4LMLA

Glic double mutant i9'a t25'a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLAAHIAFNILVETNLPKAPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Gating of the proton-gated ion channel from Gloeobacter violaceus at pH 4 as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 82
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4lmlA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4lmlA01
2LLYA 4TWHA 1OEDA 2YN6A 2BR7A 5AFHA 3TLTA 2XQ5A 4UM3S 4LMLA 4HFBA 3IGQA 3UU3A 4NPPA 1UW6A 2BYSA 4HFHA 2BJ0A 4QH5A 2ZJVA 5KE4A 5IUXA 5AFNA 3SIOA 2XQAA 5HEJA 5BP0A 4ILCA 2C9TA 2W8FA 2PH9A 3C79A 3GUAA 4ALXA 2YOEA 4ILBA 2KSRA 4ZZCA 2LM2A 5L47A 3T4MA 2WNLA 5J5GA 4BQTA 5J5IA 4X5TA 2UZ6A 2Y54A 3UQ7A 4UM3A 4ZRUA 5J0ZA 2LKHA 2XZ6A 3WIPA 4QH1A 4HFCA 3UQ4A 4A98A 4QABA 3U8NA 3TLWA 4UM3P 2XNVA 2YKSA 4XHEA 4LMJA 3U8MA 1UX2A 2W8GA 3WTLA 1UV6A 5LXBA 2BG9C 3TLSA 2WN9A 2XZ5A 4NZBA 4TNWA 4TWFA 2BYRA 4PIRA 5HCMA 3ZKRA 4ZJTA 2BYQA 5CFBA 5L4HA 4FRRA 4QACA 3UU6A 5SYOA 4ILAA 4LMKA 5TVCA 4EZ1A 2XQ8A 2MAWA 1OEDC 4QH4A 5HEHA 4ZZBA 4UXUA 3TLUA 3RI5A 4AFTA 5FJVA 3RHWA 4UY2A 5HEGA 3UU8A 2VL0A 5J5HA 2XYTA 5HEOA 3EHZA 3U8JA 3U8LA 2BG9B 3RIFA 4ZR6A 4ZK1A 3UUBA 3RQWA 3RIAA 3SQ6A 5AFMA 5BW2A 4F8HA 3WTOA 1I9BA 2Y57A 4DBMA 4AFGA 4QAAA 3WTHA 2XNTA 2M6IA 2LKGA 3SQ9A 3ZDGA 3WTIA 3WTNA 2BR8A 1OEDB 4IREA 5AFLA 3P50A 4TNVA 2XYSA 4TWDA 3U8KA 2XQ3A 2BG9E 3JADA 5KZUA 2Y58A 5AFJA 5AINA 4WV9A 3WTJA 3C84A 2WNJA 5J5FA 3UU4A 4HFIA 5HEUA 2X00A 4ZJSA 2QC1B 3SH1A 3PEOA 2WZYA 3P4WA 1OEDE 5JMEA 4D01A 2WNCA 2BYPA 4IL4A 2XNUA 2YMEA 4AFHA 4HFDA 4UM1A 2XQ9A 3EAMA 3TLVA 5BRXA 2XQ6A 3UU5A 2X00D 4IL9A 5L4EA 2XQ7A 5HCJA 4HFEA 3WTKA 4Z91A 4Z90A 2M6BA 4A97A 3JAFA 4HQPA 3ZDHA 5AFMB 3JAEA 2YMDA 3EI0A 2BG9A 4B5DA 2ZJUA 2BYNA 3PMZA 5AFKA 2PGZA 4ZK4A 3RQUA 3WTMA 5LG3A 2Y7YA 3LSVA 4BFQA 4COFA 2XQ4A 2Y56A 5CO5A 4XK9A
chains in the Genus database with same CATH superfamily
4IDQA 4PK5A 5L2LA 3AA7B 4AQFC 3IGQA 2XM2A 2EHOD 2W8FA 4DV7T 3C79A 3RIUC 5L47A 3L3PA 4ERRA 3T1YT 4ZRUA 3UQ4A 5JRCB 2XNVA 3NWIA 2K9AA 4KX6A 3EDVA 2HPLA 5LXBA 3FZLB 3TLSA 4MHCA 4CN4A 4PIRA 3O1IA 5HCMA 4E7ZA 4DR5T 2Q9QC 2AXDS 3R6NA 4G63A 2NTYA 2VL0A 2JRKA 4X64T 1T72A 4WBNE 4DBMA 2BKPA 3ZN0B 4QAAA 1IAPA 2YDRA 4L9IA 4AQFA 3B5MA 4ZEYA 5LG4A 3WTNA 4CI1B 2LM9A 4CXXA 2WY2A 3VKGA 3RIUA 5DABA 3PUQA 2A72A 4H9RC 4IL4A 3OJAA 4LF9T 3B57A 3VU7H 2J47A 2V7KA 1D1AA 4HFEA 3KBTA 5L3EB 4HQPA 2H7OA 1ZHCA 3LK3B 1CUNA 1W0BA 3KDSE 2ACZA 2V7IA 3EUHA 3ZCJA 5AQHB 2BYSA 5KE4A 3UUNA 3AE6A 2WMOA 1QLBA 2W66A 2VKDA 2CCQA 4X1IE 2CLYC 1IJ6A 2CRBA 1J5ET 2PH9A 4O2BE 1X79A 2RA1A 2V7MA 5DQVA 3N9LA 3RX6A 2WDRA 1HG2A 4P1NA 3ZT5A 4EV6A 3AXJA 1XNRT 3U8NA 3TLWA 5LHHB 3W15B 3Q5XA 3VHLA 1SA0E 2DWKA 1UV6A 1UURA 5FY1A 3ZMUB 4LMKA 1SUMB 4QH4A 3RI5A 2CA5A 3UU8A 3A5XA 4ZK1A 5FY7A 3RQWA 4DV0T 2A3DA 5C8YE 2QRXA 2XNTA 1MNEA 2JJ9A 5J2TE 2BG9E 5AINA 1MIWA 3AA6B 1UCUA 3H37A 5HEUA 1YQ3A 4G2AA 2X9YA 3RYIE 2YMEA 3TLVA 1YW0A 4LFAT 4A56A 2X67A 3KV9A 5JDLA 3P8CD 1LVFA 1DU2A 3OVUA 4F6RC 2WBLA 3C4WA 3JCFA 3RLFF 2C5IT 3AEGA 2DNXA 4MBQA 4AQGA 4O4JE 5FNVE 1E1HB 3ZC0A 2FBWA 3ABVA 3TLTA 5LHIB 4UM3S 4HTEA 2WU2A 4IDOA 2WWVA 3K3QC 1NENA 5AFNA 2Q9QD 3P4RA 2J1DG 4LF6T 4DMWA 2V6YA 2XPKA 2E9XC 4LF4T 5J5IA 1JNZA 4U3CA 1FIOA 2CE7A 4U31A 5J0ZA 1WR0A 1E2AA 4CZZB 4ADZA 4PJJA 4EEBA 2YKSA 1FJGT 3FXEB 3Q5WA 5HYAA 2XZ5A 2NWBA 2X0LB 4GYSA 2D5UA 5L3BB 2D9DA 2XAFB 3O4XE 2WP9A 1OXZA 5CFBA 4JEHB 3ZPOA 2MAWA 2YDSA 2IW5B 1KNPA 4I4TE 1HF8A 3A7MA 3RIAA 4IE0A 5FMNA 5AQMB 4L5GA 2ZM8A 5HXEA 5AQIB 2UU9T 2OV9A 4HWIB 2BBJA 3AXJB 2M6IA 3AEAA 1W09A 1R8IA 4GOUA 4AXPA 4WV9A 1UX5A 4DR1T 5ABFA 3IA3A 2VKOA 2VKHA 2WAUA 2V1DB 5EK3A 3P4PA 3RF1A 1KF6A 2YMDA 3JC6C 2VVNA 5F3JA 4JI3T 2BYNA 2FJAA 3LFMA 4HFBA 3N9OA 4HFHA 3C4XA 2W62A 5AQLB 4X66T 5KDMC 1AJ3A 3UULA 4HGAA 2UXDT 3T4MA 