V7KA 5LGUB 4ZZCA 3RPUA 5LA6E 1N36T 5CFBA 4QKNA 5AQGB 2Q9QC 2W67A 4WZXA 1U4QA 3WTIA 2JQHA 4H63V 4IDOA 4YHJA 3GWHA 2BKNA 3WTNA 5DJQC 2D2SA 4Z8XA 1JNRA 3AE9A 1HG2A 5H6RB 4IIJE 1XNQT 3VHLA 2YMEA 2LM9A 4BA9A 4C90A 5JDQA 2KINB 5J2UE 3EDVA 4ZK4A 1MMNA 1O3XA 3O1HA 3N9QA 4H9SE 3ZMUB 4AKRB 3AAEB 3BK9A 2E9XB 2YU1A 4ZZBA 3UQ4A 2OLTA 5J0ZA 1UURA 1ZP0A 2W2UA 2LE8A 5AQUB 2XQ3A 4LF7T 4HFHA 3SWHA 3HR0A 1D1BA 4PFPA 4QX8B 3L3PA 3KINB 4ZI3C 2UXXB 2OA5A 4O4JE 2UZ6A 5JDLA 5L4HA 3UU4A 3P4SA 5C2TA 3PUXF 3N9NA 5AQMB 2EHOD 4AIUA 4AKLA 3X1DA 1HG5A 3NWIA 4YSZA 4OFZA 4IE5A 3H37A 3IF8B 3N9OA 5AFNA 4U33A 2JIWA 3PV0F 1Z8UA 3EUHA 2XNUA 3RIAA 2V7MA 4NUVA 4MHCA 1CUNA 2N9DA 4TV8E 4YSXA 3VKGA 2CE7A 2V6YB 3DP7A 3PMZA 1KNZA 2Q9QD 3ZPOA 4ZR6A 2ZM2A 2HH7A 3QB5A 4ALXA 4HEAA 1D0ZA 4HKAA 2LSGA 2CM0A 3F57A 3LSVA 1FMWA 4JI2T 4AKGA 1X79A 5LHIB 5AFJA 2UXNB 3LDQB 3AEBA 3ETUA 1MMAA 2YKSA 1HFAA 3NRXA 5LG4A 4YTMA 5HWYA 3RGLA 4IL9A 1UV6A 1JNZA 3AEDA 5FVKA 3RQUA 4K0UA 3LK2B 5LMNT 1OWAA 5HXSA 3R6NA 2CCQA 2Q9QB 3V5SA 3ZN1B 5LGNB 4MLKA 4UM1A 5AQFB 4HGAA 5DQWA 4AQYT 3QC9A 2H89A 4EV6A 4OYKA 5LG3A 4IT4A 3AE5A 5ABEA 4DBMA 3Q9DA 2WMOA 3P7IA 3JC6C 4UXNB 1ZEEA 3EDUA 1HS7A 5FJVA 5EK3A 4GK5E 5HXCA 1QSDA 5AFUL 2AE9A 4HFDA 3LJCA 2XTLA 4EZ4A 4EIWA 3C98B 3OVUA 3Q2MA 4UV9B 4B3TT 2JMHA 2CBJA 2XQ9A 5CO5A 1HF8A 5JRCB 1G73A 2M67A 3N9PA 2ZM6T 4JUYA 4LFBT 3CX8B 5M4YA 1E7PA 1UK5A 3U3IA 4TN7B 3DJBA 4TWDA 4UVBB 4YSYA 4H9PC 2V7LA 4OX9T 2H88A 3OPCA 3H3AA 2E5VA 1T8BA 3AB3B 1I9BA 4AKIA 5J2TE 3TLTA 4CXWA 3MZKB 3O4XE 4ILUA 2WBLA 3HKEE 2BG9E 1Y64B 4H9QC 2N2NA 1W0BA 5L3EB 3AECA 4YLHA 2KSRA 5HEGA 1MMGA 2BYRA 3ANWA 5IHYA 4IE6A 5JDHA 2YN6A 2L3LA 4UXUA 3PUVF 3B57A 2CXLA 1WR6A 1UX5A 3M3ZB 2X9WA 2XUEA 2RPAA 3OKQA 4MBQA 4CN1A 3SOLA 2X00A 4JLEA 5C3JA 4BAYB 4L9IA 4YFSA 4ILCA 2LRLA 2G0UA 2BYSA 5J5FA 5JRCA 4YXDA 1OEDB 5E0OA 4NUUA 4KHZF 5TAOA 5LXTE 2Y56A 4HWHA 3AEEA 2KWHA 2NP9A 2X9XA 1Y01A 1UGOA 4CI2B 4ZI2D 3RKOA 4JV5T 2LSYA 3SRZA 1XZYA 5JMEA 4I0UA 3UTKA 1WFDA 4P0BA 2BVMA 2YDRA 3SFDA 1WLXA 3MK7C 4COFA 4FI5A 2JQQA 2IC6A 2HN1A 3AE2A 2YINA 4GK0E 3C79A 3KV6A 2DHRA 2X67A 3PU3A 2JJ9A 2BG9B 1J1JA 4J2CA 3JAEA 3VRBA 2B76A 1XNRT 3IA3A 2Y8DA 2W4XA 4UELA 4XAXB 3AE3A 4O8SA 3Q5WA 1UX2A 4E7SA 4QAAA 3FB2A 4HFEA 5FKYA 1WYBA 4UIGA 5HEJA 5FXVA 2WDVA 2XAHB 2EHOC 4DR3T 3PU8A 4B3ST 1D1CA 4PIRA 2BS4A 2YU2A 5AQRB 1SA0E 3NRYA 4TX5A 4QACA 3WTKA 3PUAA 3E22E 3CMLA 4HWFA 1D1AA 2LLYA 2XYTA 1M62A 2KXPB 1XDPA 2WWUA 5J1GA 1LVFA 4PJLA 3CVRA 5LB7B 2D5UA 5GONE 5AQLB 5LMUT 2ZJVA 4IDNA 4LF4T 5FL0A 2XY8B 3WAKA 5JDFA 2XHEB 3RC3A 3UU8A 4ZOLE 4EB6E 5AQQB 2CRBA 4UVCB 2E5LT 5IWAT 5AFMA 4NIQA 1MNEA 2XAQB 3AE8A 4GKKT 3CK6A 4I43B 1KEYA 1W09A 3ESLA 4MFRA 2DNXA 3ZT7A 2WN9A 2NW8A 3QNUA 4IE0A 3RYHE 3ZYLA 2CWOA 2V6XA 5JH7E 3PE0A 2ACZA 2CMRA 3C4WA 3Q5DA 4CXYA 4ZK1A 4K0KT 3ZDHA 1KF6A 2XNTA 1HNWT 4UR9A 2FBWA 2H3RA 3OYZA 1ZOYA 4ZS3A 3UUXB 2VK9A 4L0RA 5AQPB 3R84B 2PBIA 5C8YE 4YJ2E 4B6XA 4P0AA 5JR9C 4X65T 3K3QC 2MOZA 1E2AA 3MACA 1D0YA 2E8IA 2X00D 2CHOA 4UM3A 4G2AA 4KBMB 5HEHA 4AISA 4AKHA 2BKOA 2FJDA 2UUCT 5L3GB 4AFTA 1NAFA 1UUSA 4DBRA 3SQ6A 2WCAA 3AEGA 3FXDB 4JBWF 4F8HA 3UU3A 4IHJE 4JI1T 4HFIA 2A2FX 5CGMA 5L3DB 2BG9C 3WI3A 2QC1B 1YW0A 5AFMB 4ANJA 3NZPA 2WNLA 2E2AA 5AFHA 3ZT6A 2LM2A 3CPZA 4C91A 2P9BA 2XQ5A 5FXXA 4X64T 1OEDE 3I1AA 4XZCA 2VKOA 2WNCA 3ZLIA 1MNDA 2XQ8A 3WTMA 2MAWA 3ZC0A 4O2BE 3RHWA 2C5IT 3I9WA 4NPPA 2XM1A 2UXBT 4QXCB 4D01A 3MA9A 3U78A 4PK6A 3SFEA 4ZI7E 2Y58A 5HXHA 1LVKA 3QUJA 2WSSV 3JADA 5J5IA 4TWFA 3HA4A 5F3JA 5FP3A 2VKHA 4NZBA 4HN9A 5EK4A 4U2YA 1NENA 4DV0T 2ACXA 3L39A 3O1JA 