4LMLA

Glic double mutant i9'a t25'a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
310
structure length
310
Chain Sequence
b'PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLAAHIAFNILVETNLPKAPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Gating of the proton-gated ion channel from Gloeobacter violaceus at pH 4 as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 82
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4lmlA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4lmlA01
5HEUA 5HEHA 4LMJA 3UQ7A 2ZJVA 4QABA 3ZDHA 5HEJA 4ZK4A 2X00A 5J5GA 3C84A 4B5DA 5BRXA 4UM3P 2VL0A 4ILBA 4A97A 4EZ1A 4ZZCA 2ZJUA 3T4MA 2XQ7A 4HFHA 4QAAA 2WNLA 2Y54A 5HEOA 5AFMB 4IL4A 3U8LA 4IL9A 5AFNA 3PEOA 3UU3A 5HCMA 5HCJA 2XZ5A 3UQ4A 3SIOA 2KSRA 4QH4A 4UY2A 5JMEA 4TNWA 3RHWA 5HEGA 3TLTA 3EAMA 3P4WA 2BYQA 4UM1A 3WTHA 3WTKA 4XHEA 2XYTA 2WNCA 2Y57A 3U8MA 4AFHA 5AFLA 4LMKA 1OEDA 2PH9A 3UU8A 4NZBA 4NPPA 2MAWA 3SQ9A 5AFJA 2YMDA 3U8JA 2X00D 5KZUA 4ZJSA 5J0ZA 2XQ5A 2LKGA 3LSVA 4BQTA 3EI0A 3PMZA 3UU5A 4COFA 5KE4A 2BYRA 5AFMA 4ZR6A 4HFEA 4Z90A 2WN9A 2BR8A 2XYSA 2BG9E 1OEDC 4QH1A 4ZRUA 3TLSA 3TLWA 3WTLA 2BJ0A 4WV9A 3C79A 3GUAA 2LKHA 3RIAA 2XQ9A 2XNVA 5J5FA 3TLVA 3TLUA 5SYOA 3U8NA 4PIRA 5AFHA 4HFIA 2BG9B 2M6BA 4IREA 3UU4A 1UW6A 3RI5A 2WNJA 4ILAA 3WIPA 2BYNA 2YN6A 5FJVA 2XQ4A 3EHZA 2Y56A 2BYPA 5J5IA 5J5HA 3RQUA 1UX2A 3ZDGA 4ZK1A 4HQPA 4TWHA 4TWFA 5TVCA 4Z91A 4HFCA 1OEDE 3P50A 4ILCA 2W8GA 2BR7A 2XQ8A 2XQAA 3UUBA 4D01A 2XQ6A 5CO5A 5L4EA 3SQ6A 4DBMA 5BW2A 2Y58A 2Y7YA 3WTIA 3SH1A 3RIFA 5CFBA 4UXUA 4HFDA 2BG9A 2LM2A 4FRRA 5BP0A 3JAEA 5AINA 1OEDB 4TWDA 2XNTA 4BFQA 4UM3S 4A98A 4XK9A 3RQWA 4F8HA 4X5TA 1UV6A 2XQ3A 2PGZA 4HFBA 4TNVA 2WZYA 4AFTA 2BYSA 3WTJA 4LMLA 2XZ6A 2W8FA 2YMEA 4ALXA 1I9BA 5L47A 3WTNA 2QC1B 4QH5A 3U8KA 2YOEA 2M6IA 2UZ6A 2BG9C 2XNUA 3IGQA 4UM3A 4AFGA 2C9TA 3WTMA 5LXBA 5L4HA 3UU6A 5IUXA 4ZZBA 3JAFA 4ZJTA 3WTOA 5AFKA 2YKSA 4QACA 3JADA 5LG3A 2LLYA 3ZKRA
chains in the Genus database with same CATH superfamily
2CWOA 4ZI3C 4KHZF 5AQRB 1HNWT 4QKNA 3AE3A 4V1Av 2A9UA 2W00A 3T4MA 4IL4A 3U78A 4QXHB 2CCQA 2C0SA 5IYZE 5JMEA 2UUBT 2B76A 1KNPA 4AQGA 4DV2T 1HR0T 3RC3A 3LBXB 2X00D 2CWYA 1M7KA 5C3JA 4GYSA 2LT3A 3LK2B 4YY3T 2WDQA 3FZLB 5F5WA 3QNUA 2WB5A 2XSBA 4ZK1A 4AQFA 3KV4A 3LJCA 1FJGT 2Q9QC 5JH7E 5JDFA 5LMNT 5FXZA 4PJJA 4PJMA 3C4XA 1WFDA 2YK0A 4EZ4A 2Y58A 1YW0A 4TV9E 4YT0A 3QOFA 2LRLA 3CX8B 5LG4A 3RQWA 4F8HA 4EYUA 3RX6A 2BVMA 3SRZA 5FXWA 2KT9A 2E9XC 3M3ZB 3ABVA 3UU6A 1KFYA 4KUMB 1T8BA 4LMJA 4L0RA 1W0BA 2HN1A 5HEJA 3N5LA 3D0TA 3I0QA 2VB6A 3Q2MA 2HPLA 1BR0A 4UR9A 3OKQA 1SE7A 4IL9A 3PEOA 5HCMA 2KSRA 2PTFA 4O4IE 4XZCA 3E08A 2K24A 1LVFA 2JQKA 1J1JA 2W61A 2Y57A 4CXYA 3H3AA 4O2BE 2L3LA 2LSKA 4CXXA 3JC6D 1ZEEA 2WQYA 5FKYA 5AFMA 4Z90A 3SFDA 4UVBB 4O8SA 3RIAA 1FIOA 4HWCA 1I94T 3ZMSB 2BBHA 5JTGA 5FY0A 5L3DB 3ZDGA 1HFAA 3P50A 4ILCA 5JDLA 1D0XA 2XPKA 4JLEA 3AXJA 2WWUA 5AINA 2N1GA 4O4JE 4EIWA 4AFTA 3E0ZA 5LHGB 1VCTA 4MHCA 4Z8XA 3O9XA 4DR3T 2BKOA 2VWAA 5AQFB 3HKEE 2LLYA 1E1HB 2XY8B 4EAHA 2YDRA 4ILBA 4ISTA 4QAAA 5HEOA 2CBJA 2GK9A 2C5JA 4DBRA 4FI5A 5H6RB 4HTEA 3Q9DA 3CKDA 4JEHB 2A72A 3CMLA 5KZUA 2NW9A 5JDQA 5CJ5A 2LKGA 1IBMT 4UXNB 3NKZA 4WW0A 4YSXA 2XYSA 3KV5A 3PUZF 4WBNE 3EVYA 2A2FX 4H9QC 4JI2T 4UV8B 2M6BA 2BBJA 3ZSTA 3PUGA 4BA9A 2LE8A 3RGLA 2WM9A 3ZEFB 4HN9A 1WCRA 1KK7A 1D1AA 2CMRA 3WTIA 5L3BB 2BG9A 3JAEA 5AQHB 1UX4A 3X1DA 3ZYKA 4G2AA 4QXCB 2L9QA 3WTJA 4AKLA 2YMEA 3WTNA 4IE7A 2OA5A 4H9RC 2WU5A 3WTMA 3MA9A 4XBFB 2DWGA 2N9DA 2WMNA 3UQ7A 2CRBA 3FB2A 3HKDE 4YTPA 3PV0F 4H9NC 3AAAB 4KX6A 2QA7A 2PG8A 4B3RT 2WWVA 2BZBA 4P1NA 2H3RA 2K48A 1HX8A 2V5DA 5DJQC 4DR5T 2DCFA 2CHOA 4UVCB 5FL1A 5LNKA 4B6XA 3M65A 3Q5EA 3L39A 4X66T 3PURA 4LF4T 4E7SA 1S94A 5AQKB 2D0TA 4K0UA 3MACA 3TLUA 4YFSA 4IREA 1UW6A 2IIUA 2XZEA 4YLHA 5FJVA 2XAFB 