4ZS3A 1MMDA 1HNXT 4ISTA 5H6QB 4LF8T 1N36T 4UM3A 1G8XA 2XTLA 2IC9A 5AQNB 3N9QA 4CI2B 5JDHA 4NZBA 4JUYA 2WSSV 5SYOA 5TVCA 4X62T 4UIGA 4WBOA 4ZZBA 5LP6E 4PJLA 3UFGA 4UY2A 2NW8A 3AA1B 2XYTA 5C2TA 3EHZA 3H3MA 2BG9B 1VCSA 2W67A 1MNDA 3VR8A 5AFLA 4DO0A 5HXCA 2CM0A 2KINB 2WCAA 2KZ7B 2X00A 4ZJSA 3O1HA 4AQYT 3ZN1B 2WZYA 5FKYA 2DLRA 4DR4T 4AFHA 3E0ZA 3K8PC 2E9XD 3ZT7A 2HHHT 3O9XA 4EAHA 1BR0A 3MK7C 3ZDHA 1KNZA 2LJLA 5FY0A 5CA1E 4DNDA 2HN2A 2X0YA 2PFVA 1VRBA 3E22E 4LMLA 2ZJVA 2YEVC 5DQWA 3AE7A 4FJOA 2A2FX 2H7VC 3ZYMA 2PJQA 4O2AE 4X5TA 3FZHB 4AKGA 2XZ6A 3GN5B 3MJXA 3LJCA 2E2AA 4B3MT 2JMHA 5J1GA 2CEAA 4ILUA 5LYJE 4KI0F 3I0OA 4TWFA 3ZYKA 1NEKA 1KFYA 5LGUB 5HEHA 2CHNA 3RC3A 4EYYR 2FJEA 4LF7T 4ZHQE 3Q5DA 1SHZC 3RYFE 3ONXA 3AVRA 4GYRA 3JC6D 4YHJA 4ZS2A 2LKGA 4DV1T 5EK2A 4IREA 4GIWA 3E08A 2IIUA 3CX7B 2Y58A 4WNKA 2UUBT 2WNJA 2XAGB 4U72A 1XDOA 3QUJA 2ES0A 3PU3A 1FMVA 3PE0A 4AISA 2XNUA 4I43B 4AKIA 2D0UA 2X00D 3A8YC 3AE4A 1W9RA 2KT9A 3FBZA 1V9DA 2Y56A 2KWIB 4QX7B 3C50A 5FXXA 2DI4A 2IC6A 4NPPA 2BJ0A 2KXPB 3PU8A 4ILCA 4KMCA 3U78A 2JMKA 4AKLA 4BQTA 3HR0A 5FP3A 3UQ7A 4YSXA 1KNRA 3AAIA 5AQJB 2CBJA 4B6XA 4B3TT 3PJAJ 3U8MA 4YSZA 4ANJA 2E8IA 2Z6EA 1BR2A 1D1CA 2LT3A 2XJ7A 4TX5A 3CMLA 4FRRA 1XDPA 2ZM2A 3ZT6A 3FHNA 2IDOB 4OYKA 5JQGE 1OWAA 3AEDA 3RIFA 3OBVE 4F8HA 1E7PA 4DUYT 3WTOA 2GK9A 4H9PC 5JTGA 3WTHA 2LSIA 2EHOB 1T7SA 3U8KA 3JADA 3C84A 3BQKA 4PFPA 4YY3T 4UEMA 1ZOYA 2W00A 1YQ4A 1WYBA 2J62A 2LEHA 2YDQA 4PJMA 2E5VA 4U74A 3AE9A 4U2ZA 1WFDA 3WTKA 4A97A 3RKGA 1UUSA 4DV3T 2Y7YA 2J4GA 1MIYA 2X66A 3SS1A 3C64A 3KVBA 4ZXLA 5AFHA 2XQ5A 1YD8G 4UF0A 4IT4A 2JQKA 3P4SA 3EDUA 4A5XA 4JI1T 5AQPB 2K5BB 3UUMA 5LMNT 2I59A 3U3IA 1MMGA 4LF5T 5J5GA 4O4HE 4XAXB 3I1AA 2DL1A 2ZMAA 1J1JA 4AIUA 4JI6T 2Q9QA 5JH7E 4LMJA 2LOPA 1UX2A 3C4ZA 2KLQA 1M62A 3GWHA 1YXRA 4EZ1A 2XQ8A 5LMUT 4HE8A 1HX8A 4BJMA 3SQ6A 2CHOA 3QC9A 2Y57A 4JI4T 2X68A 2LOSA 3F57A 4ZI3C 2X9HA 3ONLC 4EYUA 3ZCIA 5AQVB 2BKOA 5ADXL 1KK7A 3AE1A 1IZNB 2QC1B 3B13A 4IIJE 5HAXA 2CMRA 5TAOA 4JI0T 3T8OA 3UT5E 4ZI7E 2V7LA 2X51A 2XQ6A 3S4UA 4CXYA 2ZM6T 1WLXA 3CK6A 2M6BA 3CVRA 1Z0PA 4YHHT 4B5DA 2UXXB 2B76A 2M67A 4H9SE 1SE7A 4DV6T 2CWYA 2PGZA 5JR9C 2H89A 2WM9A 2LLYA 5JVDE 2D0TA 3NBXX 3C98B 3ZEFB 4JI8T 4DBQA 2BS4A 4UV8B 4B3RT 5ABHA 4IHJE 5F5WA 2W63A 5JDGA 5A1LA 1WR6A 3MA9A 5L3CB 4YSYA 4N78D 3WTLA 4QXHB 2W4XA 3DP7A 2BVMA 3PJAA 1US7B 3SOLA 3ZKRA 1OEDC 4CI3B 3ANWA 2XSAA 4X1YE 2VVSA 2LSGA 4DMVA 4MALA 4YTPA 2YU1A 3WTIA 2Q9QB 3H3AA 2XAQB 4TWDA 4PFOA 4B3ST 2FUPA 5AFJA 4OFZA 2BS2A 3MKDA 1G73A 3PURA 5HXSA 4BJNA 4KUMB 5EZYE 4DVDA 4DR6T 2HPJA 3LK42 1UK5A 1LVKA 3PDYA 1HR0T 3P4QA 3PUVF 3CIRA 2E9XA 4XK9A 2VQET 1OEDA 2QVAA 4I55E 2A9UA 2XQYA 2NW9A 4JEUB 5LJMA 1UW6A 3N9PA 5IUXA 3Q9DA 2BVLA 2QYWA 1JNRA 1M7KA 4EIWA 5KXJA 4U7YA 3UTKA 4OHFA 5H6RB 3LBXA 5LBMA 3PUAA 3VR9A 2C5KT 2CLYB 3CWZB 4ZI3D 2VK9A 4IE6A 4GKKT 2WWUA 3F2EA 2MOZA 3GA8A 1MMNA 3FB2A 3WAKA 3LG7A 5AQRB 4QXCB 4ZR6A 3UUBA 2P9BA 2WMNA 3N2GE 4ZI2C 3ZDGA 3CQXC 4YJ2E 2SPCA 5FXZA 3RH3A 5KZUA 3ZMSB 5FVKA 2W0GA 3ZMVB 2C0SA 3P7IA 2JIWA 4EXTA 4HFIA 4H63H 2V6YB 3I9WA 3RGLA 3CQCB 3NRYA 3WAJA 5HXRA 4UM1A 3TKLB 2JPFA 2UXBT 2BBHA 3NVOA 2VKJA 4HKAA 2BKNA 2VURA 4C90A 1XZYA 4YFSA 4TV9E 5FXWA 2NOXA 4GK0E 1QUUA 2LHNA 3L09A 5DJQC 4TWHA 4CQIA 4JBWF 3UU3A 2I0MA 1KEYA 5M4YA 3HKEE 5BP0A 3PTRB 4Q25A 3BQIA 2KSRA 5LXTE 2WNLA 3KV5A 2K48A 2CBIA 4HFVA 4HFCA 5AQSB 4EZ4A 3RC8A 5BMVE 1BR1A 4K0KT 5AFUL 2E9XB 2XSBA 4M1PA 5ABFB 4UV9B 2BYRA 4ZJTA 3QK6A 2BYQA 3SFEA 2D2SA 3RHWA 1IBKT 2BZBA 4YTMA 5AQTB 1NAFA 3KVAA 2XAHB 4I0UA 3VKHA 3OTOT 5BW2A 3X1DA 5JRCA 3VRAA 3J9X1 3N2OA 3V5UA 4DUZT 2UXNB 1O3XA 3AA0B 3K3OA 1MIVA 1YKHB 1ZEEA 3SH1A 2LHRA 3IF8B 3RRWA 3ESLA 4EGWA 5BRXA 5LGNB 5LNKA 2HH7A 3UFEA 3AAAB 1S94A 4YXDA 3JAFA 1WRDA 2V8SV 1D0YA 3N5LA 2LSYA 2YN6A 4HWCA 4NXMT 2BS3A 5HWYA 3ETVA 