4LMQD

Development and preclinical characterization of a humanized antibody targeting cxcl12
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
58
structure length
55
Chain Sequence
CRFFESHVARANVKHLKILNTPLQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal cell-derived factor 1
publication title Development and Preclinical Characterization of a Humanized Antibody Targeting CXCL12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 9
structure length 55
sequence length 58
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4lmqD00
1Q3LA 3G7LA 5DNFA 1AZPA 2L11A 3DM1A 1AP0A 1BO0A 1PFMA 5JJZA 1U4RA 1RJTA 2FINB 2RSOA 2EPBA 2K04A 1F9QA 4CJ2C 5CBAE 1JE4A 3MTSA 4HSVA 4QUCA 1SSOA 1WD0A 1HHVA 2B2YA 2FFKB 1AZQA 4OIJA 2DY8A 4RWSC 2MGSA 1QE6A 2B2VA 4IUPA 5D14A 4X3KA 4ZLTF 5CORA 3I90A 1ZXTA 5E4WC 1B2TA 1VMCA 2B2WA 1HFNA 1B53A 3ONAB 1JICA 3SVMA 1NR2A 2X6GA 1NAPA 5D65A 1EOTA 2L9HA 4LMQD 1PFNA 4RAUC 1XX8A 1F9SA 1WTWA 1C8CA 1MSHA 1NCVA 2L1BA 2XIWA 4XT3B 3R93A 2EE1A 1VMPA 4XT1B 2MJ8A 2HCIA 3DEPA 1EL0A 1LV9A 3IFDA 4CJ0B 2JYOA 2B2WC 3KBXA 1A15A 3P7JA 2K05A 1WTQA 1EIHA 2Q8TA 2HDLA 1KNEA 2KEDA 1KNAA 5E4XA 1NR4A 1G2SA 1E0BA 1X3PA 2RA4A 4HEDA 3QO2A 4X3UA 4QUFA 3D6WA 4NW2A 4CJ1B 5T1IA 1BNZA 2FMMA 3GV6A 1ML0D 4X3TA 3LWEA 3I3CA 1WTVA 1DONA 2RVLA 5EJWA 3UI2A 1U4MA 5T1GA 2D9UA 4U68A 3GV3A 1U4LA 1HUMA 1O7YA 4IURA 2K1BA 4IUVA 4ZKCB 2N55A 2JP1A 2B2UA 1G6ZA 5AFWA 2CVRA 1IKMA 2B2YC 2X6LA 2J7ZA 1DOLA 1ICWA 1EIGA 5CMDA 2B2VC 2BDNA 5CBEE 3H91A 3HP3A 3DEOA 1WVLA 1HA6A 1TVXA 2EOTA 3Q6SA 1J9OA 2SDFA 2VXWA 4ZK9B 1B4OA 1HUNA 2K28A 4HCSA 4IUUA 2KECA 4O42A 3TZDA 4R8IA 2HCCA 4ZAIA 4ZKBB 2H1EA 2K01A 1MGSA 1XYIA 4XDXA 3TN2A 1SDFA 3FDTA 1IKLA 5COYA 1F2LA 2IL8A 2N88A 1MI2A 1EQTA 1PFBA 1SAPA 2NZ1D 1QG7A 1DOMA 1RTNA 1RODA 4IUQA 3F2UA 1O80A 4MN3A 3MWYW 2HDMA 1B3AA 2KEEA 2MP1A 1S4ZA 3I8ZA 2FJ2A 1U4PA 1RHPA 3KUPA 2K03A 2DY7A 4MHEA 5EQ0A 2B2TA 2RSNA 1B50A 1G91A 4DN4M 1WD1A 1M8AA 1O7ZA 1X32A 2M2LA 3N52A 4HAEA 4X3SA 5EPJA 1PLFA 1G2TA 2MPMA 4OIKA 1WTPA 1MSGA 4UAIA 1BF4A 2B2UC 2R3ZA 5EPLA 1BBXC 1DOKA 1F9PA 2HUGA 5EKIA 1HRJA 2KVMA 1WTXA 1RTOA 2L4NA 1PDQA 1J8IA 1IL8A 2KUMA 2KOLA 1QNKA 3FPUB 3IL8A 1CA6A 2B2TC 5EPKA 3I91A 1X3QA 1CA5A 1DZ1A 2NWGA 2Q8RE 2X69A 1ILPA 1CM9A 4R9WA 1ILQA 2NYZD 1WTOA 2L12A 2FHTA 1GUWA 1F9RA 4RA8A 1ESRA 4IUTA 1WTRA 1HFGA
chains in the Genus database with same CATH superfamily
3C46A 3ULJA 1EWCA 2NB0A 2KBNA 3NSWA 4BA2I 4NMZA 2H4OA 2K04A 5C4JB 2B63G 1JOQA 2E8GA 2FFKB 3EBEA 3ERQA 4BBRB 1SYGA 1GOZA 5CORA 3NBIA 4GZYC 4PZ7A 5CYUA 5EBCA 3C2PA 4KLKA 1EY5A 4C3HB 4A76A 3IAYA 2HCIA 3DEPA 1S3OA 2M9VA 4A3BH 2K5QA 4QCLA 1BBWA 1X3EA 1EYCA 1VQ9A 4LF9Q 4JI7L 1X6OA 1B70B 5T1IA 5K36H 3R2TA 1L1OB 4JBMA 4GOPB 3TMEA 1DONA 3HKZG 3UI2A 4M8AA 4I7AA 4DR1Q 1W6KA 5FOBB 4LF8Q 2N55A 4LF4Q 2B2YC 4A3GG 4EQ5A 3CC7A 3GTPB 4JI5Q 4P71A 4NKLA 4HIOA 2A5HA 4C3JH 1Q7YC 3SK8A 4A3EH 3FPPA 1DM0B 2BA0A 2UXBQ 1QNUA 1VS0A 3F8TA 3MFYA 3CQZB 1H9SB 4YHHQ 3NP8A 4MIUA 1CSPA 1SE8A 5ELCA 3JAMc 3A7AB 4YY3L 5C4XG 1RODA 3I4LA 1EFWA 1KDAA 4Q5VA 1BCPC 2UUAL 2ZJRA 4R8NA 1B3AA 3W3AA 2A6HD 5FKAC 4A93B 4WJ3M 3RN5A 2EYOA 1YNJD 1KQSA 1O7ZA 5EPJA 5DM73 1Q46A 2WB1B 2CKZB 3I7FA 3HRZC 1DOKA 4P72A 3S2HB 1X54A 4A3GH 1KAAA 4GN5A 1VQFA 1VQ4A 4IPGA 1IBMQ 3D8GA 1SN8A 5JVG3 4A3IB 4J8QA 1FGBD 1PH2A 4TQUS 1F9RA 2RKSA 5AJ3L 2YU9H 1LACA 2K6AA 3E0JA 3RN2A 3E9IA 1F9QA 5JJKA 2RQXA 1K0SA 3K6OA 4ALPA 3CCMA 3NXWA 5IYBH 4UY8C 2E2IB 4JBJA 5C0XI 4IUPA 1CT1D 1VQJA 3OOCA 3A5UA 5E4WC 1HCZA 4H13C 3GQBA 2KHIA 3FMCA 1FR3A 3NE5B 4QJFA 4DV6Q 1MSHA 4K5WA 2F0PA 2EE1A 4PMWA 4RHSA 1VQ7A 1T9HA 1O7LA 2A8VA 2PQAA 2WAQB 1QJOA 1GHKA 1S5CD 3OYYA 2ALYB 1PXUA 1K8MA 3E3XA 4DV3L 3T1HL 3W2DA 4DR6Q 2WKCA 4QUFA 4BY7G 1L0YB 1EZ8A 4A3MB 4ZQ3A 1YHBA 3H94A 4BY1H 1A3UA 4A3FG 3GTLH 2AUKA 1EY6A 1FJGQ 3SK4A 1HUMA 4GN4B 3NHHA 3OPOA 4PG3A 1JR0D 3Q0AA 1KRSA 2EIFA 3NQTA 1TWGB 1PTOF 3HKZE 1N34L 1YI2A 1OXVA 1LTSD 1OXSC 3GTQB 2K28A 3D4RA 3G4SA 3K57A 3ULPA 3C3LA 2AUJD 3K5OA 1PTOD 5G3LF 1SNDA 2K5VA 1K28A 4XIGS 5FJ8H 1YJWA 1A8VA 4KHZA 4DFAA 4WJ4A 3E0EA 2I0QA 2ZJQA 2CCZA 4LF6Q 5C3EB 3G6EA 1U4PA 2RHSB 1UNSA 3T1YL 4RMFA 4A3FH 1K9MC 1G91A 3MC0B 1M8AA 4X3SA 2IX3A 2EY1A 5BR8L 2F0EA 2L4NA 3AU7A 1D7QA 2V1CC 4FVMA 4XQQA 5KIXA 1XPRA 4EQOA 4JV5Q 4LFAL 5FO7B 3BVGA 1IYUA 3CAMA 2Z6KC 4GKKQ 5TSSA 1RJTA 2WKDA 2JA5H 2EPBA 4E6IA 1BVSA 1EQVA 3CMEA 2JA6B 3A5ZB 4B9XA 1JC7A 3P1HA 3H0GG 4CBVA 2NVTB 1VQ6A 5A2QE 1JORA 2IT1A 1LT3D 3BG3A 4N9TA 4LUOA 3CD6A 4DV1Q 3GDEA 1N8RC 1MKHA 4KHPL 4JI3Q 1N36L 3P75A 3FP9A 3ZYYX 2YV5A 2DUDA 2BH8A 4DV7Q 3I2ZA 5M3FB 2MJ8A 1QCBD 1QUQA 1QILA 2F4VL 2XGTA 1EQRA 3OIPA 2K05A 4P2CB 1XMOQ 4TSSA 3Q22A 1TWFH 1UUPA 1BXTA 4N8FA 4HEDA 4DA2A 1WTVA 1HPCA 2HIXA 2LSSA 3WOEA 5IIFA 2RCFA 3M85A 1X9NA 1O7YA 4DXGA 1KLUD 2BDOA 3VR6A 2C35B 2PO4A 3H0GH 1CQVA 1UE7A 5LMNQ 5LL6X 1SNOA 1QB5D 2EOTA 4FF4A 1U5KA 2AQ2B 3KF8A 3CW2C 2YYZA 1CSQA 4O42A 5F2DA 4JG2A 4RGMA 5HGTA 4K0KL 3J80E 1Q1EA 2WP8J 4A3JB 4DNTB 3QB3A 3TZUA 1PH3A 2OXPA 3BZCA 2CFMA 2F0LA 1IBLL 2DN8A 3SDZA 2HDMA 1ZYRD 3OTOL 2FJ2A 4B3TQ 4G7HC 2SNMA 4MHEA 5FO8B 4UP8A 2F3WA 1O78A 2EYHA 2KCNA 3EQLC 2MHVA 4ODGA 4QF4A 3S1RH 1HNXL 2KVMA 3D4WA 4YCWA 2PNRC 3I4NG 2AWNA 1MIUA 4Y7NH 2B39A 1S72A 1CA5A 3KF6A 3HKSA 2Q2UA 3PF4A 1OXXK 4KN7C 4XYQA 2TSSA 1PTOB 5FK9C 4DV2L 1QVGA 4IUTA 3S15H 1AZPA 1PZJD 2F0UA 1F2YA 1SROA 2GN5A 2C9OA 1HHVA 1WOCA 1WCMG 5M9OA 2NVXB 4CDDC 4RWSC 4C2MH 1NY4A 1YHAA 4X3KA 4JI6Q 3J81L 1MBYA 2Q2TA 4BBSH 3KFUA 5ELEA 4C3IH 1EOTA 4LAAA 4ZYSA 4RAUC 3Q8DA 5NUCA 4K5VA 2A6EC 3U9OA 2R93G 3HOUG 3M7NA 1VMPA 1VQCA 3VYRA 4FF2A 1JB3A 2Y0SG 1H9RA 2DGYA 1PV4A 3P7JA 2Q8IB 1J5EL 4Y52H 4FO2A 1WTQA 4MTNA 1EIHA 2Q8TA 2HDLA 1KNEA 5IP9G 5JPMC 1YJNA 1JOOA 4NW2A 2K5WA 5JEAH 4IALA 4ID6A 2BA1A 2K4KA 4QL5A 1CUKA 2A69C 2K52A 1XWEA 3QOLA 4G7ZC 1Q12A 4LF5L 4RCOA 5CMDA 2B2VC 1HUNA 4HCSA 4K2KA 3K59A 1E24A 4P73A 1HNZL 4P74A 4PMBA 4BBRG 2XVSA 1TWAH 3FDTA 1EY0A 1STGA 4DK0A 1ENCA 3HOYH 1Z7TA 1SAPA 4IUQA 4KTAA 4C3HG 5IP9H 2ZTEA 4LJZC 1BCPD 3S14H 4CGYB 3EROA 1I94L 2G5DA 2Z1CA 4RG1A 2VB2X 4JI1Q 3GD7A 2E2JH 2VQEQ 4DV0Q 4JI8Q 1MJEA 2UXDQ 3QJYA 2FMCA 5KGUA 4KKSA 3GTKB 2O2LD 2KUMA 2CH4A 4IFDG 1TWHB 1JJ2A 5LL6S 3HGBA 5C4JH 1GUSA 3G71A 4JI2L 1Y1WH 4X66L 1F2ZA 5EKKA 5M5YB 2A19A 4DV4Q 2VZAA 2L11A 4AYBE 5GADC 3G48A 1STYA 2DNEA 2RSOA 2JE6I 1VCIA 1YNNC 4YCVA 1UE1A 1TWCH 3PO3B 4UPAA 2KHSA 2WV6D 2E2DC 4RGNA 1LLRD 3NBHB 3MAQA 3PIOA 1HA5A 3FRPB 4LWCA 4GNXA 1KL9A 1N32L 4HTHA 4A93G 5EBDA 2JYOA 2PI2A 1SYFA 4GKJL 1Q8KA 4JVZA 2F0VA 2PMZE 3S1NB 4XYOA 5E4XA 3TEHB 1GD7A 2R92B 1B1ZA 4DK1A 2EJFC 5IT9c 3T4AC 1JCKB 4CJ1B 5IE8A 2FMMA 3VA7A 2Y0SE 3CPWA 4HJ8A 2QKIC 4KV6A 2Z8LA 4IURA 1XNQQ 3HZXA 2K1BA 2PW5A 3QG1A 1PFSA 4A3IG 2B2UA 1PH4A 5AFWA 3S17H 1DOLA 1STNA 3RLFA 2OWOA 1HR0L 3BU2A 3TP6A 5M5WB 4DV5Q 4LFCL 3TSSA 2N78A 4DR2L 3S1MH 1QVFA 1L1OA 1BKBA 1S5BD 2CWPA 3L9AX 4GOPA 4H44C 4B3SL 2R7DA 4XDXA 1VQEA 4L63B 3J81j 5ELFA 2SOBA 4I7ZC 4KK7A 5KEEA 4DR7Q 3KLWA 4YWMA 1QZHA 4DR4Q 1SRUA 5C3XA 1XNRL 3TP5A 2K5HA 3AQQA 4EVOA 3TS2A 3PSIA 4EX5A 5ISRA 5KNBA 1PLFA 4NXNL 2NVQB 1A63A 1RL2A 2AMCB 3VR4A 3X3NA 5C0XH 4HMIA 4A3IH 1XMQL 3T16A 4HN7A 1JJGA 1EU4A 3CCUA 1E1TA 1G291 1I50B 2B8FA 3ITPA 2LKVA 2R7FA 2IPKD 2NWGA 4NXMQ 2IHEA 3U4VA 3TS0A 1U9RA 1D5XC 1V1PB 2V4DA 2N49A 4XQJA 1ESRA 3STBC 5J22A 3D6CA 3EA6A 1K3RA 4OEMB 1SFOB 2D5DA 3R2IA 2O5JC 1U4RA 1MJCA 1K83H 2QILA 4CJ2C 2D0OA 1X65A 1GUOA 1CKNB 3M4QA 1HZ9A 1VQHA 1BCPB 2O4XA 2MGSA 4G7OC 4FF3A 3VR3A 3KOJA 1H9JA 1KABA 4EQNA 2P5ZX 4LF9L 4HSPA 1HZAA 2KENA 3A8JE 2F0HA 4LMQD 1CK1A 3ND9A 2EXDA 2LS01 2EYPA 3J7ZC 1EL0A 1SYBA 4MNOA 2ATWA 4JCVE 4C56C 1A3VA 2K5DA 3K80C 1D8LA 4DR3L 4A3KB 5C44H 2RA4A 1HR0W 2JA8B 4JI5L 3KLRA 3I3CA 3CKIB 4NDXA 2RVLA 1UE5A 2F0WA 3A0JA 5I9PA 3K5MA 3KLSA 2KA7A 2B8GA 2NVYB 2WB1E 2ASBA 1NMGA 2E76C 5M3MG 3I4MB 2J7ZA 3N6RA 2UXBL 4X64Q 1HZBA 4YHHL 2EZVA 2Z6BA 3GTGH 1LT5D 4DUZL 3AEVA 3L0OA 1A0IA 2VXWA 1W6JA 1N9WA 3M4OB 1PMRA 2I5LX 4ULLA 2HCCA 2F0OA 5ELBA 5FLXL 2QA4A 1HTLD 5M5XB 1IBKQ 3HOWG 2F4IA 4K5XA 3DWPA 2D2CC 4LFBQ 1DOMA 3VR5A 2UXCQ 3HOZB 5M3FG 2B63H 1VQLA 4OELB 3M7GA 4LF7Q 1IBML 1EYGA 5GQOA 4BS9A 4DUYQ 4HAEA 3N52A 1X32A 1BQQT 4IFDI 2MUYA 5IGEA 3K81C 4DXFA 1Q81C 4JYAL 1SLJA 5M3MH 2WAQE 2F0JA 5IYCG 2RCNA 4OX9Q 2N3SA 2FHTA 3PUXA 4RA8A 5GAEC 4A3LG 3BDCA 4QGUA 5DNFA 4CKEA 3HOWH 2AQ1B 2NVTH 5J3BA 3T53B 3UDIA 5IT9L 5JJZA 5IGFA 4DV6L 2K14A 4JI0Q 1GUTA 2VB3X 2WIIB 4CHTB 3S16B 1AZQA 1LTRD 2LXJA 2Z9HA 3U9SA 5CV7A 5JEAJ 2B2WA 1SBBB 5IGCA 4HIKA 