3GWHA 5LP6E 4B3TT 2CXFA 5AQIB 1YQ4A 4LFBT 3DJBA 4Z91A 4ZI2C 2XQ8A 1KNRA 5LGTB 3SH1A 3OVUA 5A1LA 2NR4A 3Q5DA 3C64A 3VKHA 1Z8UA 3Q5WA 3ONXA 4UV9B 4U2YA 5FNVE 4UM3A 4CZZB 4HGAA 4AKHA 1FMWA 4JI1T 2ZJVA 3LK42 5AQVB 5DQWA 2NWBA 2QRXA 4UF0A 4EV6A 3U8LA 3AEBA 3UU3A 1E2AA 4GK0E 1XDOA 5FXVA 3N2GE 4AFHA 3NBXX 3UU8A 5J0ZA 2CXDA 4M1PA 3S4UA 3DP7A 3O1IA 2EHOA 4OYJA 3J9X1 3FHNA 2J62A 4ZR6A 3UUNA 3OTOT 4WBOA 3B5MA 1OEDC 2KNDA 2WZIA 4DMVA 4MALA 2CEAA 4C91A 2E2AA 1QSDA 5AFHA 4HFIA 3EUHA 3ZYMA 2H7VC 4OX9T 3HA4A 3ONJA 5AQMB 2Y56A 2YU2A 3PUXF 1W09A 4IDOA 1ZOYA 4UF0B 5FY1A 1NAFA 2B1EA 4YTMA 4JI8T 1OEDE 4DIDB 1MNDA 4IHJE 1GQEA 3RIFA 5JR9A 2QYWA 4ZI2D 1IZNB 4O2AE 4HEAA 4PFOA 4NXNT 3GA8A 4DUYT 5LYJE 2XZ6A 2EHOB 1UX5A 4IT4A 4QWNB 4X1IE 2DLRA 4TN7B 5LHIB 2UZ6A 3GN5A 4U31A 2C9TA 5CA1E 4OYKA 1EZ3A 3LK3B 5IUXA 1N36T 4ZZBA 1HTJF 3WTOA 5ADXL 2QGSA 4N78D 3C4WA 4IE4A 3ZCJA 2X9XA 4JI3T 2E5VA 2IHR1 5HWYA 1IJ5A 3R6NA 3AE7A 3LFMA 3ETVA 4AKGA 4CN6A 4U3CA 3NZQA 3UUXB 3TLTA 3IF8B 3ZC0A 3P4WA 2XAJB 5AQPB 3U8MA 3PE0A 1BR4A 3ZC1A 1R8IA 1NWMX 4BJNA 2K5BB 2I0MA 3GMIA 3LSVA 3WAKA 2BYRA 2CLYB 3RIUA 3GN5B 2BJ0A 4CI1B 3N9MA 3AECA 1SA0E 3JC6C 1JNZA 2WNJA 2NW8A 3MJXA 5J5IA 5IWAT 4O4LE 4CI2B 5HWXA 2BVLA 1XMOT 4AKIA 3FBZA 3P4RA 2D9DA 2LOPA 2W4XA 3P4PA 4QX8B 4DVDA 1UCUA 3T1YT 4FJOA 4X62T 1UGOA 4PK4A 2XNTA 4AQFC 4JYAT 3RH3A 4XK9A 1WR0A 2NTYA 5ETWA 3F2EA 5JDHA 3CIRA 4I0UA 3VR9A 1D0YA 3KINB 4E7ZA 4YHJA 1D1BA 5CA0E 2Z6EA 1YQ3A 2XNUA 3C4ZA 3VHLA 4BJMA 2LHRA 3H3MA 2VKHA 2AE9A 1HF8A 3L8RA 4QABA 3KBTA 2DL1A 4KMCA 2KWHA 4B5DA 3ZPOA 4HFHA 4EEBA 4KP3C 3N9LA 3RPUA 4ISSA 2C5KT 4LF9T 4XHEA 2Q9QA 4GK5E 4LF6T 4HE8A 4X1YE 5HXSA 2CE7A 3P4QA 3TLWA 5LHHB 1E7PA 2PJQA 2X9WA 3C79A 3JCFA 2E9XA 2FJAA 2OLTA 3H37A 4AIUA 2LSIA 2XQ4A 5EK3A 5ABGA 3RQUA 4TX5A 1I6ZA 2K9AA 3HL6A 3ZJ1A 4H9PC 2V6YA 4D01A 2MOZA 1FMVA 2XQ6A 3UUBA 4IDQA 5CFBA 5ABFA 2X9YA 4GIWA 2IDOB 1WR6A 1Z0PA 1UV6A 4IDZA 2W8FA 5EK4A 2VQFT 3KFWX 3BK9A 2QC1B 2CM0A 2D5UA 2JQ9A 3I0OA 5AQJB 3P7IA 3NRYA 1MMGA 4OHFA 3AE5A 3IHRA 4HWHA 5HEHA 2NOXA 3AEGA 5AQTB 4MLKA 4L9IA 1N34T 4H63V 2VL0A 2JIWA 5KMGP 4GOUA 5AFMB 3SWHA 2WP9A 4P09A 2X67A 2V6YB 5AQSB 2E5LT 2ZLYA 2F4VT 4EB6E 5JRCA 3CX7B 4HWIB 5LJMA 4H63H 2IC6A 2FBWA 3K8PC 2V7IA 3PTRB 4DR7T 4A56A 3EI0A 4COFA 1D0ZA 5KE4A 4UIGA 1KNZA 2BS3A 1HG2A 4CQIA 3AXJB 5L2LA 2YN6A 3L3PA 2ZM0A 2BYPA 3K3QC 3CVRA 2XSAA 3VR8A 5JDNA 2V26A 4TWFA 2CHNA 2LM9A 5EZYE 5CO5A 5BW2A 1HNXT 2Y7YA 5AQGB 3V5SA 4HFDA 3BQKA 3O1HA 4XAXB 5KXJA 4PW8A 2WCAA 2WAUA 1MIVA 2AXDS 2H7OA 3UTKA 4JI4T 3MKDA 1U4QA 1VOMA 2BG9C 1Y64B 2ES0A 5EK2A 1SHZC 4I55E 3N2OA 4QACA 5LG3A 4DNDA 4JI0T 4U2ZA 4NXMT 4A97A 2W62A 2XQ7A 1UURA 1QUUA 3QB5K 2V5CA 3SIOA 5L3CB 4X1KE 2OV9A 4ZOLE 2JQHA 3ZN0B 2XAHB 3TKLB 4PJLA 4NZBA 2WS3A 3HR0A 4X65T 2ZM6T 3PUQA 2SPCA 5J2TE 1MIYA 3Q5XA 2BKNA 4EYYR 4LF8T 1HS7A 3PUAA 3TLSA 4P0BA 2JRKA 4WV9A 3ZMVB 2IMLA 5KDMC 3KV6A 3ZJ2A 2LSGA 5HXEA 1YXRA 3AAIA 2BG9B 4KI0F 1X9BA 2DNXA 1S35A 4PFPA 5DQVA 2CA5A 2FJEA 3N9QA 3PU8A 3B13A 1ZP0A 4UXUA 2WSSV 4A98A 3QC9A 4X5TA 2Y8DA 5TAOA 2UUAT 4HFBA 4TNVA 1WRDA 5LB7B 3ANWA 1AJ3A 4AI6A 3MZKB 4P0AA 3AA7B 3KBUA 3ESLA 4G63A 1N32T 5AFKA 3QUJA 3C50A 5CGMA 3ZKRA 1UUSA 5HEUA 4K0KT 5JQGE 3RYIE 4ZK4A 4ANJA 4EZ1A 3ZT7A 2R6GF 5L3FB 2WNLA 2W0GA 1US7B 2XZ5A 3UQ4A 4QH4A 2BS2A 3L09A 1OWAA 2L8KA 1L0VA 2BKPA 3EAMA 3VKGA 2RPAA 3NZPA 3AE9A 4PJNA 2UUCT 3SQ9A 4YHHT 2ZM2A 3U8JA 2HH7A 2LOSA 2VVSA 4BQTA 1YKHB 4QXBB 5FXXA 1IBKT 2XQYA 1KF6A 2XAGB 2W2UA 3WTLA 2HPJA 2UXNB 3RYCE 1G8XA 2XQ9A 3PUVF 2WMOA 3AEEA 3K3NA 2EHOC 5LGNB 4PIRA 3RI5A 3AE6A 3HKBE 1MIWA 4LFCT 3SS1A 3ZT6A 1LKXA 4PK5A 5TVCA 2VL8A 4TV8E 4CXWA 2RA1A 2VKJA 2FJBA 3I9WA 1VRBA 4QX7B 2ODUA 2BDEA 3PDYA 4TWDA 2V7JA 3AVRA 4ZXLA 3LG7A 1MNEA 1ZV4X 1HCIA 4DR4T 2MYSA 4DV4T 3ZT5A 3C98B 4LFAT 2WDRA 2YKSA 2LHNA 2CLYC 4UVAB 3CQXC 2X00A 5J5GA 2PFVA 