4QH5A 3SFDA 3VRBA 5FXVA 4O4LE 3NZQA 5L3FB 2C9TA 4HWHA 5IYZE 1GQEA 2IMLA 2KWHA 1N32T 3SWHA 4QABA 1HX1B 3QB5A 3R84B 2KMFA 4ZI2D 2LRLA 2NR4A 4X20E 2WDQA 4UVBB 1HNZT 4PJNA 4QHOA 2LE8A 4BA9A 4XBFB 2HN1A 2YU2A 5EK4A 2WU5A 4H63V 5CGMA 2XUEA 3U8LA 1XMOT 3ZYLA 2JQ9A 4DIDB 4L0RA 1NWMX 5FVLA 1B7TA 3T1HT 4X1KE 3PUXF 3MACA 1HS7A 3UU4A 2B1EA 5IWAT 4EEDA 4P0AA 2F4VT 4D01A 2WNCA 3QOFA 1I6ZA 4HFDA 3PUSA 4V1Av 4KBMB 3KV6A 3ONJA 2QA7A 1FMWA 5IHYA 1XMQT 1WCRA 3ZJ1A 3JAEA 3OYXA 2ZJUA 5CB4E 1IJ5A 3O1JA 3M3ZB 5JDFA 4WYVA 1CHUA 3HKBE 5AQFB 2K24A 4IE7A 3NZPA 4ZZCA 2E5LT 1LKXA 3N9MA 4QH1A 4U7IA 2VQFT 2FJBA 2R6GF 3DTOA 1T8BA 3LDQB 4J2CA 4TNWA 4JI2T 3K3NA 2G0UA 2CWOA 3BQLA 4O8SA 3F31A 5J5HA 4GK5E 2UXCT 2MYSA 5AFMA 2VWAA 4P0BA 4HEAA 4AFGA 3OPCA 2WS3A 4P09A 4UVCB 3P50A 1IBMT 2JQQA 2YK0A 2H88A 3KINB 5CA0E 4QKNA 3P4WA 2PTFA 4IL9A 2XQ7A 4TV8E 3RKOA 4X65T 4Z91A 2DHRA 4OK0A 5JREA 3AB3B 5L3GB 4HWDA 5L3DB 3LSVA 4DV4T 2XQ4A 2K3WA 2N1GA 3ZC1A 4JLEA 2CPTA 5AQQB 3QB5K 5LJNA 3ZSTA 1XWMA 2ZLYA 2IUBA 1W0AA 3MZKB 4H9NC 2RP4A 1U5PA 3AAEB 4MLKA 2LKHA 3WIPA 1LRZA 3PUZF 3OYZA 5LBQB 2MTQA 2BG9C 4PNIA 5E0OA 4DV5T 1XNQT 2H3RA 3I9YA 2N9DA 4TN7B 5JDNA 1ZV4X 3PV0F 4AI6A 4AFTA 4ASKA 1BR4A 5GONE 4H9QC 4JYAT 2CXDA 2Y48B 2XZEA 2VASA 4EB6E 5KX5E 3HI2A 1UX4A 4IDZA 3FZKB 3SQ9A 5ABGA 1X9BA 4NUVA 3AEFA 5LHGB 4PAGA 4NUUA 2XYSA 4AKHA 3L8RA 2LSKA 4UF0B 4DR2T 1D0ZA 3PEOA 1UGOA 1FEWA 1S35A 1OEDE 5JR9A 2XM1A 2XASB 3HL6A 3UU5A 1ZKEA 5AQGB 1Y64B 3Q2MA 3HKCE 3GMIA 5AFMB 2BG9A 3PMZA 3C51A 1D0XA 3NRXA 4O4IE 3RQUA 3V5SA 2L9QA 4COFA 3ZLIA 2W2UA 4UXNB 5FL1A 4QXBB 4E7SA 4IGUA 3J7Yq 3G06A 2XQAA 5HEJA 4DR3T 2XAJB 4ALXA 1HTJF 2X9XA 2Y8DA 4MFRA 2UUAT 1J5WA 4WW0A 4YT0A 3IBPA 4K0UA 2UUCT 5JDQA 4U33A 3L39A 4EZHA 2WQYA 3FZFB 2DCFA 2WN9A 4H9OC 3BK9A 3OKQA 2I6HA 5AQKB 2MPKA 4QACA 3D0TA 5BR8T 4UXUA 2FJDA 5FJVA 2CXLA 2V5DA 2ACXA 5HEGA 4PW8A 1U4QA 3ETUA 1I9BA 5CJ5A 2NW7A 3Q5EA 3GN5A 3FXDB 4TNVA 2DWGA 3WTJA 1HCIA 5LGTB 2JQHA 3N2KE 3ZSSA 3HA4A 5J2UE 1L0VA 4KHPT 2XQ9A 3I0QA 3AECA 3PUGA 3N9NA 2WZIA 5L4EA 2Y6XA 4CN1A 2OLTA 3EABA 4LFCT 5F8PA 3EI0A 4JV5T 5AFKA 5LG3A 5FL0A 2V7JA 1HFAA 3KBUA 3NKZA 1HNWT 3ANWB 3SIOA 4YLHA 3ZMTB 2WB5A 3GUAA 4UELA 2YOEA 5JR9B 4ILBA 2LM2A 3K1SA 4Z8XA 2Y54A 4A98A 1HG5A 3MXZA 4UM3P 2PBIA 4QWNB 4IE4A 5LCYA 2WDVA 5LA6E 3UU6A 3HKDE 5AQUB 2NP9A 2EHOC 4LFBT 4CXWA 3TLUA 2ODUA 2X0HA 3IEEA 3RRCA 2C5JA 3DJBA 3RYCE 4DV2T 3U8JA 3M65A 3QNUA 5ETWA 3AVSA 1MMAA 2BR8A 1OEDB 2CXFA 2NTXA 2VB6A 2XQ3A 3IHRA 5J5FA 3KV4A 4CN6A 1N33T 4HWFA 1D1BA 4YTNA 1VOMA 4XZCA 3CX6B 4YJ3E 5HCJA 3LBXB 4Z90A 4EOZB 2LSJA 4TZ4C 2LRKA 2PG8A 2XHEB 1YKEB 2L8KA 1Z8UA 3SRZA 1EZ3A 3RYHE 3WTMA 2VL8A 4BFQA 2IAKA 4U2YA 5HWXA 5CO5A 4UVAB 2EHOA 2V5CA 4TUYE 2BR7A 4DBRA 4UR9A 2OA5A 2X9WA 3CX8B 3ZMZB 5FYMA 2WZHA 5C3JA 4I50E 3FZMB 2AE9A 4KHZF 1VCTA 2UZ6A 2MBGA 3EVYA 1WYCA 4JI7T 4QX8B 2ODVA 3AE3A 4XHEA 4PK4A 3ZJ2A 4ZOLE 2W8GA 2V26A 4PK6A 2N2NA 1ZP0A 2RPAA 2W61A 1N34T 3UUXB 4BAYB 4NXNT 4KP3C 5L4HA 4ILAA 2V6XA 5HXHA 3AE2A 4FI5A 4HN9A 5ABEA 1QSDA 4JI5T 4OX9T 5HEOA 5JDMA 5LOVE 4ISSA 2XY8B 4AKRB 3CQGB 2L3LA 3AEBA 2BDEA 3RPUA 2KNDA 4C91A 4IDNA 3CKDA 3AE8A 3LK2B 1T98A 1H7CA 3WI3A 5KMGP 4OYJA 1I94T 3KFWX 3CPZA 5JMEA 2BYPA 3PUYF 4IE5A 5AQOB 3EAMA 2ZM0A 4NIQA 3PUWF 3AEEA 4GKJT 4IDPA 1IBLT 2QGSA 3AE5A 4DR7T 4ZK4A 2IHR1 2YINA 4WZXA 5LB7B 3FBLA 1Y01A
chains in the Genus database with same CATH topology