1WTHA 2VUMB 3FKIG 3QR8A 4LW1A 1VQ5A 1RCVD 5JPNC 1BDOA 2L0CA 4UP7A 2MO1A 4JI7Q 2L1BA 4V0BA 2XIWA 2K5NA 2OT2A 1H9MA 1FJGL 1HQMC 2K50A 1AFPA 2KEDA 2ZTDA 2LMCB 5I6WA 1G2SA 1E0BA 4X3UA 3RZOH 5C4XH 5IYCH 1BNZA 4PV1C 1I6HH 1O7IA 5I6YA 1N33L 5E1FA 3J7AV 2E2HH 1SMXA 2JEBI 1TR5A 3LX0A 3GTJB 1NSNS 1EY4A 1LUZA 1Q8IA 5I4DA 1ASYA 3BS1A 2GVAA 4JBKA 4OGQC 4FXDA 1HA6A 1EWIA 2FXQA 3V96A 2XWJB 1MD2D 5HGQA 3FKIH 4ZUJA 1RF2D 4ZKBB 2KCCA 2K01A 1Q1BA 3TN2A 3L3OC 1SDFA 3S1QB 4P75A 4WJWA 3HOVG 1Y8PB 2N8NA 1HQRD 3S2DB 2EYMA 5LHY1 4LUVA 3PIPA 2HHHQ 1A2UA 4IOAA 4JBWA 2KEEA 2F0TA 1LT4D 3EVQA 3KUPA 2F3VA 4QY7A 2OTLA 4JV5L 2RSNA 1TXYA 5I9OA 1A3TA 4PNYA 2F3IA 3CP0A 5CV5A 4KMUC 3BYTB 5AJ3Q 3PUYA 5C4HA 4GKKL 2VL6A 2KOLA 1K73C 1JE5A 3CRLC 1W3SA 1JQYD 3I91A 3UE1A 2EXZA 1WTOA 5FLMG 2L12A 1XPUA 1GUWA 3WWVA 1IW7C 1ET6A 4Z9CB 5IP7G 4DV1L 4BY7H 5DAUA 5G3LD 3HOVH 1ET9A 4JOIC 4DV7L 1YNND 4A3BB 2C5CA 2F0KA 4APVA 1JWMD 1B2TA 1VQMA 4DK3C 2VS1A 1XMOL 1B7YB 2CWAA 1PA6A 3K7AB 2MO0A 3NQIA 4J1MA 4GLXA 4XT3B 1VQGA 1CI3M 4JK1C 2IJ0A 1Y69U 2EJMA 3NPPA 4YIJA 5HY6A 2M00A 3BVZA 1GJXA 1HXYD 1I3QH 5LMNL 2EQSA 3P20A 4C3JB 1K0RA 1QZGA 4KY5A 1RIPA 2JSOA 3M3YH 4EQPA 4A3EB 1PZID 2ES2A 2RDHA 2CVRA 3GTMH 4IJHA 1EYAA 4NP5A 1EQQA 2HQEA 2E5LQ 3H91A 1A6XA 1NNXA 1VQIA 4FP5D 4L6TB 2JN4A 1NUCA 3WDNA 3RZDH 2R7ZB 3PO3G 2XN9C 4B3TL 3JAML 1LT6D 5C0XJ 2KJXA 3CCJA 2IL8A 3D0FA 1YNXA 5IGGA 3E9HA 1HNWQ 1UEBA 1FL0A 2A1AA 2EVBA 1DXMA 4A3GB 3MWYW 3K0XA 5H1SE 1JT8A 5BR8Q 2I5MX 3IFTA 4K8JA 1Q82C 3HOXB 2PQAB 4CKCA 3A7LA 1V9PA 5EQ0A 1SYDA 4MTKA 4KD3A 3F2DA 3CCEA 2ID0A 4K6DA 1PZKD 4GLVB 4X6AH 1VQAA 2YU9B 2MPMA 3PCOB 2R92G 1E2ZA 1PH7A 3BZDB 1CHPD 5EKIA 4KKTA 1PDQA 3I72A 3OSOA 1TS2A 3CC4A 1V1OA 3M4YA 1ILPA 1CM9A 1R9TB 3TRZA 5D3IB 4F87A 2UUCL 3PO3H 4G4KA 4KJNA 1QVCA 1AP0A 3STBD 3MXNA 3U4ZA 4KHPQ 1AN8A 2RDFA 3H3VH 2QDLA 4X62Q 4YWKA 4K14A 1NAPA 4TVAB 4AYBG 1PFNA 3CCRA 5ELOA 5LMNW 4BY1B 2ZM6L 3GTLB 1SMYD 5LMUQ 2EY6A 1WI5A 1FNWA 2WACA 2B2WC 3L7ZC 1CZGA 4R1JA 4UDUC 1P8LA 2F0IA 2TMPA 3U58A 3EIVA 2B29A 1U0LA 1X3FA 5ELNA 3TREA 1GHJA 3NBHA 3KDFB 3ICEA 1VDZA 2XTIA 5J39A 1VQPA 3PO2G 1K8AC 3GV3A 1NTGA 1UAPA 1PH5A 4ZKCB 4YWLA 4DAYA 3KJPA 1G6ZA 2HT1A 1YNJC 3CRKC 1Q90A 3LNNA 2IY5B 2CQOA 1ESFA 4L5TA 1TVXA 2ICIA 4IUUA 1KIXA 3I4NH 3TZDA 3OW2A 5CGKA 1ENFA 2OF1A 4A3FB 3OTOQ 1S5FD 2I5HA 4ZUIA 1MI2A 1OO9B 1STBA 2VQEL 3K0YA 4GS3A 3H09A 1KTKA 2UXDL 4MN3A 3GTOH 1S4ZA 2NN6G 3I73A 1WCMH 3SEBA 3NWTA 2ZXRA 4EGVA 4OHJA 4DKAC 5JVH3 3MZ5A 1G51A 5KNCA 2I46A 1SNQA 4RH6A 1EUJA 1I50H 1E2VA 2EYLA 2Z4IA 3PO2H 4A3KG 5C6AA 1UEAB 5EPLA 1W2BA 4DV2Q 2JA5B 2R93H 1RTOA 3VYSA 3R3OA 2QEJC 3HOUH 2Z4HA 4JI4Q 4IN3A 1FNVA 3HEJA 2NYZD 3QOJA 1M90C 1II3A 3ZJYC 3I4MG 2BH2A 3F2BA 2L55A 1PRTC 1H9KA 3V2TA 2B2YA 4WRDA 2NUCA 5EGTA 3TBIB 1TWFB 1HFNA 1B53A 1TY2A 1J5EQ 3SR1A 4DPGA 2HQLA 2LY7A 5KYLA 1V1PA 2F0QA 1JB7A 2EDGA 4HIMA 3HOZG 4XT1B 4GLAC 4POFA 1A15A 3OWFA 4BBRH 3I55A 1KD1C 1CKNA 2IWHA 5C5MA 4XQNA 3J7A5 3H0GB 1NR4A 5CC4A 3RR5A 1X3GA 3J80i 3UDXA 3WOFA 1AE2A 2NTSA 4LF5Q 3V05A 4C3HH 2O5IC 4GN3B 4DV5L 4KI0A 5D3DA 5EJWA 3OHXC 4RCNA 5T1GA 1C9OA 4G57A 2ZXPA 4CDCC 2UUBL 4IPHA 5ELDA 4IPCA 4F7XA 3F1ZA 3VR2A 1V43A 1Z47A 1NMFA 1JWUD 3A74A 3A54A 3KF6B 1SE2A 1D5ZC 3ERSX 1WFQA 2JEAI 5CBEE 4DR7L 2F0MA 4KHVA 5IYDG 3DEOA 3DHQA 3MFGA 4KN4C 4DR4L 1PH9A 4IFDH 1EY8A 2KCMA 5CV9A 3B6YA 4QB4A 2WB1G 3H3VI 4BXXG 3TDQA 1I94Q 1IKLA 4ZCKA 1HTPA 1QOHA 2ZTCA 2VUMG 3GTPH 4DF7A 1S5ED 1XPOA 3S1RB 1T5XD 1R4PB 1ICFB 3J81E 4Y7NB 3C1EA 3PQIA 1B50A 1PYWD 3CQZH 3S15B 4JW0A 4OIKA 1MSGA 2R3ZA 1SYCA 1D1IA 5JAVA 3HG9A 4FDBA 1V1QA 3BVMA 3A56A 3FPUB 2UU9Q 4A93H 4C2MB 4ME3A 1YBYA 2X69A 2QF7A 2F0GA 4BBSB 2IHFA 2CQAA 1L0WA 3RLOA 5EKLA 4C3IB 3I70A 1WTRA 3G7LA 2VQFL 4ZRZA 5IGDA 1SJED 4BXXH 3UDGA 2WAQG 2K75A 2FINB 1X55A 3S2HH 2LXKA 1KC8C 5C5LA 3O13A 5A35A 3I90A 4HIDA 3OMGA 3KJOA 2PQEA 1H9SA 4A3MG 1DCZA 1BBUA 5D65A 1VQOA 2YTVA 1KAWA 4B3RQ 2A68C 4POGA 1EOVA 4DR5Q 1GXDC 1EIYB 3CCVA 2VW9A 4DNRB 2E2IH 4V190 5GROA 1Y14B 3J80c 1ASZA 2G9HD 3CHBD 2QDBA 2KCTA 1KDCA 3QO2A 3DUZA 3RMHA 4X64L 3T13A 1D1KA 3CU7A 4PZ6A 1V8QA 5KRUA 1HR0Q 4U68A 1I4XA 3KK7A 3RUZA 3KLSX 2PZTA 1SR3A 1VQBA 1Z6HA 1ZYRC 3NUCA 3CF5A 4L5QA 1TWAB 2JXMB 3HOYB 5C3EG 4LFBL 1RDPD 3EFXD 4HR7B 4DR1L 1WVLA 3PIP3 3H3VC 4IJLA 4A3MH 1B4OA 4LF8L 2UXCL 3S14B 2KECA 5DEHA 2Q2IA 4ZAIA 4LF4L 4LF7L 3CPFA 4WFN3 2E2JB 2BE5C 1XNRQ 1F2LA 2NN6I 1PHJA 1TS3A 3KYHC 4B3MQ 1HJPA 4DUYL 1TWGH 2AQ3B 2L5TA 3A8IE 2NZ1D 1RTNA 1F2MA 4NXNQ 3MXPA 3HFZB 4QIWB 3UE0A 1AW7A 4A3DB 3GTQH 2MP1A 4KD4A 4UP9A 1XMQQ 2BCOA 4KJOA 1BUVT 1YJ9A 3F2CA 2B2TA 4ILWA 1GVPA 4N8X1 4DN4M 1WD1A 1SNMA 1Y1WB 4OX9L 1B8AA 3BJUA 2JA6G 2B3GA 1WTPA 1XXGA 1BOSA 4FXKC 1DYQA 4AH6A 1TWCB 3DM3A 4N9PA 3PF5A 4C3JG 4O0AA 3W5OA 5C3EH 4JI0L 4X65Q 3OW7A 4A3EG 5DM63 4AQYQ 5IODA 2F52A 1VF5C 4OWXB 1PFMA 1TS5A 2CW0C 4J6HA 2AHOB 4S3SA 1JE4A 2PYKA 3MTSA 4LNQA 2PZWA 4LK1C 3K7AH 5IWAQ 2R7ZG 4R4CA 4B08A 2KHJA 3ONAB 4ME5A 1C7YA 3T51B 1XX8A 1EY7A 4DR3Q 1C8CA 5IY0A 1SXTA 2OQ0A 3J81i 2OTJA 2ZXOA 2JA6H 1EY9A 1L2FA 3HOXG 1CFMA 3S17B 1DJRD 2ICEC 2RBMA 4A75A 2PW7A 1KNAA 4FNFA 3IKJA 1ML0D 3LWEA 3C1FA 2OEOA 3S1MB 4A3JG 3L2PA 5M3FH 4DUZQ 1I6VC 5IYBG 1Z9FA 1T5EA 4DR6L 4FYDA 2RHQB 1TIID 1M4VA 2A6ED 1VQNA 2BDNA 2R6GA 5A2QL 2R7ZH 1YITA 2J4XA 2E74C 5EAYA 2HHHL 3VA5A 3HS0C 4GNXC 2NBFA 3AMUA 5COYA 3K5LA 4A3LH 4DNIA 3HOXH 2R61A 2K33A 3H6MA 1SE4A 5BN3A 3OIQA 4PMCA 1O80A 4BY1G 3FVQA 3BZKA 2A69D 2Q2HA 4JYAQ 2D0PA 1R4QB 2GVBA 2DY7A 3A55A 4RHRA 4A3JH 4YY3Q 1S40A 1DD2A 2IW3A 4LF6L 2B2UC 2UUAQ 1K83B 4OL7A 4IUNA 2XSCA 1R9TH 3M9BA 3NTIA 1GKHA 1I4GA 1J8IA 1KLGD 1Y1VB 2WINB 1PH1A 2H5XA 1IXRA 4QQBX 3NK9A 1PRTF 1PVOA 2Q8RE 4R9WA 1L1OC 3J80L 4GOPC 1TS4A 3BYYB 5CV6A 5FJ8G 2ENBA 2JA7B 4I65A 3EN2A 3LWUA 1EFID 5CBAE 4HJ9A 2PPBC 1WD0A 1TU2B 3K7UC 1PRTD 1BR9A 1E3PA 5D14A 2B2VA 1ZXTA 1VMCA 5C44B 4HJ7A 4DAMA 1PTOH 3J81c 4ABNA 2L9HA 5I2XA 1LTLA 3DWAA 3G6JB 5FLXE 2AKWB 3TP8A 3SHLA 4R4IA 1FD7D 4C1NK 4R4QA 2NVXH 1N33Q 3IFDA 1STEA 4CJ0B 1JJCB 1D5MC 2AWOA 1XTCD 3PUVA 2DNCA 4JI3L 1X3PA 1GO3E 1SEBD 3CCQA 1KDBA 2L15A 3GTGB 3W1BA 1VQKA 4IFDJ 3Q24A 2E5LL 2JA5G 1FNUA 3FEWX 1CZWA 1JOKA 4HMJA 4IUVA 2JP1A 4DV3Q 3T1HQ 1YIJA 1KHIA 1JWSD 1A2TA 3R8BA 1ICWA 1EIGA 3HP3A 3S24A 5E7NA 3J7AF 2SDFA 3MVVA 1CQFA 1HNWL 4J15A 2B63B 3SE0A 1LO5D 1OXUA 2IX1A 4R8IA 4HJ5A 3NTKA 4DAPA 1PH6A 3KDFA 1CTMA 1YEZA 5IOCA 2H1EA 4OONA 1C48A 5FLMH 1N34Q 1IYJB 5IT9E 1WJJA 2GA4B 1NE3A 1QG7A 5IP7H 1B44D 5M3MB 1LYLA 3DWQA 3SK6A 1PYBA 1NBWA 1Y8OB 1IL2A 4KY7A 2YTXA 3NEMA 3UDFA 2XNAC 3RLNA 1X56A 1A62A 1C4QA 2M2LA 2KQ3A 4FXGC 5KNDA 1EEID 1P16A 3HOWB 4UAIA 4O1NA 1BBXC 3OMCA 1F9PA 2HUGA 3GO5A 1EU3A 3HKZB 3T56B 1XTDA 4OO1G 3D31A 4U673 3T1YQ 2B2TC 1DZ1A 3CCSA 5JOBA 5E3FA 3VDYA 1K8OA 4L8JA 3K5NA 1SYEA 2QW7A 1E7ZA 4X62L 4TKOB 5CV4A 1BO0A 1TT2A 4XXEA 3K58A 4HSVA 3GTKH 1CKMA 4QUCA 1SSOA 4QMGA 5LMUL 4JPBW 4LFAQ 2DY8A 2I07B 2JA9A 1KRTA 1TWHH 3ND8A 1GUNA 4ZLTF 3RNUA 3X3MA 4H02A 5BN4A 1YHQA 1OTCA 3LGJA 3Q23A 3RZOB 2X6GA 1I4RA 1LABA 5C4XB 3NENA 5M5YH 1I6HB 1NCVA 1PH8A 1EIFA 3AYHB 1J6QA 2E2HB 1FVIA 2NTTA 4JI6L 2HIVA 2A68D 3KBXA 1CHQD 3SXHA 3PIO3 1FGUA 3I56A 4OO1H 1C0AA 1G6PA 4R4OA 1N36Q 4CDEC 2XRQD 3M4PA 3U50C 2JK8A 4X3TA 2F1MA 1ZKOA 5HURA 3FKIB 1U4MA 4RGTA 2F4VQ 1K8GA 1STHA 1VQDA 2J0TD 4B9WA 1PRTB 1ZEQX 1EYDA 2WFWA 4OWTB 1HZCA 1I5FA 4M1UB 2IX0A 2X6LA 1IYVA 3S1NH 4BBSG 3D3RA 2R92H 4C3IG 5CV8A 5GAHC 1SNPA 2EYFA 4A4IA 1GM5A 2E75C 3OWEB 1LTGD 1B3QA 2LFNA 4RKLA 2EY2A 1PYSB 2DJFC 2RF4A 4TRDA 3CXCA 2MFIA 2BE5D 1JMCA 5M5WH 2XWBB 1S5DD 5JEAG 2A6HC 4L5RC 4LUZA 4K0KQ 4JI4L 1I4HA 2RDGA 4C1NI 1RD9D 1HH2P 4OXPA 3MHBA 4RKBA 3MEFA 3NTHA 4BY7B 1IBLQ 2OQKA 1UE6A 3HOVB 2UUCQ 2EYJA 1IL8A 2K7VA 1STAA 1CA6A 4JI1L 4KKUA 4F88A 3PV0A 5EPKA 2PNHA 5I2YA 1YZ6A 4K8IA 4DV0L 1Q86C 4JI8L 1TY0A 4A3CG 1ILQA 2D62A 3BDLA 4K6LA 4BWGB 3S9WA 1F77A 3IRBA 3HOYG 2NVQH 1HFGA 1HNXQ 3I4OA 3CCLA 1QUQB 3DM1A 5BN5A 1I4PA 1QWYA 3AFPA 3PUWA 2CW0D 4DGZA 2ZM6Q 2MNAA 3DMUA 2JA8G 4DV4L 4IZ8A 3QWNA 3SVMA 1E2WA 1JICA 1NR2A 2ZT9C 1I3QB 2VNUD 4KY6A 5C3WA 1SJHD 1TKWB 1SFOH 1NJIC 5FO9B 3ER0A 1OXTA 3E5SA 2G9DA 3JAME 4L5SA 2NZHA 4A3DG 4JC0A 2F0NA 5DLQE 3M3YB 4PZ8A 2NZOA 3GTMB 1Y1WG 1FYCA 3KF8B 1BCPF 3DXJC 3D6WA 3RD4A 4A3CH 4DAVA 1MHWC 1GUGA 4CDFC 3RZDB 2D9UA 2NN6H 1IHZA 2YTYA 1U4LA 1RKNA 2QEXA 3VYTA 4A3KH 4FF1A 1E22A 2CH4W 1AE3A 3SK5A 2JA8H 4ZK9B 1IZ6A 3SGIA 2HD3A 2VY3A 5KYIA 3DLLA 1EWHA 1XNQL 1D2BA 3MXNB 1B9NA 2MQHA 1PTOC 1LTBD 1MGSA 2XRSD 1G8ZD 1XYIA 5FLXc 3PMFA 2NVYH 4A3DH 