4LMPA

Mycobacterium tuberculosis l-alanine dehydrogenase x-ray structure in complex with n6-methyl adenosine
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
371
structure length
371
Chain Sequence
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Drug target analysis by dye-ligand affinity chromatography
rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords Alanine dehydrogenase
total genus 131
structure length 371
sequence length 371
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2013-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lmpA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lmpA02
2EGGA 2QRKA 4RVGA 1L7DA 1QRRA 2Q45A 5ITVA 1IULA 5U1PA 4JQCA 3DZIA 3H5NA 2C07A 2CD9A 2Q2QA 4Z9FA 4LW8A 3IDSA 1X7DA 5L3ZA 1RM3A 2Y0EA 1HDCA 4DIOA 4ALNA 3TDKA 2J6IA 1UXGA 4D7AA 3PQFA 1F0YA 2GGSA 4DRYA 4ND1A 2GDZA 1C3VA 3GMDA 3PJFA 4A26A 4MKRA 4DLBA 4AJIA 1DOHA 4XWYA 1GCOA 1MX3A 2NV6A 3WYBA 1H2HA 3L4SO 4QX6A 1YJ8A 5JMWA 1P33A 2X23A 4P4NA 4BNYA 4RQUA 4XD2A 4UUNA 4Y6RA 4YEDA 4CM4A 3IIEA 4YJGB 2HK9A 1ZMTA 3PZRA 2CVZA 1NQAO 1QLHA 3O03A 1PTJA 4J91A 1ISHA 1DRWA 1ZSNA 1A9ZA 4L8VA 4L4XA 3VTFA 3HQ4O 4A27A 2AE2A 2PZMA 3ONFA 3CZMA 2AW5A 4BO5A 4GPD1 1X15A 1E7WA 2BFOA 1O95A 3EGOA 4S1VA 3LSYA 3STHA 4ZJUA 3F1KA 3ROKA 4AJEA 4KWHA 4FGSA 4R1UA 1VJ0A 1W0CA 3UFXA 2O3SA 1AGNA 1UUFA 3C7AA 5KJ6A 2YV3A 1MA0A 4E33A 5AYVA 1ZEMA 3MOIA 1D3AA 1HE4A 3ENNA 1YONA 4D46A 2VNAA 4YJFA 2DTEA 4U7WA 3I52A 2FSVA 3N58A 3Q6IA 2AMFA 1HYGA 2D4AA 5KIAA 4P4GA 4II2A 4RVFA 4FC7A 4I9NA 1U4SA 3NT2A 4BNGA 4QT0A 3RKRA 3DWFA 4A2CA 1WZEA 2JD2A 1KS9A 4J4BA 1K0UA 4WJZA 3MWDB 1EK6A 4ROSA 3L0DA 2G17A 3DZJA 3AM4A 3CXRA 4OQYA 4E2WA 3FNFA 3F3SA 4PLFA 1LDGA 2X5OA 3LT2A 3UH1A 1EE2A 4BNMA 4BNLA 1RYDA 2EEZA 5T67A 1KY4A 4E5YA 2TMDA 1E77A 1Y9AA 2QZZA 4IS2A 1AHIA 1OZAA 4KUHA 4FFLA 3I4CA 1UXKA 1S6YA 1ZK1A 3I1JA 4QO8A 2BD0A 4YAJA 1TT5B 1ENOA 4M86A 3PVZA 3P2OA 4WE3A 4YJHA 1V3VA 5F21A 5CDYA 3TZQA 2BGKA 3LF2A 3LZ6A 2FWMX 5IZCA 4INAA 2Q2WA 5CAEA 5HA5A 4XDYA 4KTTE 4HKTA 2HUNA 1DAOA 1M6HA 4KQXA 3M6IA 4TSKA 4BO4A 1IB6A 1Z6ZA 4D79A 4AJOA 1UDBA 1PJ2A 3GN2A 1HETA 3IAHA 4EEXA 2B35A 3ZU5A 4CMJA 1F14A 1P77A 2OP0A 3GMSA 4FR5A 4JBGA 4OGWA 3W4JA 1U9JA 4W99A 4YWJA 1JWBB 3V2UA 1P1FA 1A4UA 1U8XX 4E31A 4IQ0A 3ZHXA 4XA8A 2X58A 3FN4A 1KEVA 3BHMA 4YCAA 1NHWA 1QKIA 4PG6A 3PWZA 2P5YA 5JAIA 2W8ZA 5GMOA 5THQA 2I66A 3U3XA 2X6TA 1MC4A 4NBRA 3EVTA 2OMEA 4BKOA 3DDNA 4L9RA 3WGQA 2UUPA 2VUSA 4CR6A 4RPJA 4ZRNA 4F6LA 1PL6A 3U4DA 1Y81A 2PGLA 3R1IA 3DONA 4R69A 1TI7A 1R4NA 1H6DA 3VVCA 4EITA 5MGBA 1I33A 1ADBA 5JO0A 5HBRA 4G65A 4AJ1A 1BRMA 4CMEA 4Z9XA 4B4UA 3DQPA 4MKZA 3D4NA 3WBBA 2FPPA 3ASUA 2AQ8A 4W9NC 2Q49A 4NMHA 4J7UA 3GLQA 5DOVA 5TNXA 3DOCA 2EP5A 3W8EA 1PWZA 3QVTA 1HRDA 1AE1A 5DCWA 3EVNA 1QV6A 5IDQA 5T8KA 3M2PA 4IDEA 2C0CA 3BIOA 3F1LA 4CLOB 1W73A 2HQ1A 2O2SA 2X22A 3JQ7A 4YAEA 5BNIA 1YQDA 1H5QA 1BDMA 3PYMA 2CDCA 3A1NA 2WJPA 4WCFB 4CQLB 2ZQZA 3RC1A 2XPCA 1HLPA 3GPDG 3ZN2A 4H3VA 3ZDFA 4AJ2A 3QWBA 4BOYA 2ZB7A 5A9TA 4Y6PA 3JQCA 4GGPA 4W82A 3O9ZA 1J6UA 3ZV5A 2OP1A 2B5VA 2P2SA 3DAFA 3KEOA 5KJEA 4R4JA 1E7YA 2EV9A 4N7RA 4Y98A 1M2WA 3AJRA 5CEFA 1E7QA 1MG0A 4TRJA 3MTJA 2NVUB 3PDJA 3KETA 3QWIA 3VH1A 1DC6A 4IDGA 1FMCA 4E5PA 5ES3A 2QHXA 2NNLD 2QG4A 4XJTA 5G4LA 4J2HA 4R16A 4BB5A 3VPGA 2HMSA 5LC1A 4NZ9A 1TLTA 2BI7A 4I5GA 4F3YA 3ADOA 5CDSA 3F5QA 3QRWA 4Z0HO 4CLXA 2AEJA 1E1MA 2IXAA 2XXBA 1PS9A 3BTUA 4XB2A 4JIGA 3Q1LA 1E1KA 4LSWA 1UXIA 2UYYA 1KY5A 3AY7A 4D3DA 4W4TA 1ZFNA 2FR1A 2NUAA 5EPOA 4D44A 4MIEA 4B4VA 4E4YA 3IQDB 2CF6A 2C59A 2AA3A 1Q0LA 2JFGA 2H9IA 3E9QA 2YQ4A 4FW8A 3SJ7A 2QZ9A 4S3MA 3E48A 4PLVA 2O3UA 5FEUA 3DL2A 3DMTC 2YYYA 4JBIA 1N92A 3HFSA 1ZK4A 4J9UE 1A9YA 2PLAA 3IKVA 3E82A 1EDOA 1LLUA 1LJ8A 1P45A 3SC6A 3M2TA 3VZRA 3PTZA 3IP3A 5A3JA 1XU7A 1PGPA 1WZIA 3GZNB 4H15A 2NVWA 2DC1A 2BFPA 1PQUA 2UDPA 1LXCA 3VZPA 3EMKA 3KYDB 5JXWA 1L1FA 4MIYA 3PJDA 3I6IA 3VH4A 4DPKA 4NK5A 1SBYA 4R5HA 3SBOA 1ZKMA 2X0IA 4BNUA 3K9QO 4ZQEA 1JDJA 3RUAA 1YDWA 3HDJA 5FYDA 1LDBA 2F00A 4EUFA 1GL3A 4WCFC 3C3XA 5TIIA 3ROMA 2HRZA 5HWSA 2A9FA 2FSSA 3RCBA 4BNKA 2Y05A 4CPDA 3C85A 1ISIA 1XELA 3BMNA 4HFNA 5KWEA 5I7FA 4GWKA 4A0SA 2X0RA 3BMCA 3JQDA 1N7GA 4UEOA 1TT5A 1ORRA 3T4XA 2PKQP 2I65A 3E5MA 3H6KA 4YJHB 1E7RA 5THKA 1UH5A 4CQMD 4BIIA 1UP7A 1YB1A 1NHGA 2BRUA 2J3IA 4FPXA 3KBOA 2VYVD 4RPHA 1OC2A 5EESA 1IZ9A 4WEQA 4KOAA 5JBIA 4IS3A 1EUCA 3JD4A 1KIFA 4I8XA 2ZK7A 2VT3A 3W4KA 3BMOA 5KVSA 3UN1A 3LF1A 4CM8B 4NR0A 3C8MA 1R4MB 1BXZA 2G1UA 4DIFA 3ZWNA 3TL3A 4Q3AA 1B8PA 1GQYA 2Y1DA 1Y8QB 1X0VA 3GVIA 1SC6A 2JAHA 1DO8A 1SZJG 2V6MA 1EQUA 4XYEA 1UR5A 2R00C 3IC5A 4PN3A 4YAKA 4B4WA 1AXGA 2ZATA 5EJ2A 5TSDA 1DDOA 1LTHR 5DF1A 1BWSA 2HMTA 1KVRA 4XQGA 5JS6A 2WTBA 1SNYA 1ZXLA 2EXXA 4F6CA 4JROA 2P9GA 3PDUA 3KSZO 1HYEA 7ADHA 1FDSA 4FJ2A 4D0SA 4HV4A 3I9NA 2Q99A 3ZU2A 1R66A 2C20A 2QW8A 3DZHA 2W2KA 1DRUA 4L74A 4QO7A 2FZEA 1GAEO 3F6YA 2B4RO 1VJTA 5AOVA 5KKAA 5L7WA 1NQ5A 5IXSA 3AUSA 3E9MA 4DQUA 3PZBA 4UUOA 1G0NA 5HRUA 5A04A 3BTOA 4BO1A 1CWUA 4KUGA 4NJMA 3HDQA 1CEQA 1P1IA 1C14A 3GVPA 3UCXA 2WE7A 2ZTVA 1VM6A 1PZHA 