2LLYA 4TWHA 1OEDA 2YN6A 2BR7A 5AFHA 3TLTA 2XQ5A 4UM3S 4LMLA 4HFBA 3IGQA 3UU3A 4NPPA 1UW6A 2BYSA 4HFHA 2BJ0A 4QH5A 2ZJVA 5KE4A 5IUXA 5AFNA 3SIOA 2XQAA 5HEJA 5BP0A 4ILCA 2C9TA 2W8FA 2PH9A 3C79A 3GUAA 4ALXA 2YOEA 4ILBA 2KSRA 4ZZCA 2LM2A 5L47A 3T4MA 2WNLA 5J5GA 4BQTA 5J5IA 4X5TA 2UZ6A 2Y54A 3UQ7A 4UM3A 4ZRUA 5J0ZA 2LKHA 2XZ6A 3WIPA 4QH1A 4HFCA 3UQ4A 4A98A 4QABA 3U8NA 3TLWA 4UM3P 2XNVA 2YKSA 4XHEA 4LMJA 3U8MA 1UX2A 2W8GA 3WTLA 1UV6A 5LXBA 2BG9C 3TLSA 2WN9A 2XZ5A 4NZBA 4TNWA 4TWFA 2BYRA 4PIRA 5HCMA 3ZKRA 4ZJTA 2BYQA 5CFBA 5L4HA 4FRRA 4QACA 3UU6A 5SYOA 4ILAA 4LMKA 5TVCA 4EZ1A 2XQ8A 2MAWA 1OEDC 4QH4A 5HEHA 4ZZBA 4UXUA 3TLUA 3RI5A 4AFTA 5FJVA 3RHWA 4UY2A 5HEGA 3UU8A 2VL0A 5J5HA 2XYTA 5HEOA 3EHZA 3U8JA 3U8LA 2BG9B 3RIFA 4ZR6A 4ZK1A 3UUBA 3RQWA 3RIAA 3SQ6A 5AFMA 5BW2A 4F8HA 3WTOA 1I9BA 2Y57A 4DBMA 4AFGA 4QAAA 3WTHA 2XNTA 2M6IA 2LKGA 3SQ9A 3ZDGA 3WTIA 3WTNA 2BR8A 1OEDB 4IREA 5AFLA 3P50A 4TNVA 2XYSA 4TWDA 3U8KA 2XQ3A 2BG9E 3JADA 5KZUA 2Y58A 5AFJA 5AINA 4WV9A 3WTJA 3C84A 2WNJA 5J5FA 3UU4A 4HFIA 5HEUA 2X00A 4ZJSA 2QC1B 3SH1A 3PEOA 2WZYA 3P4WA 1OEDE 5JMEA 4D01A 2WNCA 2BYPA 4IL4A 2XNUA 2YMEA 4AFHA 4HFDA 4UM1A 2XQ9A 3EAMA 3TLVA 5BRXA 2XQ6A 3UU5A 2X00D 4IL9A 5L4EA 2XQ7A 5HCJA 4HFEA 3WTKA 4Z91A 4Z90A 2M6BA 4A97A 3JAFA 4HQPA 3ZDHA 5AFMB 3JAEA 2YMDA 3EI0A 2BG9A 4B5DA 2ZJUA 2BYNA 3PMZA 5AFKA 2PGZA 4ZK4A 3RQUA 3WTMA 5LG3A 2Y7YA 3LSVA 4BFQA 4COFA 2XQ4A 2Y56A 5CO5A 4XK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LLY A;  4TWH A;  1OED A;  2YN6 A;  2BR7 A;  5AFH A;  3TLT A;  2XQ5 A;  4UM3 S;  4LML A;  4HFB A;  3IGQ A;  3UU3 A;  4NPP A;  1UW6 A;  2BYS A;  4HFH A;  2BJ0 A;  4QH5 A;  2ZJV A;  5KE4 A;  5IUX A;  5AFN A;  3SIO A;  2XQA A;  5HEJ A;  5BP0 A;  4ILC A;  2C9T A;  2W8F A;  2PH9 A;  3C79 A;  3GUA A;  4ALX A;  2YOE A;  4ILB A;  2KSR A;  4ZZC A;  2LM2 A;  5L47 A;  3T4M A;  2WNL A;  5J5G A;  4BQT A;  5J5I A;  4X5T A;  2UZ6 A;  2Y54 A;  3UQ7 A;  4UM3 A;  4ZRU A;  5J0Z A;  2LKH A;  2XZ6 A;  3WIP A;  4QH1 A;  4HFC A;  3UQ4 A;  4A98 A;  4QAB A;  3U8N A;  3TLW A;  4UM3 P;  2XNV A;  2YKS A;  4XHE A;  4LMJ A;  3U8M A;  1UX2 A;  2W8G A;  3WTL A;  1UV6 A;  5LXB A;  2BG9 C;  3TLS A;  2WN9 A;  2XZ5 A;  4NZB A;  4TNW A;  4TWF A;  2BYR A;  4PIR A;  5HCM A;  3ZKR A;  4ZJT A;  2BYQ A;  5CFB A;  5L4H A;  4FRR A;  4QAC A;  3UU6 A;  5SYO A;  4ILA A;  4LMK A;  5TVC A;  4EZ1 A;  2XQ8 A;  2MAW A;  1OED C;  4QH4 A;  5HEH A;  4ZZB A;  4UXU A;  3TLU A;  3RI5 A;  4AFT A;  5FJV A;  3RHW A;  4UY2 A;  5HEG A;  3UU8 A;  2VL0 A;  5J5H A;  2XYT A;  5HEO A;  3EHZ A;  3U8J A;  3U8L A;  2BG9 B;  3RIF A;  4ZR6 A;  4ZK1 A;  3UUB A;  3RQW A;  3RIA A;  3SQ6 A;  5AFM A;  5BW2 A;  4F8H A;  3WTO A;  1I9B A;  2Y57 A;  4DBM A;  4AFG A;  4QAA A;  3WTH A;  2XNT A;  2M6I A;  2LKG A;  3SQ9 A;  3ZDG A;  3WTI A;  3WTN A;  2BR8 A;  1OED B;  4IRE A;  5AFL A;  3P50 A;  4TNV A;  2XYS A;  4TWD A;  3U8K A;  2XQ3 A;  2BG9 E;  3JAD A;  5KZU A;  2Y58 A;  5AFJ A;  5AIN A;  4WV9 A;  3WTJ A;  3C84 A;  2WNJ A;  5J5F A;  3UU4 A;  4HFI A;  5HEU A;  2X00 A;  4ZJS A;  2QC1 B;  3SH1 A;  3PEO A;  2WZY A;  3P4W A;  1OED E;  5JME A;  4D01 A;  2WNC A;  2BYP A;  4IL4 A;  2XNU A;  2YME A;  4AFH A;  4HFD A;  4UM1 A;  2XQ9 A;  3EAM A;  3TLV A;  5BRX A;  2XQ6 A;  3UU5 A;  2X00 D;  4IL9 A;  5L4E A;  2XQ7 A;  5HCJ A;  4HFE A;  3WTK A;  4Z91 A;  4Z90 A;  2M6B A;  4A97 A;  3JAF A;  4HQP A;  3ZDH A;  5AFM B;  3JAE A;  2YMD A;  3EI0 A;  2BG9 A;  4B5D A;  2ZJU A;  2BYN A;  3PMZ A;  5AFK A;  2PGZ A;  4ZK4 A;  3RQU A;  3WTM A;  5LG3 A;  2Y7Y A;  3LSV A;  4BFQ A;  4COF A;  2XQ4 A;  2Y56 A;  5CO5 A;  4XK9 A; 
#chains in the Genus database with same CATH topology