3I4MH 1EQTA 1PFBA 2SNSA 2PCFB 5JJLA 4NPSA 1LM0A 3VYUA 3F2UA 2PZUA 3MEHA 4IO9A 3I8ZA 2OCEA 1HNZQ 1WYDA 2A74C 3M4OH 1YVCA 4H0LC 2K03A 2UU9L 5M5XH 4CKBA 4DK6C 3EJIA 4O2DA 4OO1I 2F03A 1G2TA 1BF4A 2F0FA 1HRJA 3HOZH 1DGSA 3IL8A 1QNKA 2QCPX 2F0DA 4RGOS 5C4ZA 4YCUA 4DAYB 4AIMA 2QGQA 1ENAA 1ONLA 1D6EC 1CKOA 1KXLA 2EY5A 1Q3LA 4IOCA 1EZ6A 2JJQA 2EJGC 4K2LA 3TP7A 4B3RL 4NXML 4DR5L 4OIJA 4HJAA 4WORA 5L37A 1QE6A 4JI2Q 3NWSA 4X66Q 3D4DA 1LTAD 1UWVA 2A73B 1AEXA 4DU9A 4PQXA 3QIAA 5C0XG 1E1OA 1F9SA 5IYDH 1WTWA 3R93A 3K8AA 3H15A 3MXUA 5IGBA 4Q0FA 3A8KE 1LV9A 3S16H 2BOSA 4BA1I 2UUBQ 4NB3A 1IW7D 3AFQA 3MA2B 4QIWE 3GP7A 2VUMH 3GV6A 1LTTD 2CHBD 1N32Q 3I4NB 2PI2E 1Y1VG 4AYBB 3PGZA 4GKJQ 1AH9A 1VQ8A 3NELA 3TQYA 1IKMA 1B9MA 4HCEA 4UHVA 1M1KC 2JQOA 4B3ML 1VF7A 3Q6SA 2JA7G 3KBGA 1J9OA 3GTOB 1K3BC 1WCMB 5JJIA 2DJGC 3JC66 3BDOA 1LTID 4IPDA 4IQZA 3GTJH 2ZJPA 1EEFD 1SE3A 2F0SA 3PO2B 4XTCS 2N88A 5C44G 4LFCQ 4JOIA 2PMZB 2R93B 2SEBD 3JAMi 3HOUB 3ULLA 4DR2Q 1SNCA 4R4TA 1IBKL 5CR3A 3CC2A 2Y0SB 3MXGA 1XJVA 1RHPA 4B3SQ 4OWWB 3W1GA 2K32A 2Z0SA 4X65L 4F8MA 1Y1VH 3S1QH 3PUZA 5K5PA 4H7BA 4AQYL 5J1ZA 4A3BG 3S2DH 1TQOA 5GAGC 1WTXA 3CMAA 2VQFQ 1Y8NB 2Z6KA 3E6ZX 3FHWA 4RFBA 1SMYC 3URYA 1X3QA 3AB9A 2JA7H 5K36G 5IWAL 4GNXB 3J7YW 4MZ9A 1H95A 1L0XB 1I4QA
chains in the Genus database with same CATH topology
3C46A 1EWCA 2NB0A 3NSWA 4BA2I 4NMZA 2H4OA 2K04A 5C4JB 1JOQA 2FFKB 3ERQA 4BBRB 1SYGA 1GOZA 5CORA 3NBIA 4GZYC 5CYUA 5EBCA 3C2PA 1EY5A 4C3HB 3IAYA 2HCIA 3DEPA 2M9VA 2K5QA 4QCLA 1EYCA 5T1IA 5K36H 3R2TA 3TMEA 1DONA 3UI2A 4M8AA 1W6KA 5FOBB 2N55A 2B2YC 3GTPB 4NKLA 2A5HA 3SK8A 3FPPA 1DM0B 2BA0A 1QNUA 3MFYA 3CQZB 1H9SB 3NP8A 4MIUA 5ELCA 3A7AB 1RODA 3I4LA 1KDAA 4Q5VA 1BCPC 4R8NA 1B3AA 3W3AA 2A6HD 5FKAC 4A93B 2EYOA 1YNJD 1O7ZA 5EPJA 5DM73 2WB1B 3HRZC 1DOKA 3S2HB 1KAAA 3D8GA 5JVG3 4A3IB 4J8QA 1FGBD 4TQUS 1F9RA 2RKSA 1LACA 2K6AA 3E0JA 1F9QA 2RQXA 3K6OA 3NXWA 2E2IB 5C0XI 4IUPA 1CT1D 3OOCA 5E4WC 1HCZA 4H13C 3GQBA 3FMCA 1FR3A 3NE5B 1MSHA 4K5WA 2F0PA 2EE1A 4PMWA 4RHSA 1O7LA 2WAQB 1QJOA 1GHKA 1S5CD 1PXUA 1K8MA 3W2DA 2WKCA 4QUFA 1L0YB 1EZ8A 4A3MB 4ZQ3A 3H94A 1A3UA 2AUKA 1EY6A 3SK4A 1HUMA 3NHHA 3OPOA 1JR0D 3Q0AA 3NQTA 1TWGB 1PTOF 1OXVA 1LTSD 1OXSC 3GTQB 2K28A 3D4RA 3K57A 3C3LA 2AUJD 3K5OA 1PTOD 5G3LF 1SNDA 4XIGS 4KHZA 4DFAA 5C3EB 1U4PA 1UNSA 1G91A 3MC0B 1M8AA 4X3SA 2IX3A 2EY1A 2F0EA 2L4NA 3AU7A 4FVMA 4XQQA 5KIXA 4EQOA 5FO7B 3BVGA 1IYUA 5TSSA 1RJTA 2WKDA 2EPBA 4E6IA 1EQVA 2JA6B 4B9XA 1JC7A 3P1HA 4CBVA 2NVTB 5A2QE 1JORA 2IT1A 1LT3D 3BG3A 4N9TA 3P75A 3ZYYX 5M3FB 2MJ8A 1QCBD 1QILA 3OIPA 2K05A 4P2CB 4TSSA 3Q22A 1UUPA 1BXTA 4HEDA 4DA2A 1WTVA 1HPCA 3WOEA 5IIFA 3M85A 1O7YA 4DXGA 1KLUD 2BDOA 3VR6A 2PO4A 1CQVA 5LL6X 1SNOA 1QB5D 2EOTA 4FF4A 2AQ2B 3KF8A 2YYZA 4O42A 5F2DA 4RGMA 5HGTA 3J80E 1Q1EA 2WP8J 4A3JB 4DNTB 3QB3A 3TZUA 2OXPA 2F0LA 2DN8A 3SDZA 2HDMA 1ZYRD 2FJ2A 4G7HC 2SNMA 4MHEA 5FO8B 2F3WA 1O78A 2EYHA 2KCNA 3EQLC 2MHVA 4ODGA 4QF4A 2KVMA 3D4WA 2PNRC 2AWNA 2B39A 1CA5A 1OXXK 4KN7C 4XYQA 2TSSA 1PTOB 5FK9C 4IUTA 1AZPA 1PZJD 2F0UA 1F2YA 2C9OA 1HHVA 5M9OA 2NVXB 4RWSC 4X3KA 3J81L 1MBYA 5ELEA 1EOTA 4ZYSA 4LAAA 4RAUC 5NUCA 4K5VA 2A6EC 3U9OA 3M7NA 1VMPA 3VYRA 4FF2A 1JB3A 1H9RA 3P7JA 2Q8IB 4FO2A 1WTQA 1EIHA 2Q8TA 2HDLA 1KNEA 5JPMC 1JOOA 4NW2A 2K5WA 5JEAH 4IALA 4ID6A 2BA1A 2A69C 1XWEA 3QOLA 4G7ZC 1Q12A 4RCOA 5CMDA 2B2VC 1HUNA 4HCSA 4K2KA 3K59A 4PMBA 2XVSA 3FDTA 1EY0A 1STGA 4DK0A 1ENCA 1Z7TA 1SAPA 4IUQA 4KTAA 4C3HG 4LJZC 1BCPD 4CGYB 3EROA 2Z1CA 2VB2X 3GD7A 3QJYA 2FMCA 5KGUA 4KKSA 3GTKB 2O2LD 2KUMA 4IFDG 1TWHB 5LL6S 3HGBA 1GUSA 1F2ZA 5EKKA 5M5YB 2L11A 1STYA 2DNEA 2RSOA 2JE6I 1VCIA 1YNNC 3PO3B 2KHSA 2WV6D 2E2DC 4RGNA 1LLRD 3MAQA 1HA5A 3FRPB 4HTHA 5EBDA 2JYOA 1SYFA 2F0VA 3S1NB 4XYOA 5E4XA 2R92B 1B1ZA 4DK1A 2EJFC 3T4AC 1JCKB 4CJ1B 2FMMA 3VA7A 2QKIC 4KV6A 2Z8LA 4IURA 3HZXA 2K1BA 2PW5A 3QG1A 2B2UA 5AFWA 1DOLA 1STNA 3RLFA 5M5WB 3TP6A 3TSSA 1S5BD 3L9AX 4H44C 4XDXA 4L63B 5ELFA 2SOBA 4I7ZC 4KK7A 5KEEA 5C3XA 3TP5A 4EVOA 5ISRA 5KNBA 1PLFA 2NVQB 3VR4A 3X3NA 5C0XH 4HMIA 3T16A 4HN7A 1EU4A 1G291 1I50B 2B8FA 3ITPA 2LKVA 2IPKD 2NWGA 1U9RA 1D5XC 1V1PB 2V4DA 4XQJA 1ESRA 5J22A 3D6CA 3EA6A 1SFOB 2D5DA 3R2IA 2O5JC 1U4RA 2QILA 4CJ2C 1GUOA 2O4XA 1BCPB 2MGSA 4G7OC 4FF3A 3VR3A 1H9JA 1KABA 4EQNA 4HSPA 3A8JE 2F0HA 4LMQD 1CK1A 3ND9A 2LS01 2EYPA 1EL0A 1SYBA 4C56C 1A3VA 2K5DA 4A3KB 2RA4A 2JA8B 3KLRA 3I3CA 3CKIB 4NDXA 2RVLA 2F0WA 5I9PA 3K5MA 3KLSA 2KA7A 2B8GA 2NVYB 2E76C 3I4MB 2J7ZA 3N6RA 2EZVA 1LT5D 2VXWA 1W6JA 3M4OB 1PMRA 4ULLA 5ELBA 2HCCA 2F0OA 5FLXL 1HTLD 5M5XB 2F4IA 4K5XA 3DWPA 2D2CC 1DOMA 3VR5A 3HOZB 3M7GA 4BS9A 4HAEA 3N52A 1X32A 1BQQT 4IFDI 2MUYA 5IGEA 4DXFA 2F0JA 2FHTA 3PUXA 4RA8A 3BDCA 5DNFA 4CKEA 2AQ1B 3T53B 5IT9L 5JJZA 5IGFA 1GUTA 2VB3X 2WIIB 4CHTB 3S16B 1AZQA 1LTRD 3U9SA 5JEAJ 5CV7A 2B2WA 1SBBB 5IGCA 2VUMB 1RCVD 5JPNC 1BDOA 2L0CA 2L1BA 4V0BA 2XIWA 2OT2A 1H9MA 1HQMC 1AFPA 2KEDA 5I6WA 2LMCB 1G2SA 1E0BA 4X3UA 1BNZA 4PV1C 5I6YA 5E1FA 3J7AV 2JEBI 1TR5A 3LX0A 3GTJB 1NSNS 1EY4A 1Q8IA 5I4DA 3BS1A 4OGQC 4FXDA 1HA6A 3V96A 2XWJB 1MD2D 4ZUJA 1RF2D 4ZKBB 2KCCA 2K01A 1Q1BA 3TN2A 3L3OC 1SDFA 3S1QB 4WJWA 1Y8PB 1HQRD 3S2DB 2EYMA 5LHY1 1A2UA 4JBWA 2KEEA 2F0TA 1LT4D 3EVQA 3KUPA 2F3VA 2RSNA 5I9OA 1A3TA 4PNYA 5CV5A 4KMUC 3BYTB 3PUYA 5C4HA 2KOLA 3CRLC 1JQYD 3I91A 2EXZA 1WTOA 2L12A 1GUWA 1IW7C 1ET6A 4Z9CB 5DAUA 5G3LD 1ET9A 4A3BB 1YNND 2C5CA 2F0KA 1JWMD 1B2TA 3K7AB 3NQIA 4J1MA 4XT3B 1CI3M 4JK1C 2IJ0A 1Y69U 2EJMA 3NPPA 4YIJA 2M00A 3BVZA 1GJXA 1HXYD 3P20A 4C3JB 4KY5A 2JSOA 4EQPA 4A3EB 1PZID 2RDHA 2CVRA 1EYAA 4NP5A 2HQEA 3H91A 1A6XA 4FP5D 4L6TB 1NUCA 3WDNA 2R7ZB 2XN9C 3JAML 1LT6D 5C0XJ 2KJXA 2IL8A 5IGGA 2EVBA 1DXMA 4A3GB 3MWYW 3IFTA 4K8JA 3HOXB 4CKCA 3A7LA 5EQ0A 1SYDA 4KD3A 2ID0A 4K6DA 1PZKD 2YU9B 2MPMA 1E2ZA 3BZDB 1CHPD 5EKIA 4KKTA 1PDQA 3I72A 3OSOA 1TS2A 1V1OA 3M4YA 1ILPA 1CM9A 1R9TB 5D3IB 4F87A 4G4KA 4KJNA 1AP0A 3MXNA 1AN8A 2RDFA 4K14A 1NAPA 1PFNA 4BY1B 3GTLB 1SMYD 2EY6A 1FNWA 2WACA 2B2WC 3L7ZC 1CZGA 4UDUC 2F0IA 2TMPA 1GHJA 3NBHA 1VDZA 5J39A 3GV3A 1UAPA 4ZKCB 4DAYA 1G6ZA 1YNJC 3CRKC 1Q90A 3LNNA 1ESFA 1TVXA 2ICIA 4IUUA 3TZDA 5CGKA 1ENFA 2OF1A 4A3FB 1S5FD 4ZUIA 1MI2A 1OO9B 1STBA 3K0YA 3H09A 1KTKA 4MN3A 1S4ZA 2NN6G 3I73A 3SEBA 3NWTA 2ZXRA 4EGVA 4OHJA 5JVH3 3MZ5A 5KNCA 2I46A 1SNQA 4RH6A 1E2VA 2EYLA 2Z4IA 5C6AA 1UEAB 5EPLA 2JA5B 1RTOA 3VYSA 3R3OA 2QEJC 2Z4HA 4IN3A 1FNVA 3HEJA 2NYZD 3QOJA 1II3A 2L55A 1PRTC 1H9KA 3V2TA 2B2YA 4WRDA 2NUCA 5EGTA 3TBIB 1TWFB 1HFNA 1B53A 1TY2A 3SR1A 2LY7A 5KYLA 1V1PA 2F0QA 2EDGA 4XT1B 1A15A 3OWFA 2IWHA 5C5MA 4XQNA 3H0GB 1NR4A 5CC4A 3WOFA 2NTSA 3V05A 2O5IC 4KI0A 5D3DA 5EJWA 3OHXC 4RCNA 5T1GA 4G57A 2ZXPA 5ELDA 4F7XA 3VR2A 1V43A 1Z47A 3A54A 1JWUD 1SE2A 1D5ZC 2JEAI 5CBEE 2F0MA 4KHVA 3DEOA 3DHQA 3MFGA 4KN4C 4IFDH 1EY8A 5CV9A 4QB4A 3TDQA 1IKLA 1HTPA 1QOHA 4DF7A 1S5ED 3S1RB 1T5XD 1R4PB 3J81E 4Y7NB 3C1EA 1B50A 1PYWD 3S15B 4OIKA 1MSGA 2R3ZA 1SYCA 1D1IA 5JAVA 3HG9A 3BVMA 3FPUB 3A56A 4C2MB 2X69A 2QF7A 2F0GA 4BBSB 2CQAA 5EKLA 4C3IB 3I70A 1WTRA 3G7LA 4ZRZA 5IGDA 1SJED 2FINB 5C5LA 3O13A 5A35A 3I90A 3OMGA 2PQEA 1H9SA 1DCZA 5D65A 2A68C 1GXDC 4DNRB 4V190 2G9HD 3CHBD 2QDBA 1KDCA 3QO2A 3DUZA 3RMHA 3T13A 1D1KA 3CU7A 1V8QA 5KRUA 4U68A 1I4XA 3KK7A 3RUZA 3KLSX 2PZTA 3NUCA 1Z6HA 1ZYRC 1TWAB 2JXMB 3HOYB 1RDPD 3EFXD 4HR7B 1WVLA 3PIP3 3H3VC 1B4OA 3S14B 2KECA 5DEHA 4ZAIA 4WFN3 2E2JB 2BE5C 1F2LA 2NN6I 1TS3A 2AQ3B 2L5TA 3A8IE 2NZ1D 1RTNA 1F2MA 3MXPA 4QIWB 1AW7A 4A3DB 2MP1A 4KD4A 2BCOA 4KJOA 1BUVT 2B2TA 4ILWA 4DN4M 1WD1A 1SNMA 1Y1WB 1WTPA 1XXGA 1BOSA 4FXKC 1DYQA 1TWCB 4N9PA 4C3JG 3OW7A 5DM63 5IODA 1VF5C 1PFMA 1TS5A 2CW0C 4J6HA 4S3SA 1JE4A 2PYKA 3MTSA 2PZWA 4LK1C 4B08A 3ONAB 4ME5A 3T51B 1XX8A 1EY7A 1C8CA 1SXTA 2ZXOA 1EY9A 1CFMA 3S17B 1DJRD 2ICEC 2RBMA 2PW7A 1KNAA 4FNFA 3IKJA 1ML0D 3LWEA 3C1FA 2OEOA 3S1MB 1I6VC 1T5EA 4FYDA 1TIID 1M4VA 2A6ED 2BDNA 2R6GA 5A2QL 2J4XA 2E74C 3VA5A 3HS0C 2NBFA 3AMUA 5COYA 3K5LA 2R61A 2K33A 3H6MA 1SE4A 5BN3A 3OIQA 4PMCA 1O80A 3FVQA 2A69D 1R4QB 2DY7A 3A55A 4RHRA 1DD2A 2IW3A 2B2UC 1K83B 4OL7A 4IUNA 2XSCA 3NTIA 1I4GA 1J8IA 1KLGD 1Y1VB 2WINB 3NK9A 1PRTF 2Q8RE 4R9WA 3J80L 1TS4A 3BYYB 5CV6A 2ENBA 2JA7B 4I65A 3LWUA 1EFID 5CBAE 2PPBC 1WD0A 1TU2B 1PRTD 1BR9A 5D14A 2B2VA 1ZXTA 1VMCA 5C44B 1PTOH 4ABNA 2L9HA 5I2XA 3DWAA 3G6JB 5FLXE 3TP8A 3SHLA 4C1NK 1FD7D 3IFDA 1STEA 4CJ0B 1D5MC 2AWOA 1XTCD 3PUVA 2DNCA 1X3PA 1SEBD 1KDBA 3GTGB 4IFDJ 3Q24A 1FNUA 3FEWX 1CZWA 1JOKA 4HMJA 4IUVA 2JP1A 1JWSD 1A2TA 3R8BA 1ICWA 1EIGA 3HP3A 