4WV9A 4DV6T 3RH3A 4DUYT 2M6IA 1IJ6A 5FMNA 4QABA 2ODUA 2XQ6A 4DV4T 5HAXA 4KUMB 3P4WA 3UFGA 1IJ5A 4ILBA 4UY2A 1YKHB 2XJ7A 4CXXA 3KBUA 5FY1A 4X1YE 4P09A 3A5XA 1QLBA 3ZYMA 2N1GA 3K3OA 2H7VC 2WZYA 3AA6B 2GK9A 4BQTA 3EABA 1L0VA 2BYQA 2K9AA 4O2AE 4TZ4C 3OJAA 2RA1A 4Q25A 3HKBE 4JI3T 4IE4A 3ZKRA 2QYWA 3Q5EA 1DU2A 4HFVA 2WU2A 5LYJE 1Z0PA 3U8NA 3UUNA 3ZC1A 2KZ7B 3L8RA 3SIOA 4BFQA 2WM9A 2D9DA 2QGSA 5BW2A 2Y7YA 3SH1A 2IUBA 3A7MA 4EOZB 3UQ7A 2WZIA 1US7B 2X0YA 3S4UA 4QXHB 2QVAA 3N2OA 3UU5A 3RI5A 2BR8A 3VU7H 4LMLA 2F4VT 1IAPA 3D0TA 4WBOA 4DR4T 1I6ZA 4E7ZA 3HKCE 3ZSSA 1IBKT 2WQYA 1G8XA 5LJNA 2BBHA 3UULA 2JPFA 5HYAA 4X20E 4DR6T 2LJLA 3GUAA 3RRWA 5AQOB 5KXJA 3FXEB 3ONLC 3AE6A 4F6RC 2W8FA 1M7KA 2VB6A 3B13A 4ADZA 3KVAA 3U8LA 3AXJB 3C4XA 5LHHB 2Y48B 3BQKA 1S35A 2VVNA 4IL4A 3RQWA 2XZ5A 3KV9A 3FZHB 2PGZA 4H9RC 2DI4A 3JCFA 5LNKA 2CPTA 3I9YA 1ZKEA 4GIWA 4TV9E 3AE4A 3ZMVB 1SUMB 3UUMA 5CB4E 2NW9A 4LFCT 4U2ZA 1YQ4A 2LRKA 3CQXC 4DV2T 5FXWA 4UVAB 2W00A 4U31A 3HKDE 4Z90A 2FUPA 2KLQA 3AXJA 3NKZA 3PUQA 4ZXLA 2MPKA 2ZM8A 2UXCT 3ZSTA 3PTRB 2OV9A 1YKEB 2R6GF 4UF0B 3LG7A 5LP6E 3WIPA 4TUYE 4U72A 3B5MA 2ZLYA 3GA8A 3P4RA 3PUYF 2IC9A 3ETVA 2BZBA 1UX4A 2FJEA 2EHOA 2SPCA 4GYSA 4TNVA 4YHHT 2VQET 2HPJA 4O4LE 2BR7A 2YDSA 1SE7A 3OBVE 5KDMC 4UEMA 5A1LA 4CQIA 4XK9A 2HN2A 1KNPA 2LHRA 3HI2A 1YXRA 2CEAA 4ASKA 3BQLA 3TLWA 4GKJT 4B3RT 4IDZA 4CN4A 3RKGA 3IGQA 2QRXA 4A5XA 5HEUA 4PFOA 1HTJF 2J4GA 4DR2T 3RYCE 3PUSA 2XYSA 1WCRA 3VR8A 2BVLA 3VKHA 1XWMA 4ZS2A 1UCUA 4DV7T 3AEAA 4OHFA 4TNWA 4B3MT 4DMWA 2Y54A 2IHR1 4X5TA 4JI6T 3U8KA 1T98A 2WZHA 5L47A 4CN6A 2BYPA 3KV4A 5EZYE 4QH4A 1N34T 2BBJA 4NXNT 2IAKA 1AJ3A 2XQ4A 2YEVC 3EI0A 1IZNB 4L5GA 2ZM0A 4EZ1A 3UU6A 2CXDA 5CA1E 1HX8A 3A8YC 1D0XA 5AQNB 4QWNB 5AFKA 2J62A 3KV5A 4FRRA 2Y57A 1KFYA 2JRKA 4BJNA 2V7JA 1NEKA 2WY2A 4QHOA 3NBXX 4CI3B 2X9HA 4LMJA 2WS3A 2JQ9A 5AQTB 4XHEA 2V8SV 2C0SA 4HE8A 2C9TA 5JDMA 1W9RA 3PJAJ 2KWIB 2XASB 3PJAA 3E08A 3JC6D 4JYAT 1VCSA 1GQEA 4DV5T 3FZLB 2X9YA 5FYMA 2BKPA 4AI6A 3ZYKA 3U8JA 1I94T 3IHRA 4DV1T 2CA5A 3AE7A 3F2EA 2IDOB 3MJXA 2WMNA 4OYJA 4A98A 1VCTA 4ZRUA 2NTXA 5L3CB 2XAJB 2E9XC 2BS3A 2DLRA 4PK4A 2LSKA 2X0LB 4JEHB 4X1IE 4DNDA 5L2LA 3K8PC 5HXEA 3FBZA 4PNIA 2ZJUA 3AA0B 2IMLA 2JMKA 3RLFF 3C51A 4KHPT 5JQGE 2I59A 2BYNA 1MIYA 2MYSA 3OTOT 3ZMSB 2CWYA 2K5BB 1IBLT 5FVLA 3N2KE 5FXZA 5JVDE 4AQGA 5LGTB 3V5UA 3GN5B 4WW0A 5LJMA 5BRXA 1ZV4X 2W0GA 4EZHA 5ADXL 5HXRA 4ZJTA 4EEBA 5LXBA 3PEOA 4QH1A 3TLSA 4PAGA 3P4PA 2PJQA 1EZ3A 3KFWX 2V26A 4WNKA 2Q9QA 5BP0A 4CI1B 2D0TA 3CIRA 4IREA 1H7CA 2M6BA 3ZEFB 2XZ6A 3RYIE 3DTOA 2FJAA 2UUAT 2XQYA 4KP3C 2K24A 1MIWA 3N2GE 2VVSA 3C4ZA 4IGUA 3O9XA 3KDSE 1V9DA 5AQKB 3RIFA 3RRCA 2FJBA 4U74A 4YTNA 4ZI2C 4N78D 2X51A 2CLYC 4QX7B 2WP9A 4HWCA 2CLYB 2BG9A 2CHNA 3OYXA 2LOSA 4ILAA 4PJNA 3UT5E 2E9XD 4OK0A 2C5KT 3ZT5A 2WNJA 1BR4A 1MIVA 3C50A 1B7TA 2LEHA 2NR4A 2DWGA 2X68A 3AA7B 3PUWF 1OEDC 3T1YT 2A3DA 4ISTA 3ZCJA 4X66T 4EAHA 1X9BA 2AXDS 3RIUA 1U5PA 4XBFB 2V7IA 3QOFA 4H9OC 3LBXB 3AAAB 3G06A 4PK5A 3PDYA 3WTHA 4QH5A 4IDPA 2VWAA 3EVYA 2ES0A 4DVDA 2XM2A 1HR0T 3N5LA 2K3WA 3RYFE 2MTQA 1HX1B 3ZCIA 2BS2A 5J5HA 4WBNE 4A56A 3QK6A 2J47A 2XAGB 1SHZC 2MBGA 1OXZA 3VR9A 3O1IA 3GN5A 2XSBA 5HWXA 5JDGA 4GYRA 4LMKA 5L4EA 3TLVA 5L3FB 4FJOA 1QUUA 3CX6B 3P4QA 1R8IA 5SYOA 4IDQA 4X62T 3TLUA 3Q5XA 4ERRA 5AQVB 2YMDA 2A72A 5IYZE 2V5DA 4EYUA 5ETWA 3VRAA 4EXTA 3J9X1 2W66A 2WDQA 4H9NC 2D0UA 4LF5T 1BR1A 2LKHA 2VL0A 4ISSA 2Y6XA 4DO0A 4Z91A 5F5WA 5AINA 4JEUB 3PURA 2WWVA 5BMVE 3CQCB 2W62A 3KVBA 5AQJB 2VKJA 4I4TE 3LFMA 4LF9T 4U7IA 3TKLB 1XDOA 3M65A 3C84A 3I0QA 3P50A 