3P8CD 4ZZCA 2ZJUA 2Y54A 2QVAA 2Y6XA 5J1GA 5BMVE 4TNWA 3W15B 3UFGA 4JI5T 1J5WA 4UM1A 3UT5E 4ERRA 2XYTA 4ZEYA 2A3DA 2IC9A 2XJ7A 1D1CA 2YMDA 3F57A 3A7MA 3DTOA 1V9DA 1IAPA 3N2KE 2RP4A 2XM1A 3OYZA 4HFEA 3N9OA 3CPZA 5F8PA 2KZ7B 4ILUA 5BR8T 2WU2A 5DABA 4MBQA 4GKKT 3ZCIA 3UU4A 5JR9B 5AQUB 3LBXA 4IDPA 2DWKA 3PU3A 4ZS2A 2EHOD 2BS4A 3ETUA 3NVOA 5GONE 4HQPA 4TWHA 4JI7T 5CB4E 3O1JA 2PBIA 4YSZA 5L4EA 3IEEA 2CPTA 2WZHA 3RLFF 1Y01A 5FP3A 5ABHA 5HYAA 1WYCA 1J5ET 4FRRA 5FYMA 4HKAA 5ABEA 2W63A 3BQLA 3FZKB 3N9NA 3AEAA 2VK9A 5HXHA 2WZYA 1NEKA 3FZMB 3RF1A 1YD8G 3AEFA 2M6IA 5FVLA 4TZ4C 1X79A 3JAFA 1OXZA 1G73A 3CWZB 3FXEB 4EGWA 2LSJA 3AE8A 2X68A 4MFRA 1T72A 4DV1T 3VRAA 3RHWA 4IE6A 4CN4A 2V6XA 1W0AA 2PH9A 2X51A 4NPPA 1XDPA 5LA6E 4U72A 4AKRB 2ACZA 3PMZA 3RYFE 4U7YA 4DR6T 4BAYB 3PUWF 2V1DB 4ZRUA 3WI3A 3TLVA 2FJDA 1ZHCA 1WYBA 3KV9A 3UFEA 5LBMA 2HHHT 4LF5T 5LJNA 2W8GA 4HWDA 2XQAA 5HXCA 3CX6B 2W67A 1XNRT 2VVNA 4AXPA 2LM2A 4BFQA 1XZYA 2MTQA 1N33T 2KMFA 4DV7T 2XQ3A 4EEDA 2H89A 4ZI3D 1DU2A 1MMNA 1I9BA 1BR2A 1JNRA 3U8KA 2V8SV 3G06A 5LXBA 3T1HT 3FZHB 4NIQA 5H6QB 1HG5A 4B3ST 4ALXA 2Q9QB 3EDUA 4EOZB 2DHRA 4UELA 3ZDHA 3NRXA 5L3EB 3C51A 2WDVA 3EDVA 4UM3P 3T8OA 4DO0A 5KX5E 5AQLB 4GYRA 5L3GB 4L5GA 2VASA 4J2CA 2Y48B 3WTHA 4DV3T 2UXDT 1T7SA 2E9XB 5AFLA 2LEHA 4DBQA 5AFJA 2LSYA 1QLBA 3LDQB 3SFEA 4B3MT 1H7CA 2JJ9A 2BR8A 5LMUT 4QH1A 4DMWA 2UXBT 4DUZT 3P4SA 3GUAA 2LKHA 2XNVA 2Q9QD 5ABFB 1XWMA 5HXRA 2I6HA 2BYNA 4IGUA 2YDQA 4QHOA 4H9OC 3BQIA 4PNIA 4HFCA 2MBGA 2IUBA 2DI4A 5J2UE 3SQ6A 3A8YC 2XAQB 2E9XD 4TUYE 3ZMZB 2XUEA 5BP0A 1XMQT 3ONLC 2MPKA 2X0HA 2KINB 3RRCA 4A5XA 2HN2A 3KDSE 1SUMB 1CUNA 3IGQA 5JRCB 4U33A 5JREA 1XNQT 3U3IA 5JDMA 4EZHA 3KVBA 3C84A 5BRXA 2J4GA 2JMKA 1BR1A 4YXDA 3AE4A 5AFNA 5C8YE 2ZM8A 2FUPA 1WLXA 5HEGA 3E22E 2VKDA 4JUYA 3AA1B 1IBLT 2MAWA 1KEYA 3RKOA 2LRKA 4I43B 4ZJSA 4WYVA 5AQOB 2XQ5A 1M62A 2YU1A 4HFVA 5E0OA 4IIJE 1O3XA 4AQYT 3IA3A 3HI2A 2WN9A 2X0YA 2NP9A 2BG9E 1YKEB 5LBQB 5J5FA 3MXZA 3U8NA 5SYOA 2K3WA 3A5XA 4DV6T 3N9PA 3AVSA 5J5HA 2XM2A 3FBLA 5M4YA 2YDSA 3F31A 2J47A 2BR7A 4U74A 1CHUA 1FEWA 2V7LA 3AE1A 2KLQA 4UM3S 4U7IA 4ADZA 2ZMAA 4CN1A 2UU9T 2VURA 2ACXA 2PGZA 2C5IT 2V7KA 3RKGA 4LMLA 2ODVA 4JEUB 4ZHQE 4QH5A 3UULA 2NW7A 4NUVA 2JPFA 2N2NA 3ZYLA 2VKOA 4C90A 1HNZT 3I1AA 1IJ6A 3JADA 3UUMA 4OFZA 5LXTE 3I9YA 4X64T 1LVKA 3ZSSA 2YINA 2NTXA 4AISA 4YJ2E 4LF7T 5IHYA 4GKJT 4YSYA 5JDGA 2P9BA 4DV0T 3QK6A 3B57A 3WTKA 4ASKA 3FZFB 2WNCA 5AQQB 2UXCT 2IW5B 4LMKA 1NENA 4PK6A 2JMHA 4H9SE 2X0LB 2IAKA 2CXLA 3UU5A 2X9HA 5JVDE 2W66A 3RRWA 2I59A 5FMNA 2XHEB 3O4XE 4PAGA 2LJLA 3KVAA 4ILAA 3EHZA 1MMAA 1UX2A 2XASB 2KWIB 3ANWB 1T98A 4F6RC 4YTNA 2VQET 3AA0B 4DBMA 1VCSA 5FVKA 3EABA 3OYXA 2E8IA 5LOVE 4OK0A 4KBMB 2J1DG 3VU7H 2WBLA 2D2SA 4O4HE 2BYSA 2CBIA 5L47A 1W9RA 4X20E 1UK5A 2V7MA 3V5UA 2YOEA 2YEVC 4IE0A 3WAJA 4AFGA 4I50E 3ZMTB 3RYHE 5L4HA 2M67A 4WZXA 3CK6A 5LGUB 2H88A 3ZMUB 4Q25A 3R84B 4EXTA 3AA6B 2XTLA 3RC8A 2WY2A 1ZKEA 3PJAJ 5AQNB 5HCJA 5JR9C 4UY2A 3CQCB 3VRBA 3PUYF 2BYQA 3K1SA 1U5PA 4ZS3A 5FY7A 3MK7C 1OEDA 3SOLA 3AAEB 4JV5T 2KXPB 5LCYA 4KHPT 4I4TE 3AE2A 4DV5T 5C2TA 3AB3B 3OBVE 4UEMA 3ZN1B 4DR1T 2UXXB 1MMDA 4IDNA 3IBPA 3OJAA 3J7Yq 1HX1B 3WIPA 2JQQA 3AEDA 2D0UA 5AFUL 4YJ3E 2X66A 4NUUA 3CQGB 3NWIA 4HWFA 4JI6T 3QB5A 4IE5A 3ZLIA 3K3OA 1OEDB 1LRZA 3RIUC 3PUSA 4ZI7E 4JBWF 2G0UA 4CI3B 3OPCA 4WNKA 5FL0A 3PJAA 5F3JA 1B7TA 4ZJTA 3FXDB 4DR2T 5HAXA 3HKCE
chains in the Genus database with same CATH topology