3J7AF 2SDFA 3MVVA 1CQFA 2B63B 3SE0A 1LO5D 1OXUA 2IX1A 4R8IA 3NTKA 4DAPA 1CTMA 5IOCA 2H1EA 1C48A 5IT9E 2GA4B 1QG7A 1B44D 5M3MB 3DWQA 3SK6A 1Y8OB 4KY7A 2XNAC 1C4QA 2M2LA 2KQ3A 4FXGC 5KNDA 1EEID 3HOWB 4UAIA 4O1NA 1BBXC 3OMCA 1F9PA 2HUGA 3GO5A 1EU3A 3HKZB 3T56B 4OO1G 3D31A 4U673 2B2TC 1DZ1A 5JOBA 5E3FA 1K8OA 4L8JA 3K5NA 1SYEA 4TKOB 5CV4A 1BO0A 1TT2A 4XXEA 3K58A 4HSVA 4QUCA 1SSOA 4QMGA 2DY8A 2I07B 3ND8A 1GUNA 4ZLTF 3X3MA 5BN4A 3RZOB 3Q23A 2X6GA 1I4RA 1LABA 5C4XB 1I6HB 1NCVA 2E2HB 2NTTA 2A68D 3KBXA 1CHQD 3SXHA 3PIO3 4OO1H 2XRQD 4X3TA 2F1MA 1ZKOA 5HURA 3FKIB 1U4MA 4RGTA 1STHA 2J0TD 4B9WA 1PRTB 1ZEQX 1EYDA 4M1UB 2IX0A 2X6LA 1IYVA 3D3RA 4C3IG 5CV8A 1SNPA 2EYFA 2E75C 3OWEB 1LTGD 2LFNA 4RKLA 2EY2A 4TRDA 2BE5D 2XWBB 1S5DD 5JEAG 2A6HC 1I4HA 2RDGA 4C1NI 1RD9D 3MHBA 4RKBA 3NTHA 4BY7B 3HOVB 2EYJA 1IL8A 2K7VA 1STAA 1CA6A 4KKUA 4F88A 3PV0A 5EPKA 5I2YA 4K8IA 1TY0A 1ILQA 2D62A 3BDLA 4K6LA 4BWGB 3S9WA 1F77A 1HFGA 3DM1A 5BN5A 1I4PA 1QWYA 3PUWA 2CW0D 4DGZA 3DMUA 4IZ8A 3QWNA 3SVMA 1E2WA 1JICA 1NR2A 2ZT9C 1I3QB 2VNUD 4KY6A 5C3WA 1SJHD 1TKWB 5FO9B 1OXTA 3E5SA 2G9DA 3JAME 2F0NA 3M3YB 3GTMB 1FYCA 1BCPF 3DXJC 3D6WA 3RD4A 4DAVA 1GUGA 3RZDB 2D9UA 2NN6H 1IHZA 1U4LA 1RKNA 3VYTA 4FF1A 3SK5A 4ZK9B 5KYIA 1EWHA 1D2BA 1B9NA 1PTOC 1LTBD 1MGSA 2XRSD 1G8ZD 1XYIA 3PMFA 1EQTA 1PFBA 2SNSA 2PCFB 3VYUA 3F2UA 2PZUA 3MEHA 3I8ZA 2A74C 4H0LC 2K03A 4CKBA 3EJIA 4OO1I 2F03A 1G2TA 1BF4A 2F0FA 1HRJA 3IL8A 1QNKA 2QCPX 2F0DA 4RGOS 5C4ZA 1ENAA 1ONLA 1D6EC 2EY5A 1Q3LA 1EZ6A 2EJGC 4K2LA 3TP7A 4OIJA 4WORA 1QE6A 3NWSA 3D4DA 1LTAD 2A73B 4DU9A 1AEXA 4PQXA 3QIAA 5C0XG 1F9SA 1WTWA 3R93A 3MXUA 5IGBA 4Q0FA 3A8KE 1LV9A 2BOSA 4BA1I 1IW7D 3MA2B 3GP7A 3GV6A 1LTTD 2CHBD 3I4NB 4AYBB 1IKMA 1B9MA 4HCEA 1VF7A 3Q6SA 3GTOB 3KBGA 1J9OA 1WCMB 3BDOA 1LTID 4IQZA 1EEFD 1SE3A 2F0SA 3PO2B 4XTCS 2N88A 2PMZB 2R93B 2SEBD 3HOUB 1SNCA 5CR3A 2Y0SB 3MXGA 1RHPA 2K32A 4F8MA 3PUZA 5K5PA 4H7BA 5J1ZA 1TQOA 1WTXA 1Y8NB 3E6ZX 4RFBA 1SMYC 3URYA 1X3QA 3AB9A 5K36G 3J7YW 1L0XB 1I4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3L A;  3G7L A;  5DNF A;  1AZP A;  2L11 A;  3DM1 A;  1AP0 A;  1BO0 A;  1PFM A;  5JJZ A;  1U4R A;  1RJT A;  2FIN B;  2RSO A;  2EPB A;  2K04 A;  1F9Q A;  4CJ2 C;  5CBA E;  1JE4 A;  3MTS A;  4HSV A;  4QUC A;  1SSO A;  1WD0 A;  1HHV A;  2B2Y A;  2FFK B;  1AZQ A;  4OIJ A;  2DY8 A;  4RWS C;  2MGS A;  1QE6 A;  2B2V A;  4IUP A;  5D14 A;  4X3K A;  4ZLT F;  5COR A;  3I90 A;  1ZXT A;  5E4W C;  1B2T A;  1VMC A;  2B2W A;  1HFN A;  1B53 A;  3ONA B;  1JIC A;  3SVM A;  1NR2 A;  2X6G A;  1NAP A;  5D65 A;  1EOT A;  2L9H A;  4LMQ D;  1PFN A;  4RAU C;  1XX8 A;  1F9S A;  1WTW A;  1C8C A;  1MSH A;  1NCV A;  2L1B A;  2XIW A;  4XT3 B;  3R93 A;  2EE1 A;  1VMP A;  4XT1 B;  2MJ8 A;  2HCI A;  3DEP A;  1EL0 A;  1LV9 A;  3IFD A;  4CJ0 B;  2JYO A;  2B2W C;  3KBX A;  1A15 A;  3P7J A;  2K05 A;  1WTQ A;  1EIH A;  2Q8T A;  2HDL A;  1KNE A;  2KED A;  1KNA A;  5E4X A;  1NR4 A;  1G2S A;  1E0B A;  1X3P A;  2RA4 A;  4HED A;  3QO2 A;  4X3U A;  4QUF A;  3D6W A;  4NW2 A;  4CJ1 B;  5T1I A;  1BNZ A;  2FMM A;  3GV6 A;  1ML0 D;  4X3T A;  3LWE A;  3I3C A;  1WTV A;  1DON A;  2RVL A;  5EJW A;  3UI2 A;  1U4M A;  5T1G A;  2D9U A;  4U68 A;  3GV3 A;  1U4L A;  1HUM A;  1O7Y A;  4IUR A;  2K1B A;  4IUV A;  4ZKC B;  2N55 A;  2JP1 A;  2B2U A;  1G6Z A;  5AFW A;  2CVR A;  1IKM A;  2B2Y C;  2X6L A;  2J7Z A;  1DOL A;  1ICW A;  1EIG A;  5CMD A;  2B2V C;  2BDN A;  5CBE E;  3H91 A;  3HP3 A;  3DEO A;  1WVL A;  1HA6 A;  1TVX A;  2EOT A;  3Q6S A;  1J9O A;  2SDF A;  2VXW A;  4ZK9 B;  1B4O A;  1HUN A;  2K28 A;  4HCS A;  4IUU A;  2KEC A;  4O42 A;  3TZD A;  4R8I A;  2HCC A;  4ZAI A;  4ZKB B;  2H1E A;  2K01 A;  1MGS A;  1XYI A;  4XDX A;  3TN2 A;  1SDF A;  3FDT A;  1IKL A;  5COY A;  1F2L A;  2IL8 A;  2N88 A;  1MI2 A;  1EQT A;  1PFB A;  1SAP A;  2NZ1 D;  1QG7 A;  1DOM A;  1RTN A;  1ROD A;  4IUQ A;  3F2U A;  1O80 A;  4MN3 A;  3MWY W;  2HDM A;  1B3A A;  2KEE A;  2MP1 A;  1S4Z A;  3I8Z A;  2FJ2 A;  1U4P A;  1RHP A;  3KUP A;  2K03 A;  2DY7 A;  4MHE A;  5EQ0 A;  2B2T A;  2RSN A;  1B50 A;  1G91 A;  4DN4 M;  1WD1 A;  1M8A A;  1O7Z A;  1X32 A;  2M2L A;  3N52 A;  4HAE A;  4X3S A;  5EPJ A;  1PLF A;  1G2T A;  2MPM A;  4OIK A;  1WTP A;  1MSG A;  4UAI A;  1BF4 A;  2B2U C;  2R3Z A;  5EPL A;  1BBX C;  1DOK A;  1F9P A;  2HUG A;  5EKI A;  1HRJ A;  2KVM A;  1WTX A;  1RTO A;  2L4N A;  1PDQ A;  1J8I A;  1IL8 A;  2KUM A;  2KOL A;  1QNK A;  3FPU B;  3IL8 A;  1CA6 A;  2B2T C;  5EPK A;  3I91 A;  1X3Q A;  1CA5 A;  1DZ1 A;  2NWG A;  2Q8R E;  2X69 A;  1ILP A;  1CM9 A;  4R9W A;  1ILQ A;  2NYZ D;  1WTO A;  2L12 A;  2FHT A;  1GUW A;  1F9R A;  4RA8 A;  1ESR A;  4IUT A;  1WTR A;  1HFG A; 
#chains in the Genus database with same CATH topology
 3C46 A;  3ULJ A;  1EWC A;  2NB0 A;  2KBN A;  3NSW A;  4BA2 I;  4NMZ A;  2H4O A;  2K04 A;  5C4J B;  2B63 G;  1JOQ A;  2E8G A;  2FFK B;  3EBE A;  3ERQ A;  4BBR B;  1SYG A;  1GOZ A;  5COR A;  3NBI A;  4GZY C;  4PZ7 A;  5CYU A;  5EBC A;  3C2P A;  4KLK A;  1EY5 A;  4C3H B;  4A76 A;  3IAY A;  2HCI A;  3DEP A;  1S3O A;  2M9V A;  4A3B H;  2K5Q A;  4QCL A;  1BBW A;  1X3E A;  1EYC A;  1VQ9 A;  4LF9 Q;  4JI7 L;  1X6O A;  1B70 B;  5T1I A;  5K36 H;  3R2T A;  1L1O B;  4JBM A;  4GOP B;  3TME A;  1DON A;  3HKZ G;  3UI2 A;  4M8A A;  4I7A A;  4DR1 Q;  1W6K A;  5FOB B;  4LF8 Q;  2N55 A;  4LF4 Q;  2B2Y C;  4A3G G;  4EQ5 A;  3CC7 A;  3GTP B;  4JI5 Q;  4P71 A;  4NKL A;  4HIO A;  2A5H A;  4C3J H;  1Q7Y C;  3SK8 A;  4A3E H;  3FPP A;  1DM0 B;  2BA0 A;  2UXB Q;  1QNU A;  1VS0 A;  3F8T A;  3MFY A;  3CQZ B;  1H9S B;  4YHH Q;  3NP8 A;  4MIU A;  1CSP A;  1SE8 A;  5ELC A;  3JAM c;  3A7A B;  4YY3 L;  5C4X G;  1ROD A;  3I4L A;  1EFW A;  1KDA A;  4Q5V A;  1BCP C;  2UUA L;  2ZJR A;  4R8N A;  1B3A A;  3W3A A;  2A6H D;  5FKA C;  4A93 B;  4WJ3 M;  3RN5 A;  2EYO A;  1YNJ D;  1KQS A;  1O7Z A;  5EPJ A;  5DM7 3;  1Q46 A;  2WB1 B;  2CKZ B;  3I7F A;  3HRZ C;  1DOK A;  4P72 A;  3S2H B;  1X54 A;  4A3G H;  1KAA A;  4GN5 A;  1VQF A;  1VQ4 A;  4IPG A;  1IBM Q;  3D8G A;  1SN8 A;  5JVG 3;  4A3I B;  4J8Q A;  1FGB D;  1PH2 A;  4TQU S;  1F9R A;  2RKS A;  5AJ3 L;  2YU9 H;  1LAC A;  2K6A A;  3E0J A;  3RN2 A;  3E9I A;  1F9Q A;  5JJK A;  2RQX A;  1K0S A;  3K6O A;  4ALP A;  3CCM A;  3NXW A;  5IYB H;  4UY8 C;  2E2I B;  4JBJ A;  5C0X I;  4IUP A;  1CT1 D;  1VQJ A;  3OOC A;  3A5U A;  5E4W C;  1HCZ A;  4H13 C;  3GQB A;  2KHI A;  3FMC A;  1FR3 A;  3NE5 B;  4QJF A;  4DV6 Q;  1MSH A;  4K5W A;  2F0P A;  2EE1 A;  4PMW A;  4RHS A;  1VQ7 A;  1T9H A;  1O7L A;  2A8V A;  2PQA A;  2WAQ B;  1QJO A;  1GHK A;  1S5C D;  3OYY A;  2ALY B;  1PXU A;  1K8M A;  3E3X A;  4DV3 L;  3T1H L;  3W2D A;  4DR6 Q;  2WKC A;  4QUF A;  4BY7 G;  1L0Y B;  1EZ8 A;  4A3M B;  4ZQ3 A;  1YHB A;  3H94 A;  4BY1 H;  1A3U A;  4A3F G;  3GTL H;  2AUK A;  1EY6 A;  1FJG Q;  3SK4 A;  1HUM A;  4GN4 B;  3NHH A;  3OPO A;  4PG3 A;  1JR0 D;  3Q0A A;  1KRS A;  2EIF A;  3NQT A;  1TWG B;  1PTO F;  3HKZ E;  1N34 L;  1YI2 A;  1OXV A;  1LTS D;  1OXS C;  3GTQ B;  2K28 A;  3D4R A;  3G4S A;  3K57 A;  3ULP A;  3C3L A;  2AUJ D;  3K5O A;  1PTO D;  5G3L F;  1SND A;  2K5V A;  1K28 A;  4XIG S;  5FJ8 H;  1YJW A;  1A8V A;  4KHZ A;  4DFA A;  4WJ4 A;  3E0E A;  2I0Q A;  2ZJQ A;  2CCZ A;  4LF6 Q;  5C3E B;  3G6E A;  1U4P A;  2RHS B;  1UNS A;  3T1Y L;  4RMF A;  4A3F H;  1K9M C;  1G91 A;  3MC0 B;  1M8A A;  4X3S A;  2IX3 A;  2EY1 A;  5BR8 L;  2F0E A;  2L4N A;  3AU7 A;  1D7Q A;  2V1C C;  4FVM A;  4XQQ A;  5KIX A;  1XPR A;  4EQO A;  4JV5 Q;  4LFA L;  5FO7 B;  3BVG A;  1IYU A;  3CAM A;  2Z6K C;  4GKK Q;  5TSS A;  1RJT A;  2WKD A;  2JA5 H;  2EPB A;  4E6I A;  1BVS A;  1EQV A;  3CME A;  2JA6 B;  3A5Z B;  4B9X A;  1JC7 A;  3P1H A;  3H0G G;  4CBV A;  2NVT B;  1VQ6 A;  5A2Q E;  1JOR A;  2IT1 A;  1LT3 D;  3BG3 A;  4N9T A;  4LUO A;  3CD6 A;  4DV1 Q;  3GDE A;  1N8R C;  1MKH A;  4KHP L;  4JI3 Q;  1N36 L;  3P75 A;  3FP9 A;  3ZYY X;  2YV5 A;  2DUD A;  2BH8 A;  4DV7 Q;  3I2Z A;  5M3F B;  2MJ8 A;  1QCB D;  1QUQ A;  1QIL A;  2F4V L;  2XGT A;  1EQR A;  3OIP A;  2K05 A;  4P2C B;  1XMO Q;  4TSS A;  3Q22 A;  1TWF H;  1UUP A;  1BXT A;  4N8F A;  4HED A;  4DA2 A;  1WTV A;  1HPC A;  2HIX A;  2LSS A;  3WOE A;  5IIF A;  2RCF A;  3M85 A;  1X9N A;  1O7Y A;  4DXG A;  1KLU D;  2BDO A;  3VR6 A;  2C35 B;  2PO4 A;  3H0G H;  1CQV A;  1UE7 A;  5LMN Q;  5LL6 X;  1SNO A;  1QB5 D;  2EOT A;  4FF4 A;  1U5K