2UXDT 2WAUA 4LF8T 3K1SA 4AQFA 3ZMTB 4YY3T 3IEEA 5J5GA 4A97A 1WRDA 3CX7B 4CZZB 5H6QB 4KI0F 4DMVA 2HPLA 5KMGP 1E1HB 3LK42 3K3NA 2YK0A 1MMDA 3PUZF 1FJGT 2HHHT 1FMVA 2PG8A 1N33T 1KK7A 2LSIA 4AXPA 5IUXA 1VOMA 2WB5A 2XQAA 4H63H 2KNDA 3N9MA 4DR7T 3C64A 1HNXT 4DIDB 2ODVA 2LT3A 3H3MA 2JQKA 3ONJA 4HTEA 5DQVA 2WU5A 5HCJA 2DWKA 1J5WA 3FBLA 1YD8G 3NVOA 2PH9A 5JR9B 2E9XA 5FNVE 2WDRA 1J5ET 5LBQB 2J1DG 2CXFA 2L9QA 3CQGB 2ZMAA 2IW5B 3HL6A 4HFCA 3P8CD 2VASA 4M1PA 3T8OA 1BR0A 5KE4A 1W0AA 1FEWA 3ZJ1A 3JAFA 1ZHCA 2KT9A 3NZQA 5ABHA 2H7OA 2XZEA 4UM3P 2A9UA 3AE1A 4AQFC 5L3BB 4EGWA 4ZEYA 4QXBB 5F8PA 4UV8B 3WTOA 4ZI3D 2LHNA 4U7YA 4KMCA 3GMIA 5JREA 2UUBT 3BQIA 1LKXA 5LCYA 4YTPA 3LBXA 2QA7A 3ZMZB 1CHUA 2EHOB 2XPKA 3SS1A 1UW6A 4UM3S 4JI8T 4TWHA 2Z6EA 2BJ0A 4DR5T 3WTJA 5ABFB 2L8KA 3RIUC 3WAJA 2IIUA 3RC8A 4HQPA 5KZUA 4EYYR 3ABVA 2XNVA 4YJ3E 4I50E 1VRBA 5AFLA 2NOXA 3F31A 1LRZA 2XSAA 4PJMA 4GOUA 2X0HA 3ZN0B 5LBMA 4KX6A 5TVCA 2I0MA 5AQIB 4PW8A 5ABGA 4O4IE 4B5DA 3AA1B 1BR2A 5FL1A 4WYVA 5DABA 5BR8T 3FZFB 1WR0A 3AVRA 3UFEA 3UUBA 2PTFA 3MKDA 3KBTA 5JR9A 4X1KE 3I0OA 1YQ3A 2XAFB 2I6HA 2PFVA 4HWDA 3W15B 3AAIA 2NW7A 5EK2A 3ANWB 3FZMB 3ZJ2A 2B1EA 3WTLA 1XMQT 3SQ9A 4EEDA 4AFHA 4MALA 4DUZT 4NXMT 2XQ7A 3CWZB 3FZKB 4HFBA 2VQFT 2V5CA 4O4HE 1S94A 1IBMT 2YDQA 4UF0A 4IE7A 2DCFA 1T72A 1WYCA 3AVSA 3RX6A 3N9LA 2K48A 1HCIA 4YT0A 4ZHQE 5KX5E 5AQHB 2CBIA 3T4MA 3LK3B 4PJJA 3ZDGA 4JI5T 3RF1A 2RP4A 5FY0A 4BJMA 3PUGA 1T7SA 2YOEA 2W63A 5ABFA 4DV3T 4V1Av 5FY7A 1HNZT 2V6YA 1FIOA 1KNRA 5HCMA 5LHGB 2DL1A 3ONXA 3IBPA 2W8GA 2NTYA 5LOVE 2W61A 1OEDA 1XMOT 3EHZA 1N32T 4ZJSA 2NWBA 2VL8A 2LKGA 1NWMX 5AQSB 3CKDA 3T1HT 2LOPA 4HWIB 5HEOA 4P1NA 3MXZA 4JI4T 4JI7T 4LF6T 4DBQA 3U8MA 3E0ZA 2LSJA 3J7Yq 5CJ5A 5JTGA 2KMFA 2VKDA 2BDEA 4U3CA 3L09A 4DR1T 2VURA 3FHNA 2X66A 4AFGA 4G63A 4JI0T 3EAMA 5JDNA 5CA0E 2UU9T
chains in the Genus database with same CATH topology
3IGQA 4UM3P 4BQTA 5BP0A 2PGZA 4HFBA 1I9BA 2BYQA 3C84A 4XHEA 4HFIA 5HEUA 2BG9C 3TLTA 4COFA 4IREA 2C9TA 2M6BA 4ZZCA 3P50A 2QC1B 2XZ6A 5AFMA 4UM1A 5J5HA 3WTOA 3ZKRA 2XYSA 2BG9E 5AFMB 5CFBA 3C79A 2WNLA 3RIFA 5AFHA 2LM2A 5J5GA 2KSRA 4A97A 3U8NA 2BG9B 5HEGA 5AFNA 3SIOA 3WTIA 4BFQA 2BYRA 3JAEA 5BW2A 2Y7YA 3SH1A 2XQ5A 3T4MA 4TNWA 2Y54A 5LG3A 2YN6A 3U8JA 1OEDE 2XNUA 3WTNA 3ZDGA 4UXUA 4X5TA 2WNCA 3UQ7A 2WN9A 3U8KA 3RIAA 2XQ8A 4LMKA 1UW6A 2BG9A 2MAWA 5L4EA 3WTMA 4TWHA 4DBMA 4UM3S 3TLVA 3RHWA 1UX2A 5IUXA 2BJ0A 4QAAA 4NPPA 4ILAA 3WTJA 5L47A 4Z90A 4HFEA 2XQAA 2YMEA 2YOEA 4A98A 5FJVA 2BYPA 4ZRUA 4D01A 4HQPA 5KZUA 5HEJA 3UU5A 3RI5A 2BR8A 2WNJA 2XNVA 3PMZA 4QH4A 5SYOA 4ZK4A 3TLUA 4HFDA 2X00A 2Y58A 5AFLA 4ZK1A 4LMLA 3ZDHA 5HCMA 2YMDA 2XNTA 4ZR6A 4PIRA 3WIPA 2W8GA 2XQ4A 3JADA 4ALXA 4ILCA 5J5IA 1OEDA 3EHZA 2ZJUA 5TVCA 4TWFA 4ZJSA 3EI0A 2BYSA 4NZBA 2LKGA 4ZZBA 3UQ4A 3LSVA 2XQ9A 1OEDC 5J0ZA 5HCJA 5CO5A 5J5FA 4QACA 4EZ1A 4B5DA 2BYNA 3UU6A 5HEOA 1OEDB 4WV9A 2XQ3A 3WTKA 2Y56A 5AFJA 2M6IA 4HFHA 3UUBA 2PH9A 4TNVA 4QABA 2LKHA 3GUAA 2X00D 2XQ6A 2BR7A 2YKSA 2VL0A 2LLYA 4UM3A 2XYTA 5BRXA 5HEHA 3U8MA 4TWDA 5AFKA 2W8FA 4Z91A 4ZJTA 4FRRA 2Y57A 3P4WA 5AINA 4HFCA 4IL9A 1UV6A 4XK9A 5LXBA 4ILBA 3PEOA 4UY2A 4AFTA 3WTHA 4QH1A 4QH5A 3U8LA 2UZ6A 3TLSA 3SQ6A 5JMEA 5L4HA 2ZJVA 3UU4A 3WTLA 5KE4A 3RQUA 3SQ9A 4AFGA 4LMJA 4AFHA 3JAFA 3EAMA 4F8HA 3UU8A 3TLWA 4IL4A 3RQWA 2WZYA 2XZ5A 3UU3A 2XQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IGQ A;  4UM3 P;  4BQT A;  5BP0 A;  2PGZ A;  4HFB A;  1I9B A;  2BYQ A;  3C84 A;  4XHE A;  4HFI A;  5HEU A;  2BG9 C;  3TLT A;  4COF A;  4IRE A;  2C9T A;  2M6B A;  4ZZC