The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
86
|
sequence length |
322
|
structure length |
292
|
Chain Sequence |
MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Mechanism of MEK inhibition determines efficacy in mutant KRAS- versus BRAF-driven cancers.
pubmed doi rcsb |
molecule tags |
Transferase/transferase inhibitor
|
source organism |
Homo sapiens
|
molecule keywords |
Dual specificity mitogen-activated protein kinase kinase 1
|
total genus |
86
|
structure length |
292
|
sequence length |
322
|
ec nomenclature |
ec
2.7.12.2: Mitogen-activated protein kinase kinase. |
pdb deposition date | 2013-07-10 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00069 | Pkinase | Protein kinase domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Transferase(Phosphotransferase); domain 1 | Transferase(Phosphotransferase) domain 1 | ||
Alpha Beta | 2-Layer Sandwich | Phosphorylase Kinase; domain 1 | Phosphorylase Kinase; domain 1 |