A;  2AQ2 B;  3KF8 A;  3CW2 C;  2YYZ A;  1CSQ A;  4O42 A;  5F2D A;  4JG2 A;  4RGM A;  5HGT A;  4K0K L;  3J80 E;  1Q1E A;  2WP8 J;  4A3J B;  4DNT B;  3QB3 A;  3TZU A;  1PH3 A;  2OXP A;  3BZC A;  2CFM A;  2F0L A;  1IBL L;  2DN8 A;  3SDZ A;  2HDM A;  1ZYR D;  3OTO L;  2FJ2 A;  4B3T Q;  4G7H C;  2SNM A;  4MHE A;  5FO8 B;  4UP8 A;  2F3W A;  1O78 A;  2EYH A;  2KCN A;  3EQL C;  2MHV A;  4ODG A;  4QF4 A;  3S1R H;  1HNX L;  2KVM A;  3D4W A;  4YCW A;  2PNR C;  3I4N G;  2AWN A;  1MIU A;  4Y7N H;  2B39 A;  1S72 A;  1CA5 A;  3KF6 A;  3HKS A;  2Q2U A;  3PF4 A;  1OXX K;  4KN7 C;  4XYQ A;  2TSS A;  1PTO B;  5FK9 C;  4DV2 L;  1QVG A;  4IUT A;  3S15 H;  1AZP A;  1PZJ D;  2F0U A;  1F2Y A;  1SRO A;  2GN5 A;  2C9O A;  1HHV A;  1WOC A;  1WCM G;  5M9O A;  2NVX B;  4CDD C;  4RWS C;  4C2M H;  1NY4 A;  1YHA A;  4X3K A;  4JI6 Q;  3J81 L;  1MBY A;  2Q2T A;  4BBS H;  3KFU A;  5ELE A;  4C3I H;  1EOT A;  4LAA A;  4ZYS A;  4RAU C;  3Q8D A;  5NUC A;  4K5V A;  2A6E C;  3U9O A;  2R93 G;  3HOU G;  3M7N A;  1VMP A;  1VQC A;  3VYR A;  4FF2 A;  1JB3 A;  2Y0S G;  1H9R A;  2DGY A;  1PV4 A;  3P7J A;  2Q8I B;  1J5E L;  4Y52 H;  4FO2 A;  1WTQ A;  4MTN A;  1EIH A;  2Q8T A;  2HDL A;  1KNE A;  5IP9 G;  5JPM C;  1YJN A;  1JOO A;  4NW2 A;  2K5W A;  5JEA H;  4IAL A;  4ID6 A;  2BA1 A;  2K4K A;  4QL5 A;  1CUK A;  2A69 C;  2K52 A;  1XWE A;  3QOL A;  4G7Z C;  1Q12 A;  4LF5 L;  4RCO A;  5CMD A;  2B2V C;  1HUN A;  4HCS A;  4K2K A;  3K59 A;  1E24 A;  4P73 A;  1HNZ L;  4P74 A;  4PMB A;  4BBR G;  2XVS A;  1TWA H;  3FDT A;  1EY0 A;  1STG A;  4DK0 A;  1ENC A;  3HOY H;  1Z7T A;  1SAP A;  4IUQ A;  4KTA A;  4C3H G;  5IP9 H;  2ZTE A;  4LJZ C;  1BCP D;  3S14 H;  4CGY B;  3ERO A;  1I94 L;  2G5D A;  2Z1C A;  4RG1 A;  2VB2 X;  4JI1 Q;  3GD7 A;  2E2J H;  2VQE Q;  4DV0 Q;  4JI8 Q;  1MJE A;  2UXD Q;  3QJY A;  2FMC A;  5KGU A;  4KKS A;  3GTK B;  2O2L D;  2KUM A;  2CH4 A;  4IFD G;  1TWH B;  1JJ2 A;  5LL6 S;  3HGB A;  5C4J H;  1GUS A;  3G71 A;  4JI2 L;  1Y1W H;  4X66 L;  1F2Z A;  5EKK A;  5M5Y B;  2A19 A;  4DV4 Q;  2VZA A;  2L11 A;  4AYB E;  5GAD C;  3G48 A;  1STY A;  2DNE A;  2RSO A;  2JE6 I;  1VCI A;  1YNN C;  4YCV A;  1UE1 A;  1TWC H;  3PO3 B;  4UPA A;  2KHS A;  2WV6 D;  2E2D C;  4RGN A;  1LLR D;  3NBH B;  3MAQ A;  3PIO A;  1HA5 A;  3FRP B;  4LWC A;  4GNX A;  1KL9 A;  1N32 L;  4HTH A;  4A93 G;  5EBD A;  2JYO A;  2PI2 A;  1SYF A;  4GKJ L;  1Q8K A;  4JVZ A;  2F0V A;  2PMZ E;  3S1N B;  4XYO A;  5E4X A;  3TEH B;  1GD7 A;  2R92 B;  1B1Z A;  4DK1 A;  2EJF C;  5IT9 c;  3T4A C;  1JCK B;  4CJ1 B;  5IE8 A;  2FMM A;  3VA7 A;  2Y0S E;  3CPW A;  4HJ8 A;  2QKI C;  4KV6 A;  2Z8L A;  4IUR A;  1XNQ Q;  3HZX A;  2K1B A;  2PW5 A;  3QG1 A;  1PFS A;  4A3I G;  2B2U A;  1PH4 A;  5AFW A;  3S17 H;  1DOL A;  1STN A;  3RLF A;  2OWO A;  1HR0 L;  3BU2 A;  3TP6 A;  5M5W B;  4DV5 Q;  4LFC L;  3TSS A;  2N78 A;  4DR2 L;  3S1M H;  1QVF A;  1L1O A;  1BKB A;  1S5B D;  2CWP A;  3L9A X;  4GOP A;  4H44 C;  4B3S L;  2R7D A;  4XDX A;  1VQE A;  4L63 B;  3J81 j;  5ELF A;  2SOB A;  4I7Z C;  4KK7 A;  5KEE A;  4DR7 Q;  3KLW A;  4YWM A;  1QZH A;  4DR4 Q;  1SRU A;  5C3X A;  1XNR L;  3TP5 A;  2K5H A;  3AQQ A;  4EVO A;  3TS2 A;  3PSI A;  4EX5 A;  5ISR A;  5KNB A;  1PLF A;  4NXN L;  2NVQ B;  1A63 A;  1RL2 A;  2AMC B;  3VR4 A;  3X3N A;  5C0X H;  4HMI A;  4A3I H;  1XMQ L;  3T16 A;  4HN7 A;  1JJG A;  1EU4 A;  3CCU A;  1E1T A;  1G29 1;  1I50 B;  2B8F A;  3ITP A;  2LKV A;  2R7F A;  2IPK D;  2NWG A;  4NXM Q;  2IHE A;  3U4V A;  3TS0 A;  1U9R A;  1D5X C;  1V1P B;  2V4D A;  2N49 A;  4XQJ A;  1ESR A;  3STB C;  5J22 A;  3D6C A;  3EA6 A;  1K3R A;  4OEM B;  1SFO B;  2D5D A;  3R2I A;  2O5J C;  1U4R A;  1MJC A;  1K83 H;  2QIL A;  4CJ2 C;  2D0O A;  1X65 A;  1GUO A;  1CKN B;  3M4Q A;  1HZ9 A;  1VQH A;  1BCP B;  2O4X A;  2MGS A;  4G7O C;  4FF3 A;  3VR3 A;  3KOJ A;  1H9J A;  1KAB A;  4EQN A;  2P5Z X;  4LF9 L;  4HSP A;  1HZA A;  2KEN A;  3A8J E;  2F0H A;  4LMQ D;  1CK1 A;  3ND9 A;  2EXD A;  2LS0 1;  2EYP A;  3J7Z C;  1EL0 A;  1SYB A;  4MNO A;  2ATW A;  4JCV E;  4C56 C;  1A3V A;  2K5D A;  3K80 C;  1D8L A;  4DR3 L;  4A3K B;  5C44 H;  2RA4 A;  1HR0 W;  2JA8 B;  4JI5 L;  3KLR A;  3I3C A;  3CKI B;  4NDX A;  2RVL A;  1UE5 A;  2F0W A;  3A0J A;  5I9P A;  3K5M A;  3KLS A;  2KA7 A;  2B8G A;  2NVY B;  2WB1 E;  2ASB A;  1NMG A;  2E76 C;  5M3M G;  3I4M B;  2J7Z A;  3N6R A;  2UXB L;  4X64 Q;  1HZB A;  4YHH L;  2EZV A;  2Z6B A;  3GTG H;  1LT5 D;  4DUZ L;  3AEV A;  3L0O A;  1A0I A;  2VXW A;  1W6J A;  1N9W A;  3M4O B;  1PMR A;  2I5L X;  4ULL A;  2HCC A;  2F0O A;  5ELB A;  5FLX L;  2QA4 A;  1HTL D;  5M5X B;  1IBK Q;  3HOW G;  2F4I A;  4K5X A;  3DWP A;  2D2C C;  4LFB Q;  1DOM A;  3VR5 A;  2UXC Q;  3HOZ B;  5M3F G;  2B63 H;  1VQL A;  4OEL B;  3M7G A;  4LF7 Q;  1IBM L;  1EYG A;  5GQO A;  4BS9 A;  4DUY Q;  4HAE A;  3N52 A;  1X32 A;  1BQQ T;  4IFD I;  2MUY A;  5IGE A;  3K81 C;  4DXF A;  1Q81 C;  4JYA L;  1SLJ A;  5M3M H;  2WAQ E;  2F0J A;  5IYC G;  2RCN A;  4OX9 Q;  2N3S A;  2FHT A;  3PUX A;  4RA8 A;  5GAE C;  4A3L G;  3BDC A;  4QGU A;  5DNF A;  4CKE A;  3HOW H;  2AQ1 B;  2NVT H;  5J3B A;  3T53 B;  3UDI A;  5IT9 L;  5JJZ A;  5IGF A;  4DV6 L;  2K14 A;  4JI0 Q;  1GUT A;  2VB3 X;  2WII B;  4CHT B;  3S16 B;  1AZQ A;  1LTR D;  2LXJ A;  2Z9H A;  3U9S A;  5CV7 A;  5JEA J;  2B2W A;  1SBB B;  5IGC A;  4HIK A;  1WTH A;  2VUM B;  3FKI G;  3QR8 A;  4LW1 A;  1VQ5 A;  1RCV D;  5JPN C;  1BDO A;  2L0C A;  4UP7 A;  2MO1 A;  4JI7 Q;  2L1B A;  4V0B A;  2XIW A;  2K5N A;  2OT2 A;  1H9M A;  1FJG L;  1HQM C;  2K50 A;  1AFP A;  2KED A;  2ZTD A;  2LMC B;  5I6W A;  1G2S A;  1E0B A;  4X3U A;  3RZO H;  5C4X H;  5IYC H;  1BNZ A;  4PV1 C;  1I6H H;  1O7I A;  5I6Y A;  1N33 L;  5E1F A;  3J7A V;  2E2H H;  1SMX A;  2JEB I;  1TR5 A;  3LX0 A;  3GTJ B;  1NSN S;  1EY4 A;  1LUZ A;  1Q8I A;  5I4D A;  1ASY A;  3BS1 A;  2GVA A;  4JBK A;  4OGQ C;  4FXD A;  1HA6 A;  1EWI A;  2FXQ A;  3V96 A;  2XWJ B;  1MD2 D;  5HGQ A;  3FKI H;  4ZUJ A;  1RF2 D;  4ZKB B;  2KCC A;  2K01 A;  1Q1B A;  3TN2 A;  3L3O C;  1SDF A;  3S1Q B;  4P75 A;  4WJW A;  3HOV G;  1Y8P B;  2N8N A;  1HQR D;  3S2D B;  2EYM A;  5LHY 1;  4LUV A;  3PIP A;  2HHH Q;  1A2U A;  4IOA A;  4JBW A;  2KEE A;  2F0T A;  1LT4 D;  3EVQ A;  3KUP A;  2F3V A;  4QY7 A;  2OTL A;  4JV5 L;  2RSN A;  1TXY A;  5I9O A;  1A3T A;  4PNY A;  2F3I A;  3CP0 A;  5CV5 A;  4KMU C;  3BYT B;  5AJ3 Q;  3PUY A;  5C4H A;  4GKK L;  2VL6 A;  2KOL A;  1K73 C;  1JE5 A;  3CRL C;  1W3S A;  1JQY D;  3I91 A;  3UE1 A;  2EXZ A;  1WTO A;  5FLM G;  2L12 A;  1XPU A;  1GUW A;  3WWV A;  1IW7 C;  1ET6 A;  4Z9C B;  5IP7 G;  4DV1 L;  4BY7 H;  5DAU A;  5G3L D;  3HOV H;  1ET9 A;  4JOI C;  4DV7 L;  1YNN D;  4A3B B;  2C5C A;  2F0K A;  4APV A;  1JWM D;  1B2T A;  1VQM A;  4DK3 C;  2VS1 A;  1XMO L;  1B7Y B;  2CWA A;  1PA6 A;  3K7A B;  2MO0 A;  3NQI A;  4J1M A;  4GLX A;  4XT3 B;  1VQG A;  1CI3 M;  4JK1 C;  2IJ0 A;  1Y69 U;  2EJM A;  3NPP A;  4YIJ A;  5HY6 A;  2M00 A;  3BVZ A;  1GJX A;  1HXY D;  1I3Q H;  5LMN L;  2EQS A;  3P20 A;  4C3J B;  1K0R A;  1QZG A;  4KY5 A;  1RIP A;  2JSO A;  3M3Y H;  4EQP A;  4A3E B;  1PZI D;  2ES2 A;  2RDH A;  2CVR A;  3GTM H;  4IJH A;  1EYA A;  4NP5 A;  1EQQ A;  2HQE A;  2E5L Q;  3H91 A;  1A6X A;  1NNX A;  1VQI A;  4FP5 D;  4L6T B;  2JN4 A;  1NUC A;  3WDN A;  3RZD H;  2R7Z B;  3PO3 G;  2XN9 C;  4B3T L;  3JAM L;  1LT6 D;  5C0X J;  2KJX A;  3CCJ A;  2IL8 A;  3D0F A;  1YNX A;  5IGG A;  3E9H A;  1HNW Q;  1UEB A;  1FL0 A;  2A1A A;  2EVB A;  1DXM A;  4A3G B;  3MWY W;  3K0X A;  5H1S E;  1JT8 A;  5BR8 Q;  2I5M X;  3IFT A;  4K8J A;  1Q82 C;  3HOX B;  2PQA B;  4CKC A;  3A7L A;  1V9P A;  5EQ0 A;  1SYD A;  4MTK A;  4KD3 A;  3F2D A;  3CCE A;  2ID0 A;  4K6D A;  1PZK D;  4GLV B;  4X6A H;  1VQA A;  2YU9 B;  2MPM A;  3PCO B;  2R92 G;  1E2Z A;  1PH7 A;  3BZD B;  1CHP D;  5EKI A;  4KKT A;  1PDQ A;  3I72 A;  3OSO A;  1TS2 A;  3CC4 A;  1V1O A;  3M4Y A;  1ILP A;  1CM9 A;  1R9T B;  3TRZ A;  5D3I B;  4F87 A;  2UUC L;  3PO3 H;  4G4K A;  4KJN A;  1QVC A;  1AP0 A;  3STB D;  3MXN A;  3U4Z A;  4KHP Q;  1AN8 A;  2RDF A;  3H3V H;  2QDL A;  4X62 Q;  4YWK A;  4K14 A;  1NAP A;  4TVA B;  4AYB G;  1PFN A;  3CCR A;  5ELO A;  5LMN W;  4BY1 B;  2ZM6 L;  3GTL B;  1SMY D;  5LMU Q;  2EY6 A;  1WI5 A;  1FNW A;  2WAC A;  2B2W C;  3L7Z C;  1CZG A;  4R1J A;  4UDU C;  1P8L A;  2F0I A;  2TMP A;  3U58 A;  3EIV A;  