 4IDQ A;  4PK5 A;  5L2L A;  3AA7 B;  4AQF C;  3IGQ A;  2XM2 A;  2EHO D;  2W8F A;  4DV7 T;  3C79 A;  3RIU C;  5L47 A;  3L3P A;  4ERR A;  3T1Y T;  4ZRU A;  3UQ4 A;  5JRC B;  2XNV A;  3NWI A;  2K9A A;  4KX6 A;  3EDV A;  2HPL A;  5LXB A;  3FZL B;  3TLS A;  4MHC A;  4CN4 A;  4PIR A;  3O1I A;  5HCM A;  4E7Z A;  4DR5 T;  2Q9Q C;  2AXD S;  3R6N A;  4G63 A;  2NTY A;  2VL0 A;  2JRK A;  4X64 T;  1T72 A;  4WBN E;  4DBM A;  2BKP A;  3ZN0 B;  4QAA A;  1IAP A;  2YDR A;  4L9I A;  4AQF A;  3B5M A;  4ZEY A;  5LG4 A;  3WTN A;  4CI1 B;  2LM9 A;  4CXX A;  2WY2 A;  3VKG A;  3RIU A;  5DAB A;  3PUQ A;  2A72 A;  4H9R C;  4IL4 A;  3OJA A;  4LF9 T;  3B57 A;  3VU7 H;  2J47 A;  2V7K A;  1D1A A;  4HFE A;  3KBT A;  5L3E B;  4HQP A;  2H7O A;  1ZHC A;  3LK3 B;  1CUN A;  1W0B A;  3KDS E;  2ACZ A;  2V7I A;  3EUH A;  3ZCJ A;  5AQH B;  2BYS A;  5KE4 A;  3UUN A;  3AE6 A;  2WMO A;  1QLB A;  2W66 A;  2VKD A;  2CCQ A;  4X1I E;  2CLY C;  1IJ6 A;  2CRB A;  1J5E T;  2PH9 A;  4O2B E;  1X79 A;  2RA1 A;  2V7M A;  5DQV A;  3N9L A;  3RX6 A;  2WDR A;  1HG2 A;  4P1N A;  3ZT5 A;  4EV6 A;  3AXJ A;  1XNR T;  3U8N A;  3TLW A;  5LHH B;  3W15 B;  3Q5X A;  3VHL A;  1SA0 E;  2DWK A;  1UV6 A;  1UUR A;  5FY1 A;  3ZMU B;  4LMK A;  1SUM B;  4QH4 A;  3RI5 A;  2CA5 A;  3UU8 A;  3A5X A;  4ZK1 A;  5FY7 A;  3RQW A;  4DV0 T;  2A3D A;  5C8Y E;  2QRX A;  2XNT A;  1MNE A;  2JJ9 A;  5J2T E;  2BG9 E;  5AIN A;  1MIW A;  3AA6 B;  1UCU A;  3H37 A;  5HEU A;  1YQ3 A;  4G2A A;  2X9Y A;  3RYI E;  2YME A;  3TLV A;  1YW0 A;  4LFA T;  4A56 A;  2X67 A;  3KV9 A;  5JDL A;  3P8C D;  1LVF A;  1DU2 A;  3OVU A;  4F6R C;  2WBL A;  3C4W A;  3JCF A;  3RLF F;  2C5I T;  3AEG A;  2DNX A;  4MBQ A;  4AQG A;  4O4J E;  5FNV E;  1E1H B;  3ZC0 A;  2FBW A;  3ABV A;  3TLT A;  5LHI B;  4UM3 S;  4HTE A;  2WU2 A;  4IDO A;  2WWV A;  3K3Q C;  1NEN A;  5AFN A;  2Q9Q D;  3P4R A;  2J1D G;  4LF6 T;  4DMW A;  2V6Y A;  2XPK A;  2E9X C;  4LF4 T;  5J5I A;  1JNZ A;  4U3C A;  1FIO A;  2CE7 A;  4U31 A;  5J0Z A;  1WR0 A;  1E2A A;  4CZZ B;  4ADZ A;  4PJJ A;  4EEB A;  2YKS A;  1FJG T;  3FXE B;  3Q5W A;  5HYA A;  2XZ5 A;  2NWB A;  2X0L B;  4GYS A;  2D5U A;  5L3B B;  2D9D A;  2XAF B;  3O4X E;  2WP9 A;  1OXZ A;  5CFB A;  4JEH B;  3ZPO A;  2MAW A;  2YDS A;  2IW5 B;  1KNP A;  4I4T E;  1HF8 A;  3A7M A;  3RIA A;  4IE0 A;  5FMN A;  5AQM B;  4L5G A;  2ZM8 A;  5HXE A;  5AQI B;  2UU9 T;  2OV9 A;  4HWI B;  2BBJ A;  3AXJ B;  2M6I A;  3AEA A;  1W09 A;  1R8I A;  4GOU A;  4AXP A;  4WV9 A;  1UX5 A;  4DR1 T;  5ABF A;  3IA3 A;  2VKO A;  2VKH A;  2WAU A;  2V1D B;  5EK3 A;  3P4P A;  3RF1 A;  1KF6 A;  2YMD A;  3JC6 C;  2VVN A;  5F3J A;  4JI3 T;  2BYN A;  2FJA A;  3LFM A;  4HFB A;  3N9O A;  4HFH A;  3C4X A;  2W62 A;  5AQL B;  4X66 T;  5KDM C;  1AJ3 A;  3UUL A;  4HGA A;  2UXD T;  3T4M A;  4ZS3 A;  1MMD A;  1HNX T;  4IST A;  5H6Q B;  4LF8 T;  1N36 T;  4UM3 A;  1G8X A;  2XTL A;  2IC9 A;  5AQN B;  3N9Q A;  4CI2 B;  5JDH A;  4NZB A;  4JUY A;  2WSS V;  5SYO A;  5TVC A;  4X62 T;  4UIG A;  4WBO A;  4ZZB A;  5LP6 E;  4PJL A;  3UFG A;  4UY2 A;  2NW8 A;  3AA1 B;  2XYT A;  5C2T A;  3EHZ A;  3H3M A;  2BG9 B;  1VCS A;  2W67 A;  1MND A;  3VR8 A;  5AFL A;  4DO0 A;  5HXC A;  2CM0 A;  2KIN B;  2WCA A;  2KZ7 B;  2X00 A;  4ZJS A;  3O1H A;  4AQY T;  3ZN1 B;  2WZY A;  5FKY A;  2DLR A;  4DR4 T;  4AFH A;  3E0Z A;  3K8P C;  2E9X D;  3ZT7 A;  2HHH T;  3O9X A;  4EAH A;  1BR0 A;  3MK7 C;  3ZDH A;  1KNZ A;  2LJL A;  5FY0 A;  5CA1 E;  4DND A;  2HN2 A;  2X0Y A;  2PFV A;  1VRB A;  3E22 E;  4LML A;  2ZJV A;  2YEV C;  5DQW A;  3AE7 A;  4FJO A;  2A2F X;  2H7V C;  3ZYM A;  2PJQ A;  4O2A E;  4X5T A;  3FZH B;  4AKG A;  2XZ6 A;  3GN5 B;  3MJX A;  3LJC A;  2E2A A;  4B3M T;  2JMH A;  5J1G A;  2CEA A;  4ILU A;  5LYJ E;  4KI0 F;  3I0O A;  4TWF A;  3ZYK A;  1NEK A;  1KFY A;  5LGU B;  5HEH A;  2CHN A;  3RC3 A;  4EYY R;  2FJE A;  4LF7 T;  4ZHQ E;  3Q5D A;  1SHZ C;  3RYF E;  3ONX A;  3AVR A;  4GYR A;  3JC6 D;  4YHJ A;  4ZS2 A;  2LKG A;  4DV1 T;  5EK2 A;  4IRE A;  4GIW A;  3E08 A;  2IIU A;  3CX7 B;  2Y58 A;  4WNK A;  2UUB T;  2WNJ A;  2XAG B;  4U72 A;  1XDO A;  3QUJ A;  2ES0 A;  3PU3 A;  1FMV A;  3PE0 A;  4AIS A;  2XNU A;  4I43 B;  4AKI A;  2D0U A;  2X00 D;  3A8Y C;  3AE4 A;  1W9R A;  2KT9 A;  3FBZ A;  1V9D A;  2Y56 A;  2KWI B;  4QX7 B;  3C50 A;  5FXX A;  2DI4 A;  