5IG2A 3UICA 2JD1A 2EIHA 2RBEA 4BL5A 3I9KA 3H3FA 3U4IA 1YL6A 5TT1A 4E0BA 4PLZA 1Y7TA 2O7SA 3E9NA 4XIJA 3UF0A 1CIVA 2D59A 3P5SA 1GDHA 1XQ1A 4HWKA 5I7VA 3QQPA 1IOLA 3DMTA 4FSHA 3DFUA 3HDYA 4C4OA 3WG9A 4R3NA 3B70A 4BO7A 3BZUA 2X7HA 4XJSA 2FN7A 4J3FA 3FBTA 4J49A 3WFIA 5I9LA 5LDGA 2PZLA 2VHWA 2Q1WA 1K89A 3DBVO 2O7QA 2WYUA 5L9AA 3V1YA 3WX0A 2CDBA 4JGBA 2I67A 4G81A 1Y8RB 3AOEA 6LDHA 1LU9A 3I4FA 4AJKA 1JWAB 3AWDA 3HB4X 3V5NA 5EL0A 4NG5A 4M49A 3F46A 3PQEA 1SOWA 4KP7A 2UVDA 4OOEA 3VC7A 1CERA 1KVQA 3JD0A 2OFPA 4XQCA 1JVBA 3KRTA 2Q1TA 3WOHA 2PH5A 5B12A 3E03A 3TFOA 4ZHSA 2BMAA 3WWZA 1KEWA 4JCOA 4M8SA 1HZZA 5G0SA 3QP9A 3WDSA 2ZCUA 3PHGA 1GPDG 2JL1A 3JCZA 3RQSA 4CM9A 2NADA 2PGDA 3NT4A 3PWSA 4GVXA 4E2XA 3DTYA 5JY1A 3EW7A 3GPIA 5TX7A 4QEDA 1VJ1A 1PL7A 3NAQA 2OOSA 1FK8A 2AG8A 3L6DA 3GNQA 3VH2A 1O94A 3ANMA 4AJLA 3AUAA 2OL4A 4YAGA 4NBVA 1RM4A 4J1NA 4O59O 4IZIA 1BXGA 3QIVA 1EEHA 1T1SA 2V6BA 2HSDA 1E0DA 3WWYA 4PG8A 4BGEA 1PSDA 3C1TA 5DBFA 3H9JA 3OP4A 1C1XA 4J7CA 4GLOA 1EBUA 1B16A 5A3VA 3ANNA 4AVYA 1D4FA 4RVUA 3GNSA 2NU6A 2WDZA 2G5CA 1NASA 3NUGA 1I32A 2PNFA 9LDTA 5C7LO 1J4AA 3GZNA 4CMKA 4U8GA 1NFFA 4BNFA 1HT0A 2D8AA 1V9LA 3FNGA 2YW9A 1E5LA 3KYDA 3WFJA 2LDXA 3IUSA 3ETDA 3GDGA 5EERA 1UAGA 1WNTA 4FOOA 1YL5A 1YH3A 1D1SA 3WLEA 1ZMOA 3WMWA 3H8VA 1X1TA 1RM5A 1R12A 4R54A 2I5PO 3NX4A 4EBFA 3ZWOA 3IP1A 3ZHYA 4NH4A 1MP0A 3DAGA 1EVYA 4KWIA 3L6OO 1SO8A 4FJ0A 4XEHA 1VL8A 2IRWA 1OBFO 1IY8A 3VVBA 4XKJA 4A73A 5C5IA 3ORFA 2JD0A 2H1SA 2Q1SA 4IPTA 1LLCA 2DBRA 2AEMA 1DIBA 4BB6A 4N54A 3Q2KA 4XRGA 4C7KA 4NBWA 1DJNA 2B69A 3ANLA 2O3TA 5KOIA 4JXKA 3UVEA 2Z1NA 1Q7GA 2FMUA 2PKRA 3AK4A 5JCJD 4RZIA 2PD6A 3RJ5A 2FRDA 3N74A 1DXYA 1OOEA 5K6AC 4YJDA 4CM7A 1MLDA 4PG7A 1S7CA 5KVQA 3OM9A 3FTNA 2DT5A 2DTXA 3PGXA 4H16A 4BO0A 4JNKA 4BKUA 4RO0A 4CM8A 3RUHA 2VUUA 1MXHA 4XGKA 2FPGA 2Q1UA 3AFMA 4XGNA 5FF9A 3S2IA 5JMPA 5ENDA 4BMNA 4BNJA 4ALIA 1V8BA 1X7GA 1BMDA 1QYWA 2DBZA 2GRAA 3HHPA 3M1LA 2AE1A 3R6DA 4Q3EA 5F3RA 3WNQA 1IUKA 2DPHA 4HP8A 4M1QA 1LSUA 1YBVA 3KYCA 4K9DA 1XQ6A 4PCVA 3B1JA 4HFJA 1GEEA 1Y9EA 3GK3A 3JD1A 3DB2A 4Z3KA 1T26A 3OBBA 4E13A 3BAZA 1HZJA 3FNHA 2BHLA 2VYVA 3QE3A 3KHUA 2D1YA 1LDYA 2PR2A 2WE8A 3PFFA 2IYOA 4QTZA 3GR6A 4MKXA 3JQ7B 4RDIA 1B3RA 5AVOA 2HDHA 3FR8A 1QYDA 1CYDA 3K5PA 3Q2IA 3R0IA 2EHDA 1HEUA 3ZNNA 3VPXA 2E4AA 3LT1A 4IMRA 3GRKA 3CZRA 1WPQA 1UZNA 1HLDA 1I3NA 1PZFA 3KEQA 2NVBA 3KUXA 1K3TA 3QVWA 4R01A 3IL2A 2JHFA 4D43A 3LC1O 4ZQFA 4J4TA 3CPSA 3RFXA 2IXBA 4BNXA 2DVMA 3D3WB 2CNBA 1I30A 2X4GA 3CIFA 3WSWA 1N8KA 2YZ7A 4HBGA 4QFCA 5FWNA 3W8FA 1P0FA 3B1KA 3FWZA 4GKBA 5G4KB 3RFTA 4BNVA 3SXPA 4CR8A 1JKJA 4DVJA 1HL3A 2FZWA 1NPYA 4WOKA 4XB1A 3ZHZA 2J5QA 3ZU3A 5KVCA 2A94A 4K26A 3G0OA 4WUVA 4RPKA 1YDEA 3AU8A 4UUPA 1W4ZA 3NGLA 1IL0A 1V0JA 4GQAA 4EZBA 1ADGA 3D7LA 4YAIA 3TJRA 4CUKA 2BKAA 2Z1MA 2SCUA 3JQ9C 5L7YA 3VOSA 2GPTA 1RM0A 5DDIP 2HJSA 1WAMA 3T7CA 4CLRA 4K6CA 1ZVMA 3ZW9A 3O26A 4ITUA 2FHSA 3G49A 1DFHA 4GGOA 4UEJA 4BNHA 3RU7A 1CF2O 5JDIC 1Y8RA 5A05A 1ADFA 2V7PA 3GGPA 3DZFA 3ROPA 4CUZA 4EDFA 4B4OA 1HXHA 2NU9A 3EHEA 3RJ9A 4OH1A 3H3JA 3IJPA 4O0LA 3UHAA 2FOIA 1DJQA 3EUWA 5BT9A 2VWHA 1UP4A 1GADO 5DP1A 1KC1A 3HN2A 2C7VA 1U7TA 5CPBA 4PZDA 1XYGA 5DOZA 4YTEA 4TRRA 1OI7A 3CTMA 2JFFA 4DC0A 4GSLA 1U3WA 1EFLA 4KTVE 3VKUA 1TEHA 1WXDA 2EW2A 3H5AA 1OAAA 4BO2A 5IDWA 1EDZA 4PIVA 4CL8A 3GG9A 4GH5A 2Q2VA 2ZTMA 3WGGA 1UDCA 5EQDA 3OA2A 5C3MA 3T4EA 1WDKA 2BGLA 2NLOA 3I6QA 5KTKA 1XG5A 4BO6A 5FI5A 1T2FA 3X2FA 4O6VA 1LI4A 4Q3DA 3W6ZA 1TVEA 1QSGA 1EVJA 3LK7A 4O5OA 3RBZA 1HDGO 3TZCA 3QVXA 3VTZA 3AFNA 1P9LA 4D45A 3L9WA 4J0EA 3A9WA 4XYGA 3S2GA 4A5OA 1P0CA 3LU1A 3DEYX 3DTTA 4R51A 4WKGA 1ENZA 2E48A 3K30A 1V3UA 1VSVA 5CG2A 2H63A 4AFNA 1LSSA 2O3QA 2YJZA 4Q3BA 2VUTA 1DIHA 1J0XO 3OJEA 4LISA 3D5QA 2IDZA 2J3JA 2BF7A 3FNEA 3CUKA 4L4RA 2W2LD 3OQ6A 3D0OA 4WOJA 1LSJA 4R3WA 4Y9DA 3CEAA 3KZVA 2PD3A 1RYEA 2IZ0A 4XRRA 3COSA 3ZCXA 1PS8A 2I9PA 3S2EA 4PLPA 5G0WA 4ND2A 3IOYA 1R15A 3JQGA 2VQ3A 4XR9A 1OMOA 1SCUA 2PD4A 3CMCO 3C7CB 3JQ8A 5CPFA 5BSHA 1ULUA 3TNLA 3DHNA 1U3TA 5EINA 1XDWA 5TJ9A 3TFQA 2Y66A 3KV3O 4U6SA 2OHXA 3RASA 1GFSA 1PJ3A 5BSEA 4CV0A 1E1NA 4MOWA 3H9UA 4P22A 4EUEA 1QMGA 4YPOA 4FC6A 5A9SA 2PZJA 4M55A 4R1SA 4WEOA 4HNGA 3WGYA 1WP4A 2HMVA 1FF9A 1ZSVA 4CMHA 1IPFA 3DBHB 3G3EA 4DC1A 2HU2A 1YOVB 4CMCA 1Z75A 3ZWMA 2DQ4A 1DIRA 1YO6A 5EQFA 2OBYA 1FXSA 5G0VA 5I9NA 3OFSA 3OMLA 2CFCA 1SEPA 3JYPA 3GVHA 4DYVA 5B1YA 2GO1A 3DBLA 2C5AA 3K8ZA 1XWFA 2ZYGA 4OXYA 1L7EA 4NK4A 2VRCD 4DLLA 2Y1OA 4ALKA 1HWYA 2FY8A 2C29D 4GMFA 1EUZA 2AQHA 1HTBA 1RKXA 1YWGO 2ZYAA 1XCBA 1LSOA 1GYRA 1YBAA 3U49A 2WMDA 4BV9A 3H9EO 5DCUA 4GX0A 3CH6A 4B79A 1TB4A 2EJWA 1PJTA 1YL7A 2HK7A 2X9NA 3VZSA 2OZPA 3ICCA 4AG3A 5JY6A 1QXSA 4KDEA 1KERA 4IGFA 2YHUA 3E8XA 5EIOA 3R3JA 4YT2A 1UDAA 1CQJA 2B36A 4GMGA 4TRMA 4CV2A 4TZKA 1QV7A 2W4QA 1DC5A 2HO5A 4PG5A 5TRTA 2PTGA 3JV7A 3TQHA 4MVJM 4B3HA 1X1EA 2I99A 3BHIA 1DB3A 3WYCA 5JW6A 3HE3A 1YB4A 2JFHA 5ICMA 4IIVA 3LVFO 4DYDA 3AUUA 4DL9A 2YV2A 4EUHA 1BGVA 3ZNPA 1XEAA 4I1IA 1NNUA 1XU9A 4B3JA 1H9BA 1U3UA 5B37A 1JAYA 1QLJA 4AICA 1D1TA 5DBGA 2D5CA 3SX2A 4MVJD 2VHZA 2P4HX 