2B29 A;  1U0L A;  1X3F A;  5ELN A;  3TRE A;  1GHJ A;  3NBH A;  3KDF B;  3ICE A;  1VDZ A;  2XTI A;  5J39 A;  1VQP A;  3PO2 G;  1K8A C;  3GV3 A;  1NTG A;  1UAP A;  1PH5 A;  4ZKC B;  4YWL A;  4DAY A;  3KJP A;  1G6Z A;  2HT1 A;  1YNJ C;  3CRK C;  1Q90 A;  3LNN A;  2IY5 B;  2CQO A;  1ESF A;  4L5T A;  1TVX A;  2ICI A;  4IUU A;  1KIX A;  3I4N H;  3TZD A;  3OW2 A;  5CGK A;  1ENF A;  2OF1 A;  4A3F B;  3OTO Q;  1S5F D;  2I5H A;  4ZUI A;  1MI2 A;  1OO9 B;  1STB A;  2VQE L;  3K0Y A;  4GS3 A;  3H09 A;  1KTK A;  2UXD L;  4MN3 A;  3GTO H;  1S4Z A;  2NN6 G;  3I73 A;  1WCM H;  3SEB A;  3NWT A;  2ZXR A;  4EGV A;  4OHJ A;  4DKA C;  5JVH 3;  3MZ5 A;  1G51 A;  5KNC A;  2I46 A;  1SNQ A;  4RH6 A;  1EUJ A;  1I50 H;  1E2V A;  2EYL A;  2Z4I A;  3PO2 H;  4A3K G;  5C6A A;  1UEA B;  5EPL A;  1W2B A;  4DV2 Q;  2JA5 B;  2R93 H;  1RTO A;  3VYS A;  3R3O A;  2QEJ C;  3HOU H;  2Z4H A;  4JI4 Q;  4IN3 A;  1FNV A;  3HEJ A;  2NYZ D;  3QOJ A;  1M90 C;  1II3 A;  3ZJY C;  3I4M G;  2BH2 A;  3F2B A;  2L55 A;  1PRT C;  1H9K A;  3V2T A;  2B2Y A;  4WRD A;  2NUC A;  5EGT A;  3TBI B;  1TWF B;  1HFN A;  1B53 A;  1TY2 A;  1J5E Q;  3SR1 A;  4DPG A;  2HQL A;  2LY7 A;  5KYL A;  1V1P A;  2F0Q A;  1JB7 A;  2EDG A;  4HIM A;  3HOZ G;  4XT1 B;  4GLA C;  4POF A;  1A15 A;  3OWF A;  4BBR H;  3I55 A;  1KD1 C;  1CKN A;  2IWH A;  5C5M A;  4XQN A;  3J7A 5;  3H0G B;  1NR4 A;  5CC4 A;  3RR5 A;  1X3G A;  3J80 i;  3UDX A;  3WOF A;  1AE2 A;  2NTS A;  4LF5 Q;  3V05 A;  4C3H H;  2O5I C;  4GN3 B;  4DV5 L;  4KI0 A;  5D3D A;  5EJW A;  3OHX C;  4RCN A;  5T1G A;  1C9O A;  4G57 A;  2ZXP A;  4CDC C;  2UUB L;  4IPH A;  5ELD A;  4IPC A;  4F7X A;  3F1Z A;  3VR2 A;  1V43 A;  1Z47 A;  1NMF A;  1JWU D;  3A74 A;  3A54 A;  3KF6 B;  1SE2 A;  1D5Z C;  3ERS X;  1WFQ A;  2JEA I;  5CBE E;  4DR7 L;  2F0M A;  4KHV A;  5IYD G;  3DEO A;  3DHQ A;  3MFG A;  4KN4 C;  4DR4 L;  1PH9 A;  4IFD H;  1EY8 A;  2KCM A;  5CV9 A;  3B6Y A;  4QB4 A;  2WB1 G;  3H3V I;  4BXX G;  3TDQ A;  1I94 Q;  1IKL A;  4ZCK A;  1HTP A;  1QOH A;  2ZTC A;  2VUM G;  3GTP H;  4DF7 A;  1S5E D;  1XPO A;  3S1R B;  1T5X D;  1R4P B;  1ICF B;  3J81 E;  4Y7N B;  3C1E A;  3PQI A;  1B50 A;  1PYW D;  3CQZ H;  3S15 B;  4JW0 A;  4OIK A;  1MSG A;  2R3Z A;  1SYC A;  1D1I A;  5JAV A;  3HG9 A;  4FDB A;  1V1Q A;  3BVM A;  3A56 A;  3FPU B;  2UU9 Q;  4A93 H;  4C2M B;  4ME3 A;  1YBY A;  2X69 A;  2QF7 A;  2F0G A;  4BBS B;  2IHF A;  2CQA A;  1L0W A;  3RLO A;  5EKL A;  4C3I B;  3I70 A;  1WTR A;  3G7L A;  2VQF L;  4ZRZ A;  5IGD A;  1SJE D;  4BXX H;  3UDG A;  2WAQ G;  2K75 A;  2FIN B;  1X55 A;  3S2H H;  2LXK A;  1KC8 C;  5C5L A;  3O13 A;  5A35 A;  3I90 A;  4HID A;  3OMG A;  3KJO A;  2PQE A;  1H9S A;  4A3M G;  1DCZ A;  1BBU A;  5D65 A;  1VQO A;  2YTV A;  1KAW A;  4B3R Q;  2A68 C;  4POG A;  1EOV A;  4DR5 Q;  1GXD C;  1EIY B;  3CCV A;  2VW9 A;  4DNR B;  2E2I H;  4V19 0;  5GRO A;  1Y14 B;  3J80 c;  1ASZ A;  2G9H D;  3CHB D;  2QDB A;  2KCT A;  1KDC A;  3QO2 A;  3DUZ A;  3RMH A;  4X64 L;  3T13 A;  1D1K A;  3CU7 A;  4PZ6 A;  1V8Q A;  5KRU A;  1HR0 Q;  4U68 A;  1I4X A;  3KK7 A;  3RUZ A;  3KLS X;  2PZT A;  1SR3 A;  1VQB A;  1Z6H A;  1ZYR C;  3NUC A;  3CF5 A;  4L5Q A;  1TWA B;  2JXM B;  3HOY B;  5C3E G;  4LFB L;  1RDP D;  3EFX D;  4HR7 B;  4DR1 L;  1WVL A;  3PIP 3;  3H3V C;  4IJL A;  4A3M H;  1B4O A;  4LF8 L;  2UXC L;  3S14 B;  2KEC A;  5DEH A;  2Q2I A;  4ZAI A;  4LF4 L;  4LF7 L;  3CPF A;  4WFN 3;  2E2J B;  2BE5 C;  1XNR Q;  1F2L A;  2NN6 I;  1PHJ A;  1TS3 A;  3KYH C;  4B3M Q;  1HJP A;  4DUY L;  1TWG H;  2AQ3 B;  2L5T A;  3A8I E;  2NZ1 D;  1RTN A;  1F2M A;  4NXN Q;  3MXP A;  3HFZ B;  4QIW B;  3UE0 A;  1AW7 A;  4A3D B;  3GTQ H;  2MP1 A;  4KD4 A;  4UP9 A;  1XMQ Q;  2BCO A;  4KJO A;  1BUV T;  1YJ9 A;  3F2C A;  2B2T A;  4ILW A;  1GVP A;  4N8X 1;  4DN4 M;  1WD1 A;  1SNM A;  1Y1W B;  4OX9 L;  1B8A A;  3BJU A;  2JA6 G;  2B3G A;  1WTP A;  1XXG A;  1BOS A;  4FXK C;  1DYQ A;  4AH6 A;  1TWC B;  3DM3 A;  4N9P A;  3PF5 A;  4C3J G;  4O0A A;  3W5O A;  5C3E H;  4JI0 L;  4X65 Q;  3OW7 A;  4A3E G;  5DM6 3;  4AQY Q;  5IOD A;  2F52 A;  1VF5 C;  4OWX B;  1PFM A;  1TS5 A;  2CW0 C;  4J6H A;  2AHO B;  4S3S A;  1JE4 A;  2PYK A;  3MTS A;  4LNQ A;  2PZW A;  4LK1 C;  3K7A H;  5IWA Q;  2R7Z G;  4R4C A;  4B08 A;  2KHJ A;  3ONA B;  4ME5 A;  1C7Y A;  3T51 B;  1XX8 A;  1EY7 A;  4DR3 Q;  1C8C A;  5IY0 A;  1SXT A;  2OQ0 A;  3J81 i;  2OTJ A;  2ZXO A;  2JA6 H;  1EY9 A;  1L2F A;  3HOX G;  1CFM A;  3S17 B;  1DJR D;  2ICE C;  2RBM A;  4A75 A;  2PW7 A;  1KNA A;  4FNF A;  3IKJ A;  1ML0 D;  3LWE A;  3C1F A;  2OEO A;  3S1M B;  4A3J G;  3L2P A;  5M3F H;  4DUZ Q;  1I6V C;  5IYB G;  1Z9F A;  1T5E A;  4DR6 L;  4FYD A;  2RHQ B;  1TII D;  1M4V A;  2A6E D;  1VQN A;  2BDN A;  2R6G A;  5A2Q L;  2R7Z H;  1YIT A;  2J4X A;  2E74 C;  5EAY A;  2HHH L;  3VA5 A;  3HS0 C;  4GNX C;  2NBF A;  3AMU A;  5COY A;  3K5L A;  4A3L H;  4DNI A;  3HOX H;  2R61 A;  2K33 A;  3H6M A;  1SE4 A;  5BN3 A;  3OIQ A;  4PMC A;  1O80 A;  4BY1 G;  3FVQ A;  3BZK A;  2A69 D;  2Q2H A;  4JYA Q;  2D0P A;  1R4Q B;  2GVB A;  2DY7 A;  3A55 A;  4RHR A;  4A3J H;  4YY3 Q;  1S40 A;  1DD2 A;  2IW3 A;  4LF6 L;  2B2U C;  2UUA Q;  1K83 B;  4OL7 A;  4IUN A;  2XSC A;  1R9T H;  3M9B A;  3NTI A;  1GKH A;  1I4G A;  1J8I A;  1KLG D;  1Y1V B;  2WIN B;  1PH1 A;  2H5X A;  1IXR A;  4QQB X;  3NK9 A;  1PRT F;  1PVO A;  2Q8R E;  4R9W A;  1L1O C;  3J80 L;  4GOP C;  1TS4 A;  3BYY B;  5CV6 A;  5FJ8 G;  2ENB A;  2JA7 B;  4I65 A;  3EN2 A;  3LWU A;  1EFI D;  5CBA E;  4HJ9 A;  2PPB C;  1WD0 A;  1TU2 B;  3K7U C;  1PRT D;  1BR9 A;  1E3P A;  5D14 A;  2B2V A;  1ZXT A;  1VMC A;  5C44 B;  4HJ7 A;  4DAM A;  1PTO H;  3J81 c;  4ABN A;  2L9H A;  5I2X A;  1LTL A;  3DWA A;  3G6J B;  5FLX E;  2AKW B;  3TP8 A;  3SHL A;  4R4I A;  1FD7 D;  4C1N K;  4R4Q A;  2NVX H;  1N33 Q;  3IFD A;  1STE A;  4CJ0 B;  1JJC B;  1D5M C;  2AWO A;  1XTC D;  3PUV A;  2DNC A;  4JI3 L;  1X3P A;  1GO3 E;  1SEB D;  3CCQ A;  1KDB A;  2L15 A;  3GTG B;  3W1B A;  1VQK A;  4IFD J;  3Q24 A;  2E5L L;  2JA5 G;  1FNU A;  3FEW X;  1CZW A;  1JOK A;  4HMJ A;  4IUV A;  2JP1 A;  4DV3 Q;  3T1H Q;  1YIJ A;  1KHI A;  1JWS D;  1A2T A;  3R8B A;  1ICW A;  1EIG A;  3HP3 A;  3S24 A;  5E7N A;  3J7A F;  2SDF A;  3MVV A;  1CQF A;  1HNW L;  4J15 A;  2B63 B;  3SE0 A;  1LO5 D;  1OXU A;  2IX1 A;  4R8I A;  4HJ5 A;  3NTK A;  4DAP A;  1PH6 A;  3KDF A;  1CTM A;  1YEZ A;  5IOC A;  2H1E A;  4OON A;  1C48 A;  5FLM H;  1N34 Q;  1IYJ B;  5IT9 E;  1WJJ A;  2GA4 B;  1NE3 A;  1QG7 A;  5IP7 H;  1B44 D;  5M3M B;  1LYL A;  3DWQ A;  3SK6 A;  1PYB A;  1NBW A;  1Y8O B;  1IL2 A;  4KY7 A;  2YTX A;  3NEM A;  3UDF A;  2XNA C;  3RLN A;  1X56 A;  1A62 A;  1C4Q A;  2M2L A;  2KQ3 A;  4FXG C;  5KND A;  1EEI D;  1P16 A;  3HOW B;  4UAI A;  4O1N A;  1BBX C;  3OMC A;  1F9P A;  2HUG A;  3GO5 A;  1EU3 A;  3HKZ B;  3T56 B;  1XTD A;  4OO1 G;  3D31 A;  4U67 3;  3T1Y Q;  2B2T C;  1DZ1 A;  3CCS A;  5JOB A;  5E3F A;  3VDY A;  1K8O A;  4L8J A;  3K5N A;  1SYE A;  2QW7 A;  1E7Z A;  4X62 L;  4TKO B;  5CV4 A;  1BO0 A;  1TT2 A;  4XXE A;  3K58 A;  4HSV A;  3GTK H;  1CKM A;  4QUC A;  1SSO A;  4QMG A;  5LMU L;  4JPB W;  4LFA Q;  2DY8 A;  2I07 B;  2JA9 A;  1KRT A;  1TWH H;  3ND8 A;  1GUN A;  4ZLT F;  3RNU A;  3X3M A;  4H02 A;  5BN4 A;  1YHQ A;  1OTC A;  3LGJ A;  3Q23 A;  3RZO B;  2X6G A;  1I4R A;  1LAB A;  5C4X B;  3NEN A;  5M5Y H;  1I6H B;  1NCV A;  1PH8 A;  1EIF A;  3AYH B;  1J6Q A;  2E2H B;  1FVI A;  2NTT A;  4JI6 L;  2HIV A;  2A68 D;  3KBX A;  1CHQ D;  3SXH A;  3PIO 3;  1FGU A;  3I56 A;  4OO1 H;  1C0A A;  1G6P A;  4R4O A;  1N36 Q;  4CDE C;  2XRQ D;  3M4P A;  3U50 C;  2JK8 A;  4X3T A;  2F1M A;  1ZKO A;  5HUR A;  3FKI B;  1U4M A;  4RGT A;  2F4V Q;  1K8G A;  1STH A;  1VQD A;  2J0T D;  4B9W A;  1PRT B;  1ZEQ X;  1EYD A;  2WFW A;  4OWT B;  1HZC A;  1I5F A;  4M1U B;  2IX0 A;  2X6L A;  1IYV A;  3S1N H;  4BBS G;  3D3R A;  2R92 H;  4C3I G;  5CV8 A;  5GAH C;  1SNP A;  2EYF A;  4A4I A;  1GM5 A;  2E75 C;  3OWE B;  1LTG D;  1B3Q A;  2LFN A;  4RKL A;  2EY2 A;  1PYS B;  2DJF C;  2RF4 A;  4TRD A;  3CXC A;  2MFI A;  2BE5 D;  1JMC A;  5M5W H;  2XWB B;  1S5D D;  5JEA G;  2A6H C;  4L5R C;  4LUZ A;  4K0K Q;  4JI4 L;  1I4H A;  2RDG A;  4C1N I;  1RD9 D;  1HH2 P;  4OXP A;  3MHB A;  4RKB A;  3MEF A;  3NTH A;  4BY7 B;  1IBL Q;  2OQK A;  1UE6 A;  3HOV B;  2UUC Q;  2EYJ A;  1IL8 A;  2K7V A;  1STA A;  1CA6 A;  