4LMQD

Development and preclinical characterization of a humanized antibody targeting cxcl12
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
58
structure length
55
Chain Sequence
CRFFESHVARANVKHLKILNTPLQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development and Preclinical Characterization of a Humanized Antibody Targeting CXCL12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords Stromal cell-derived factor 1
total genus 9
structure length 55
sequence length 58
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4lmqD00
2X69A 4OIKA 4IUVA 1B3AA 1IL8A 1HFGA 1QNKA 1AZQA 4RWSC 1DOKA 2X6LA 1WTVA 2L1BA 1QE6A 4R9WA 2M2LA 1LV9A 1HUNA 2L12A 4CJ2C 5DNFA 1G2SA 2NWGA 1HFNA 1EQTA 2B2YA 1VMCA 4XT1B 5JJZA 2FJ2A 1U4MA 2MP1A 1X3QA 2HDMA 2MPMA 2N88A 1RJTA 4ZKBB 1HRJA 1WD1A 1EIHA 1PFMA 1RTOA 4LMQD 2RVLA 1SSOA 1F9QA 1QG7A 1U4LA 2JP1A 1PFNA 5EPJA 3I8ZA 1GUWA 3SVMA 2HDLA 1VMPA 2KEEA 2MJ8A 2RA4A 3I90A 3R93A 1MI2A 2B2WA 3F2UA 4X3TA 2K01A 2KEDA 1Q3LA 4MHEA 5CBEE 1O80A 1X32A 1NCVA 2KVMA 3FDTA 3FPUB 2RSOA 1WTPA 1EIGA 2EPBA 4HEDA 3TZDA 5CBAE 1WD0A 2J7ZA 1ZXTA 1PFBA 2FFKB 4XT3B 1CA5A 3KBXA 1JICA 1ICWA 1PLFA 1ILQA 1A15A 5E4WC 4IUTA 4RAUC 2B2VC 1HHVA 2L11A 3IL8A 2B2UA 3LWEA 4IUQA 4ZKCB 3P7JA 1B53A 1B4OA 2B2TC 2K28A 1MSGA 2Q8RE 2XIWA 1WTWA 4RA8A 5CORA 1RTNA 4X3KA 1NR2A 1HUMA 1RHPA 1SAPA 2DY7A 4U68A 4CJ1B 1E0BA 2KUMA 4CJ0B 1BBXC 3H91A 4QUCA 2H1EA 3D6WA 2FINB 1SDFA 1BO0A 2BDNA 2KECA 2MGSA 3IFDA 1ML0D 1XYIA 2NYZD 1F9RA 4OIJA 3G7LA 3ONAB 4ZK9B 2FHTA 2DY8A 1RODA 3GV6A 1ESRA 2K05A 3TN2A 2HUGA 1B2TA 3Q6SA 1F9SA 2KOLA 2Q8TA 1NR4A 5EJWA 1MGSA 2X6GA 3I3CA 3N52A 2NZ1D 4ZLTF 2K1BA 1HA6A 1KNEA 3HP3A 1U4PA 3I91A 2HCCA 1O7ZA 2D9UA 4IURA 2SDFA 3MWYW 1AZPA 1B50A 1PDQA 1M8AA 5D14A 4HAEA 1U4RA 5EPLA 4R8IA 4XDXA 1C8CA 4NW2A 1DONA 1X3PA 3MTSA 3GV3A 4X3SA 1KNAA 2B2TA 2EOTA 1G91A 5EPKA 1WTXA 1F2LA 4IUPA 2K04A 4QUFA 5EKIA 4IUUA 5EQ0A 2JYOA 1BF4A 