A;  3P50 A;  2QC1 B;  2XZ6 A;  5AFM A;  4UM1 A;  5J5H A;  3WTO A;  3ZKR A;  2XYS A;  2BG9 E;  5AFM B;  5CFB A;  3C79 A;  2WNL A;  3RIF A;  5AFH A;  2LM2 A;  5J5G A;  2KSR A;  4A97 A;  3U8N A;  2BG9 B;  5HEG A;  5AFN A;  3SIO A;  3WTI A;  4BFQ A;  2BYR A;  3JAE A;  5BW2 A;  2Y7Y A;  3SH1 A;  2XQ5 A;  3T4M A;  4TNW A;  2Y54 A;  5LG3 A;  2YN6 A;  3U8J A;  1OED E;  2XNU A;  3WTN A;  3ZDG A;  4UXU A;  4X5T A;  2WNC A;  3UQ7 A;  2WN9 A;  3U8K A;  3RIA A;  2XQ8 A;  4LMK A;  1UW6 A;  2BG9 A;  2MAW A;  5L4E A;  3WTM A;  4TWH A;  4DBM A;  4UM3 S;  3TLV A;  3RHW A;  1UX2 A;  5IUX A;  2BJ0 A;  4QAA A;  4NPP A;  4ILA A;  3WTJ A;  5L47 A;  4Z90 A;  4HFE A;  2XQA A;  2YME A;  2YOE A;  4A98 A;  5FJV A;  2BYP A;  4ZRU A;  4D01 A;  4HQP A;  5KZU A;  5HEJ A;  3UU5 A;  3RI5 A;  2BR8 A;  2WNJ A;  2XNV A;  3PMZ A;  4QH4 A;  5SYO A;  4ZK4 A;  3TLU A;  4HFD A;  2X00 A;  2Y58 A;  5AFL A;  4ZK1 A;  4LML A;  3ZDH A;  5HCM A;  2YMD A;  2XNT A;  4ZR6 A;  4PIR A;  3WIP A;  2W8G A;  2XQ4 A;  3JAD A;  4ALX A;  4ILC A;  5J5I A;  1OED A;  3EHZ A;  2ZJU A;  5TVC A;  4TWF A;  4ZJS A;  3EI0 A;  2BYS A;  4NZB A;  2LKG A;  4ZZB A;  3UQ4 A;  3LSV A;  2XQ9 A;  1OED C;  5J0Z A;  5HCJ A;  5CO5 A;  5J5F A;  4QAC A;  4EZ1 A;  4B5D A;  2BYN A;  3UU6 A;  5HEO A;  1OED B;  4WV9 A;  2XQ3 A;  3WTK A;  2Y56 A;  5AFJ A;  2M6I A;  4HFH A;  3UUB A;  2PH9 A;  4TNV A;  4QAB A;  2LKH A;  3GUA A;  2X00 D;  2XQ6 A;  2BR7 A;  2YKS A;  2VL0 A;  2LLY A;  4UM3 A;  2XYT A;  5BRX A;  5HEH A;  3U8M A;  4TWD A;  5AFK A;  2W8F A;  4Z91 A;  4ZJT A;  4FRR A;  2Y57 A;  3P4W A;  5AIN A;  4HFC A;  4IL9 A;  1UV6 A;  4XK9 A;  5LXB A;  4ILB A;  3PEO A;  4UY2 A;  4AFT A;  3WTH A;  4QH1 A;  4QH5 A;  3U8L A;  2UZ6 A;  3TLS A;  3SQ6 A;  5JME A;  5L4H A;  2ZJV A;  3UU4 A;  3WTL A;  5KE4 A;  3RQU A;  3SQ9 A;  4AFG A;  4LMJ A;  4AFH A;  3JAF A;  3EAM A;  4F8H A;  3UU8 A;  3TLW A;  4IL4 A;  3RQW A;  2WZY A;  2XZ5 A;  3UU3 A;  2XQ7 A; 
#chains in the Genus database with same CATH topology
 3QB5 K;  4I55 E;  4LFA T;  3AEF A;  2C5J A;  2V1D B;  2V7K A;  5LGU B;  4ZZC A;  3RPU A;  5LA6 E;  1N36 T;  5CFB A;  4QKN A;  5AQG B;  2Q9Q C;  2W67 A;  4WZX A;  1U4Q A;  3WTI A;  2JQH A;  4H63 V;  4IDO A;  4YHJ A;  3GWH A;  2BKN A;  3WTN A;  5DJQ C;  2D2S A;  4Z8X A;  1JNR A;  3AE9 A;  1HG2 A;  5H6R B;  4IIJ E;  1XNQ T;  3VHL A;  2YME A;  2LM9 A;  4BA9 A;  4C90 A;  5JDQ A;  2KIN B;  5J2U E;  3EDV A;  4ZK4 A;  1MMN A;  1O3X A;  3O1H A;  3N9Q A;  4H9S E;  3ZMU B;  4AKR B;  3AAE B;  3BK9 A;  2E9X B;  2YU1 A;  4ZZB A;  3UQ4 A;  2OLT A;  5J0Z A;  1UUR A;  1ZP0 A;  2W2U A;  2LE8 A;  5AQU B;  2XQ3 A;  4LF7 T;  4HFH A;  3SWH A;  3HR0 A;  1D1B A;  4PFP A;  4QX8 B;  3L3P A;  3KIN B;  4ZI3 C;  2UXX B;  2OA5 A;  4O4J E;  2UZ6 A;  5JDL A;  5L4H A;  3UU4 A;  3P4S A;  5C2T A;  3PUX F;  3N9N A;  5AQM B;  2EHO D;  4AIU A;  4AKL A;  3X1D A;  1HG5 A;  3NWI A;  4YSZ A;  4OFZ A;  4IE5 A;  3H37 A;  3IF8 B;  3N9O A;  5AFN A;  4U33 A;  2JIW A;  3PV0 F;  1Z8U A;  3EUH A;  2XNU A;  3RIA A;  2V7M A;  4NUV A;  4MHC A;  1CUN A;  2N9D A;  4TV8 E;  4YSX A;  3VKG A;  2CE7 A;  2V6Y B;  3DP7 A;  3PMZ A;  1KNZ A;  2Q9Q D;  3ZPO A;  4ZR6 A;  2ZM2 A;  2HH7 A;  3QB5 A;  4ALX A;  4HEA A;  1D0Z A;  4HKA A;  2LSG A;  2CM0 A;  3F57 A;  3LSV A;  1FMW A;  4JI2 T;  4AKG A;  1X79 A;  5LHI B;  5AFJ A;  2UXN B;  3LDQ B;  3AEB A;  3ETU A;  1MMA A;  2YKS A;  1HFA A;  3NRX A;  5LG4 A;  4YTM A;  5HWY A;  3RGL A;  4IL9 A;  1UV6 A;  1JNZ A;  3AED A;  5FVK A;  3RQU A;  4K0U A;  3LK2 B;  