5HEUA 5HEHA 4LMJA 3UQ7A 2ZJVA 4QABA 3ZDHA 5HEJA 4ZK4A 2X00A 5J5GA 3C84A 4B5DA 5BRXA 4UM3P 2VL0A 4ILBA 4A97A 4EZ1A 4ZZCA 2ZJUA 3T4MA 2XQ7A 4HFHA 4QAAA 2WNLA 2Y54A 5HEOA 5AFMB 4IL4A 3U8LA 4IL9A 5AFNA 3PEOA 3UU3A 5HCMA 5HCJA 2XZ5A 3UQ4A 3SIOA 2KSRA 4QH4A 4UY2A 5JMEA 4TNWA 3RHWA 5HEGA 3TLTA 3EAMA 3P4WA 2BYQA 4UM1A 3WTHA 3WTKA 4XHEA 2XYTA 2WNCA 2Y57A 3U8MA 4AFHA 5AFLA 4LMKA 1OEDA 2PH9A 3UU8A 4NZBA 4NPPA 2MAWA 3SQ9A 5AFJA 2YMDA 3U8JA 2X00D 5KZUA 4ZJSA 5J0ZA 2XQ5A 2LKGA 3LSVA 4BQTA 3EI0A 3PMZA 3UU5A 4COFA 5KE4A 2BYRA 5AFMA 4ZR6A 4HFEA 4Z90A 2WN9A 2BR8A 2XYSA 2BG9E 1OEDC 4QH1A 4ZRUA 3TLSA 3TLWA 3WTLA 2BJ0A 4WV9A 3C79A 3GUAA 2LKHA 3RIAA 2XQ9A 2XNVA 5J5FA 3TLVA 3TLUA 5SYOA 3U8NA 4PIRA 5AFHA 4HFIA 2BG9B 2M6BA 4IREA 3UU4A 1UW6A 3RI5A 2WNJA 4ILAA 3WIPA 2BYNA 2YN6A 5FJVA 2XQ4A 3EHZA 2Y56A 2BYPA 5J5IA 5J5HA 3RQUA 1UX2A 3ZDGA 4ZK1A 4HQPA 4TWHA 4TWFA 5TVCA 4Z91A 4HFCA 1OEDE 3P50A 4ILCA 2W8GA 2BR7A 2XQ8A 2XQAA 3UUBA 4D01A 2XQ6A 5CO5A 5L4EA 3SQ6A 4DBMA 5BW2A 2Y58A 2Y7YA 3WTIA 3SH1A 3RIFA 5CFBA 4UXUA 4HFDA 2BG9A 2LM2A 4FRRA 5BP0A 3JAEA 5AINA 1OEDB 4TWDA 2XNTA 4BFQA 4UM3S 4A98A 4XK9A 3RQWA 4F8HA 4X5TA 1UV6A 2XQ3A 2PGZA 4HFBA 4TNVA 2WZYA 4AFTA 2BYSA 3WTJA 4LMLA 2XZ6A 2W8FA 2YMEA 4ALXA 1I9BA 5L47A 3WTNA 2QC1B 4QH5A 3U8KA 2YOEA 2M6IA 2UZ6A 2BG9C 2XNUA 3IGQA 4UM3A 4AFGA 2C9TA 3WTMA 5LXBA 5L4HA 3UU6A 5IUXA 4ZZBA 3JAFA 4ZJTA 3WTOA 5AFKA 2YKSA 4QACA 3JADA 5LG3A 2LLYA 3ZKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEU A;  5HEH A;  4LMJ A;  3UQ7 A;  2ZJV A;  4QAB A;  3ZDH A;  5HEJ A;  4ZK4 A;  2X00 A;  5J5G A;  3C84 A;  4B5D A;  5BRX A;  4UM3 P;  2VL0 A;  4ILB A;  4A97 A;  4EZ1 A;  4ZZC A;  2ZJU A;  3T4M A;  2XQ7 A;  4HFH A;  4QAA A;  2WNL A;  2Y54 A;  5HEO A;  5AFM B;  4IL4 A;  3U8L A;  4IL9 A;  5AFN A;  3PEO A;  3UU3 A;  5HCM A;  5HCJ A;  2XZ5 A;  3UQ4 A;  3SIO A;  2KSR A;  4QH4 A;  4UY2 A;  5JME A;  4TNW A;  3RHW A;  5HEG A;  3TLT A;  3EAM A;  3P4W A;  2BYQ A;  4UM1 A;  3WTH A;  3WTK A;  4XHE A;  2XYT A;  2WNC A;  2Y57 A;  3U8M A;  4AFH A;  5AFL A;  4LMK A;  1OED A;  2PH9 A;  3UU8 A;  4NZB A;  4NPP A;  2MAW A;  3SQ9 A;  5AFJ A;  2YMD A;  3U8J A;  2X00 D;  5KZU A;  4ZJS A;  5J0Z A;  2XQ5 A;  2LKG A;  3LSV A;  4BQT A;  3EI0 A;  3PMZ A;  3UU5 A;  4COF A;  5KE4 A;  2BYR A;  5AFM A;  4ZR6 A;  4HFE A;  4Z90 A;  2WN9 A;  2BR8 A;  2XYS A;  2BG9 E;  1OED C;  4QH1 A;  4ZRU A;  3TLS A;  3TLW A;  3WTL A;  2BJ0 A;  4WV9 A;  3C79 A;  3GUA A;  2LKH A;  3RIA A;  2XQ9 A;  2XNV A;  5J5F A;  3TLV A;  3TLU A;  5SYO A;  3U8N A;  4PIR A;  5AFH A;  4HFI A;  2BG9 B;  2M6B A;  4IRE A;  3UU4 A;  1UW6 A;  3RI5 A;  2WNJ A;  4ILA A;  3WIP A;  2BYN A;  2YN6 A;  5FJV A;  2XQ4 A;  3EHZ A;  2Y56 A;  2BYP A;  5J5I A;  5J5H A;  3RQU A;  1UX2 A;  3ZDG A;  4ZK1 A;  4HQP A;  4TWH A;  4TWF A;  5TVC A;  4Z91 A;  4HFC A;  1OED E;  3P50 A;  4ILC A;  2W8G A;  2BR7 A;  2XQ8 A;  2XQA A;  3UUB A;  4D01 A;  2XQ6 A;  5CO5 A;  5L4E A;  3SQ6 A;  4DBM A;  5BW2 A;  2Y58 A;  2Y7Y A;  3WTI A;  3SH1 A;  3RIF A;  5CFB A;  4UXU A;  4HFD A;  2BG9 A;  2LM2 A;  4FRR A;  5BP0 A;  3JAE A;  5AIN A;  1OED B;  4TWD A;  2XNT A;  4BFQ A;  4UM3 S;  4A98 A;  4XK9 A;  3RQW A;  4F8H A;  4X5T A;  1UV6 A;  2XQ3 A;  2PGZ A;  4HFB A;  4TNV A;  2WZY A;  4AFT A;  2BYS A;  3WTJ A;  4LML A;  2XZ6 A;  2W8F A;  2YME A;  4ALX A;  1I9B A;  5L47 A;  3WTN A;  2QC1 B;  4QH5 A;  3U8K A;  2YOE A;  2M6I A;  2UZ6 A;  2BG9 C;  2XNU A;  3IGQ A;  4UM3 A;  4AFG A;  2C9T A;  3WTM A;  5LXB A;  5L4H A;  3UU6 A;  5IUX A;  4ZZB A;  3JAF A;  4ZJT A;  3WTO A;  5AFK A;  2YKS A;  4QAC A;  3JAD A;  5LG3 A;  2LLY A;  3ZKR A; 
#chains in the Genus database with same CATH topology