2IC6 A;  4NPP A;  2BJ0 A;  2KXP B;  3PU8 A;  4ILC A;  4KMC A;  3U78 A;  2JMK A;  4AKL A;  4BQT A;  3HR0 A;  5FP3 A;  3UQ7 A;  4YSX A;  1KNR A;  3AAI A;  5AQJ B;  2CBJ A;  4B6X A;  4B3T T;  3PJA J;  3U8M A;  4YSZ A;  4ANJ A;  2E8I A;  2Z6E A;  1BR2 A;  1D1C A;  2LT3 A;  2XJ7 A;  4TX5 A;  3CML A;  4FRR A;  1XDP A;  2ZM2 A;  3ZT6 A;  3FHN A;  2IDO B;  4OYK A;  5JQG E;  1OWA A;  3AED A;  3RIF A;  3OBV E;  4F8H A;  1E7P A;  4DUY T;  3WTO A;  2GK9 A;  4H9P C;  5JTG A;  3WTH A;  2LSI A;  2EHO B;  1T7S A;  3U8K A;  3JAD A;  3C84 A;  3BQK A;  4PFP A;  4YY3 T;  4UEM A;  1ZOY A;  2W00 A;  1YQ4 A;  1WYB A;  2J62 A;  2LEH A;  2YDQ A;  4PJM A;  2E5V A;  4U74 A;  3AE9 A;  4U2Z A;  1WFD A;  3WTK A;  4A97 A;  3RKG A;  1UUS A;  4DV3 T;  2Y7Y A;  2J4G A;  1MIY A;  2X66 A;  3SS1 A;  3C64 A;  3KVB A;  4ZXL A;  5AFH A;  2XQ5 A;  1YD8 G;  4UF0 A;  4IT4 A;  2JQK A;  3P4S A;  3EDU A;  4A5X A;  4JI1 T;  5AQP B;  2K5B B;  3UUM A;  5LMN T;  2I59 A;  3U3I A;  1MMG A;  4LF5 T;  5J5G A;  4O4H E;  4XAX B;  3I1A A;  2DL1 A;  2ZMA A;  1J1J A;  4AIU A;  4JI6 T;  2Q9Q A;  5JH7 E;  4LMJ A;  2LOP A;  1UX2 A;  3C4Z A;  2KLQ A;  1M62 A;  3GWH A;  1YXR A;  4EZ1 A;  2XQ8 A;  5LMU T;  4HE8 A;  1HX8 A;  4BJM A;  3SQ6 A;  2CHO A;  3QC9 A;  2Y57 A;  4JI4 T;  2X68 A;  2LOS A;  3F57 A;  4ZI3 C;  2X9H A;  3ONL C;  4EYU A;  3ZCI A;  5AQV B;  2BKO A;  5ADX L;  1KK7 A;  3AE1 A;  1IZN B;  2QC1 B;  3B13 A;  4IIJ E;  5HAX A;  2CMR A;  5TAO A;  4JI0 T;  3T8O A;  3UT5 E;  4ZI7 E;  2V7L A;  2X51 A;  2XQ6 A;  3S4U A;  4CXY A;  2ZM6 T;  1WLX A;  3CK6 A;  2M6B A;  3CVR A;  1Z0P A;  4YHH T;  4B5D A;  2UXX B;  2B76 A;  2M67 A;  4H9S E;  1SE7 A;  4DV6 T;  2CWY A;  2PGZ A;  5JR9 C;  2H89 A;  2WM9 A;  2LLY A;  5JVD E;  2D0T A;  3NBX X;  3C98 B;  3ZEF B;  4JI8 T;  4DBQ A;  2BS4 A;  4UV8 B;  4B3R T;  5ABH A;  4IHJ E;  5F5W A;  2W63 A;  5JDG A;  5A1L A;  1WR6 A;  3MA9 A;  5L3C B;  4YSY A;  4N78 D;  3WTL A;  4QXH B;  2W4X A;  3DP7 A;  2BVM A;  3PJA A;  1US7 B;  3SOL A;  3ZKR A;  1OED C;  4CI3 B;  3ANW A;  2XSA A;  4X1Y E;  2VVS A;  2LSG A;  4DMV A;  4MAL A;  4YTP A;  2YU1 A;  3WTI A;  2Q9Q B;  3H3A A;  2XAQ B;  4TWD A;  4PFO A;  4B3S T;  2FUP A;  5AFJ A;  4OFZ A;  2BS2 A;  3MKD A;  1G73 A;  3PUR A;  5HXS A;  4BJN A;  4KUM B;  5EZY E;  4DVD A;  4DR6 T;  2HPJ A;  3LK4 2;  1UK5 A;  1LVK A;  3PDY A;  1HR0 T;  3P4Q A;  3PUV F;  3CIR A;  2E9X A;  4XK9 A;  2VQE T;  1OED A;  2QVA A;  4I55 E;  2A9U A;  2XQY A;  2NW9 A;  4JEU B;  5LJM A;  1UW6 A;  3N9P A;  5IUX A;  3Q9D A;  2BVL A;  2QYW A;  1JNR A;  1M7K A;  4EIW A;  5KXJ A;  4U7Y A;  3UTK A;  4OHF A;  5H6R B;  3LBX A;  5LBM A;  3PUA A;  3VR9 A;  2C5K T;  2CLY B;  3CWZ B;  4ZI3 D;  2VK9 A;  4IE6 A;  4GKK T;  2WWU A;  3F2E A;  2MOZ A;  3GA8 A;  1MMN A;  3FB2 A;  3WAK A;  3LG7 A;  5AQR B;  4QXC B;  4ZR6 A;  3UUB A;  2P9B A;  2WMN A;  3N2G E;  4ZI2 C;  3ZDG A;  3CQX C;  4YJ2 E;  2SPC A;  5FXZ A;  3RH3 A;  5KZU A;  3ZMS B;  5FVK A;  2W0G A;  3ZMV B;  2C0S A;  3P7I A;  2JIW A;  4EXT A;  4HFI A;  4H63 H;  2V6Y B;  3I9W A;  3RGL A;  3CQC B;  3NRY A;  3WAJ A;  5HXR A;  4UM1 A;  3TKL B;  2JPF A;  2UXB T;  2BBH A;  3NVO A;  2VKJ A;  4HKA A;  2BKN A;  2VUR A;  4C90 A;  1XZY A;  4YFS A;  4TV9 E;  5FXW A;  2NOX A;  4GK0 E;  1QUU A;  2LHN A;  3L09 A;  5DJQ C;  4TWH A;  4CQI A;  4JBW F;  3UU3 A;  2I0M A;  1KEY A;  5M4Y A;  3HKE E;  5BP0 A;  3PTR B;  4Q25 A;  3BQI A;  2KSR A;  5LXT E;  2WNL A;  3KV5 A;  2K48 A;  2CBI A;  4HFV A;  4HFC A;  5AQS B;  4EZ4 A;  3RC8 A;  5BMV E;  1BR1 A;  4K0K T;  5AFU L;  2E9X B;  2XSB A;  4M1P A;  5ABF B;  4UV9 B;  2BYR A;  4ZJT A;  3QK6 A;  2BYQ A;  3SFE A;  2D2S A;  3RHW A;  1IBK T;  2BZB A;  4YTM A;  5AQT B;  1NAF A;  3KVA A;  2XAH B;  4I0U A;  3VKH A;  3OTO T;  5BW2 A;  3X1D