5LMN T;  1OWA A;  5HXS A;  3R6N A;  2CCQ A;  2Q9Q B;  3V5S A;  3ZN1 B;  5LGN B;  4MLK A;  4UM1 A;  5AQF B;  4HGA A;  5DQW A;  4AQY T;  3QC9 A;  2H89 A;  4EV6 A;  4OYK A;  5LG3 A;  4IT4 A;  3AE5 A;  5ABE A;  4DBM A;  3Q9D A;  2WMO A;  3P7I A;  3JC6 C;  4UXN B;  1ZEE A;  3EDU A;  1HS7 A;  5FJV A;  5EK3 A;  4GK5 E;  5HXC A;  1QSD A;  5AFU L;  2AE9 A;  4HFD A;  3LJC A;  2XTL A;  4EZ4 A;  4EIW A;  3C98 B;  3OVU A;  3Q2M A;  4UV9 B;  4B3T T;  2JMH A;  2CBJ A;  2XQ9 A;  5CO5 A;  1HF8 A;  5JRC B;  1G73 A;  2M67 A;  3N9P A;  2ZM6 T;  4JUY A;  4LFB T;  3CX8 B;  5M4Y A;  1E7P A;  1UK5 A;  3U3I A;  4TN7 B;  3DJB A;  4TWD A;  4UVB B;  4YSY A;  4H9P C;  2V7L A;  4OX9 T;  2H88 A;  3OPC A;  3H3A A;  2E5V A;  1T8B A;  3AB3 B;  1I9B A;  4AKI A;  5J2T E;  3TLT A;  4CXW A;  3MZK B;  3O4X E;  4ILU A;  2WBL A;  3HKE E;  2BG9 E;  1Y64 B;  4H9Q C;  2N2N A;  1W0B A;  5L3E B;  3AEC A;  4YLH A;  2KSR A;  5HEG A;  1MMG A;  2BYR A;  3ANW A;  5IHY A;  4IE6 A;  5JDH A;  2YN6 A;  2L3L A;  4UXU A;  3PUV F;  3B57 A;  2CXL A;  1WR6 A;  1UX5 A;  3M3Z B;  2X9W A;  2XUE A;  2RPA A;  3OKQ A;  4MBQ A;  4CN1 A;  3SOL A;  2X00 A;  4JLE A;  5C3J A;  4BAY B;  4L9I A;  4YFS A;  4ILC A;  2LRL A;  2G0U A;  2BYS A;  5J5F A;  5JRC A;  4YXD A;  1OED B;  5E0O A;  4NUU A;  4KHZ F;  5TAO A;  5LXT E;  2Y56 A;  4HWH A;  3AEE A;  2KWH A;  2NP9 A;  2X9X A;  1Y01 A;  1UGO A;  4CI2 B;  4ZI2 D;  3RKO A;  4JV5 T;  2LSY A;  3SRZ A;  1XZY A;  5JME A;  4I0U A;  3UTK A;  1WFD A;  4P0B A;  2BVM A;  2YDR A;  3SFD A;  1WLX A;  3MK7 C;  4COF A;  4FI5 A;  2JQQ A;  2IC6 A;  2HN1 A;  3AE2 A;  2YIN A;  4GK0 E;  3C79 A;  3KV6 A;  2DHR A;  2X67 A;  3PU3 A;  2JJ9 A;  2BG9 B;  1J1J A;  4J2C A;  3JAE A;  3VRB A;  2B76 A;  1XNR T;  3IA3 A;  2Y8D A;  2W4X A;  4UEL A;  4XAX B;  3AE3 A;  4O8S A;  3Q5W A;  1UX2 A;  4E7S A;  4QAA A;  3FB2 A;  4HFE A;  5FKY A;  1WYB A;  4UIG A;  5HEJ A;  5FXV A;  2WDV A;  2XAH B;  2EHO C;  4DR3 T;  3PU8 A;  4B3S T;  1D1C A;  4PIR A;  2BS4 A;  2YU2 A;  5AQR B;  1SA0 E;  3NRY A;  4TX5 A;  4QAC A;  3WTK A;  3PUA A;  3E22 E;  3CML A;  4HWF A;  1D1A A;  2LLY A;  2XYT A;  1M62 A;  2KXP B;  1XDP A;  2WWU A;  5J1G A;  1LVF A;  4PJL A;  3CVR A;  5LB7 B;  2D5U A;  5GON E;  5AQL B;  5LMU T;  2ZJV A;  4IDN A;  4LF4 T;  5FL0 A;  2XY8 B;  3WAK A;  5JDF A;  2XHE B;  3RC3 A;  3UU8 A;  4ZOL E;  4EB6 E;  5AQQ B;  2CRB A;  4UVC B;  2E5L T;  5IWA T;  5AFM A;  4NIQ A;  1MNE A;  2XAQ B;  3AE8 A;  4GKK T;  3CK6 A;  4I43 B;  1KEY A;  1W09 A;  3ESL A;  4MFR A;  2DNX A;  3ZT7 A;  2WN9 A;  2NW8 A;  3QNU A;  4IE0 A;  3RYH E;  3ZYL A;  2CWO A;  2V6X A;  5JH7 E;  3PE0 A;  2ACZ A;  2CMR A;  3C4W A;  3Q5D A;  4CXY A;  4ZK1 A;  4K0K T;  3ZDH A;  1KF6 A;  2XNT A;  1HNW T;  4UR9 A;  2FBW A;  2H3R A;  3OYZ A;  1ZOY A;  4ZS3 A;  3UUX B;  2VK9 A;  4L0R A;  5AQP B;  3R84 B;  2PBI A;  5C8Y E;  4YJ2 E;  4B6X A;  4P0A A;  5JR9 C;  4X65 T;  3K3Q C;  2MOZ A;  1E2A A;  3MAC A;  1D0Y A;  2E8I A;  2X00 D;  2CHO A;  4UM3 A;  4G2A A;  4KBM B;  5HEH A;  4AIS A;  4AKH A;  2BKO A;  2FJD A;  2UUC T;  5L3G B;  4AFT A;  1NAF A;  1UUS A;  4DBR A;  3SQ6 A;  2WCA A;  3AEG A;  3FXD B;  4JBW F;  4F8H A;  3UU3 A;  4IHJ E;  4JI1 T;  4HFI A;  2A2F X;  5CGM A;  5L3D B;  2BG9 C;  3WI3 A;  2QC1 B;  1YW0 A;  5AFM B;  4ANJ A;  3NZP A;  2WNL A;  2E2A A;  5AFH A;  3ZT6 A;  2LM2 A;  3CPZ A;  4C91 A;  2P9B A;  2XQ5 A;  5FXX A;  4X64 T;  1OED E;  3I1A A;  4XZC A;  2VKO A;  2WNC A;  3ZLI A;  1MND A;  2XQ8 A;  3WTM A;  2MAW A;  3ZC0 A;  4O2B E;  3RHW A;  2C5I