4N18A 1GR0A 3DMYA 2VRBA 4IQ8A 2B0JA 4RGBA 3WXBA 3DOOA 3WICA 1GTMA 4ALMA 5ILOA 3PPIA 1BW9B 4QSMA 3TN7A 2GSDA 1PQWA 1GY8A 1VE9A 4OM8A 4RPLA 2UUOA 1V6AA 4NNJA 4TROA 3GGGA 5T6BA 4OXKA 5ENVA 4E3ZA 2QYTA 1E3WA 4ZD6A 1CQIA 1GCUA 3TOXA 1QYXA 5A9RA 4F46A 2Z5LA 1F17A 1KVUA 2JCXA 1YVEI 2VN8A 2YHIB 3DBRA 4J4HA 4DQXA 1P31A 4NU5A 2R00A 2V65A 1LQUA 2BLLA 1Z73A 2NQ8A 2NTNA 3JQAA 1SPXA 4OO3A 4WLUA 5CHEA 3VAZA 1EUDA 4DLAA 2NSDA 3EDMA 3P19A 1ARZA 1GYPA 3PLRA 2D2IA 4Q3NA 3MJCA 1G0OA 3U4CA 1JVSA 5B4TA 4WLNA 5JAMA 1K2WA 1KVSA 3MCVA 1NPDA 1EFKA 1PIWA 5COAA 1E1LA 1U2GA 3V1TC 3DFZA 1ZK2A 1ZJYA 4J7XA 3I9MA 2O50A 1U5AA 5K9ZA 2CZCA 4IXWA 3ZWWA 2PK3A 4DPLA 3LT0A 4WCFA 4CQLA 3ETGA 1E6UA 2GLXA 1KYQA 1NTOA 4FQ8A 4A10A 4YQZA 1B15A 4CQMB 3DC2A 2QX7A 3H2ZA 4CODB 1YQXA 3GY0A 3U09A 2DU8A 3RAJA 2I3GA 4BNZA 4LRTB 1DBVO 3K96A 3PEFA 4HUJA 1B0AA 2EKQA 2Y1CA 3FBGA 5TLSA 3CINA 5L4NA 1KC3A 4CLEA 4YYZA 3PP8A 4CV3A 3PLNA 4XQEA 5DULA 4LVCA 2GZ3A 1NAHA 2YDYA 4U6QA 5COBA 1KVTA 4F45A 1BTOA 3ZWBA 3QVSA 1UJMA 4JK3A 3WS7A 2VCYA 1P3DA 1JKFA 4BGVA 3NJ4A 4W7HA 4L0QA 4RL6A 4KUEA 5IZ4A 1C0KA 2VZ8A 4IINA 4GAEA 4HADA 4EI2A 5F1PA 3UKOA 1X7HA 1K6XA 1JLLA 1Y5MA 5DNAA 2DTDA 4IJUA 4J9VA 2NU7A 4FD3A 1C0LA 1NXQA 2IODA 2XXJA 4BO3A 4DWVA 3FPLA 4I9UA 4E6PA 3ZV4A 1VI2A 4YBZA 4DTIA 5LDHA 2HAEA 1HSOA 1WMBA 3D5TA 1I3LA 1Q1NA 2ZB3A 3OIFA 1YJQA 3JQBC 3JSAA 1HDRA 3OA0A 2Q3EA 1H6BA 3A4VA 2I3AA 1YRLA 2X5KO 3TRIA 2YFQA 1T1RA 5JDIA 2DLDA 3K6JA 5EN4A 1NM5A 2E49A 3PI7A 5A06A 4OJNA 2RAFA 1LLQA 1MFZA 2HMUA 3EC7A 4M54A 3L9XA 1BHSA 3BA1A 3KLPX 1ZK0A 1HE2A 3JQ9A 1P74A 2VYNA 3CMMA 1ZUD1 1WMAA 1LQTA 1YOVA 1PJLA 4IBOA 4Y67A 5C7OO 3L77A 1ONNA 4MVJA 4FFOA 5TS3A 2OUIA 1PJ4A 3QWFA 2C2YA 3ONEA 3JTMA 4XR4A 4JBHA 3DO5A 1B8UA 4UREA 3O8QB 1BXKA 3KSUA 3ETEA 2HLPA 4HX5A 3MJEA 1GV0A 4DXHA 1KEUA 1GQ2A 1E7MA 3Q0EA 1PGJA 4NI5A 5T8KC 3WTBA 4OAQA 2X0NA 2P4QA 3FSRA 3M1AA 4YVFA 2EKPA 2CDAA 1ML3A 3FI9A 3IS3A 2EKLA 4RF2A 4R5MA 2GN4A 1KBZA 1NWHA 1FDTA 2OXIA 3OEWA 4W9NA 2PKQO 3MTGA 3G1UA 1V35A 5G4KA 1HKUA 4MINA 1U5CA 4WLVA 2Y93A 3JD2A 1ZO8A 1A5ZA 3VZQA 1G1AA 1GUYA 2DAPA 4JJGA 3KM0A 1T25A 1WDMA 3I5MA 4CM4B 2YQ5A 5KVVA 4EW6A 1I2CA 4YJGA 1VL0A 2B4QA 3ZWAA 1PGQA 3W4IA 4ZA2A 2ZIZA 3HJAA 1XLTA 2POQX 3ULKA 5I9MA 4ZVVA 3TWOA 4YT4A 2PZKA 1Y1PA 3I3OA 3KOUA 4YA6A 1ULSA 3O38A 5H82A 3W8DA 4EEZA 4QECA 5F5NA 1LLDA 3AOGA 3L4BC 1UP6A 1GYQA 4D0RA 3PJGA 4CLOA 4HNHA 3C1AA 3DHYA 4A7PA 2WD8A 1X0XA 3N7UA 2NWQA 1UXJA 3FPCA 3DZGA 3Q3CA 4R68A 1GUZA 1PR3A 4YJFB 1E3JA 1C0PA 1I3KA 3GFGA 4NIMA 3S8MA 2O4UX 1SAYA 1T24A 3NDRA 4E12A 1ONPA 2Q4BA 1JU9A 2X8LA 4RVDA 4K28A 2DUUA 1TT7A 1I24A 1O6ZA 2YY7A 2YHIA 1XGKA 3DBRB 1Z82A 3GRPA 4KDFA 1H6CA 3FWNA 4L4SA 5JE8A 3UW3A 3WGZA 4E5NA 1YS4A 2GNAA 4NU6A 2GASA 1LC0A 4QQRA 3SEFA 4FB5A 5A1TA 3JD3A 4LGVA 3INTA 1D7OA 2QRJA 3NJ8A 4N5LA 5JYEA 1VLLA 4Z6KA 4CL3A 2R2GA 1DEHA 1U8FO 5DP2A 4IM7A 5AXDA 3ZWCA 4E2YA 5T64A 3FTPA 1MUUA 4JN6B 2YV1A 4YXFA 4OIMA 1H94A 2B83A 4FFRA 5IF3A 3GNTA 4BO9A 5L4LA 4BHTA 4FOSA 4FBGA 5B4UA 1H6AA 3GH3A 3GOHA 3INGA 2WSBA 2X5JO 3GUCA 1GD1O 4NJOA 4EJ6A 3QWAA 2EP7A 1SB9A 4ZU3A 3OF2A 3EYWA 6ADHA 3U5TA 4IMPA 4CM5A 1W6UA 2VWPA 1E5QA 2GZ2A 2QRLA 4MP6A 1R0SA 3A14A 3MJSA 2PFGA 3JYOA 3HFGA 4BQRA 2YUTA 5C7IO 3MZ0A 2BGMA 4IDCA 1O9BA 4Q3CA 4NDNE 3JYQA 3LLSA 4QFDA 1W8DA 1SEVA 4GX1A 4DIBA 3Q11A 5A03A 5A5EA 1GV1A 1ZCJA 2O2YA 5CP8A 3RUCA 4IDFA 1MG5A 3GEMA 4ESOA 1GZ3A 2DFDA 2WD7B 4GI2A 1DC3A 1NR7A 1DLIA 4U0KA 3ZU4A 4ZQGA 4PLWA 4OSPA 2P9EA 2VHXA 2LDBA 4YB8A 1B3BA 3ZHBA 4XYLA 2WEKA 3LDHA 4UULA 1MB4A 3C24A 1GU7A 3RSHA 1YBMA 2GYYA 4E5KA 1AUPA 3PGJA 4ID9A 4XCVA 4B8ZA 2XAAA 3BYZA 1ENPA 3IMFA 4UVEA 4BNWA 5CDTA 1VC2A 3JQBA 1T4BA 1HDXA 4IXTA 4PZEA 3VDRA 4XYBA 1C1XB 3K73O 5L53A 2HK8A 2O3RA 3E1KA 3GT0A 4RZHA 1RWBA 3ZV3A 4YACA 3GN1A 5JNLA 4J2OA 1BDBA 1UZLA 3P7MA 1B26A 1A7AA 4KZPA 8LDHA 3H9GA 2Y99A 4HY3A 1LDNA 4GLLA 4XGIA 1ZJZA 4WNIA 1EK5A 3MOGA 2GN9A 5KJCA 3JQAD 2PA3A 2UV8A 1OC4A 4JJIA 1H2BA 2J3HA 1HE5A 4J6FA 1LDMA 1WLYA 3IUPA 4BKQA 1PR9A 2Y67A 1F8FA 3BMQA 3GEDA 3QLJA 1YE3A 1Q7CA 4P38A 3BXXA 3QSGA 1T2AA 1PEDA 5BNFA 3FHLA 4AJHA 2EJVA 3TZHA 1LEHA 3NEPX 5CDGA 3QV1A 2RH4A 3UAGA 3PRJA 3K31A 5GY7A 3RBXA 5G0UA 4FGWA 3VPHA 4TKLA 1IPEA 1BSVA 2JJYA 1EQ2A 4BKRA 3PFWO 2NACA 1IHXA 3OJ0A 4RJTA 5FFFA 2X0JA 5JAQA 4BNIA 4ZRMA 3JQEA 2O48X 3K2BA 3PIDA 1P1HA 1IE3A 4II3A 3ZW8A 3F4LA 3HADA 1PX0A 4NHEA 3G1TA 4FFMA 5IN5A 4K6FA 2C5EA 2VHYA 1ISFA 1N9GA 3NKLA 1PS0A 2OORA 1LUAA 3EZLA 4WLFA 5JC8A 1TXGA 2HKIA 3OQBA 4UVGA 3LYLA 4GX2A 1PZGA 4BGUA 3AU9A 4JP2A 5G2OA 3OETA 4B7XA 4XX0A 3GAZA 1PJCA 3DOJA 2FR0A 1K6JA 1IZ0A 4JJFA 4PGFA 5KCZA 5BQFA 1AN9A 1M76A 2HRBA 2JAPA 4NBTA 1KETA 3Q9UA 4NJMB 1XSEA 5EMHA 2AHRA 1VSUA 4UVHA 1P1RA 4D3SA 1CDOA 5COQA 2H6EA 1DIGA 3S1LA 3B6ZA 1JW9B 1A7KA 3EZYA 2AQIA 5K0ZA 1HDYA 5L7TA 3SVTA 3F9IA 4ND5A 1PGNA 3PYXA 3RUDA 3ON5A 1DLJA 5JCJA 2JCVA 1T2EA 4KMSA 3ABIA 1FDVA 4DA9A 4GKVA 4MVJG 4Z0PA 2CSUA 4RLSA 2ZB4A 4MP3A 3F5SA 3ASVA 5I8ZA 1KOLA 1ISJA 3WR5A 4BGIA 1VKNA 5IXYA 2Y0CA 1R0KA 1U3VA 4DPMA 1CETA 4IZHA 3SLKA 3RWBA 4IUYA 3AI3A 1U2DA 2NTVA 4XDZA 5U4QA 3K92A 2H5LA 3VDQA 1JA9A 