 2CWO A;  4ZI3 C;  4KHZ F;  5AQR B;  1HNW T;  4QKN A;  3AE3 A;  4V1A v;  2A9U A;  2W00 A;  3T4M A;  4IL4 A;  3U78 A;  4QXH B;  2CCQ A;  2C0S A;  5IYZ E;  5JME A;  2UUB T;  2B76 A;  1KNP A;  4AQG A;  4DV2 T;  1HR0 T;  3RC3 A;  3LBX B;  2X00 D;  2CWY A;  1M7K A;  5C3J A;  4GYS A;  2LT3 A;  3LK2 B;  4YY3 T;  2WDQ A;  3FZL B;  5F5W A;  3QNU A;  2WB5 A;  2XSB A;  4ZK1 A;  4AQF A;  3KV4 A;  3LJC A;  1FJG T;  2Q9Q C;  5JH7 E;  5JDF A;  5LMN T;  5FXZ A;  4PJJ A;  4PJM A;  3C4X A;  1WFD A;  2YK0 A;  4EZ4 A;  2Y58 A;  1YW0 A;  4TV9 E;  4YT0 A;  3QOF A;  2LRL A;  3CX8 B;  5LG4 A;  3RQW A;  4F8H A;  4EYU A;  3RX6 A;  2BVM A;  3SRZ A;  5FXW A;  2KT9 A;  2E9X C;  3M3Z B;  3ABV A;  3UU6 A;  1KFY A;  4KUM B;  1T8B A;  4LMJ A;  4L0R A;  1W0B A;  2HN1 A;  5HEJ A;  3N5L A;  3D0T A;  3I0Q A;  2VB6 A;  3Q2M A;  2HPL A;  1BR0 A;  4UR9 A;  3OKQ A;  1SE7 A;  4IL9 A;  3PEO A;  5HCM A;  2KSR A;  2PTF A;  4O4I E;  4XZC A;  3E08 A;  2K24 A;  1LVF A;  2JQK A;  1J1J A;  2W61 A;  2Y57 A;  4CXY A;  3H3A A;  4O2B E;  2L3L A;  2LSK A;  4CXX A;  3JC6 D;  1ZEE A;  2WQY A;  5FKY A;  5AFM A;  4Z90 A;  3SFD A;  4UVB B;  4O8S A;  3RIA A;  1FIO A;  4HWC A;  1I94 T;  3ZMS B;  2BBH A;  5JTG A;  5FY0 A;  5L3D B;  3ZDG A;  1HFA A;  3P50 A;  4ILC A;  5JDL A;  1D0X A;  2XPK A;  4JLE A;  3AXJ A;  2WWU A;  5AIN A;  2N1G A;  4O4J E;  4EIW A;  4AFT A;  3E0Z A;  5LHG B;  1VCT A;  4MHC A;  4Z8X A;  3O9X A;  4DR3 T;  2BKO A;  2VWA A;  5AQF B;  3HKE E;  2LLY A;  1E1H B;  2XY8 B;  4EAH A;  2YDR A;  4ILB A;  4IST A;  4QAA A;  5HEO A;  2CBJ A;  2GK9 A;  2C5J A;  4DBR A;  4FI5 A;  5H6R B;  4HTE A;  3Q9D A;  3CKD A;  4JEH B;  2A72 A;  3CML A;  5KZU A;  2NW9 A;  5JDQ A;  5CJ5 A;  2LKG A;  1IBM T;  4UXN B;  3NKZ A;  4WW0 A;  4YSX A;  2XYS A;  3KV5 A;  3PUZ F;  4WBN E;  3EVY A;  2A2F X;  4H9Q C;  4JI2 T;  4UV8 B;  2M6B A;  2BBJ A;  3ZST A;  3PUG A;  4BA9 A;  2LE8 A;  3RGL A;  2WM9 A;  3ZEF B;  4HN9 A;  1WCR A;  1KK7 A;  1D1A A;  2CMR A;  3WTI A;  5L3B B;  2BG9 A;  3JAE A;  5AQH B;  1UX4 A;  3X1D A;  3ZYK A;  4G2A A;  4QXC B;  2L9Q A;  3WTJ A;  4AKL A;  2YME A;  3WTN A;  4IE7 A;  2OA5 A;  4H9R C;  2WU5 A;  3WTM A;  3MA9 A;  4XBF B;  2DWG A;  2N9D A;  2WMN A;  3UQ7 A;  2CRB A;  3FB2 A;  3HKD E;  4YTP A;  3PV0 F;  4H9N C;  3AAA B;  4KX6 A;  2QA7 A;  2PG8 A;  4B3R T;  2WWV A;  2BZB A;  4P1N A;  2H3R A;  2K48 A;  1HX8 A;  2V5D A;  5DJQ C;  4DR5 T;  2DCF A;  2CHO A;  4UVC B;  5FL1 A;  5LNK A;  4B6X A;  3M65 A;  3Q5E A;  3L39 A;  4X66 T;  3PUR A;  4LF4 T;  4E7S A;  1S94 A;  5AQK B;  2D0T A;  4K0U A;  3MAC A;  3TLU A;  4YFS A;  4IRE A;  1UW6 A;  2IIU A;  2XZE A;  4YLH A;  5FJV A;  2XAF B;  3GWH A;  5LP6 E;  4B3T T;  2CXF A;  5AQI B;  1YQ4 A;  4LFB T;  3DJB A;  4Z91 A;  4ZI2 C;  2XQ8 A;  1KNR A;  5LGT B;  3SH1 A;  3OVU A;  5A1L A;  2NR4 A;  3Q5D A;  3C64 A;  3VKH A;  1Z8U A;  3Q5W A;  3ONX A;  4UV9 B;  4U2Y A;  5FNV E;  4UM3 A;  4CZZ B;  4HGA A;  4AKH A;  1FMW A;  4JI1 T;  2ZJV A;  3LK4 2;  5AQV B;  5DQW A;  2NWB A;  2QRX A;  4UF0 A;  4EV6 A;  3U8L A;  3AEB A;  3UU3 A;  1E2A A;  4GK0 E;  1XDO A;  5FXV A;  3N2G E;  4AFH A;  3NBX X;  3UU8 A;  5J0Z A;  2CXD A;  4M1P A;  3S4U A;  3DP7 A;  3O1I A;  2EHO A;  4OYJ A;  3J9X 1;  3FHN A;  2J62 A;  4ZR6 A;  3UUN A;  3OTO T;  4WBO A;  3B5M A;  1OED C;  2KND A;  2WZI A;  4DMV A;  4MAL A;  2CEA A;  4C91 A;  2E2A A;  1QSD A;  5AFH A;  4HFI A;  3EUH A;  3ZYM A;  2H7V C;  4OX9 T;  3HA4 A;  3ONJ A;  5AQM B;  2Y56 A;  2YU2 A;  3PUX F;  1W09 A;  4IDO A;  1ZOY A;  4UF0 B;  5FY1 A;  1NAF A;  2B1E A;  4YTM A;  4JI8 T;  1OED E;  4DID B;  1MND A;  4IHJ E;  1GQE A;  3RIF A;  5JR9 A;  2QYW A;  4ZI2 D;  1IZN B;  4O2A E;  4HEA A;  4PFO A;  4NXN T;  3GA8 A;  4DUY T;  5LYJ E;  2XZ6 A;  2EHO B;  1UX5 A;  4IT4 A;  4QWN B;  4X1I E;  2DLR A;  4TN7 B;  5LHI B;  2UZ6 A;  3GN5 A;  4U31 A;  2C9T A;  5CA1 E;  4OYK A;  1EZ3 A;  3LK3 B;  5IUX A;  1N36 T;  4ZZB A;  1HTJ F;  3WTO A;  5ADX L;  2QGS A;  4N78 D;  3C4W A;  4IE4 A;  3ZCJ A;  2X9X A;  4JI3 T;  2E5V A;  2IHR 1;  5HWY A;  1IJ5 A;  3R6N A;  3AE7 A;  3LFM A;  3ETV A;  4AKG A;  4CN6 A;  4U3C A;  3NZQ A;  3UUX B;  3TLT A;  3IF8 B;  3ZC0 A;  3P4W A;  2XAJ B;  5AQP B;  3U8M A;  3PE0 A;  1BR4 A;  3ZC1 A;  1R8I A;  1NWM X;  4BJN A;  2K5B B;  2I0M A;  