T;  3I9W A;  4NPP A;  2XM1 A;  2UXB T;  4QXC B;  4D01 A;  3MA9 A;  3U78 A;  4PK6 A;  3SFE A;  4ZI7 E;  2Y58 A;  5HXH A;  1LVK A;  3QUJ A;  2WSS V;  3JAD A;  5J5I A;  4TWF A;  3HA4 A;  5F3J A;  5FP3 A;  2VKH A;  4NZB A;  4HN9 A;  5EK4 A;  4U2Y A;  1NEN A;  4DV0 T;  2ACX A;  3L39 A;  3O1J A;  4WV9 A;  4DV6 T;  3RH3 A;  4DUY T;  2M6I A;  1IJ6 A;  5FMN A;  4QAB A;  2ODU A;  2XQ6 A;  4DV4 T;  5HAX A;  4KUM B;  3P4W A;  3UFG A;  1IJ5 A;  4ILB A;  4UY2 A;  1YKH B;  2XJ7 A;  4CXX A;  3KBU A;  5FY1 A;  4X1Y E;  4P09 A;  3A5X A;  1QLB A;  3ZYM A;  2N1G A;  3K3O A;  2H7V C;  2WZY A;  3AA6 B;  2GK9 A;  4BQT A;  3EAB A;  1L0V A;  2BYQ A;  2K9A A;  4O2A E;  4TZ4 C;  3OJA A;  2RA1 A;  4Q25 A;  3HKB E;  4JI3 T;  4IE4 A;  3ZKR A;  2QYW A;  3Q5E A;  1DU2 A;  4HFV A;  2WU2 A;  5LYJ E;  1Z0P A;  3U8N A;  3UUN A;  3ZC1 A;  2KZ7 B;  3L8R A;  3SIO A;  4BFQ A;  2WM9 A;  2D9D A;  2QGS A;  5BW2 A;  2Y7Y A;  3SH1 A;  2IUB A;  3A7M A;  4EOZ B;  3UQ7 A;  2WZI A;  1US7 B;  2X0Y A;  3S4U A;  4QXH B;  2QVA A;  3N2O A;  3UU5 A;  3RI5 A;  2BR8 A;  3VU7 H;  4LML A;  2F4V T;  1IAP A;  3D0T A;  4WBO A;  4DR4 T;  1I6Z A;  4E7Z A;  3HKC E;  3ZSS A;  1IBK T;  2WQY A;  1G8X A;  5LJN A;  2BBH A;  3UUL A;  2JPF A;  5HYA A;  4X20 E;  4DR6 T;  2LJL A;  3GUA A;  3RRW A;  5AQO B;  5KXJ A;  3FXE B;  3ONL C;  3AE6 A;  4F6R C;  2W8F A;  1M7K A;  2VB6 A;  3B13 A;  4ADZ A;  3KVA A;  3U8L A;  3AXJ B;  3C4X A;  5LHH B;  2Y48 B;  3BQK A;  1S35 A;  2VVN A;  4IL4 A;  3RQW A;  2XZ5 A;  3KV9 A;  3FZH B;  2PGZ A;  4H9R C;  2DI4 A;  3JCF A;  5LNK A;  2CPT A;  3I9Y A;  1ZKE A;  4GIW A;  4TV9 E;  3AE4 A;  3ZMV B;  1SUM B;  3UUM A;  5CB4 E;  2NW9 A;  4LFC T;  4U2Z A;  1YQ4 A;  2LRK A;  3CQX C;  4DV2 T;  5FXW A;  4UVA B;  2W00 A;  4U31 A;  3HKD E;  4Z90 A;  2FUP A;  2KLQ A;  3AXJ A;  3NKZ A;  3PUQ A;  4ZXL A;  2MPK A;  2ZM8 A;  2UXC T;  3ZST A;  3PTR B;  2OV9 A;  1YKE B;  2R6G F;  4UF0 B;  3LG7 A;  5LP6 E;  3WIP A;  4TUY E;  4U72 A;  3B5M A;  2ZLY A;  3GA8 A;  3P4R A;  3PUY F;  2IC9 A;  3ETV A;  2BZB A;  1UX4 A;  2FJE A;  2EHO A;  2SPC A;  4GYS A;  4TNV A;  4YHH T;  2VQE T;  2HPJ A;  4O4L E;  2BR7 A;  2YDS A;  1SE7 A;  3OBV E;  5KDM C;  4UEM A;  5A1L A;  4CQI A;  4XK9 A;  2HN2 A;  1KNP A;  2LHR A;  3HI2 A;  1YXR A;  2CEA A;  4ASK A;  3BQL A;  3TLW A;  4GKJ T;  4B3R T;  4IDZ A;  4CN4 A;  3RKG A;  3IGQ A;  2QRX A;  4A5X A;  5HEU A;  4PFO A;  1HTJ F;  2J4G A;  4DR2 T;  3RYC E;  3PUS A;  2XYS A;  1WCR A;  3VR8 A;  2BVL A;  3VKH A;  1XWM A;  4ZS2 A;  1UCU A;  4DV7 T;  3AEA A;  4OHF A;  4TNW A;  4B3M T;  4DMW A;  2Y54 A;  2IHR 1;  4X5T A;  4JI6 T;  3U8K A;  1T98 A;  2WZH A;  5L47 A;  4CN6 A;  2BYP A;  3KV4 A;  5EZY E;  4QH4 A;  1N34 T;  2BBJ A;  4NXN T;  2IAK A;  1AJ3 A;  2XQ4 A;  2YEV C;  3EI0 A;  1IZN B;  4L5G A;  2ZM0 A;  4EZ1 A;  3UU6 A;  2CXD A;  5CA1 E;  1HX8 A;  3A8Y C;  1D0X A;  5AQN B;  4QWN B;  5AFK A;  2J62 A;  3KV5 A;  4FRR A;  2Y57 A;  1KFY A;  2JRK A;  4BJN A;  2V7J A;  1NEK A;  2WY2 A;  4QHO A;  3NBX X;  4CI3 B;  2X9H A;  4LMJ A;  2WS3 A;  2JQ9 A;  5AQT B;  4XHE A;  2V8S V;  2C0S A;  4HE8 A;  2C9T A;  5JDM A;  1W9R A;  3PJA J;  2KWI B;  2XAS B;  3PJA A;  3E08 A;  3JC6 D;  4JYA T;  1VCS A;  1GQE A;  4DV5 T;  3FZL B;  2X9Y A;  5FYM A;  2BKP A;  4AI6 A;  3ZYK A;  3U8J A;  1I94 T;  3IHR A;  4DV1 T;  2CA5 A;  3AE7 A;  3F2E A;  2IDO B;  3MJX A;  2WMN A;  4OYJ A;  4A98 A;  1VCT A;  4ZRU A;  2NTX A;  5L3C B;  2XAJ B;  2E9X C;  2BS3 A;  2DLR A;  4PK4 A;  2LSK A;  2X0L B;  4JEH B;  4X1I E;  4DND