1T2CA 2QYSA 3BHJA 1YKFA 3VH3A 1JN0A 5BSGA 3X2EA 1B7GO 4Y6SA 4BQPA 3RFVA 1K5HA 4J1QA 1LDEA 5F1KA 1FDWA 1ZZEA 1ZNQO 1HF3A 5JPIA 4CM3A 4OHUA 3SC4A 4AJPA 4KQWA 4WCDA 1IYZA 1EZ4A 2DFVA 3I23A 4BS9A 5L95A 4W6ZA 4O63O 5L45A 3BMNB 1M75A 1F06A 1DC4A 3RI3A 4ND4A 1ZK3A 3GUYA 2X9GA 1O5IA 4FCCA 2IE0A 4DMLA 3EY4A 3QA9A 2W2LA 3KTDA 1MFPA 4CLRB 1MC5A 4M87A 3GF4A 5J23A 3ZWVA 3QY9A 4JP3A 2OGUA 3I9OA 4OL9A 3VHRA 1BG6A 1NQTA 4K1LA 2F1KA 2QIOA 4GL4A 1ZW1A 5I7SA 2RCYA 3NYWA 1Y5RA 1K6IA 5BR7A 1SOVA 4JLWA 3AI1A 5LCXA 1ZH8A 1I36A 2ILTA 2NM0A 3I9LA 4RVSA 5AXAA 5DBIA 4D42A 3V2HA 1R4MA 1NYTA 1PWXA 2FP4A 1NR1A 3D3EA 3ZH2A 1HDOA 5ICSA 4J1TA 4OOFA 3VPFA 1DFIA 1R37A 1ZIDA 4Z3DA 3ZI0A 4RPGA 1Q2XA 4L73A 4ZQHA 1DRVA 3KXDA 4LRSB 3G79A 2VWQA 3GHHA 4I08A 3Q9NA 4DREA 4J0FA 3RC7A 3OJFA 1AHHA 3ROQA 2C7GA 4HFMA 3VKVA 1Z45A 3VPSA 4G5HA 5B4VA 5L40A 1VRWA 1DPGA 1E3IA 3PWKA 2Y1EA 5T5QA 3H5RA 3T7EA 1H93A 3NDJA 1XR3A 4ZGWA 2TMGA 1ZXBA 2A35A 3WYEA 3WLFA 3ICPA 3HZZA 2UAGA 3OJOA 2FPIA 4P8RA 1ZEJA 4GWGA 1JKIA 1PJSA 1PL8A 2C82A 2CF5A 2EG9A 5HS4A 3O4RA 4BVAA 3CE6A 3SJUA 1ONOA 3ONDA 4OKIA 3BTVA 3MWEB 4PVCA 1I8TA 1CJCA 3OECA 4BUCA 3H65A 3E18A 1YB5A 3F4BA 5DZSA 1BVRA 2GUGA 2HMWA 3OH8A 2CVOA 2P91A 4WNCA 4Z0TA 1RJWA 1O8CA 1MV8A 3GFBA 4YT5A 2I6TA 5AQ1A 5TC4A 3BMQB 4YR9A 1BVUA 3MJ4A 3L07A 2Y68A 2NVUA 5C37A 1JQBA 3JQ8B 1Z7EA 2ZB8A 1YXMA 4ZICA 3F47A 4NPCA 1NQOA 5TGDA 1F8GA 2IZ1A 5DCYA 5AXBA 1J5PA 1CRWG 4FFNA 4IDBA 2P5UA 4MVJI 1A27A 3V2GA 5A9SB 5MDHA 3E5RA 5IN4A 4RVHA 3GA0A 5A4DA 4WLOA 3RBVA 3OICA 2Q50A 4RLHA 4R9RA 1H0KA 2D5AA 1A4IA 1DHTA 4PRLA 1ISGA 1HE3A 3GDOA 4PVDA 4CJXA 3DBHA 3A06A 1C1DB 1E3LA 1N9GB 1U1IA 3K2EA 3LT4A 4R1TA 4Y8VA 2G76A 3A28A 4LK3A 3TL2A 5IAAA 1PQPA 2DPGA 2JHGA 3OEYA 4PRKA 3W6UA 3CSDA 1UZMA 3WQSB 5DN9A 3OIGA 3RKUA 5T57A 3QHAA 4IJKA 1MXFA 2WM3A 5F5LA 5TT0A 3L6EA 2VZ0A 4E2ZA 2ZCVA 3GQVA 4TWRA 4CMIA 4AJNA 5KJFA 2EWMA 2IEBA 5GZ6A 4MVJE 4UVIA 3V1UA 1EBFA 4UUMA 2PH3A 2WWRA 1I2BA 2YDXA 3MEQA 4U5QA 3UOGA 3WGTA 3C7DB 3I83A 3IJRA 4PLTA 2V6FA 3DHEA 1BXGB 1N1GA 4GSKA 1KEPA 4N5MA 1O89A 2HCTA 1OFGA 2E37A 2VOJA 4GX5A 1QYCA 4BNTA 4DGSA 4CMGA 1B2LA 2BH9A 1DIAA 2ZTUA 1AXEA 2VNSA 3KB6A 3H2SA 4R1NA 4JX8A 4NFSA 3GGOA 3L4BA 1X13A 3ENKA 3ZV6A 5TF4A 4HXYA 4RCVA 5JO9A 5IZCC 2Q46A 1ID1A 2G0TA 2X86A 4OYRA 3NTRA 5AXCA 4IDAA 1N5DA 3NGXA 1NVTA 3GVXA 4PZCA 4IDDA 3D4PA 4P4LA 3WJ7A 4MDHA 3C1OA 1TA4A 7MDHA 3WGIA 2E6UX 3UXYA 2B4TO 2J5RA 1E7SA 5TQVA 3S2FA 2XOXA 3BMOB 1UAYA 2NTJA 1I10A 1Q7BA 4I9HA 3ZWXA 5JCXA 2G82A 5GZ3A 5ITWA 5F1OA 4OXNA 4ZN6A 4CLHA 1WDLA 3OQ1A 4MP8A 3WGOA 1HYHA 1JTVA 3GDFA 3RC2A 3W1VA 3WQRA 5JFOA 1VKOA 4DUPA 2O3JA 2D0IA 1PU2A 4NFHA 3GG2A 3NDIA 3NT5A 3PJEA 1EVZA 1Y8QA 4ZQBA 4MVJF 4FN4A 1ZSYA 2ZTLA 4AJ4A 1E3WB 3LLVA 1VL6A 4YRDA 3TOZA 1FJHA 4OSOA 3KYBA 3RROA 5U9CA 3QW2A 3PYLA 5ILGA 1MGOA 3JQAB 4MPDA 2DBQA 2RIRA 1FDUA 3KVOA 4GVLA 4N5NA 5TJHA 5ADHA 2GERA 3RIHA 1O0SA 5KNLA 2Z95A 3AY6A 4R41A 2NU8A 4CMEC 5DT9A 1LNQA 1QR6A 2W2KB 4O1MA 3WIEA 4DMMA 2PV7A 4RF5A 2RHCA 4B7UA 2GR9A 2VTDA 4URFA 3WSVA 5IDXA 4UVDA 4AJJA 1NX6A 4Q39A 1I0ZA 2VZ9A 4PLHA 4XYMA 2GN8A 3GAFA 2GCGA 4TZTA 4E30A 8ADHA 2E82A 2R6JA 3I9JA 1N2SA 4ND3A 5K6AA 2IZZA 3QWHA 1UXHA 3U4HA 4IJVA 5IJZA 1B14A 1Q0QA 5JC1A 4DBZA 4NFYA 1P44A 1E6WA 4L76A 1XA0A 4CM1A 4E32A 5CEJA 2BFMA 1Y6JA 2Q4EA 2EF1A 2O23A 4IJWA 3GVCA 2HJRA 4RV9A 3D64A 2FR8A 2ZKLA 4MJLA 3CKYA 3OIDA 3JQGB 1GQQA 4YT8A 3H4VA 4TKMA 3EAGA 3U62A 1GZ4A 3NTOA 1LX6A 4EYEA 4UAGA 3UCFA 1P1KA 3RU9A 4GBJA 3AW9A 2O4CA 4RQTA 1IHYA 4J1SA 2B5WA 4I5FA 3HDHA 2D3TA 2W98A 1LRJA 3RD5A 2JKVA 4RDHA 3TZKA 2VT2A 4W7IA 3TZ6A 5A02A 2Y1FA 4ILKA 4J90A 4BV8A 1V3TA 2GD1O 4TRNA 3RVDA 1QG6A 3ADPA 1X14A 4PFJA 3D4OA 4MO2A 2DM6A 4Z9YA 1SB8A 4DQVA 3HSKA 3DBLB 1PJQA 4B8WA 3QVOA 3RUEA 1DHRA 4PG4A 4TQGA 9LDBA 1QP8A 4ALLA 1R4NB 1M66A 2CMDA 2X1HA 4LSMA 3EK2A 2WYWA 4FFPA 1XKQA 1M6WA 3JYLA 3ITKA 3PHJA 2WYVA 1LRLA 4LMRA 2CVQA 3H7AA 3HWRA 3S55A 1G6KA 3LC2O 5L51A 3UGKA 2EERA 1LC3A 4OMUA 4LCJA 4CV1A 1U28A 4XZ3A 1XIVA 3DXFA 4B7CA 3P2YA 2ZQYA 3FRJA 4EJ0A 4HFRA 2GF2A 1C1DA 4R9SA 5JLAA 1GPJA 4IY1A 3WMXA 4G2NA 2QQ5A 1R6DA 2RH8A 3JQFA 1E6EA 3WTCA 3O8QA 1NWCA 3UUWA 4CM6A 3GZ4A 3TPCA 1LRKA 3HNPA 3ZNOA 2YFHA 4EJMA 5I8WA 1U4OA 1EMDA 1NP3A 4PLGA 4BMSA 2XF8A 3ZGYA 2VOEA 1GEGA 1YQGA 4CMIB 5BSFA 2GZ1A 4E21A 3QJ5A 1GUFA 2AQKA 3OJLA 5H83A 2CUKA 4WASA 2VWGA 3DR3A 5G0TA 3LC7O 3WQQA 4MIOA 5GZ1A 1C0IA 2J5KA 2JCYA 1ADCA 3AUTA 3HUDA 3PHIA 5ER9A 4OQZA 3PK0A 1LA2A 1BW9A 1GZ6A 2BFAA 5KJ1A 1DSSG 5H81A 3MJVA 2ZJ0A 3JQ6A 3ZNQA 4J16A 4YDRA 3UCEA 4LVUA 1PGOA 2BI8A 1QORA 1WWKA 3KO8A 4EGFA 3DZKA 3OHSX 4I5EA 4AL4A 1N7HA 1NBOA 5JAZA 2CY0A 1NFRA 3MJTA 3RC9A 3OSUA 5JDCC 3AOEC 3BTSA 4BKPA 1D8AA 2A92A 4PLYA 1VPDA 3RUFA 1Z7BA 4UEKA 1I3MA 4WECA 4D41A 5JSFA 3NV9A 4YRBA 4L75A 1EVIA 3HN7A 1HDZA 3HG7A 5L4SA 5CDUA 4PLCA 1DAPA 2W90A 2ZYDA 1YGYA 1H9AA 2X9VA 2AG5A 4ALJA 2DKNA 4FJ1A 4TVBA 4X54A 5HTOA 1JAXA 4LCEA 5A5FA 5CG1A 2AEFA 1N1EA 3U0BA 2VRCA 3E6AA 4D3FA 4BNNA 2V6GA 5KKCA 1NVGA 2C54A 4YQYA 1F12A 4A03A 2AXQA 4CM9D 1NAIA 2PY6A 4WLEA 5CFZA 3TF5A 4C7JA 3WNVA 2DUWA 5IDYA 3PXXA 2PWZA 3PQDA 4U0JA 