3GMI A;  3LSV A;  3WAK A;  2BYR A;  2CLY B;  3RIU A;  3GN5 B;  2BJ0 A;  4CI1 B;  3N9M A;  3AEC A;  1SA0 E;  3JC6 C;  1JNZ A;  2WNJ A;  2NW8 A;  3MJX A;  5J5I A;  5IWA T;  4O4L E;  4CI2 B;  5HWX A;  2BVL A;  1XMO T;  4AKI A;  3FBZ A;  3P4R A;  2D9D A;  2LOP A;  2W4X A;  3P4P A;  4QX8 B;  4DVD A;  1UCU A;  3T1Y T;  4FJO A;  4X62 T;  1UGO A;  4PK4 A;  2XNT A;  4AQF C;  4JYA T;  3RH3 A;  4XK9 A;  1WR0 A;  2NTY A;  5ETW A;  3F2E A;  5JDH A;  3CIR A;  4I0U A;  3VR9 A;  1D0Y A;  3KIN B;  4E7Z A;  4YHJ A;  1D1B A;  5CA0 E;  2Z6E A;  1YQ3 A;  2XNU A;  3C4Z A;  3VHL A;  4BJM A;  2LHR A;  3H3M A;  2VKH A;  2AE9 A;  1HF8 A;  3L8R A;  4QAB A;  3KBT A;  2DL1 A;  4KMC A;  2KWH A;  4B5D A;  3ZPO A;  4HFH A;  4EEB A;  4KP3 C;  3N9L A;  3RPU A;  4ISS A;  2C5K T;  4LF9 T;  4XHE A;  2Q9Q A;  4GK5 E;  4LF6 T;  4HE8 A;  4X1Y E;  5HXS A;  2CE7 A;  3P4Q A;  3TLW A;  5LHH B;  1E7P A;  2PJQ A;  2X9W A;  3C79 A;  3JCF A;  2E9X A;  2FJA A;  2OLT A;  3H37 A;  4AIU A;  2LSI A;  2XQ4 A;  5EK3 A;  5ABG A;  3RQU A;  4TX5 A;  1I6Z A;  2K9A A;  3HL6 A;  3ZJ1 A;  4H9P C;  2V6Y A;  4D01 A;  2MOZ A;  1FMV A;  2XQ6 A;  3UUB A;  4IDQ A;  5CFB A;  5ABF A;  2X9Y A;  4GIW A;  2IDO B;  1WR6 A;  1Z0P A;  1UV6 A;  4IDZ A;  2W8F A;  5EK4 A;  2VQF T;  3KFW X;  3BK9 A;  2QC1 B;  2CM0 A;  2D5U A;  2JQ9 A;  3I0O A;  5AQJ B;  3P7I A;  3NRY A;  1MMG A;  4OHF A;  3AE5 A;  3IHR A;  4HWH A;  5HEH A;  2NOX A;  3AEG A;  5AQT B;  4MLK A;  4L9I A;  1N34 T;  4H63 V;  2VL0 A;  2JIW A;  5KMG P;  4GOU A;  5AFM B;  3SWH A;  2WP9 A;  4P09 A;  2X67 A;  2V6Y B;  5AQS B;  2E5L T;  2ZLY A;  2F4V T;  4EB6 E;  5JRC A;  3CX7 B;  4HWI B;  5LJM A;  4H63 H;  2IC6 A;  2FBW A;  3K8P C;  2V7I A;  3PTR B;  4DR7 T;  4A56 A;  3EI0 A;  4COF A;  1D0Z A;  5KE4 A;  4UIG A;  1KNZ A;  2BS3 A;  1HG2 A;  4CQI A;  3AXJ B;  5L2L A;  2YN6 A;  3L3P A;  2ZM0 A;  2BYP A;  3K3Q C;  3CVR A;  2XSA A;  3VR8 A;  5JDN A;  2V26 A;  4TWF A;  2CHN A;  2LM9 A;  5EZY E;  5CO5 A;  5BW2 A;  1HNX T;  2Y7Y A;  5AQG B;  3V5S A;  4HFD A;  3BQK A;  3O1H A;  4XAX B;  5KXJ A;  4PW8 A;  2WCA A;  2WAU A;  1MIV A;  2AXD S;  2H7O A;  3UTK A;  4JI4 T;  3MKD A;  1U4Q A;  1VOM A;  2BG9 C;  1Y64 B;  2ES0 A;  5EK2 A;  1SHZ C;  4I55 E;  3N2O A;  4QAC A;  5LG3 A;  4DND A;  4JI0 T;  4U2Z A;  4NXM T;  4A97 A;  2W62 A;  2XQ7 A;  1UUR A;  1QUU A;  3QB5 K;  2V5C A;  3SIO A;  5L3C B;  4X1K E;  2OV9 A;  4ZOL E;  2JQH A;  3ZN0 B;  2XAH B;  3TKL B;  4PJL A;  4NZB A;  2WS3 A;  3HR0 A;  4X65 T;  2ZM6 T;  3PUQ A;  2SPC A;  5J2T E;  1MIY A;  3Q5X A;  2BKN A;  4EYY R;  4LF8 T;  1HS7 A;  3PUA A;  3TLS A;  4P0B A;  2JRK A;  4WV9 A;  3ZMV B;  2IML A;  5KDM C;  3KV6 A;  3ZJ2 A;  2LSG A;  5HXE A;  1YXR A;  3AAI A;  2BG9 B;  4KI0 F;  1X9B A;  2DNX A;  1S35 A;  4PFP A;  5DQV A;  2CA5 A;  2FJE A;  3N9Q A;  3PU8 A;  3B13 A;  1ZP0 A;  4UXU A;  2WSS V;  4A98 A;  3QC9 A;  4X5T A;  2Y8D A;  5TAO A;  2UUA T;  4HFB A;  4TNV A;  1WRD A;  5LB7 B;  3ANW A;  1AJ3 A;  4AI6 A;  3MZK B;  4P0A A;  3AA7 B;  3KBU A;  3ESL A;  4G63 A;  1N32 T;  5AFK A;  3QUJ A;  3C50 A;  5CGM A;  3ZKR A;  1UUS A;  5HEU A;  4K0K T;  5JQG E;  3RYI E;  4ZK4 A;  4ANJ A;  4EZ1 A;  3ZT7 A;  2R6G F;  5L3F B;  2WNL A;  2W0G A;  1US7 B;  2XZ5 A;  3UQ4 A;  4QH4 A;  2BS2 A;  3L09 A;  1OWA A;  2L8K A;  1L0V A;  2BKP A;  3EAM A;  3VKG A;  2RPA A;  3NZP A;  3AE9 A;  4PJN A;  2UUC T;  3SQ9 A;  4YHH T;  2ZM2 A;  3U8J A;  2HH7 A;  2LOS A;  2VVS A;  4BQT A;  1YKH B;  4QXB B;  5FXX A;  1IBK T;  2XQY A;  1KF6 A;  2XAG B;  2W2U A;  3WTL A;  2HPJ A;  2UXN B;  3RYC E;  1G8X A;  2XQ9 A;  3PUV F;  2WMO A;  3AEE A;  3K3N A;  2EHO C;  5LGN B;  4PIR A;  3RI5 A;  3AE6 A;  3HKB E;  1MIW A;  4LFC T;  3SS1 A;  3ZT6 A;  1LKX A;  4PK5 A;  5TVC A;  2VL8 A;  4TV8 E;  4CXW A;  2RA1 A;  2VKJ A;  