A;  5L2L A;  3K8P C;  5HXE A;  3FBZ A;  4PNI A;  2ZJU A;  3AA0 B;  2IML A;  2JMK A;  3RLF F;  3C51 A;  4KHP T;  5JQG E;  2I59 A;  2BYN A;  1MIY A;  2MYS A;  3OTO T;  3ZMS B;  2CWY A;  2K5B B;  1IBL T;  5FVL A;  3N2K E;  5FXZ A;  5JVD E;  4AQG A;  5LGT B;  3V5U A;  3GN5 B;  4WW0 A;  5LJM A;  5BRX A;  1ZV4 X;  2W0G A;  4EZH A;  5ADX L;  5HXR A;  4ZJT A;  4EEB A;  5LXB A;  3PEO A;  4QH1 A;  3TLS A;  4PAG A;  3P4P A;  2PJQ A;  1EZ3 A;  3KFW X;  2V26 A;  4WNK A;  2Q9Q A;  5BP0 A;  4CI1 B;  2D0T A;  3CIR A;  4IRE A;  1H7C A;  2M6B A;  3ZEF B;  2XZ6 A;  3RYI E;  3DTO A;  2FJA A;  2UUA T;  2XQY A;  4KP3 C;  2K24 A;  1MIW A;  3N2G E;  2VVS A;  3C4Z A;  4IGU A;  3O9X A;  3KDS E;  1V9D A;  5AQK B;  3RIF A;  3RRC A;  2FJB A;  4U74 A;  4YTN A;  4ZI2 C;  4N78 D;  2X51 A;  2CLY C;  4QX7 B;  2WP9 A;  4HWC A;  2CLY B;  2BG9 A;  2CHN A;  3OYX A;  2LOS A;  4ILA A;  4PJN A;  3UT5 E;  2E9X D;  4OK0 A;  2C5K T;  3ZT5 A;  2WNJ A;  1BR4 A;  1MIV A;  3C50 A;  1B7T A;  2LEH A;  2NR4 A;  2DWG A;  2X68 A;  3AA7 B;  3PUW F;  1OED C;  3T1Y T;  2A3D A;  4IST A;  3ZCJ A;  4X66 T;  4EAH A;  1X9B A;  2AXD S;  3RIU A;  1U5P A;  4XBF B;  2V7I A;  3QOF A;  4H9O C;  3LBX B;  3AAA B;  3G06 A;  4PK5 A;  3PDY A;  3WTH A;  4QH5 A;  4IDP A;  2VWA A;  3EVY A;  2ES0 A;  4DVD A;  2XM2 A;  1HR0 T;  3N5L A;  2K3W A;  3RYF E;  2MTQ A;  1HX1 B;  3ZCI A;  2BS2 A;  5J5H A;  4WBN E;  4A56 A;  3QK6 A;  2J47 A;  2XAG B;  1SHZ C;  2MBG A;  1OXZ A;  3VR9 A;  3O1I A;  3GN5 A;  2XSB A;  5HWX A;  5JDG A;  4GYR A;  4LMK A;  5L4E A;  3TLV A;  5L3F B;  4FJO A;  1QUU A;  3CX6 B;  3P4Q A;  1R8I A;  5SYO A;  4IDQ A;  4X62 T;  3TLU A;  3Q5X A;  4ERR A;  5AQV B;  2YMD A;  2A72 A;  5IYZ E;  2V5D A;  4EYU A;  5ETW A;  3VRA A;  4EXT A;  3J9X 1;  2W66 A;  2WDQ A;  4H9N C;  2D0U A;  4LF5 T;  1BR1 A;  2LKH A;  2VL0 A;  4ISS A;  2Y6X A;  4DO0 A;  4Z91 A;  5F5W A;  5AIN A;  4JEU B;  3PUR A;  2WWV A;  5BMV E;  3CQC B;  2W62 A;  3KVB A;  5AQJ B;  2VKJ A;  4I4T E;  3LFM A;  4LF9 T;  4U7I A;  3TKL B;  1XDO A;  3M65 A;  3C84 A;  3I0Q A;  3P50 A;  2UXD T;  2WAU A;  4LF8 T;  3K1S A;  4AQF A;  3ZMT B;  4YY3 T;  3IEE A;  5J5G A;  4A97 A;  1WRD A;  3CX7 B;  4CZZ B;  5H6Q B;  4KI0 F;  4DMV A;  2HPL A;  5KMG P;  1E1H B;  3LK4 2;  3K3N A;  2YK0 A;  1MMD A;  3PUZ F;  1FJG T;  2HHH T;  1FMV A;  2PG8 A;  1N33 T;  1KK7 A;  2LSI A;  4AXP A;  5IUX A;  1VOM A;  2WB5 A;  2XQA A;  4H63 H;  2KND A;  3N9M A;  4DR7 T;  3C64 A;  1HNX T;  4DID B;  2ODV A;  2LT3 A;  3H3M A;  2JQK A;  3ONJ A;  4HTE A;  5DQV A;  2WU5 A;  5HCJ A;  2DWK A;  1J5W A;  3FBL A;  1YD8 G;  3NVO A;  2PH9 A;  5JR9 B;  2E9X A;  5FNV E;  2WDR A;  1J5E T;  5LBQ B;  2J1D G;  2CXF A;  2L9Q A;  3CQG B;  2ZMA A;  2IW5 B;  3HL6 A;  4HFC A;  3P8C D;  2VAS A;  4M1P A;  3T8O A;  1BR0 A;  5KE4 A;  1W0A A;  1FEW A;  3ZJ1 A;  3JAF A;  1ZHC A;  2KT9 A;  3NZQ A;  5ABH A;  2H7O A;  2XZE A;  4UM3 P;  2A9U A;  3AE1 A;  4AQF C;  5L3B B;  4EGW A;  4ZEY A;  4QXB B;  5F8P A;  4UV8 B;  3WTO A;  4ZI3 D;  2LHN A;  4U7Y A;  4KMC A;  3GMI A;  5JRE A;  2UUB T;  3BQI A;  1LKX A;  5LCY A;  4YTP A;  3LBX A;  2QA7 A;  3ZMZ B;  1CHU A;  2EHO B;  2XPK A;  3SS1 A;  1UW6 A;  4UM3 S;  4JI8 T;  4TWH A;  2Z6E A;  2BJ0 A;  4DR5 T;  3WTJ A;  5ABF B;  2L8K A;  3RIU C;  3WAJ A;  2IIU A;  3RC8 A;  4HQP A;  5KZU A;  4EYY R;  3ABV A;  2XNV A;  4YJ3 E;  4I50 E;  1VRB A;  5AFL A;  2NOX A;  3F31 A;  1LRZ A;  2XSA A;  4PJM A;  4GOU A;  2X0H A;  3ZN0 B;  5LBM A;  4KX6 A;  5TVC A;  2I0M A;  5AQI B;  4PW8 A;  5ABG A;  