4JI1 L;  4KKU A;  4F88 A;  3PV0 A;  5EPK A;  2PNH A;  5I2Y A;  1YZ6 A;  4K8I A;  4DV0 L;  1Q86 C;  4JI8 L;  1TY0 A;  4A3C G;  1ILQ A;  2D62 A;  3BDL A;  4K6L A;  4BWG B;  3S9W A;  1F77 A;  3IRB A;  3HOY G;  2NVQ H;  1HFG A;  1HNX Q;  3I4O A;  3CCL A;  1QUQ B;  3DM1 A;  5BN5 A;  1I4P A;  1QWY A;  3AFP A;  3PUW A;  2CW0 D;  4DGZ A;  2ZM6 Q;  2MNA A;  3DMU A;  2JA8 G;  4DV4 L;  4IZ8 A;  3QWN A;  3SVM A;  1E2W A;  1JIC A;  1NR2 A;  2ZT9 C;  1I3Q B;  2VNU D;  4KY6 A;  5C3W A;  1SJH D;  1TKW B;  1SFO H;  1NJI C;  5FO9 B;  3ER0 A;  1OXT A;  3E5S A;  2G9D A;  3JAM E;  4L5S A;  2NZH A;  4A3D G;  4JC0 A;  2F0N A;  5DLQ E;  3M3Y B;  4PZ8 A;  2NZO A;  3GTM B;  1Y1W G;  1FYC A;  3KF8 B;  1BCP F;  3DXJ C;  3D6W A;  3RD4 A;  4A3C H;  4DAV A;  1MHW C;  1GUG A;  4CDF C;  3RZD B;  2D9U A;  2NN6 H;  1IHZ A;  2YTY A;  1U4L A;  1RKN A;  2QEX A;  3VYT A;  4A3K H;  4FF1 A;  1E22 A;  2CH4 W;  1AE3 A;  3SK5 A;  2JA8 H;  4ZK9 B;  1IZ6 A;  3SGI A;  2HD3 A;  2VY3 A;  5KYI A;  3DLL A;  1EWH A;  1XNQ L;  1D2B A;  3MXN B;  1B9N A;  2MQH A;  1PTO C;  1LTB D;  1MGS A;  2XRS D;  1G8Z D;  1XYI A;  5FLX c;  3PMF A;  2NVY H;  4A3D H;  3I4M H;  1EQT A;  1PFB A;  2SNS A;  2PCF B;  5JJL A;  4NPS A;  1LM0 A;  3VYU A;  3F2U A;  2PZU A;  3MEH A;  4IO9 A;  3I8Z A;  2OCE A;  1HNZ Q;  1WYD A;  2A74 C;  3M4O H;  1YVC A;  4H0L C;  2K03 A;  2UU9 L;  5M5X H;  4CKB A;  4DK6 C;  3EJI A;  4O2D A;  4OO1 I;  2F03 A;  1G2T A;  1BF4 A;  2F0F A;  1HRJ A;  3HOZ H;  1DGS A;  3IL8 A;  1QNK A;  2QCP X;  2F0D A;  4RGO S;  5C4Z A;  4YCU A;  4DAY B;  4AIM A;  2QGQ A;  1ENA A;  1ONL A;  1D6E C;  1CKO A;  1KXL A;  2EY5 A;  1Q3L A;  4IOC A;  1EZ6 A;  2JJQ A;  2EJG C;  4K2L A;  3TP7 A;  4B3R L;  4NXM L;  4DR5 L;  4OIJ A;  4HJA A;  4WOR A;  5L37 A;  1QE6 A;  4JI2 Q;  3NWS A;  4X66 Q;  3D4D A;  1LTA D;  1UWV A;  2A73 B;  1AEX A;  4DU9 A;  4PQX A;  3QIA A;  5C0X G;  1E1O A;  1F9S A;  5IYD H;  1WTW A;  3R93 A;  3K8A A;  3H15 A;  3MXU A;  5IGB A;  4Q0F A;  3A8K E;  1LV9 A;  3S16 H;  2BOS A;  4BA1 I;  2UUB Q;  4NB3 A;  1IW7 D;  3AFQ A;  3MA2 B;  4QIW E;  3GP7 A;  2VUM H;  3GV6 A;  1LTT D;  2CHB D;  1N32 Q;  3I4N B;  2PI2 E;  1Y1V G;  4AYB B;  3PGZ A;  4GKJ Q;  1AH9 A;  1VQ8 A;  3NEL A;  3TQY A;  1IKM A;  1B9M A;  4HCE A;  4UHV A;  1M1K C;  2JQO A;  4B3M L;  1VF7 A;  3Q6S A;  2JA7 G;  3KBG A;  1J9O A;  3GTO B;  1K3B C;  1WCM B;  5JJI A;  2DJG C;  3JC6 6;  3BDO A;  1LTI D;  4IPD A;  4IQZ A;  3GTJ H;  2ZJP A;  1EEF D;  1SE3 A;  2F0S A;  3PO2 B;  4XTC S;  2N88 A;  5C44 G;  4LFC Q;  4JOI A;  2PMZ B;  2R93 B;  2SEB D;  3JAM i;  3HOU B;  3ULL A;  4DR2 Q;  1SNC A;  4R4T A;  1IBK L;  5CR3 A;  3CC2 A;  2Y0S B;  3MXG A;  1XJV A;  1RHP A;  4B3S Q;  4OWW B;  3W1G A;  2K32 A;  2Z0S A;  4X65 L;  4F8M A;  1Y1V H;  3S1Q H;  3PUZ A;  5K5P A;  4H7B A;  4AQY L;  5J1Z A;  4A3B G;  3S2D H;  1TQO A;  5GAG C;  1WTX A;  3CMA A;  2VQF Q;  1Y8N B;  2Z6K A;  3E6Z X;  3FHW A;  4RFB A;  1SMY C;  3URY A;  1X3Q A;  3AB9 A;  2JA7 H;  5K36 G;  5IWA L;  4GNX B;  3J7Y W;  4MZ9 A;  1H95 A;  1L0X B;  1I4Q A; 
#chains in the Genus database with same CATH homology
 3C46 A;  1EWC A;  2NB0 A;  3NSW A;  4BA2 I;  4NMZ A;  2H4O A;  2K04 A;  5C4J B;  1JOQ A;  2FFK B;  3ERQ A;  4BBR B;  1SYG A;  1GOZ A;  5COR A;  3NBI A;  4GZY C;  5CYU A;  5EBC A;  3C2P A;  1EY5 A;  4C3H B;  3IAY A;  2HCI A;  3DEP A;  2M9V A;  2K5Q A;  4QCL A;  1EYC A;  5T1I A;  5K36 H;  3R2T A;  3TME A;  1DON A;  3UI2 A;  4M8A A;  1W6K A;  5FOB B;  2N55 A;  2B2Y C;  3GTP B;  4NKL A;  2A5H A;  3SK8 A;  3FPP A;  1DM0 B;  2BA0 A;  1QNU A;  3MFY A;  3CQZ B;  1H9S B;  3NP8 A;  4MIU A;  5ELC A;  3A7A B;  1ROD A;  3I4L A;  1KDA A;  4Q5V A;  1BCP C;  4R8N A;  1B3A A;  3W3A A;  2A6H D;  5FKA C;  4A93 B;  2EYO A;  1YNJ D;  1O7Z A;  5EPJ A;  5DM7 3;  2WB1 B;  3HRZ C;  1DOK A;  3S2H B;  1KAA A;  3D8G A;  5JVG 3;  4A3I B;  4J8Q A;  1FGB D;  4TQU S;  1F9R A;  2RKS A;  1LAC A;  2K6A A;  3E0J A;  1F9Q A;  2RQX A;  3K6O A;  3NXW A;  2E2I B;  5C0X I;  4IUP A;  1CT1 D;  3OOC A;  5E4W C;  1HCZ A;  4H13 C;  3GQB A;  3FMC A;  1FR3 A;  3NE5 B;  1MSH A;  4K5W A;  2F0P A;  2EE1 A;  4PMW A;  4RHS A;  1O7L A;  2WAQ B;  1QJO A;  1GHK A;  1S5C D;  1PXU A;  1K8M A;  3W2D A;  2WKC A;  4QUF A;  1L0Y B;  1EZ8 A;  4A3M B;  4ZQ3 A;  3H94 A;  1A3U A;  2AUK A;  1EY6 A;  3SK4 A;  1HUM A;  3NHH A;  3OPO A;  1JR0 D;  3Q0A A;  3NQT A;  1TWG B;  1PTO F;  1OXV A;  1LTS D;  1OXS C;  3GTQ B;  2K28 A;  3D4R A;  3K57 A;  3C3L A;  2AUJ D;  3K5O A;  1PTO D;  5G3L F;  1SND A;  4XIG S;  4KHZ A;  4DFA A;  5C3E B;  1U4P A;  1UNS A;  1G91 A;  3MC0 B;  1M8A A;  4X3S A;  2IX3 A;  2EY1 A;  2F0E A;  2L4N A;  3AU7 A;  4FVM A;  4XQQ A;  5KIX A;  4EQO A;  5FO7 B;  3BVG A;  1IYU A;  5TSS A;  1RJT A;  2WKD A;  2EPB A;  4E6I A;  1EQV A;  2JA6 B;  4B9X A;  1JC7 A;  3P1H A;  4CBV A;  2NVT B;  5A2Q E;  1JOR A;  2IT1 A;  1LT3 D;  3BG3 A;  4N9T A;  3P75 A;  3ZYY X;  5M3F B;  2MJ8 A;  1QCB D;  1QIL A;  3OIP A;  2K05 A;  4P2C B;  4TSS A;  3Q22 A;  1UUP A;  1BXT A;  4HED A;  4DA2 A;  1WTV A;  1HPC A;  3WOE A;  5IIF A;  3M85 A;  1O7Y A;  4DXG A;  1KLU D;  2BDO A;  3VR6 A;  2PO4 A;  1CQV A;  5LL6 X;  1SNO A;  1QB5 D;  2EOT A;  4FF4 A;  2AQ2 B;  3KF8 A;  2YYZ A;  4O42 A;  5F2D A;  4RGM A;  5HGT A;  3J80 E;  1Q1E A;  2WP8 J;  4A3J B;  4DNT B;  3QB3 A;  3TZU A;  2OXP A;  2F0L A;  2DN8 A;  3SDZ A;  2HDM A;  1ZYR D;  2FJ2 A;  4G7H C;  2SNM A;  4MHE A;  5FO8 B;  2F3W A;  1O78 A;  2EYH A;  2KCN A;  3EQL C;  2MHV A;  4ODG A;  4QF4 A;  2KVM A;  3D4W A;  2PNR C;  2AWN A;  2B39 A;  1CA5 A;  1OXX K;  4KN7 C;  4XYQ A;  2TSS A;  1PTO B;  5FK9 C;  4IUT A;  1AZP A;  1PZJ D;  2F0U A;  1F2Y A;  2C9O A;  1HHV A;  5M9O A;  2NVX B;  4RWS C;  4X3K A;  3J81 L;  1MBY A;  5ELE A;  1EOT A;  4ZYS A;  4LAA A;  4RAU C;  5NUC A;  4K5V A;  2A6E C;  3U9O A;  3M7N A;  1VMP A;  3VYR A;  4FF2 A;  1JB3 A;  1H9R A;  3P7J A;  2Q8I B;  4FO2 A;  1WTQ A;  1EIH A;  2Q8T A;  2HDL A;  1KNE A;  5JPM C;  1JOO A;  4NW2 A;  2K5W A;  5JEA H;  4IAL A;  4ID6 A;  2BA1 A;  2A69 C;  1XWE A;  3QOL A;  4G7Z C;  1Q12 A;  4RCO A;  5CMD A;  2B2V C;  1HUN A;  4HCS A;  4K2K A;  3K59 A;  4PMB A;  2XVS A;  3FDT A;  1EY0 A;  1STG A;  4DK0 A;  1ENC A;  1Z7T A;  1SAP A;  4IUQ A;  4KTA A;  4C3H G;  4LJZ C;  1BCP D;  4CGY B;  3ERO A;  2Z1C A;  2VB2 X;  3GD7 A;  3QJY A;  2FMC A;  5KGU A;  4KKS A;  3GTK B;  2O2L D;  2KUM A;  4IFD G;  1TWH B;  5LL6 S;  3HGB A;  1GUS A;  1F2Z A;  5EKK A;  5M5Y B;  2L11 A;  1STY A;  2DNE A;  2RSO A;  2JE6 I;  1VCI A;  1YNN C;  3PO3 B;  2KHS A;  2WV6 D;  2E2D C;  4RGN A;  1LLR D;  3MAQ A;  1HA5 A;  3FRP B;  4HTH A;  5EBD A;  2JYO A;  1SYF A;  2F0V A;  3S1N B;  4XYO A;  5E4X A;  2R92 B;  1B1Z A;  4DK1 A;  2EJF C;  3T4A C;  1JCK B;  4CJ1 B;  2FMM A;  3VA7 A;  2QKI C;  4KV6 A;  2Z8L A;  4IUR A;  3HZX A;  2K1B A;  2PW5 A;  3QG1 A;  2B2U A;  5AFW A;  1DOL A;  1STN A;  3RLF A;  5M5W B;  3TP6 A;  3TSS A;  1S5B D;  3L9A X;  4H44 C;  4XDX A;  4L63 B;  5ELF A;  2SOB A;  4I7Z C;  4KK7 A;  5KEE A;  5C3X A;  3TP5 A;  4EVO A;  5ISR A;  5KNB A;  1PLF A;  2NVQ B;  3VR4 A;  3X3N A;  5C0X H;  4HMI A;  3T16 A;  4HN7 A;  1EU4 A;  1G29 1;  1I50 B;  2B8F A;  3ITP A;  2LKV A;  2IPK D;  2NWG A;  1U9R A;  1D5X C;  1V1P B;  2V4D A;  4XQJ A;  1ESR A;  5J22 A;  3D6C A;  3EA6 A;  1SFO B;  2D5D A;  3R2I A;  2O5J C;  1U4R A;  2QIL A;  4CJ2 C;  1GUO A;  2O4X A;  1BCP B;  2MGS A;  4G7O C;  4FF3 A;  3VR3 A;  1H9J A;  1KAB A;  4EQN A;  4HSP A;  3A8J E;  2F0H A;  4LMQ D;  1CK1 A;  3ND9 A;  2LS0 1;  2EYP A;  1EL0 A;  1SYB A;  4C56 C;  1A3V A;  2K5D A;  4A3K B;  2RA4 A;  2JA8 B;  3KLR A;  3I3C A;  3CKI B;  4NDX A;  2RVL A;  2F0W A;  5I9P A;  3K5M A;  3KLS A;  2KA7 A;  2B8G A;  2NVY B;  2E76 C;  3I4M B;  2J7Z A;  3N6R A;  2EZV A;  1LT5 D;  2VXW A;  1W6J A;  3M4O B;  1PMR A;  4ULL A;  5ELB A;  2HCC A;  2F0O A;  5FLX L;  1HTL D;  5M5X B;  2F4I A;  4K5X A;  3DWP A;  2D2C C;  1DOM A;  3VR5 A;  3HOZ B;  3M7G A;  4BS9 A;  4HAE A;  3N52 A;  1X32 A;  1BQQ T;  4IFD I;  2MUY A;  5IGE A;  4DXF A;  2F0J A;  2FHT A;  3PUX A;  4RA8 A;  3BDC A;  5DNF A;  4CKE A;  2AQ1 B;  3T53 B;  5IT9 L;  5JJZ A;  5IGF A;  1GUT A;  2VB3 X;  2WII B;  4CHT B;  3S16 B;  1AZQ A;  1LTR D;  3U9S A;  5JEA J;  5CV7 A;  2B2W A;  1SBB B;  5IGC A;  2VUM B;  1RCV D;  5JPN C;  1BDO A;  2L0C A;  2L1B A;  4V0B A;  2XIW A;  2OT2 