2FJB A;  3I9W A;  1VRB A;  4QX7 B;  2ODU A;  2BDE A;  3PDY A;  4TWD A;  2V7J A;  3AVR A;  4ZXL A;  3LG7 A;  1MNE A;  1ZV4 X;  1HCI A;  4DR4 T;  2MYS A;  4DV4 T;  3ZT5 A;  3C98 B;  4LFA T;  2WDR A;  2YKS A;  2LHN A;  2CLY C;  4UVA B;  3CQX C;  2X00 A;  5J5G A;  2PFV A;  3P8C D;  4ZZC A;  2ZJU A;  2Y54 A;  2QVA A;  2Y6X A;  5J1G A;  5BMV E;  4TNW A;  3W15 B;  3UFG A;  4JI5 T;  1J5W A;  4UM1 A;  3UT5 E;  4ERR A;  2XYT A;  4ZEY A;  2A3D A;  2IC9 A;  2XJ7 A;  1D1C A;  2YMD A;  3F57 A;  3A7M A;  3DTO A;  1V9D A;  1IAP A;  3N2K E;  2RP4 A;  2XM1 A;  3OYZ A;  4HFE A;  3N9O A;  3CPZ A;  5F8P A;  2KZ7 B;  4ILU A;  5BR8 T;  2WU2 A;  5DAB A;  4MBQ A;  4GKK T;  3ZCI A;  3UU4 A;  5JR9 B;  5AQU B;  3LBX A;  4IDP A;  2DWK A;  3PU3 A;  4ZS2 A;  2EHO D;  2BS4 A;  3ETU A;  3NVO A;  5GON E;  4HQP A;  4TWH A;  4JI7 T;  5CB4 E;  3O1J A;  2PBI A;  4YSZ A;  5L4E A;  3IEE A;  2CPT A;  2WZH A;  3RLF F;  1Y01 A;  5FP3 A;  5ABH A;  5HYA A;  1WYC A;  1J5E T;  4FRR A;  5FYM A;  4HKA A;  5ABE A;  2W63 A;  3BQL A;  3FZK B;  3N9N A;  3AEA A;  2VK9 A;  5HXH A;  2WZY A;  1NEK A;  3FZM B;  3RF1 A;  1YD8 G;  3AEF A;  2M6I A;  5FVL A;  4TZ4 C;  1X79 A;  3JAF A;  1OXZ A;  1G73 A;  3CWZ B;  3FXE B;  4EGW A;  2LSJ A;  3AE8 A;  2X68 A;  4MFR A;  1T72 A;  4DV1 T;  3VRA A;  3RHW A;  4IE6 A;  4CN4 A;  2V6X A;  1W0A A;  2PH9 A;  2X51 A;  4NPP A;  1XDP A;  5LA6 E;  4U72 A;  4AKR B;  2ACZ A;  3PMZ A;  3RYF E;  4U7Y A;  4DR6 T;  4BAY B;  3PUW F;  2V1D B;  4ZRU A;  3WI3 A;  3TLV A;  2FJD A;  1ZHC A;  1WYB A;  3KV9 A;  3UFE A;  5LBM A;  2HHH T;  4LF5 T;  5LJN A;  2W8G A;  4HWD A;  2XQA A;  5HXC A;  3CX6 B;  2W67 A;  1XNR T;  2VVN A;  4AXP A;  2LM2 A;  4BFQ A;  1XZY A;  2MTQ A;  1N33 T;  2KMF A;  4DV7 T;  2XQ3 A;  4EED A;  2H89 A;  4ZI3 D;  1DU2 A;  1MMN A;  1I9B A;  1BR2 A;  1JNR A;  3U8K A;  2V8S V;  3G06 A;  5LXB A;  3T1H T;  3FZH B;  4NIQ A;  5H6Q B;  1HG5 A;  4B3S T;  4ALX A;  2Q9Q B;  3EDU A;  4EOZ B;  2DHR A;  4UEL A;  3ZDH A;  3NRX A;  5L3E B;  3C51 A;  2WDV A;  3EDV A;  4UM3 P;  3T8O A;  4DO0 A;  5KX5 E;  5AQL B;  4GYR A;  5L3G B;  4L5G A;  2VAS A;  4J2C A;  2Y48 B;  3WTH A;  4DV3 T;  2UXD T;  1T7S A;  2E9X B;  5AFL A;  2LEH A;  4DBQ A;  5AFJ A;  2LSY A;  1QLB A;  3LDQ B;  3SFE A;  4B3M T;  1H7C A;  2JJ9 A;  2BR8 A;  5LMU T;  4QH1 A;  4DMW A;  2UXB T;  4DUZ T;  3P4S A;  3GUA A;  2LKH A;  2XNV A;  2Q9Q D;  5ABF B;  1XWM A;  5HXR A;  2I6H A;  2BYN A;  4IGU A;  2YDQ A;  4QHO A;  4H9O C;  3BQI A;  4PNI A;  4HFC A;  2MBG A;  2IUB A;  2DI4 A;  5J2U E;  3SQ6 A;  3A8Y C;  2XAQ B;  2E9X D;  4TUY E;  3ZMZ B;  2XUE A;  5BP0 A;  1XMQ T;  3ONL C;  2MPK A;  2X0H A;  2KIN B;  3RRC A;  4A5X A;  2HN2 A;  3KDS E;  1SUM B;  1CUN A;  3IGQ A;  5JRC B;  4U33 A;  5JRE A;  1XNQ T;  3U3I A;  5JDM A;  4EZH A;  3KVB A;  3C84 A;  5BRX A;  2J4G A;  2JMK A;  1BR1 A;  4YXD A;  3AE4 A;  5AFN A;  5C8Y E;  2ZM8 A;  2FUP A;  1WLX A;  5HEG A;  3E22 E;  2VKD A;  4JUY A;  3AA1 B;  1IBL T;  2MAW A;  1KEY A;  3RKO A;  2LRK A;  4I43 B;  4ZJS A;  4WYV A;  5AQO B;  2XQ5 A;  1M62 A;  2YU1 A;  4HFV A;  5E0O A;  4IIJ E;  1O3X A;  4AQY T;  3IA3 A;  3HI2 A;  2WN9 A;  2X0Y A;  2NP9 A;  2BG9 E;  1YKE B;  5LBQ B;  5J5F A;  3MXZ A;  3U8N A;  5SYO A;  2K3W A;  3A5X A;  4DV6 T;  3N9P A;  3AVS A;  5J5H A;  2XM2 A;  3FBL A;  5M4Y A;  2YDS A;  3F31 A;  2J47 A;  2BR7 A;  4U74 A;  1CHU A;  1FEW A;  2V7L A;  3AE1 A;  2KLQ A;  4UM3 S;  4U7I A;  4ADZ A;  2ZMA A;  4CN1 A;  2UU9 T;  2VUR A;  2ACX A;  2PGZ A;  2C5I T;  2V7K A;  3RKG A;  4LML A;  2ODV A;  4JEU B;  4ZHQ E;  4QH5 A;  3UUL A;  2NW7 A;  4NUV A;  2JPF A;  2N2N A;  3ZYL A;  2VKO A;  4C90 A;  1HNZ T;  3I1A A;  1IJ6 A;  3JAD A;  3UUM A;  4OFZ A;  5LXT E;  3I9Y A;  4X64 T;  1LVK A;  3ZSS A;  2YIN A;  2NTX A;  4AIS A;  4YJ2 E;  