4O4I E;  4B5D A;  3AA1 B;  1BR2 A;  5FL1 A;  4WYV A;  5DAB A;  5BR8 T;  3FZF B;  1WR0 A;  3AVR A;  3UFE A;  3UUB A;  2PTF A;  3MKD A;  3KBT A;  5JR9 A;  4X1K E;  3I0O A;  1YQ3 A;  2XAF B;  2I6H A;  2PFV A;  4HWD A;  3W15 B;  3AAI A;  2NW7 A;  5EK2 A;  3ANW B;  3FZM B;  3ZJ2 A;  2B1E A;  3WTL A;  1XMQ T;  3SQ9 A;  4EED A;  4AFH A;  4MAL A;  4DUZ T;  4NXM T;  2XQ7 A;  3CWZ B;  3FZK B;  4HFB A;  2VQF T;  2V5C A;  4O4H E;  1S94 A;  1IBM T;  2YDQ A;  4UF0 A;  4IE7 A;  2DCF A;  1T72 A;  1WYC A;  3AVS A;  3RX6 A;  3N9L A;  2K48 A;  1HCI A;  4YT0 A;  4ZHQ E;  5KX5 E;  5AQH B;  2CBI A;  3T4M A;  3LK3 B;  4PJJ A;  3ZDG A;  4JI5 T;  3RF1 A;  2RP4 A;  5FY0 A;  4BJM A;  3PUG A;  1T7S A;  2YOE A;  2W63 A;  5ABF A;  4DV3 T;  4V1A v;  5FY7 A;  1HNZ T;  2V6Y A;  1FIO A;  1KNR A;  5HCM A;  5LHG B;  2DL1 A;  3ONX A;  3IBP A;  2W8G A;  2NTY A;  5LOV E;  2W61 A;  1OED A;  1XMO T;  3EHZ A;  1N32 T;  4ZJS A;  2NWB A;  2VL8 A;  2LKG A;  1NWM X;  5AQS B;  3CKD A;  3T1H T;  2LOP A;  4HWI B;  5HEO A;  4P1N A;  3MXZ A;  4JI4 T;  4JI7 T;  4LF6 T;  4DBQ A;  3U8M A;  3E0Z A;  2LSJ A;  3J7Y q;  5CJ5 A;  5JTG A;  2KMF A;  2VKD A;  2BDE A;  4U3C A;  3L09 A;  4DR1 T;  2VUR A;  3FHN A;  2X66 A;  4AFG A;  4G63 A;  4JI0 T;  3EAM A;  5JDN A;  5CA0 E;  2UU9 T; 
#chains in the Genus database with same CATH homology
 3IGQ A;  4UM3 P;  4BQT A;  5BP0 A;  2PGZ A;  4HFB A;  1I9B A;  2BYQ A;  3C84 A;  4XHE A;  4HFI A;  5HEU A;  2BG9 C;  3TLT A;  4COF A;  4IRE A;  2C9T A;  2M6B A;  4ZZC A;  3P50 A;  2QC1 B;  2XZ6 A;  5AFM A;  4UM1 A;  5J5H A;  3WTO A;  3ZKR A;  2XYS A;  2BG9 E;  5AFM B;  5CFB A;  3C79 A;  2WNL A;  3RIF A;  5AFH A;  2LM2 A;  5J5G A;  2KSR A;  4A97 A;  3U8N A;  2BG9 B;  5HEG A;  5AFN A;  3SIO A;  3WTI A;  4BFQ A;  2BYR A;  3JAE A;  5BW2 A;  2Y7Y A;  3SH1 A;  2XQ5 A;  3T4M A;  4TNW A;  2Y54 A;  5LG3 A;  2YN6 A;  3U8J A;  1OED E;  2XNU A;  3WTN A;  3ZDG A;  4UXU A;  4X5T A;  2WNC A;  3UQ7 A;  2WN9 A;  3U8K A;  3RIA A;  2XQ8 A;  4LMK A;  1UW6 A;  2BG9 A;  2MAW A;  5L4E A;  3WTM A;  4TWH A;  4DBM A;  4UM3 S;  3TLV A;  3RHW A;  1UX2 A;  5IUX A;  2BJ0 A;  4QAA A;  4NPP A;  4ILA A;  3WTJ A;  5L47 A;  4Z90 A;  4HFE A;  2XQA A;  2YME A;  2YOE A;  4A98 A;  5FJV A;  2BYP A;  4ZRU A;  4D01 A;  4HQP A;  5KZU A;  5HEJ A;  3UU5 A;  3RI5 A;  2BR8 A;  2WNJ A;  2XNV A;  3PMZ A;  4QH4 A;  5SYO A;  4ZK4 A;  3TLU A;  4HFD A;  2X00 A;  2Y58 A;  5AFL A;  4ZK1 A;  4LML A;  3ZDH A;  5HCM A;  2YMD A;  2XNT A;  4ZR6 A;  4PIR A;  3WIP A;  2W8G A;  2XQ4 A;  3JAD A;  4ALX A;  4ILC A;  5J5I A;  1OED A;  3EHZ A;  2ZJU A;  5TVC A;  4TWF A;  4ZJS A;  3EI0 A;  2BYS A;  4NZB A;  2LKG A;  4ZZB A;  3UQ4 A;  3LSV A;  2XQ9 A;  1OED C;  5J0Z A;  5HCJ A;  5CO5 A;  5J5F A;  4QAC A;  4EZ1 A;  4B5D A;  2BYN A;  3UU6 A;  5HEO A;  1OED B;  4WV9 A;  2XQ3 A;  3WTK A;  2Y56 A;  5AFJ A;  2M6I A;  4HFH A;  3UUB A;  2PH9 A;  4TNV A;  4QAB A;  2LKH A;  3GUA A;  2X00 D;  2XQ6 A;  2BR7 A;  2YKS A;  2VL0 A;  2LLY A;  4UM3 A;  2XYT A;  5BRX A;  5HEH A;  3U8M A;  4TWD A;  5AFK A;  2W8F A;  4Z91 A;  4ZJT A;  4FRR A;  2Y57 A;  3P4W A;  5AIN A;  4HFC A;  4IL9 A;  1UV6 A;  4XK9 A;  5LXB A;  4ILB A;  3PEO A;  4UY2 A;  4AFT A;  3WTH A;  4QH1 A;  4QH5 A;  3U8L A;  2UZ6 A;  3TLS A;  3SQ6 A;  5JME A;  5L4H A;  2ZJV A;  3UU4 A;  3WTL A;  5KE4 A;  3RQU A;  3SQ9 A;  4AFG A;  4LMJ A;  4AFH A;  3JAF A;  3EAM A;  4F8H A;  3UU8 A;  3TLW A;  4IL4 A;  3RQW A;  2WZY A;  2XZ5 A;  3UU3 A;  2XQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...