1WW8A 1RPNA 4RF4A 4DBVO 1T2DA 4RF3A 3JYNA 1E3EA 3FCOA 4NBUA 3RUIA 3U9LA 3KYCB 4CQMA 1U7HA 1M67A 3WJAA 4E5MA 4LMPA 3WB9A 3WBFA 1NPTO 1PJBA 4WK6A 5BNTA 4XQ9A 1ZBQA 5JDCA 3DZBA 3V8BA 3FD8A 3AY3A 2ET6A 4BO8A 3G17A 1PZEA 4IGEA 2B37A 4FDAA 1SMKA 5IFLA 3D1LA 4XIYA 2VTEA 1A71A 4B3IA 3NTQA 3GHYA 4IQGA 3ZZNA 3PHHA 1B8VA 1LBEA 3AM5A 2P9CA 1I2ZA 1J49A 4BMVA 3FF4A 3PHLA 1I5RA 2GN6A 2Y0DA 1DFGA 4MVJH 4IIUA 1E92A 2A4KA 3BMCB 4OKNA 4CMAA 2NQTA 3D3WA 4QUKA 1T4DA 3WGHA 1A72A 3ITDA 3IKTA 3KLMX 4I5DA 4TMFA 1NFQA 2OO5A 5JYDA 2EW8A 3HB5X 1QYVA 2OBNA 5HS6A 3INRA 3TSCA 4LN1A 4CUJA 2IEDA 4H7PA 4J43A 4NQZA 2VYND 3B1FA 2BELA 3FR7A 3LQFA 4M89A 4MVJP 3ST7A 3AI2A 4Q9NA 3GEGA 3JQFC 4RORA 3GC6A 1HSZA 4TVOA 3R3SA 2EGHA 4FIZA 1ISMA 1E3SA 4YRAA 5HM8A 3DAPA 1WVGA 1EE9A 4CR7A 1R0LA 3ZWYA 2DBVO 3H9QA 4CLDA 4WPGA 1Q0HA 2Y1GA 3PIIA 4CMBA 3SLGA 2I76A 3KSDO 5FI3A 5ER6A 1P1JA 3ZWPA 5CEEA 4FS3A 4ONEA 5I7EA 3B20A 2PGJA 2WD7A 4QXMA 1XHLA 1ENYA 2VHVA 3NRCA 2IYPA 3WIDA 1R16A 4WGGA 3AM3A 1NVMB 2RHRA 2J8ZA 2C2XA 1I01A 2P68A 2ZJ1A 2J3KA 1Z74A
chains in the Genus database with same CATH superfamily
3HACA 4IUDS 3TR6A 2Q45A 1OH8A 4JHXA 2CNKA 4IF4A 4GNKA 5U1PA 4PC2A 2IHYA 2CD9A 1YIOA 4JJ8A 3IXMA 4IVQA 5HKAA 5HPYB 4FWBA 1S1CA 3B9BA 2C42A 3WYDA 4YCLA 2FUG6 3H8JA 2H2IA 2LWIA 3RC8A 1RM3A 5FBLB 4QBIA 3OUUA 4ALNA 3SZRA 3M82A 2ID4A 3OLXA 3QLVC 1UXGA 3TDKA 2WYOA 2GCEA 3QXJA 1F0YA 2R1ZA 3CKKA 3IP8A 4POAA 1GGNA 4DB4A 3GMDA 2CV2A 4X62B 4AJIA 4MYCA 2PUVA 4QULA 1GCOA 2ZDGA 1VBMA 5B1SA 5K8TA 3OPQA 2HYIC 1SOMA 1YJ8A 2WSIA 1P33A 2X40A 2YXNA 1VHQA 3U17A 3NBYC 5GJWC 3DQQA 2H59A 3IIEA 4PX9A 3EPRA 3CZ4A 1ZMTA 4F84A 1D2GA 1QLHA 1RWNA 4G97A 4FYIA 2P6MA 3IQZA 3EIWA 1JPJA 1L4GA 4M98A 1BKDR 1ZSNA 3QVMA 4I9GA 4L4XA 3VTFA 2G70A 2CXOA 2W6ID 3OEHD 5HOEA 1JE0A 5E8JA 4TSFD 3RO7A 5FI1B 1YJBA 3HVRA 1E7WA 1N2CE 1RRCA 3PFBA 4HAVA 1Q0SA 1CUFA 3EGOA 3DMFA 1PR4A 3FLBA 3LSYA 4CNBA 4UNRA 4ZJUA 5CVTA 2IHTA 1J1ZA 2I4OA 5DXAA 3VC1A 2JFQA 4AJEA 3HB7A 1A8QA 3WB2A 4DLSA 4DANA 2JHPA 1YJXA 3FSGA 3IELA 5A62A 3PS9A 3U4QB 1E1QA 3WL3A 2Q1XA 4F0JA 5L6LB 1AGNA 1D2HA 2QVXX 5FNZA 4BNDB 1VZ2A 1AM4D 3O47A 3BEDA 1XD8A 5G3YA 3SICE 1NVFA 3R09A 3TCXB 1SCKA 2JJMA 3QXCA 1E6MA 5AYVA 1GDTA 4NCAA 4R0VA 2CJXA 4D46A 3ESXA 2FN4A 1M1ZA 3FHCB 2N1MA 2YWJA 2FSVA 3HYCA 2L82A 1HY3A 2H2WA 3Q6IA 3OT1A 3HEAA 4B09A 2VSNA 3ZCPA 2H1LA 5KIAA 4II2A 5DI3A 4Q21A 3ZX4A 1MENA 2BMWA 2NO9A 4QT0A 2W83A 4F96A 3RKRA 3DWFA 4FT2A 4BGDA 1WZEA 4WFQA 5J3JA 1M1NB 4QYWA 4HXGA 2RHMA 4FI3C 3CU5A 4WD3A 4WJZA 3MWDB 4RLFA 3C6XA 1JGTA 2B4AA 1GAQA 1Q0ZA 3L0DA 3L7JA 5FL3A 2RHBA 2XUGA 3BE4A 3DZJA 5LD2B 5CB4F 4FNOA 3WV5A 4E2WA 1AO3A 2ST1A 3N8HA 3W1EA 4D3XA 4B4DA 2J85A 3F3SA 4GPTA 1Q0PA 1E94E 4QBKA 2X5OA 5DV9A 2FFHA 3O83A 4KSYA 1EE2A 1GPWB 2I71A 4NYIR 5BSUA 3NIWA 4RENA 3SCZA 4RTLA 3SPXA 3I5AA 4I36A 1JI3A 4RXUA 4L8WB 2TMDA 4URXR 1QKKA 3UY4A 3TTXA 1EFCA 2D00A 2RGBA 1ND5A 1EHYA 2IEZA 5KTRA 2G9ZA 4EKNB 3KJHA 3HNOA 4K9SA 4JLJA 4IKPA 4REMA 3I1JA 4P4UA 4ZT5A 1WHSB 3RS4A 4FHEA 2EGUA 2BD0A 4KPEC 1OXMA 1G17A 1F8YA 1TT5B 1P0IA 3E8SA 1TO1E 4ZAZA 4BIMA 3J7AC 2OFFA 1YZGA 2B6HA 3O8LA 3PVZA 4D6PA 2H7YA 4WE3A 4ZJZA 3FOAA 1X74A 1ZA2A 3K5WA 1LVUA 2W2NA 1TZCA 1GNQA 4OLHA 2PGXA 2FWMX 3HGTA 4INAA 2Q2WA 4DQ0A 2B2NA 3D3KA 5HA5A 3WKCA 721PA 3ICWA 3P8ZA 4KTTE 2R11A 4HKTA 1PEAA 1VHJA 4EZIA 5DNCA 4URZR 1E63A 2PUBA 4KQXA 1X8KA 4TSKA 4YRLA 1A9TA 3MWYW 3QVUA 1FP7A 3RARA 4AJOA 4U39A 1MDBA 1PJ2A 3BCRA 4IHAA 4ENRA 2ZJAA 1ORTA 4P5DA 1ORHA 3JW8A 4CMJA 4PBRA 1CRPA 1P77A 4ZCRA 2CL6X 4EI8A 2O2EA 4YUAA 5GOTA 3TB4A 2Q9BA 1OJLA 1U9JA 2CMFA 2ZAIA 3G5UA 1E8NA 1NJ8A 4W99A 5EUMA 5FTWA 5TEWA 3USES 2HRDA 4EJSB 1JWBB 3V2UA 1P1FA 4E31A 4GPBA 3JR7A 2VDJA 1QG0A 1AC5A 1U7DA 1XLUA 2F1JA 3STWA 4D3ZA 1XRPA 1NHWA 2AXEA 1Q95A 2G0NA 3VUEA 5H3CA 4Y9RA 4PICA 1JHMA 5D2CA 2PDAA 4WV3A 5THXA 5H3LA 1Z4KA 1HG0A 5IJWA 1JSCA 4A6DA 2JLXA 3NC0C 4MX8A 3N7UA 2Z6AA 1H2EA 3M3PA 3ND6A 3EVTA 4HRYA 1NVXQ 3TBKA 1GOTA 3WHKA 2F2TA 4U9IS 1OFHA 4ZI3A 3ZWQA 3HXOA 4L9RA 3L0PA 2GVNA 3DZDA 1DDIA 1BEZA 3RAEC 1YV9A 1XMQB 3IEUA 1X87A 5J4HA 4EG7A 2QMYA 5EGSA 5EPUA 5TE9A 1PL6A 4RV4A 2OV8A 3U4DA 2PGLA 5A6SB 1WW3A 3TVYA 1VCNA 4CIXA 4EITA 3U3MA 3IVGA 4LXIA 1OX4B 4UU8A 4RZSA 1PKEA 1I33A 1SIBE 3GGCA 4KBGA 5HBRA 4G65A 4BVLA 2ZSDA 5H4GA 2DR0A 1FVOA 3C5HA 1KJYA 2C5SA 1AS2A 1KSFX 1Q22A 1IPHA 3R44A 4W9NC 2YZGA 4J7UA 3NKVA 3OE7D 5CITA 3FCYA 5LJIA 1M1YA 1U8CB 1QLWA 2BBTA 1NOKA 2ASEA 2AHOA 1HRDA 1AE1A 1OA0A 3FDFA 3A70A 3LOPA 1FUYB 5IUKC 2Q5LA 4JYCA 4KRXA 5T8KA 1DX4A 3WIUA 3IALA 4RHFA 4IXDA 1PNOA 3RREA 2YXLA 1VP3A 4NECA 3VYUB 4MEJA 2VXCA 1KRHA 1W73A 3I2HA 2Q28A 2O2SA 4Z5XA 4XTCS 3OO0A 2GN2A 3N2YA 4I3HA 4K5QA 3AEKA 1YQDA 4BXOB 1ZY2A 3N2ZB 3VU8A 4MEBA 1Z9BA 3SDBA 1JAIA 2WJPA 4C03A 1SU4A 3RC1A 2WR8A 3NM4A 3AKZA 1MX5A 3GPDG 3S29A 2W6IA 3OEHA 2VH2A 3H1GA 3QWBA 3KAJA 4H17A 2JKZA 4BOYA 2RC5A 3N9IA 5A9TA 4Y6PA 5P8WA 4MUYA 1J6UA 5IRCD 4QZVA 4MH0R 3J81A 4RZUA 2B5VA 4P54A 2P0AA 1S89A 5EWMA 4R2KA 1RACA 1YAHA 1NRXA 3MSXA 1FYEA 3RFCA 2IZOA 2WYHA 1ZVQA 2C78A 3IGFA 1AKRA 1R00A 2RAPA 4IGAA 4ZHQB 1X8JA 2Q41A 3UG7A 2C5LA 1MG0A 