A;  1H9M A;  1HQM C;  1AFP A;  2KED A;  5I6W A;  2LMC B;  1G2S A;  1E0B A;  4X3U A;  1BNZ A;  4PV1 C;  5I6Y A;  5E1F A;  3J7A V;  2JEB I;  1TR5 A;  3LX0 A;  3GTJ B;  1NSN S;  1EY4 A;  1Q8I A;  5I4D A;  3BS1 A;  4OGQ C;  4FXD A;  1HA6 A;  3V96 A;  2XWJ B;  1MD2 D;  4ZUJ A;  1RF2 D;  4ZKB B;  2KCC A;  2K01 A;  1Q1B A;  3TN2 A;  3L3O C;  1SDF A;  3S1Q B;  4WJW A;  1Y8P B;  1HQR D;  3S2D B;  2EYM A;  5LHY 1;  1A2U A;  4JBW A;  2KEE A;  2F0T A;  1LT4 D;  3EVQ A;  3KUP A;  2F3V A;  2RSN A;  5I9O A;  1A3T A;  4PNY A;  5CV5 A;  4KMU C;  3BYT B;  3PUY A;  5C4H A;  2KOL A;  3CRL C;  1JQY D;  3I91 A;  2EXZ A;  1WTO A;  2L12 A;  1GUW A;  1IW7 C;  1ET6 A;  4Z9C B;  5DAU A;  5G3L D;  1ET9 A;  4A3B B;  1YNN D;  2C5C A;  2F0K A;  1JWM D;  1B2T A;  3K7A B;  3NQI A;  4J1M A;  4XT3 B;  1CI3 M;  4JK1 C;  2IJ0 A;  1Y69 U;  2EJM A;  3NPP A;  4YIJ A;  2M00 A;  3BVZ A;  1GJX A;  1HXY D;  3P20 A;  4C3J B;  4KY5 A;  2JSO A;  4EQP A;  4A3E B;  1PZI D;  2RDH A;  2CVR A;  1EYA A;  4NP5 A;  2HQE A;  3H91 A;  1A6X A;  4FP5 D;  4L6T B;  1NUC A;  3WDN A;  2R7Z B;  2XN9 C;  3JAM L;  1LT6 D;  5C0X J;  2KJX A;  2IL8 A;  5IGG A;  2EVB A;  1DXM A;  4A3G B;  3MWY W;  3IFT A;  4K8J A;  3HOX B;  4CKC A;  3A7L A;  5EQ0 A;  1SYD A;  4KD3 A;  2ID0 A;  4K6D A;  1PZK D;  2YU9 B;  2MPM A;  1E2Z A;  3BZD B;  1CHP D;  5EKI A;  4KKT A;  1PDQ A;  3I72 A;  3OSO A;  1TS2 A;  1V1O A;  3M4Y A;  1ILP A;  1CM9 A;  1R9T B;  5D3I B;  4F87 A;  4G4K A;  4KJN A;  1AP0 A;  3MXN A;  1AN8 A;  2RDF A;  4K14 A;  1NAP A;  1PFN A;  4BY1 B;  3GTL B;  1SMY D;  2EY6 A;  1FNW A;  2WAC A;  2B2W C;  3L7Z C;  1CZG A;  4UDU C;  2F0I A;  2TMP A;  1GHJ A;  3NBH A;  1VDZ A;  5J39 A;  3GV3 A;  1UAP A;  4ZKC B;  4DAY A;  1G6Z A;  1YNJ C;  3CRK C;  1Q90 A;  3LNN A;  1ESF A;  1TVX A;  2ICI A;  4IUU A;  3TZD A;  5CGK A;  1ENF A;  2OF1 A;  4A3F B;  1S5F D;  4ZUI A;  1MI2 A;  1OO9 B;  1STB A;  3K0Y A;  3H09 A;  1KTK A;  4MN3 A;  1S4Z A;  2NN6 G;  3I73 A;  3SEB A;  3NWT A;  2ZXR A;  4EGV A;  4OHJ A;  5JVH 3;  3MZ5 A;  5KNC A;  2I46 A;  1SNQ A;  4RH6 A;  1E2V A;  2EYL A;  2Z4I A;  5C6A A;  1UEA B;  5EPL A;  2JA5 B;  1RTO A;  3VYS A;  3R3O A;  2QEJ C;  2Z4H A;  4IN3 A;  1FNV A;  3HEJ A;  2NYZ D;  3QOJ A;  1II3 A;  2L55 A;  1PRT C;  1H9K A;  3V2T A;  2B2Y A;  4WRD A;  2NUC A;  5EGT A;  3TBI B;  1TWF B;  1HFN A;  1B53 A;  1TY2 A;  3SR1 A;  2LY7 A;  5KYL A;  1V1P A;  2F0Q A;  2EDG A;  4XT1 B;  1A15 A;  3OWF A;  2IWH A;  5C5M A;  4XQN A;  3H0G B;  1NR4 A;  5CC4 A;  3WOF A;  2NTS A;  3V05 A;  2O5I C;  4KI0 A;  5D3D A;  5EJW A;  3OHX C;  4RCN A;  5T1G A;  4G57 A;  2ZXP A;  5ELD A;  4F7X A;  3VR2 A;  1V43 A;  1Z47 A;  3A54 A;  1JWU D;  1SE2 A;  1D5Z C;  2JEA I;  5CBE E;  2F0M A;  4KHV A;  3DEO A;  3DHQ A;  3MFG A;  4KN4 C;  4IFD H;  1EY8 A;  5CV9 A;  4QB4 A;  3TDQ A;  1IKL A;  1HTP A;  1QOH A;  4DF7 A;  1S5E D;  3S1R B;  1T5X D;  1R4P B;  3J81 E;  4Y7N B;  3C1E A;  1B50 A;  1PYW D;  3S15 B;  4OIK A;  1MSG A;  2R3Z A;  1SYC A;  1D1I A;  5JAV A;  3HG9 A;  3BVM A;  3FPU B;  3A56 A;  4C2M B;  2X69 A;  2QF7 A;  2F0G A;  4BBS B;  2CQA A;  5EKL A;  4C3I B;  3I70 A;  1WTR A;  3G7L A;  4ZRZ A;  5IGD A;  1SJE D;  2FIN B;  5C5L A;  3O13 A;  5A35 A;  3I90 A;  3OMG A;  2PQE A;  1H9S A;  1DCZ A;  5D65 A;  2A68 C;  1GXD C;  4DNR B;  4V19 0;  2G9H D;  3CHB D;  2QDB A;  1KDC A;  3QO2 A;  3DUZ A;  3RMH A;  3T13 A;  1D1K A;  3CU7 A;  1V8Q A;  5KRU A;  4U68 A;  1I4X A;  3KK7 A;  3RUZ A;  3KLS X;  2PZT A;  3NUC A;  1Z6H A;  1ZYR C;  1TWA B;  2JXM B;  3HOY B;  1RDP D;  3EFX D;  4HR7 B;  1WVL A;  3PIP 3;  3H3V C;  1B4O A;  3S14 B;  2KEC A;  5DEH A;  4ZAI A;  4WFN 3;  2E2J B;  2BE5 C;  1F2L A;  2NN6 I;  1TS3 A;  2AQ3 B;  2L5T A;  3A8I E;  2NZ1 D;  1RTN A;  1F2M A;  3MXP A;  4QIW B;  1AW7 A;  4A3D B;  2MP1 A;  4KD4 A;  2BCO A;  4KJO A;  1BUV T;  2B2T A;  4ILW A;  4DN4 M;  1WD1 A;  1SNM A;  1Y1W B;  1WTP A;  1XXG A;  1BOS A;  4FXK C;  1DYQ A;  1TWC B;  4N9P A;  4C3J G;  3OW7 A;  5DM6 3;  5IOD A;  1VF5 C;  1PFM A;  1TS5 A;  2CW0 C;  4J6H A;  4S3S A;  1JE4 A;  2PYK A;  3MTS A;  2PZW A;  4LK1 C;  4B08 A;  3ONA B;  4ME5 A;  3T51 B;  1XX8 A;  1EY7 A;  1C8C A;  1SXT A;  2ZXO A;  1EY9 A;  1CFM A;  3S17 B;  1DJR D;  2ICE C;  2RBM A;  2PW7 A;  1KNA A;  4FNF A;  3IKJ A;  1ML0 D;  3LWE A;  3C1F A;  2OEO A;  3S1M B;  1I6V C;  1T5E A;  4FYD A;  1TII D;  1M4V A;  2A6E D;  2BDN A;  2R6G A;  5A2Q L;  2J4X A;  2E74 C;  3VA5 A;  3HS0 C;  2NBF A;  3AMU A;  5COY A;  3K5L A;  2R61 A;  2K33 A;  3H6M A;  1SE4 A;  5BN3 A;  3OIQ A;  4PMC A;  1O80 A;  3FVQ A;  2A69 D;  1R4Q B;  2DY7 A;  3A55 A;  4RHR A;  1DD2 A;  2IW3 A;  2B2U C;  1K83 B;  4OL7 A;  4IUN A;  2XSC A;  3NTI A;  1I4G A;  1J8I A;  1KLG D;  1Y1V B;  2WIN B;  3NK9 A;  1PRT F;  2Q8R E;  4R9W A;  3J80 L;  1TS4 A;  3BYY B;  5CV6 A;  2ENB A;  2JA7 B;  4I65 A;  3LWU A;  1EFI D;  5CBA E;  2PPB C;  1WD0 A;  1TU2 B;  1PRT D;  1BR9 A;  5D14 A;  2B2V A;  1ZXT A;  1VMC A;  5C44 B;  1PTO H;  4ABN A;  2L9H A;  5I2X A;  3DWA A;  3G6J B;  5FLX E;  3TP8 A;  3SHL A;  4C1N K;  1FD7 D;  3IFD A;  1STE A;  4CJ0 B;  1D5M C;  2AWO A;  1XTC D;  3PUV A;  2DNC A;  1X3P A;  1SEB D;  1KDB A;  3GTG B;  4IFD J;  3Q24 A;  1FNU A;  3FEW X;  1CZW A;  1JOK A;  4HMJ A;  4IUV A;  2JP1 A;  1JWS D;  1A2T A;  3R8B A;  1ICW A;  1EIG A;  3HP3 A;  3J7A F;  2SDF A;  3MVV A;  1CQF A;  2B63 B;  3SE0 A;  1LO5 D;  1OXU A;  2IX1 A;  4R8I A;  3NTK A;  4DAP A;  1CTM A;  5IOC A;  2H1E A;  1C48 A;  5IT9 E;  2GA4 B;  1QG7 A;  1B44 D;  5M3M B;  3DWQ A;  3SK6 A;  1Y8O B;  4KY7 A;  2XNA C;  1C4Q A;  2M2L A;  2KQ3 A;  4FXG C;  5KND A;  1EEI D;  3HOW B;  4UAI A;  4O1N A;  1BBX C;  3OMC A;  1F9P A;  2HUG A;  3GO5 A;  1EU3 A;  3HKZ B;  3T56 B;  4OO1 G;  3D31 A;  4U67 3;  2B2T C;  1DZ1 A;  5JOB A;  5E3F A;  1K8O A;  4L8J A;  3K5N A;  1SYE A;  4TKO B;  5CV4 A;  1BO0 A;  1TT2 A;  4XXE A;  3K58 A;  4HSV A;  4QUC A;  1SSO A;  4QMG A;  2DY8 A;  2I07 B;  3ND8 A;  1GUN A;  4ZLT F;  3X3M A;  5BN4 A;  3RZO B;  3Q23 A;  2X6G A;  1I4R A;  1LAB A;  5C4X B;  1I6H B;  1NCV A;  2E2H B;  2NTT A;  2A68 D;  3KBX A;  1CHQ D;  3SXH A;  3PIO 3;  4OO1 H;  2XRQ D;  4X3T A;  2F1M A;  1ZKO A;  5HUR A;  3FKI B;  1U4M A;  4RGT A;  1STH A;  2J0T D;  4B9W A;  1PRT B;  1ZEQ X;  1EYD A;  4M1U B;  2IX0 A;  2X6L A;  1IYV A;  3D3R A;  4C3I G;  5CV8 A;  1SNP A;  2EYF A;  2E75 C;  3OWE B;  1LTG D;  2LFN A;  4RKL A;  2EY2 A;  4TRD A;  2BE5 D;  2XWB B;  1S5D D;  5JEA G;  2A6H C;  1I4H A;  2RDG A;  4C1N I;  1RD9 D;  3MHB A;  4RKB A;  3NTH A;  4BY7 B;  3HOV B;  2EYJ A;  1IL8 A;  2K7V A;  1STA A;  1CA6 A;  4KKU A;  4F88 A;  3PV0 A;  5EPK A;  5I2Y A;  4K8I A;  1TY0 A;  1ILQ A;  2D62 A;  3BDL A;  4K6L A;  4BWG B;  3S9W A;  1F77 A;  1HFG A;  3DM1 A;  5BN5 A;  1I4P A;  1QWY A;  3PUW A;  2CW0 D;  4DGZ A;  3DMU A;  4IZ8 A;  3QWN A;  3SVM A;  1E2W A;  1JIC A;  1NR2 A;  2ZT9 C;  1I3Q B;  2VNU D;  4KY6 A;  5C3W A;  1SJH D;  1TKW B;  5FO9 B;  1OXT A;  3E5S A;  2G9D A;  3JAM E;  2F0N A;  3M3Y B;  3GTM B;  1FYC A;  1BCP F;  3DXJ C;  3D6W A;  3RD4 A;  4DAV A;  1GUG A;  3RZD B;  2D9U A;  2NN6 H;  1IHZ A;  1U4L A;  1RKN A;  3VYT A;  4FF1 A;  3SK5 A;  4ZK9 B;  5KYI A;  1EWH A;  1D2B A;  1B9N A;  1PTO C;  1LTB D;  1MGS A;  2XRS D;  1G8Z D;  1XYI A;  3PMF A;  1EQT A;  1PFB A;  2SNS A;  2PCF B;  3VYU A;  3F2U A;  2PZU A;  3MEH A;  3I8Z A;  2A74 C;  4H0L C;  2K03 A;  4CKB A;  3EJI A;  4OO1 I;  2F03 A;  1G2T A;  1BF4 A;  2F0F A;  1HRJ A;  3IL8 A;  1QNK A;  2QCP X;  2F0D A;  4RGO S;  5C4Z A;  1ENA A;  1ONL A;  1D6E C;  2EY5 A;  1Q3L A;  1EZ6 A;  2EJG C;  4K2L A;  3TP7 A;  4OIJ A;  4WOR A;  1QE6 A;  3NWS A;  3D4D A;  1LTA D;  2A73 B;  4DU9 A;  1AEX A;  4PQX A;  3QIA A;  5C0X G;  1F9S A;  1WTW A;  3R93 A;  3MXU A;  5IGB A;  4Q0F A;  3A8K E;  1LV9 A;  2BOS A;  4BA1 I;  1IW7 D;  3MA2 B;  3GP7 A;  3GV6 A;  1LTT D;  2CHB D;  3I4N B;  4AYB B;  1IKM A;  1B9M A;  4HCE A;  1VF7 A;  3Q6S A;  3GTO B;  3KBG A;  1J9O A;  1WCM B;  3BDO A;  1LTI D;  4IQZ A;  1EEF D;  1SE3 A;  2F0S A;  3PO2 B;  4XTC S;  2N88 A;  2PMZ B;  2R93 B;  2SEB D;  3HOU B;  1SNC A;  5CR3 A;  2Y0S B;  3MXG A;  1RHP A;  2K32 A;  4F8M A;  3PUZ A;  5K5P A;  4H7B A;  5J1Z A;  1TQO A;  1WTX A;  1Y8N B;  3E6Z X;  4RFB A;  1SMY C;  3URY A;  1X3Q A;  3AB9 A;  5K36 G;  3J7Y W;  1L0X B;  1I4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...