4LF7 T;  5IHY A;  4GKJ T;  4YSY A;  5JDG A;  2P9B A;  4DV0 T;  3QK6 A;  3B57 A;  3WTK A;  4ASK A;  3FZF B;  2WNC A;  5AQQ B;  2UXC T;  2IW5 B;  4LMK A;  1NEN A;  4PK6 A;  2JMH A;  4H9S E;  2X0L B;  2IAK A;  2CXL A;  3UU5 A;  2X9H A;  5JVD E;  2W66 A;  3RRW A;  2I59 A;  5FMN A;  2XHE B;  3O4X E;  4PAG A;  2LJL A;  3KVA A;  4ILA A;  3EHZ A;  1MMA A;  1UX2 A;  2XAS B;  2KWI B;  3ANW B;  1T98 A;  4F6R C;  4YTN A;  2VQE T;  3AA0 B;  4DBM A;  1VCS A;  5FVK A;  3EAB A;  3OYX A;  2E8I A;  5LOV E;  4OK0 A;  4KBM B;  2J1D G;  3VU7 H;  2WBL A;  2D2S A;  4O4H E;  2BYS A;  2CBI A;  5L47 A;  1W9R A;  4X20 E;  1UK5 A;  2V7M A;  3V5U A;  2YOE A;  2YEV C;  4IE0 A;  3WAJ A;  4AFG A;  4I50 E;  3ZMT B;  3RYH E;  5L4H A;  2M67 A;  4WZX A;  3CK6 A;  5LGU B;  2H88 A;  3ZMU B;  4Q25 A;  3R84 B;  4EXT A;  3AA6 B;  2XTL A;  3RC8 A;  2WY2 A;  1ZKE A;  3PJA J;  5AQN B;  5HCJ A;  5JR9 C;  4UY2 A;  3CQC B;  3VRB A;  3PUY F;  2BYQ A;  3K1S A;  1U5P A;  4ZS3 A;  5FY7 A;  3MK7 C;  1OED A;  3SOL A;  3AAE B;  4JV5 T;  2KXP B;  5LCY A;  4KHP T;  4I4T E;  3AE2 A;  4DV5 T;  5C2T A;  3AB3 B;  3OBV E;  4UEM A;  3ZN1 B;  4DR1 T;  2UXX B;  1MMD A;  4IDN A;  3IBP A;  3OJA A;  3J7Y q;  1HX1 B;  3WIP A;  2JQQ A;  3AED A;  2D0U A;  5AFU L;  4YJ3 E;  2X66 A;  4NUU A;  3CQG B;  3NWI A;  4HWF A;  4JI6 T;  3QB5 A;  4IE5 A;  3ZLI A;  3K3O A;  1OED B;  1LRZ A;  3RIU C;  3PUS A;  4ZI7 E;  4JBW F;  2G0U A;  4CI3 B;  3OPC A;  4WNK A;  5FL0 A;  3PJA A;  5F3J A;  1B7T A;  4ZJT A;  3FXD B;  4DR2 T;  5HAX A;  3HKC E; 
#chains in the Genus database with same CATH homology
 5HEU A;  5HEH A;  4LMJ A;  3UQ7 A;  2ZJV A;  4QAB A;  3ZDH A;  5HEJ A;  4ZK4 A;  2X00 A;  5J5G A;  3C84 A;  4B5D A;  5BRX A;  4UM3 P;  2VL0 A;  4ILB A;  4A97 A;  4EZ1 A;  4ZZC A;  2ZJU A;  3T4M A;  2XQ7 A;  4HFH A;  4QAA A;  2WNL A;  2Y54 A;  5HEO A;  5AFM B;  4IL4 A;  3U8L A;  4IL9 A;  5AFN A;  3PEO A;  3UU3 A;  5HCM A;  5HCJ A;  2XZ5 A;  3UQ4 A;  3SIO A;  2KSR A;  4QH4 A;  4UY2 A;  5JME A;  4TNW A;  3RHW A;  5HEG A;  3TLT A;  3EAM A;  3P4W A;  2BYQ A;  4UM1 A;  3WTH A;  3WTK A;  4XHE A;  2XYT A;  2WNC A;  2Y57 A;  3U8M A;  4AFH A;  5AFL A;  4LMK A;  1OED A;  2PH9 A;  3UU8 A;  4NZB A;  4NPP A;  2MAW A;  3SQ9 A;  5AFJ A;  2YMD A;  3U8J A;  2X00 D;  5KZU A;  4ZJS A;  5J0Z A;  2XQ5 A;  2LKG A;  3LSV A;  4BQT A;  3EI0 A;  3PMZ A;  3UU5 A;  4COF A;  5KE4 A;  2BYR A;  5AFM A;  4ZR6 A;  4HFE A;  4Z90 A;  2WN9 A;  2BR8 A;  2XYS A;  2BG9 E;  1OED C;  4QH1 A;  4ZRU A;  3TLS A;  3TLW A;  3WTL A;  2BJ0 A;  4WV9 A;  3C79 A;  3GUA A;  2LKH A;  3RIA A;  2XQ9 A;  2XNV A;  5J5F A;  3TLV A;  3TLU A;  5SYO A;  3U8N A;  4PIR A;  5AFH A;  4HFI A;  2BG9 B;  2M6B A;  4IRE A;  3UU4 A;  1UW6 A;  3RI5 A;  2WNJ A;  4ILA A;  3WIP A;  2BYN A;  2YN6 A;  5FJV A;  2XQ4 A;  3EHZ A;  2Y56 A;  2BYP A;  5J5I A;  5J5H A;  3RQU A;  1UX2 A;  3ZDG A;  4ZK1 A;  4HQP A;  4TWH A;  4TWF A;  5TVC A;  4Z91 A;  4HFC A;  1OED E;  3P50 A;  4ILC A;  2W8G A;  2BR7 A;  2XQ8 A;  2XQA A;  3UUB A;  4D01 A;  2XQ6 A;  5CO5 A;  5L4E A;  3SQ6 A;  4DBM A;  5BW2 A;  2Y58 A;  2Y7Y A;  3WTI A;  3SH1 A;  3RIF A;  5CFB A;  4UXU A;  4HFD A;  2BG9 A;  2LM2 A;  4FRR A;  5BP0 A;  3JAE A;  5AIN A;  1OED B;  4TWD A;  2XNT A;  4BFQ A;  4UM3 S;  4A98 A;  4XK9 A;  3RQW A;  4F8H A;  4X5T A;  1UV6 A;  2XQ3 A;  2PGZ A;  4HFB A;  4TNV A;  2WZY A;  4AFT A;  2BYS A;  3WTJ A;  4LML A;  2XZ6 A;  2W8F A;  2YME A;  4ALX A;  1I9B A;  5L47 A;  3WTN A;  2QC1 B;  4QH5 A;  3U8K A;  2YOE A;  2M6I A;  2UZ6 A;  2BG9 C;  2XNU A;  3IGQ A;  4UM3 A;  4AFG A;  2C9T A;  3WTM A;  5LXB A;  5L4H A;  3UU6 A;  5IUX A;  4ZZB A;  3JAF A;  4ZJT A;  3WTO A;  5AFK A;  2YKS A;  4QAC A;  3JAD A;  5LG3 A;  2LLY A;  3ZKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...