A;  5JRC A;  3VRA A;  3J9X 1;  3N2O A;  3V5U A;  4DUZ T;  2UXN B;  1O3X A;  3AA0 B;  3K3O A;  1MIV A;  1YKH B;  1ZEE A;  3SH1 A;  2LHR A;  3IF8 B;  3RRW A;  3ESL A;  4EGW A;  5BRX A;  5LGN B;  5LNK A;  2HH7 A;  3UFE A;  3AAA B;  1S94 A;  4YXD A;  3JAF A;  1WRD A;  2V8S V;  1D0Y A;  3N5L A;  2LSY A;  2YN6 A;  4HWC A;  4NXM T;  2BS3 A;  5HWY A;  3ETV A;  4QH5 A;  3SFD A;  3VRB A;  5FXV A;  4O4L E;  3NZQ A;  5L3F B;  2C9T A;  4HWH A;  5IYZ E;  1GQE A;  2IML A;  2KWH A;  1N32 T;  3SWH A;  4QAB A;  1HX1 B;  3QB5 A;  3R84 B;  2KMF A;  4ZI2 D;  2LRL A;  2NR4 A;  4X20 E;  2WDQ A;  4UVB B;  1HNZ T;  4PJN A;  4QHO A;  2LE8 A;  4BA9 A;  4XBF B;  2HN1 A;  2YU2 A;  5EK4 A;  2WU5 A;  4H63 V;  5CGM A;  2XUE A;  3U8L A;  1XMO T;  3ZYL A;  2JQ9 A;  4DID B;  4L0R A;  1NWM X;  5FVL A;  1B7T A;  3T1H T;  4X1K E;  3PUX F;  3MAC A;  1HS7 A;  3UU4 A;  2B1E A;  5IWA T;  4EED A;  4P0A A;  2F4V T;  4D01 A;  2WNC A;  3QOF A;  1I6Z A;  4HFD A;  3PUS A;  4V1A v;  4KBM B;  3KV6 A;  3ONJ A;  2QA7 A;  1FMW A;  5IHY A;  1XMQ T;  1WCR A;  3ZJ1 A;  3JAE A;  3OYX A;  2ZJU A;  5CB4 E;  1IJ5 A;  3O1J A;  3M3Z B;  5JDF A;  4WYV A;  1CHU A;  3HKB E;  5AQF B;  2K24 A;  4IE7 A;  3NZP A;  4ZZC A;  2E5L T;  1LKX A;  3N9M A;  4QH1 A;  4U7I A;  2VQF T;  2FJB A;  2R6G F;  3DTO A;  1T8B A;  3LDQ B;  4J2C A;  4TNW A;  4JI2 T;  3K3N A;  2G0U A;  2CWO A;  3BQL A;  4O8S A;  3F31 A;  5J5H A;  4GK5 E;  2UXC T;  2MYS A;  5AFM A;  2VWA A;  4P0B A;  4HEA A;  4AFG A;  3OPC A;  2WS3 A;  4P09 A;  4UVC B;  3P50 A;  1IBM T;  2JQQ A;  2YK0 A;  2H88 A;  3KIN B;  5CA0 E;  4QKN A;  3P4W A;  2PTF A;  4IL9 A;  2XQ7 A;  4TV8 E;  3RKO A;  4X65 T;  4Z91 A;  2DHR A;  4OK0 A;  5JRE A;  3AB3 B;  5L3G B;  4HWD A;  5L3D B;  3LSV A;  4DV4 T;  2XQ4 A;  2K3W A;  2N1G A;  3ZC1 A;  4JLE A;  2CPT A;  5AQQ B;  3QB5 K;  5LJN A;  3ZST A;  1XWM A;  2ZLY A;  2IUB A;  1W0A A;  3MZK B;  4H9N C;  2RP4 A;  1U5P A;  3AAE B;  4MLK A;  2LKH A;  3WIP A;  1LRZ A;  3PUZ F;  3OYZ A;  5LBQ B;  2MTQ A;  2BG9 C;  4PNI A;  5E0O A;  4DV5 T;  1XNQ T;  2H3R A;  3I9Y A;  2N9D A;  4TN7 B;  5JDN A;  1ZV4 X;  3PV0 F;  4AI6 A;  4AFT A;  4ASK A;  1BR4 A;  5GON E;  4H9Q C;  4JYA T;  2CXD A;  2Y48 B;  2XZE A;  2VAS A;  4EB6 E;  5KX5 E;  3HI2 A;  1UX4 A;  4IDZ A;  3FZK B;  3SQ9 A;  5ABG A;  1X9B A;  4NUV A;  3AEF A;  5LHG B;  4PAG A;  4NUU A;  2XYS A;  4AKH A;  3L8R A;  2LSK A;  4UF0 B;  4DR2 T;  1D0Z A;  3PEO A;  1UGO A;  1FEW A;  1S35 A;  1OED E;  5JR9 A;  2XM1 A;  2XAS B;  3HL6 A;  3UU5 A;  1ZKE A;  5AQG B;  1Y64 B;  3Q2M A;  3HKC E;  3GMI A;  5AFM B;  2BG9 A;  3PMZ A;  3C51 A;  1D0X A;  3NRX A;  4O4I E;  3RQU A;  3V5S A;  2L9Q A;  4COF A;  3ZLI A;  2W2U A;  4UXN B;  5FL1 A;  4QXB B;  4E7S A;  4IGU A;  3J7Y q;  3G06 A;  2XQA A;  5HEJ A;  4DR3 T;  2XAJ B;  4ALX A;  1HTJ F;  2X9X A;  2Y8D A;  4MFR A;  2UUA T;  1J5W A;  4WW0 A;  4YT0 A;  3IBP A;  4K0U A;  2UUC T;  5JDQ A;  4U33 A;  3L39 A;  4EZH A;  2WQY A;  3FZF B;  2DCF A;  2WN9 A;  4H9O C;  3BK9 A;  3OKQ A;  2I6H A;  5AQK B;  2MPK A;  4QAC A;  3D0T A;  5BR8 T;  4UXU A;  2FJD A;  5FJV A;  2CXL A;  2V5D A;  2ACX A;  5HEG A;  4PW8 A;  1U4Q A;  3ETU A;  1I9B A;  5CJ5 A;  2NW7 A;  3Q5E A;  3GN5 A;  3FXD B;  4TNV A;  2DWG A;  3WTJ A;  1HCI A;  5LGT B;  2JQH A;  3N2K E;  3ZSS A;  3HA4 A;  5J2U E;  1L0V A;  4KHP T;  2XQ9 A;  3I0Q A;  3AEC A;  3PUG A;  3N9N A;  2WZI A;  5L4E A;  2Y6X A;  4CN1 A;  2OLT A;  3EAB A;  4LFC T;  5F8P A;  3EI0 A;  4JV5 T;  5AFK A;  5LG3 A;  5FL0 A;  2V7J A;  1HFA A;  3KBU A;  3NKZ A;  1HNW T;  3ANW B;  3SIO A;  4YLH A;  3ZMT B;  2WB5 A;  3GUA A;  4UEL A;  2YOE A;  5JR9 B;  4ILB A;  2LM2 A;  3K1S A;  4Z8X A;  2Y54 A;  4A98 A;  1HG5 A;  3MXZ A;  4UM3 P;  2PBI A;  4QWN B;  4IE4 A;  5LCY A;  2WDV A;  5LA6 E;  