2RGGA 2QDXA 1ZU4A 1JJFA 4LWZA 3SDZA 4F1JA 2NVUB 3HU3A 3N5KA 3KETA 1DC6A 5CW1A 3L7OA 2IWRA 3L04A 1WU7A 4E5PA 2QHXA 6Q21A 3F7MA 4XJTA 5FIUA 1LBIA 1F4PA 2BEKA 3Q3JB 5B3JA 1LF0A 4BUJA 4EI7A 4DEYA 5FAXA 4IMJB 4HAOA 2HMSA 4MS4A 5AMXA 1HI9A 1VFNA 1TLTA 1E9FA 5B3LA 1L7AA 4RHUA 1KE2A 3LVRE 3BTUA 1FTYA 2WWXA 3BICA 1E1KA 2XHEA 3PWTA 4HYQA 4KWCA 1J5EB 2UYYA 2DOKA 1KY5A 1O95C 2NYAA 3A3OA 3AY7A 4UKDA 2FR1A 3T0IA 1X80B 5EPOA 3ZGOA 4MIEA 4LC0A 2J6HA 1X6VA 1JQEA 2W93A 4RVFA 3RIGA 4E4YA 4QAJA 1Q0LA 2E4XA 1VCIA 1GQFA 2CNNA 2C5FA 3IAEA 4ZO6A 4JELA 3VFDA 1HNNA 1UM9A 4YJ3A 3C8HA 1R27A 3VYTB 1CS4C 3ZCQA 3A8TA 5ARCA 5AJWA 1IOVA 3W3AD 3AC0A 3DL2A 2R6R1 3ENWA 4JBIA 4B0PA 5KTNA 2IXEA 4RHTA 4F9GA 4UQLA 3E82A 4JI7B 4M9RA 1G6OA 3TZLA 2I33A 1A98A 2RHWA 1IWOA 3LI2A 3VX3A 2H1OA 3GJYA 5HNKA 1W0KD 3LOQA 2GCIA 2JGFA 1ZJ4A 4Y1RB 1XU7A 4ND6A 2UXBB 1I13A 5CBKA 3SXJA 1B93A 5DCLA 4Z49A 1IJEA 3M3HA 2I6GA 1NNLA 1ST3A 3TOVA 4L57A 2RMKA 1VGVA 1ZIPA 1WQ1R 1FE8A 4P7BA 1RLUA 1NZDA 4WFJA 1SUIA 3PJDA 5LQSA 3I61A 4WJLA 4DCTA 3I8OA 1SBYA 2OVBA 4NK5A 4ZJPA 2GNOA 3F74A 1WL8A 5IF9A 4FZVA 3EEBA 2DWQA 3K9QO 4ZQEA 2OQRA 3B51X 5FYDA 1LDBA 1ZWLA 4E94A 1GL3A 1VE5A 4WCFC 3RS7A 5TIIA 2BGJA 2O2IA 3SX0A 1DAFA 4BYGA 3OLWA 2QMEA 2O2XA 4RMIA 3COZA 3SQNA 5KSZA 2FWJA 3EXG1 4R9UC 3RCBA 2Y05A 5DYIA 3MFQA 2XB6A 3PB3A 3HDVA 4HFNA 3OPYA 4Q4HB 4GWKA 1MF7A 1QVAA 1QU2A 1N7IA 1T36A 3BF7A 2QP3A 1TT5A 2RH5A 4NWIA 3KB2A 3T4XA 4IZ6A 1WM1A 2YYZA 1PSWA 5FUBA 4RMHA 1E7RA 1UH5A 1XWWA 3WHPA 2IELA 3EAQA 2GHTA 2BRUA 1DG3A 3PFNA 2FWBA 3PPWA 3I32A 3GRFA 1AUOA 3DBIA 3Q88A 4RPHA 2KHZA 3FNRA 3B5EA 4TLLB 2RKWA 4HRXA 1M2JA 1IZ9A 3SIWA 1EK1A 3KHKA 2PGOA 3P2JA 2QA5A 3BILA 1VJDA 1SOUA 2ZK7A 2BMEA 2VT3A 1W30A 1TCAA 4O4JF 3UJ8A 1CULC 4L85A 2O8BB 1MH1A 2WICA 3PFCA 3GMIA 1XNGA 3V97A 4F1KA 3PC2A 4DIFA 1SCQA 4DNPA 2GA9A 5KBYA 4UC0A 1RRVA 2VXBA 3QITA 4R2JA 3STYA 3TL3A 1B8PA 1GQYA 2QEQA 4LJSA 4WCVA 1Y8QB 4YV1A 1SC6A 1QVVA 4KAXA 4QSHA 4LVNA 3V8EA 2V6MA 2R00C 2XYHA 3IC5A 4DW8A 4PN3A 4YAKA 1DZIA 1AXGA 5K8IA 1YS9A 2ZI9A 5TSDA 3TW4A 5JAOA 1XA3A 1T9HA 1DDOA 1GSOA 1LTHR 2QN2A 5DF1A 1TE2A 3WGKA 2EJCA 4R2IA 3R7WA 5KTPA 2IU3A 4B40A 2CVHA 2DPMA 3HCRA 2A0XA 2VYCA 4FZJA 4ZODA 4IAOA 4AXBA 1WUJS 2EXXA 2ZSJA 4XIIA 4OB6A 4DHWA 4KNYA 2I8AA 3CLRC 4PNZA 4C4RA 3U61B 5BO5A 1V8PA 5D86A 3WZLA 4BX2A 7ADHA 5KSYA 1FDSA 2QTGA 4D0SA 4BFYA 1CP3A 3EBOA 4C2TA 3KUDA 3I9NA 4FSXA 1KFBB 3R3YA 2F59A 4ZANA 3BFJA 4DN6A 2QK4A 1BDJA 2P9JA 4M9SA 2C20A 4R2MA 3U39A 5HXAA 1E1YA 3TS1A 3F6YA 3OIVA 1VJTA 3AW8A 1GU1A 1L4FA 4OU4A 5JWRA 2HB6A 1OX4A 4DQUA 4QG3A 3PZBA 2PLFA 2PS0A 3AF1A 5HRUA 1C30B 3BTOA 1CWUA 3KQQA 3D31A 5B6JA 1H4VB 1N6KA 3CUTA 1I51A 3FUCA 3GVPA 3MTAA 4D92A 4P98A 3AL3A 2P4EA 4U9UA 5LP1A 2QTRA 2ZTVA 1JEDA 2JGNA 2L2QA 3RS3A 4LC9A 3S27A 1FA9A 4B3CA 2ZBPA 2WIFA 3GJSA 4BL5A 4BBAA 1Y5IA 2RHTA 3DUFB 4C0AC 1C2YA 4A2PA 4XIJA 5I9SA 1CIVA 2D59A 1FFEA 1GDHA 5TPWB 1LK5A 1IOLA 1MIHA 1VMEA 2AUNA 5TQJA 5DNVA 3HDYA 3VV3A 2Q3CA 4NENA 3GEHA 3GYBA 1GUAA 3BZUA 1Z38A 2OSBA 4WN9B 4XJSA 3ZQJA 4ZCMA 5LZ5A 4BQQA 5JSHA 3WFIA 1CP2A 2I7VA 2NPIA 1JFSA 4XWWA 2BFWA 4AY2A 4KXVA 3P4UA 4UMVA 1G4AE 1O4VA 2BBWA 2FDRA 2O0HA 2G08A 4U7FA 2PZLA 1Z08A 2AR7A 1NMSA 2VAWA 4HTFA 5EZQA 4MUXA 5DM0A 1TTTA 4D0LB 4IJ6A 3V1YA 1RJ9B 3ZU6A 3T5GA 3OZIA 3R9WA 3X3HA 1CY4A 3KTAA 3PGLA 3TR5A 1OYVA 4KAFA 4R2HA 4PN7A 3AOEA 3QTLA 1LU9A 1IXYA 1QHHB 1B23P 2XCUA 2WD9A 3AWDA 4KN9S 4I3GA 4TS9A 5B3JC 1ZYUA 5JPCA 1JZQA 4M49A 1SOWA 3PT9A 5EWMB 4N3BA 4AZ3A 1XAHA 1ZNYA 4Y2JA 4BCBA 2FWAA 4OOEA 2YVLA 1CERA 1KVQA 3JD0A 2OFPA 4MV1A 4QIHA 3DLPX 3EWSA 3KRTA 5FHRA 4CKXA 4W5RA 3NLLA 3WOHA 2PH5A 3B38A 3DAOA 3R77A 1FDIA 1R6XA 4Y2HA 3VU0A 4DNQA 3K71B 4M8SA 5DGIA 5G0SA 3QP9A 3TRHA 2ZCUA 3G8BA 3PHGA 2VHUA 2QXYA 1JZSA 2B7BA 3G0DA 5EYPA 5IMBA 4CM9A 4D9NA 3DDZX 3BK1A 1UK9A 2NADA 3NT4A 3K1JA 2P1ZA 4ER0A 1SGWA 3ONNA 2FUEA 1ZRMA 1Y8ZA 4G85A 1EK2A 1JR3E 1TYAE 5GQSA 4BFZA 1WUTA 5D5PA 4B1FA 3GNQA 3OQMA 5DTQA 3OCVA 2ZB2A 3ANMA 4AWXA 2ONCA 3ZG6A 2BRUC 5CYGA 3AUAA 1PF7E 4ZMRA 5AHOA 4P2GA 2QTTA 4O59O 4ZOLB 4GBED 1RHUA 2OYRA 5C2JB 2H57A 5ICGA 3O73A 2ORYA 2V6BA 2CJWA 1RBQA 2M98A 2VEDA 2QR3A 2J09A 2ZYVX 3LOUA 4M0LA 2O5VA 5LA6F 5C1BA 4DG9A 3C1TA 3DEKA 1IWPB 5DBFA 1PX2A 2ZYIA 5KNCD 2V5VA 3BL5A 5ITZA 2PZFA 3OP4A 4DA6A 4H7DA 4LJYA 4J7CA 1UF9A 1EBUA 2VZLA 3GFOA 4V39A 4X9XA 5A3VA 2VF4X 4FMDB 1D4FA 3OZFA 5B7GA 3M5WA 2A33A 4ZPJA 4OATA 2R66A 2R1TB 3OE5A 4NU0A 4Q66C 1U0LA 4RY8A 2PNFA 1JP7A 3MJDA 5DIFA 1EWRA 3U3OA 3W5UA 4IOMA 3GZNA 1SBNE 2VSOA 1HMYA 1U1CA 4X7BA 2P6OA 3MK31 3C87A 1E5LA 4JXJA 3T1VA 2PSDA 3WFJA 2LDXA 3ETDA 5EERA 3ESZA 1WNTA 1J21A 3IO3A 1YH3A 1GKKA 3IUJA 2DWPA 4NHOA 3HA2A 4U7HA 5FOXA 5CT5A 4R54A 3PD0A 3HLYA 1NJ1A 3NX4A 3AUYA 3IPXA 2JA2A 3G0GA 1T5IA 4BJHB 5LLTA 1WO8A 2WIKA 1MZVA 3R6GA 1GLGA 3AFOA 1PR1A 4NBSA 1MP0A 1NSYA 4FONA 1EVYA 4PBTA 3L6OO 3WHIA 1SO8A 5J5AA 3OQPA 5KQRA 2BR4A 3Q0TA 3G6KA 3GGDA 2QX6A 4DKJA 1RPTA 1O5OA 2JARA 4Q4HA 3TLYA 4G1UC 3DE3X 4OFZA 5C52B 3J81k 3UJNA 1KQNA 3K70B 5DHRA 1YHZA 5FNVF 1M6EX 5C5IA 3ORFA 4M1OA 2JD0A 3WGIA 3I2KA 4Z0NA 1Y1SA 3RVOA 1TKRA 2H1SA 4UD6A 4IPTA 1U8UA 3K1YA 2DBRA 3K6RA 4BB6A 4N54A 5FRDA 3O1IC 4TLBA 1J8VA 2I1LA 1DJNA 2F3TA 3KZXA 4NBWA 4JXKA 1K6MA 1GZSA 1Q7GA 2FMUA 2NO4A 4AO6A 1XXLA 4RZIA 5EP2A 1FUIA 2FRDA 3BE6A 2I54A 4R31A 4CM7A 1MLDA 4CEJA 1VIMA 3AVPA 3KU4A 3N2IA 5HZMA 1KMCA 4H16A 4J0QA 3LQKA 3PPVA 2IX9A 1AKVA 1M2FA 4ZOEA 1ZL2A 4CM8A 3RUHA 5CD1A 3LQ4A 2VUUA 1GTG1 1CUCA 1W44A 4XGKA 2FPGA 1NVWQ 2FKNA 2OHJA 2Z08A 5JALA 4KRGA 5JMPA 3RVMA 4B46A 2I7TA 4I1SA 3LTNC 2FJ0A 3LRXA 4BMNA 1GM5A 2ATCA 4BE9A 3HKBB 2C2HA 5ELLA 4I4LA 4LV6A 5JOQA 1U7UA 1RU3A 1CLEA 2WU0A 2OXFA 3R6DA 4Q3EA 3SJBA 2DPHA 5FUVA 1FXWA 1NVEA 3ETJA 3IOMA 6REQA 3KYCA 3PFKA 1U9IC 2HLDD 2FUNB 3I0MA 4XCXA 1XKTA 2AUTA 2L42A 4HI0E 1GEEA 3GK3A 3NDBB 2WSSA 1EP3B 3II6X 4R0NA 4ZREA 4Z3KA 1T26A 4E13A 5HJEA 4RULA 3DE6X 4RJLA 1COWA 1Y4SA 2BHLA 3NBQA 4KR0A 5FOQA 7MHTA 1IEVA 1PFVA 2AUMA 4UQOA 5JRZA 2D1YA 3TEJA 1M33A 3MLAA 3PFFA 2G5TA 1K5GA 1ZGCA 2V7BA 1U90A 2Z2XA 3A3YA 3O4HA 3GR6A 1DTWA 4MKXA 5EPEA 3TMKA 4F3KA 3DEFA 4N3CA 1CR4A 1QG4A 3AUKA 2HDHA 4C7XA 3JX9A 4KGDA 4W8GA 4EW3A 4C0WA 2BGIA 4AZSA 1GN8A 4QTUB 1R8XA 4DUYB 3VPXA 2SBTA 3FPKA 4QODA 4M0MA 2QL6A 2NZYA 4G67A 1HLDA 2WU1A 3I9V6 3KEQA 2NVBA 3OG9A 3QVWA 1TM5E 2DP4E 1KAHA 3FVTA 2AVNA 3O1LA 3HU5A 3LC1O 3DYIA 3U7QB 1XMOB 4BNXA 4QPDA 2YCLA 3IEXA 4G56A 3A36A 3R9KA 2CNBA 3EZ6A 2WKRA 1U2PA 1OA1A 5H70A 1B00A 3TDMA 3TTUA 2XKKA 4Q1FA 3CVXA 4P0PB 3W8FA 3OX4A 3B1KA 3KYIB 4BNVA 3T1HB 2Q62A 3SXPA 4BTEA 4D97A 2ONKA 2JVIA 4G37A 4HSGA 2H00A 3SHTA 4N4AA 4ABYA 4DVJA 3CVWA 4WOKA 3MG9A 2NIPA 3JALB 3ZHZA 3WYEA 1AH2A 3ASYA 3GLTA 3GWGA 3G2IA 4AY3A 1Z15A 1V5WA 2A5GA 3NGLA 1UFKA 3U16A 5DYNA 4DIEA 2VH1A 3BE8A 3N0WA 3CFYA 5E3HA 5A0TA 2PWYA 3K0AA 4YAIA 2IUUA 1WABA 3TJRA 2F1IA 1JX6A 3LWZA 1E1RD 4NYMQ 4Q9HA 1REQB 2HJSA 4NV0A 3NG1A 3ZCSA 3AFIA 5CNIA 4K9LA 1DFHA 1CKEA 4GGOA 3WLKX 2UZ0A 3RU7A 1CF2O 5JZBA 3F97A 5JDIC 1LV8A 1WXFA 2PIAA 1ADFA 4FKMA 2HJ9A 3RV3A 3NALA 1CEYA 2QBYA 1QHNA 2Z6QA 4CDNA 4E5DA 3IURA 4GKAA 4Q00A 2IOYA 3P9IA 8GPBA 1P18A 3W3AH 4ZOBA 1UJBA 3C5WP 5IK2A 1U0GA 3H3JA 4OH1A 4CTOA 4OI4A 5K8JB 3AHCA 1ZD1A 1N34B 2XTNA 1KKUA 1M0SA 3W3AA 4ZK6A 4IRMA 1S02A 5LQKA 3ESAA 1U7TA 2FP4B 2QSZA 2VZEA 3GRYA 1XX6A 4WOCA 5B58C 1XYGA 5L8VA 2QI9C 1EXDA 1FRZA 4I55B 2BAGA 5AOAA 3RRYA 1OI7A 1TK2A 4Q4LA 3IDAA 4EY4A 2QZ4A 3CNBA 2FN3A 1U3WA 4K0RA 4XEUA 4F6RB 1TEHA 1WXDA 5AM0A 2YWXA 4BO2A 5IDWA 4AX4A 4CL8A 3T5AA 4GH5A 4R98A 3OOJA 3WGGA 4IWYA 5EXEA 4LZJA 2J0UA 1UDCA 1CE8A 4HDRA 4RC9A 3CVUA 2C9CA 3G5AA 4QKQA 1V71A 2RONA 3SAJA 4PAQA 1SBQA 1D2EA 5DWVA 1KYZA 5KTKA 4BO6A 1IQUA 2GFHA 2FG5A 1QE0A 1ADJA 1VPEA 3N05A 4MAFA 4Q3DA 4PAMA 4Q48A 4ZOLA 1CFZA 1Z56C 4L5AA 1EVJA 3T7RA 1J9GA 2RAUA 4OY3A 4CCYA 3KIPA 3GLFB 2NP7A 3QVXA 3RYCA 3IQGX 3T3HA 3LK6A 1OLSB 1P60A 3U2QA 4DWVA 3B6JA 3S2GA 4A5OA 4AQ7A 1DWUA 2FPIB 2OFWA 4YP0A 4J94A 5F33A 2P3QA 5EUQB 1LS6A 1LVGA 1OI3A 2RG7A 2X14A 1LSSA 4Q3BA 4D8XA 3C48A 3EGWA 3IUYA 3ILHA 2XCTB 1HNWB 2Y8EA 4LY0A 2HHCA 1NW7A 1GGEA 1G60A 3EC2A 4UUQA 3D5QA 2GKGA 4J07A 4AECA 4DF3A 2CYCA 1SKAA 3V8MA 1GCIA 3LDUA 2XLBA 4S0ZA 2I2DA 1UK7A 3FNEA 3L6CA 3WQHA 5M04A 1GAXA 1MPTA 3PL1A 4W9MC 4K3UA 5FPKA 1RAHA 2I6QA 1KFEB 4LOHA 2IU4A 5CX1A 3GRUA 4Y9DA 3ZEAA 3ADBA 3I5UA 2PD3A 1WY5A 4DJFC 1OWNA 2WVGA 5AUNB 3K6SA 1PS8A 1Y3CE 1F48A 2C04A 2HWXA 3AJAA 5F12A 2QN6A 1JZTA 2B8EA 3FUWA 1T43A 3O7MA 5FUQA 2X1VA 2QD5A 1G8JA 3JQGA 1U2GC 1GITA 2YHSA 3RJTA 3JQ8A 1XT6A 3FVVA 3LX4A 1W25A 3C7CB 3DVAB 4JH0A 5CPFA 1ULUA 2VNHA 3KJQA 3TNLA 2C8JA 1NTRA 3OLQA 3ET5A 1U3TA 1VLHA 3GCDA 4PS0A 5E7JA 1XDWA 2HPVA 3EFBA 3RYHB 1CVIA 2Y66A 3TFQA 1S01A 4XCQA 5BRNA 1Z88A 2OPBA 4LEIA 4QJ5A 3RASA 3UOWA 1IXRC 3MGCA 5GWXA 2QUKA 2ZJ6A 2I1QA 3QXXA 5EKUA 3OWOA 1QMGA 3ZGNA 1NBAA 4FC6A 2PZJA 1JB9A 2X1MA 4LJ4A 4R1SA 5KCMA 4WEOA 4M7OA 3WGYA 4ARSA 2HWWA 2GN0A 3KCNA 2HMVA 1FF9A 4ASUA 1DCTA 1JDPA 1MT3A 2C00A 2PVSA 4M38A 4CMHA 1VE3A 4GIBA 2PL1A 4PX2A 1YZHA 4A8PA 4DC1A 1YOVB 2G36A 2QR5A 3K09C 2FG7C 1JMKC 4GMXA 3VO9A 1FXSA 5BPHA 1AQJA 4LXHA 1G21A 3PR3A 4G8DA 5C51B 2CK3D 2XEDA 4CF3A 2K87A 4UAVA 2CFCA 1SEPA 1XMXA 3GVHA 3A6JA 1M0TA 2GO1A 1GTL1 1KJWA 2BCEA 3DBLA 2C5AA 3O90A 4BN0A 4ZKDA 1JH9A 2BMFA 1PE0A 4KK4A 4GLJA 2FSGA 1L7EA 2OM2A 2NO0A 3L7CA 3W7VA 5LMZA 3TH5A 4XWTA 4OQMA 3DWEX 2G83A 1CDZA 5HCNA 3ZQKA 2FY8A 3HVJA 2FSFA 2C29D 4Y0VA 1TYCA 1TAUA 5EEGA 1RKXA 5C5CA 5IC4A 2ZYAA 3K9GA 1LSOA 1QF7A 3U44B 1ZGJA 1Q2UA 1WVIA 5DCUA 4AMGA 4GX0A 4GQIA 2BFDA 2EJWA 4EMTA 1MGPA 1PJTA 1N1DA 2X9NA 2O2GA 2FGJA 2ZJYA 5K05A 1SUPA 4Q4DA 1RMYA 2GJKA 3C3AA 3T1TA 1EFRA 1KERA 4IGFA 3FW1A 4CTNA 1JFTA 2G0AA 5EIOA 1N33B 2Z8ZA 1RXYA 4RHYA 3NBMA 4S05A 3ZDCA 1DTWB 4HDSB 4TRMA 4BPRA 4TZKA 2IZ6A 4KGZA 4B6GA 2ZP1A 2W4QA 5A4MS 3BSYA 4XX1A 3CW2A 5EJ8A 4PG5A 3CBGA 2FMKA 2PTGA 4HLQB 4K6OA 1JR6A 1VHDA 4B3HA 1T29A 1YOBA 2P8SA 4EI9A 2HHHB 3Q8MA 1G3MA 2O9JA 2IKQA 4F2GA 2VXYA 4G0MA 1Z0AA 1WZCA 2CXPA 1J1IA 4DL9A 4AKHA 3IA2A 4LHVA 1KFKB 5D6OA 3T9CA 2VJQA 1BGVA 1JHOA 1HURA 1XU9A 1H9BA 4EVQA 5B37A 4FOPA 1D1TA 4TLDA 5DBGA 3PNBA 2WPNA 1UWLA 3A2MA 1DIOB 4PY2A 4ZALA 2G71A 3DVLA 3DMYA 1R74A 2IZ5A 1VE6A 4KYUA 2B0JA 3KPVA 4RKYA 5BYJA 1V39A 2C7PA 3ECSA 