3UU6 A;  3HKD E;  5AQU B;  2NP9 A;  2EHO C;  4LFB T;  4CXW A;  3TLU A;  2ODU A;  2X0H A;  3IEE A;  3RRC A;  2C5J A;  3DJB A;  3RYC E;  4DV2 T;  3U8J A;  3M65 A;  3QNU A;  5ETW A;  3AVS A;  1MMA A;  2BR8 A;  1OED B;  2CXF A;  2NTX A;  2VB6 A;  2XQ3 A;  3IHR A;  5J5F A;  3KV4 A;  4CN6 A;  1N33 T;  4HWF A;  1D1B A;  4YTN A;  1VOM A;  4XZC A;  3CX6 B;  4YJ3 E;  5HCJ A;  3LBX B;  4Z90 A;  4EOZ B;  2LSJ A;  4TZ4 C;  2LRK A;  2PG8 A;  2XHE B;  1YKE B;  2L8K A;  1Z8U A;  3SRZ A;  1EZ3 A;  3RYH E;  3WTM A;  2VL8 A;  4BFQ A;  2IAK A;  4U2Y A;  5HWX A;  5CO5 A;  4UVA B;  2EHO A;  2V5C A;  4TUY E;  2BR7 A;  4DBR A;  4UR9 A;  2OA5 A;  2X9W A;  3CX8 B;  3ZMZ B;  5FYM A;  2WZH A;  5C3J A;  4I50 E;  3FZM B;  2AE9 A;  4KHZ F;  1VCT A;  2UZ6 A;  2MBG A;  3EVY A;  1WYC A;  4JI7 T;  4QX8 B;  2ODV A;  3AE3 A;  4XHE A;  4PK4 A;  3ZJ2 A;  4ZOL E;  2W8G A;  2V26 A;  4PK6 A;  2N2N A;  1ZP0 A;  2RPA A;  2W61 A;  1N34 T;  3UUX B;  4BAY B;  4NXN T;  4KP3 C;  5L4H A;  4ILA A;  2V6X A;  5HXH A;  3AE2 A;  4FI5 A;  4HN9 A;  5ABE A;  1QSD A;  4JI5 T;  4OX9 T;  5HEO A;  5JDM A;  5LOV E;  4ISS A;  2XY8 B;  4AKR B;  3CQG B;  2L3L A;  3AEB A;  2BDE A;  3RPU A;  2KND A;  4C91 A;  4IDN A;  3CKD A;  3AE8 A;  3LK2 B;  1T98 A;  1H7C A;  3WI3 A;  5KMG P;  4OYJ A;  1I94 T;  3KFW X;  3CPZ A;  5JME A;  2BYP A;  3PUY F;  4IE5 A;  5AQO B;  3EAM A;  2ZM0 A;  4NIQ A;  3PUW F;  3AEE A;  4GKJ T;  4IDP A;  1IBL T;  2QGS A;  3AE5 A;  4DR7 T;  4ZK4 A;  2IHR 1;  2YIN A;  4WZX A;  5LB7 B;  3FBL A;  1Y01 A; 
#chains in the Genus database with same CATH homology
 2LLY A;  4TWH A;  1OED A;  2YN6 A;  2BR7 A;  5AFH A;  3TLT A;  2XQ5 A;  4UM3 S;  4LML A;  4HFB A;  3IGQ A;  3UU3 A;  4NPP A;  1UW6 A;  2BYS A;  4HFH A;  2BJ0 A;  4QH5 A;  2ZJV A;  5KE4 A;  5IUX A;  5AFN A;  3SIO A;  2XQA A;  5HEJ A;  5BP0 A;  4ILC A;  2C9T A;  2W8F A;  2PH9 A;  3C79 A;  3GUA A;  4ALX A;  2YOE A;  4ILB A;  2KSR A;  4ZZC A;  2LM2 A;  5L47 A;  3T4M A;  2WNL A;  5J5G A;  4BQT A;  5J5I A;  4X5T A;  2UZ6 A;  2Y54 A;  3UQ7 A;  4UM3 A;  4ZRU A;  5J0Z A;  2LKH A;  2XZ6 A;  3WIP A;  4QH1 A;  4HFC A;  3UQ4 A;  4A98 A;  4QAB A;  3U8N A;  3TLW A;  4UM3 P;  2XNV A;  2YKS A;  4XHE A;  4LMJ A;  3U8M A;  1UX2 A;  2W8G A;  3WTL A;  1UV6 A;  5LXB A;  2BG9 C;  3TLS A;  2WN9 A;  2XZ5 A;  4NZB A;  4TNW A;  4TWF A;  2BYR A;  4PIR A;  5HCM A;  3ZKR A;  4ZJT A;  2BYQ A;  5CFB A;  5L4H A;  4FRR A;  4QAC A;  3UU6 A;  5SYO A;  4ILA A;  4LMK A;  5TVC A;  4EZ1 A;  2XQ8 A;  2MAW A;  1OED C;  4QH4 A;  5HEH A;  4ZZB A;  4UXU A;  3TLU A;  3RI5 A;  4AFT A;  5FJV A;  3RHW A;  4UY2 A;  5HEG A;  3UU8 A;  2VL0 A;  5J5H A;  2XYT A;  5HEO A;  3EHZ A;  3U8J A;  3U8L A;  2BG9 B;  3RIF A;  4ZR6 A;  4ZK1 A;  3UUB A;  3RQW A;  3RIA A;  3SQ6 A;  5AFM A;  5BW2 A;  4F8H A;  3WTO A;  1I9B A;  2Y57 A;  4DBM A;  4AFG A;  4QAA A;  3WTH A;  2XNT A;  2M6I A;  2LKG A;  3SQ9 A;  3ZDG A;  3WTI A;  3WTN A;  2BR8 A;  1OED B;  4IRE A;  5AFL A;  3P50 A;  4TNV A;  2XYS A;  4TWD A;  3U8K A;  2XQ3 A;  2BG9 E;  3JAD A;  5KZU A;  2Y58 A;  5AFJ A;  5AIN A;  4WV9 A;  3WTJ A;  3C84 A;  2WNJ A;  5J5F A;  3UU4 A;  4HFI A;  5HEU A;  2X00 A;  4ZJS A;  2QC1 B;  3SH1 A;  3PEO A;  2WZY A;  3P4W A;  1OED E;  5JME A;  4D01 A;  2WNC A;  2BYP A;  4IL4 A;  2XNU A;  2YME A;  4AFH A;  4HFD A;  4UM1 A;  2XQ9 A;  3EAM A;  3TLV A;  5BRX A;  2XQ6 A;  3UU5 A;  2X00 D;  4IL9 A;  5L4E A;  2XQ7 A;  5HCJ A;  4HFE A;  3WTK A;  4Z91 A;  4Z90 A;  2M6B A;  4A97 A;  3JAF A;  4HQP A;  3ZDH A;  5AFM B;  3JAE A;  2YMD A;  3EI0 A;  2BG9 A;  4B5D A;  2ZJU A;  2BYN A;  3PMZ A;  5AFK A;  2PGZ A;  4ZK4 A;  3RQU A;  3WTM A;  5LG3 A;  2Y7Y A;  3LSV A;  4BFQ A;  4COF A;  2XQ4 A;  2Y56 A;  5CO5 A;  4XK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...