1J24A 4ALMA 5I7RA 1FFAA 3MUNA 4MAAA 1J8FA 3HCOA 1BW9B 2JFNA 4KKVA 4TYPA 4QXRA 3E9ZA 3MSCA 1AOXA 1AA6A 1CJMA 3AVOA 1VRCA 3IAS1 2Y2VA 5CIWA 1M2VB 5HDBB 5T6BA 1SQ6A 3GGGA 5KKNB 4D8VA 4OXKA 3H5WA 1DAEA 1MN6A 1SN7A 2TECE 5ENVA 2D54A 2JGJA 3EDOA 3MUEA 5JAPA 3AYZB 2JC3A 2XA1A 2O8NA 4ZVPA 4F46A 4MZDA 1F17A 3TUJC 4KQFA 2JCXA 2NPOA 1AZTA 2C95A 1P31A 3CA8A 1XZHA 1ISPA 2R00A 2BLLA 4MPRA 4DDWA 5EJ6A 1U3GA 1VKJA 1ZM3A 3MMNA 2YZKA 1JJBA 4BAGA 1U9CA 3EDMA 3B85A 4LI0A 3FSEA 4BZPA 4AKTA 2D2IA 1IBRA 1T34A 3HC7A 3MJCA 3S2YA 1OBHA 5DU2A 1G8GA 1X2BA 3N5CA 1S3GA 3L6UA 3U4CA 1JVSA 3AERA 1THMA 5AK5A 3SZLA 1KY2A 3IFSA 4GM0A 2DULA 4B47A 5JAMA 3GBVA 2UKDA 4AW9A 1K2WA 4C0BA 4ZI7F 2CCJA 4U00A 3T1QA 4HWGA 1U2GA 1XZPA 3SZ3A 3CJTA 1YZVA 3OPVA 3I9MA 2O50A 4REQA 2Z2YA 4D4GA 5LKAA 4JZKA 4P4SA 3PQ2A 2EYUA 2PK3A 4JLSA 4ZVNA 1W34A 1WRBA 4RZXA 1XRMA 1NVDA 2X8JA 3PRYA 4WCFA 4CQLA 3GFPA 2BEWB 2XTZA 1CJBA 1BEUB 4G9GA 1BA2A 2ZBFA 3PV0A 2G7MC 4L5JA 5JXJA 3FJYA 4FKBA 2Y92A 3DC2A 3X2SA 3PUVA 2ZLBA 3H2ZA 4P93A 1I1QB 3L8HA 4QJBA 3KZ1E 5I3CA 4CODB 3S8YA 1YQXA 3GY0A 3U09A 1N77A 1J8YF 1AZWA 4BECA 5KYUB 4L95C 1TEXA 3WLAA 5CH3A 4FU0A 3C6BA 3TAXA 2DFLA 2IGBA 4HUJA 4RH1A 5AW5A 4C3VA 1N2IA 4NYIQ 5BUZA 1JDBC 1UJ2A 4NCBA 1EFVB 1Z6PA 5H8WA 4BMPB 1NUAA 2GKSA 1JEOA 3CINA 4NAUA 1KC3A 2AVDA 2HGZA 4UAJA 1T1GA 4CCYB 4YYZA 2GJ9A 5L4NA 4XI9A 4KHZA 2C98A 1CUSA 4GU5A 4CV3A 2K6GA 4JLVA 1A3CA 4K8OA 2BMVA 2OORC 2Z2JA 3WADA 1SKQA 4TYYA 4LVCA 4ZGBA 4MR7B 4C7OB 3AVVA 2YJ6A 1KI6B 3PUHA 5KQLA 4F45A 1BTOA 1P9WA 3ZWBA 4YV7A 3VISA 1MNAA 2OUKA 1JG7A 1XXHB 2WIGA 3TGLA 3ENVA 3PX2A 4BGVA 4G1VA 1Y33E 4PXYA 3LGSA 1DXQA 3IR5A 1C0KA 2C31A 2VZ8A 3V32A 2CLIB 2JGMA 4HADA 3L8ZA 2JJ1D 3W04A 1W75A 4FLFA 1X7HA 3RJMA 3UK0A 5ARDA 4B6PA 4Z4EA 4UTVA 1JLLA 2BI4A 5HF6A 1KAMA 4PNHA 1A82A 3AHFA 4LVOA 2XF2A 3FIJA 4IJUA 3MYYA 4AURA 2R0QC 4FMCB 1Z8NA 2XXJA 3SBDA 3VU1A 3L5KA 4HNUA 4EJ2A 1VI2A 4KSCA 2AXPA 5CCEA 2PA0A 1HSOA 1WMBA 1OBOA 1W5AA 2XB9A 2BR3A 1CFJA 3EEQA 1Q1NA 1TM1E 2ZB3A 4RADA 3OIFA 4E09A 4QUEA 4ZYYA 2CLLB 5DYTA 2I0FA 2FR8C 2FUKA 3OA0A 5JWHA 4D1YA 1H6BA 1FJXA 1D6MA 4GEKA 1TZJA 4GZ5A 1YRLA 4TTSA 2R25B 2X5KO 3LHFA 3UB4A 5BN3A 3O4FA 1Z29A 5DTJA 5EN4A 4UOQA 1P6QA 3D8SA 1J06A 1JLSA 3ESDA 2J9GA 4JJ6A 4JI6B 4BDSA 5FTMA 3R9IA 3H9BA 1MFZA 3EC7A 3PIRA 5AHWA 2V3CC 2QRVB 2YWDA 3HCEA 3HYNA 3Q87B 3KLPX 4NU8X 1UBEA 3ELUA 3JQ9A 1P74A 1UJ6A 3NWEA 1Q44A 4IXNA 4L9AA 2AGVA 3BORA 4U2CA 1WETA 1LPMA 1PJLA 5C7OO 3IT1A 5K3SA 2LVBA 4YP9A 3KKQA 4RESA 2WHQA 5TS3A 2DCUA 4L4ZA 3RPEA 3WK7A 2QN3A 2C2YA 4MI3A 2PUAA 1RYBA 2GPBA 4DNFA 3O8QB 1JRLA 1BXKA 1EM8A 4OA8A 3OEEA 3OOYA 2XQKA 8OHMA 1Z83A 4NNPA 3ORHA 2H1RA 5H59A 2OEPA 1GV0A 1E1RA 1XXHE 1KEUA 1M7GA 2JIZA 1BROA 5NLLA 5A4FS 1NMZA 5T8KC 3UV7A 3DCJA 1VIVA 2HO4A 3F3KA 2BGNA 1S7GA 2RK6A 4HQ0A 3ZH9B 4Q9IA 2W6MA 4LF4B 5TGZA 3LP8A 4RF2A 4R5MA 1G18A 1MW8X 4NJEB 2GN4A 1KBZA 2PKEA 3H84A 4C3OB 3BXOA 1FDTA 4MAMA 1X7WA 2GARA 1GXSB 1V35A 2FCAA 3MTGA 3RANA 4JT4A 1U5CA 4DGQA 5FLEX 1ZO8A 1A5ZA 3IMCA 2QE7A 2DAPA 3ZTTA 1N0WA 4D6YA 1Y6FA 5CJ2A 2HUPA 3KM0A 2XD4A 3I5MA 4CM4B 1VL1A 3BE5A 4YJGA 4QDUA 4ATNA 4LOIA 1VL0A 4BY9E 1PGQA 4TWBA 3BZWA 3TW6A 2ZRNA 4F3NA 1BX1A 2QU8A 2WJYA 3UMSA 1T5DX 3V46A 2QPLA 3TWOA 1RVDA 4K2AA 3QU5A 2N42A 3I3OA 4QXAA 4XB6B 4QBGB 3B6EA 4DMFA 4WBNF 4ZC8A 3FDJA 2VP3A 2BL4A 3FWHA 4D4IA 3L40A 4PQYA 3AEQB 2MMGA 2Q27A 3E3AA 1DRKA 4CXMA 4OQ4A 5EA2A 2WKPA 3AOGA 2VPXA 3F4KA 1KP3A 4GVPA 1BEEA 4P32A 1MNQA 5AVRA 1UP6A 4ZJYA 1NUUA 1Z62A 3ANSA 4D0RA 3MPUA 2C3OA 2OWDA 2JPDA 1X0XA 3H11A 1B0UA 4Y6QA 2P62A 4MA0A 4R68A 1V8DA 1DTEA 1FFWA 5CXQA 1PR3A 3D4LA 1GG8A 4YJFB 2AD1A 5FPYA 2O0KA 4PAOA 4TUYB 1FFDA 4IIXA 1W46A 3GFGA 1AZLA 2PBRA 2ZPTX 4P1ZA 3I5XA 2FW8A 2PMDA 3FUUA 4BMCA 2E1RA 4DXAA 1GVHA 2O0MA 2VHTA 4R7GA 3T94A 4CZ2A 2Q07A 1I9CA 3ASZA 4QPZA 1CVLA 3OX3A 1XGKA 4KDFA 4P7JA 4XLLA 3FWNA 3TIXB 4E5NA 3KCQA 4NU6A 3EAFA 4UNQA 3CXUA 2QJFA 3SEFA 5IAEA 5A1TA 5BN1A 4LGVA 4P82A 4WKCA 3ZE8A 4US2R 1NGSA 4PNEA 2QRJA 3ZE9A 2R6FA 1KY3A 3NJ8A 1CF4A 2QMUA 2PGIA 4H77A 1KMNA 5JYEA 4DDMA 2YVUA 3KX2A 3AERB 4O0MA 4CL3A 4Z6KA 5DP2A 1N2EA 1EVEA 4IH1A 4IM7A 2KLHA 3M4JA 3GUZA 4EA6A 3I64A 1XCJA 1OLUA 4S1TA 1YS6A 2FEAA 1IM2A 4X6UA 4YXFA 2YXEA 3G2OA 5IKPA 2P5TB 1JTEA 3MWJA 4AUKA 1RXIA 2XUPA 3GNTA 1QWSA 2ODBA 4OV6B 1XN1A 3FFTA 4DOMA 5L4LA 3TQFA 4FOSA 4BHTA 3GLHA 4EL5A 4YCNA 2WT8A 5JU6A 1SBCA 2QM3A 2HHJA 2GJ4A 2X5JO 2PS9A 2XCQA 4NJOA 1K7XB 1U31A 5IBRA 2X9QA 1K8QA 1EXWA 4EJ6A 2BEVB 5LD2C 3T5CA 2A9OA 3WYNA 2AMLA 1XB2A 1TM3E 4P53A 2JAWA 4IMPA 4HN4B 4Q9AA 4B3BA 2IYYA 3GARA 2FH5B 3QG1A 2LBPA 1IFXA 4XWKA 2GZ2A 3MXOA 3TTWA 2QRLA 3A14A 2JW5A 4JLAA 3JYOA 4JLMA 2ZAGA 1YI0A 1GFWA 3CH5A 4G0QA 6CHYA 3ZLJA 3IIJA 4OCZA 1ZHOA 2X13A 5BVHB 2OG2A 1ZH4A 4PCLA 2BGMA 3KQWA 3HPQA 4Q3CA 3PDIA 1ZPDA 1TCBA 3VYWA 3ZJUA 1W8DA 4J29A 2OV4A 2X3UA 1SEVA 4M7RA 4GOKA 5A5EA 4NZOA 2DY0A 3SEQA 1XN4A 1Z6YA 1Y7PA 1ZCJA 4RKQA 4YAFA 5K1ZA 1LPAB 4EHFA 3RUCA 4DSAA 4FEAA 1T5SA 1K7EB 1ZGHA 3DDUA 4Q93A 1MG5A 2J0VA 1VL5A 1C7QA 1V1JA 2DFDA 2WD7B 3M7IA 2GCPA 4ZQGA 5KDLA 1QB8A 4PLWA 2N1BA 2VHXA 1VB5A 1JLLB 2GO7A 2WEKA