1IKLA 5E4XA 1JE4A 3KUPA 2HCIA 4ZAIA 4MN3A 2EE1A 3UI2A 1J9OA 1WTOA 1CM9A 1WTQA 1CA6A 2L4NA 1XX8A 1DOLA 2IL8A 4UAIA 5CMDA 1MSHA 5T1GA 2R3ZA 1NAPA 2B2WC 1BNZA 1EOTA 4HCSA 5T1IA 1J8IA 2B2UC 1ILPA 1WTRA 5COYA 1G6ZA 2B2VA 1DOMA 2L9HA 2CVRA 3DEOA 1S4ZA 2VXWA 5AFWA 4X3UA 4O42A 2FMMA 3DEPA 1G2TA 1WVLA 5D65A 1EL0A 2RSNA 4HSVA 2K03A 1F9PA 3QO2A 2N55A 3DM1A 1O7YA 4DN4M 1TVXA 1DZ1A 2B2YC 1IKMA 1AP0A
chains in the Genus database with same CATH superfamily
4GNXB 2ENBA 1AZQA 3CKIB 4R9WA 3ZJYC 4I65A 5HURA 4JI3Q 2IWHA 3R2TA 4K2LA 1MBYA 1A3TA 3I70A 4TRDA 3J81j 4KHPQ 1SNQA 2E5LQ 1KRTA 1EYCA 5C3XA 3I2ZA 1EU4A 2EXDA 3CC2A 2UUCL 2JP1A 1HNWQ 1H9SB 3D31A 4FXGC 1EY5A 4BWGB 2F0KA 4M1UB 2B63H 4V190 3CHBD 3PUYA 4JI6Q 2RBMA 2XGTA 1VQJA 3PIPA 3AEVA 4HJ7A 3KF8B 3R2IA 2AQ2B 1EFID 4DAYA 4CDDC 3BJUA 1ILQA 1D5XC 2B8FA 2B2VC 3S1QB 1CZWA 3DM3A 1VQLA 3DHQA 1PRTD 2J4XA 4IPHA 3K8AA 5EAYA 4JI1Q 4LFBL 4G7ZC 1YVCA 1HUMA 1RHPA 3NEMA 3CC7A 3H91A 4KN7C 1SDFA 4IQZA 5HY6A 2NYZD 1XTDA 2JA9A 4QF4A 4YWKA 3EFXD 1PRTC 5IOCA 1ZEQX 4H13C 4LFBQ 2VL6A 4L63B 3SGIA 4RG1A 4ABNA 2R6GA 3BDLA 1CHQD 2A6EC 3JAMi 2XVSA 3GV3A 4F7XA 2D0PA 2EOTA 2K52A 2JA8G 2SEBD 4OHJA 3IRBA 4EQPA 1I4QA 2P5ZX 1STHA 2K5DA 2A74C 3GTOB 5KRUA 1HH2P 1KQSA 5CMDA 1MSHA 3KK7A 3JAMc 3DLLA 1BNZA 4BXXG 3A54A 2A1AA 1QVGA 1DOMA 1VQBA 4KHPL 5BR8Q 5JPMC 2VXWA 4JPBW 2K5QA 3BVGA 1SYFA 5CYUA 3QIAA 4NKLA 5JEAJ 1EFWA 1H9KA 2F0LA 4XQQA 4NB3A 2WB1B 4UP7A 3GTOH 4A3DH 4Q0FA 3U4ZA 3KJOA 1EYGA 1OTCA 3I4MB 3EVQA 3F2BA 3UDFA 1WTVA 3OIQA 3FKIH 4QCLA 4WRDA 5H1SE 4ZUJA 5KYIA 1B9NA 2WAQB 1WI5A 2AWNA 4A3LG 3HG9A 2H5XA 4CKEA 4A3BG 1C7YA 1Q82C 3H0GB 5CGKA 4JBKA 2EYJA 4DR7L 5IWAQ 2GA4B 4RGMA 1QNUA 4FF2A 2VUMB 4JI0L 1EZ6A 4A4IA 1MHWC 2B2WA 5CBEE 3TSSA 1NCVA 5IGFA 1VDZA 1LTBD 4FVMA 1X55A 1FR3A 5F2DA 3NBHA 1ICWA 2R7FA 4DNIA 5E1FA 4HJ5A 4GKKQ 3IL8A 3KF6A 2ID0A 3S2DB 2CCZA 3R3OA 1KABA 5FK9C 2KUMA 4K5VA 2EY1A 1S40A 2FINB 2MGSA 4WORA 1M4VA 4A3IG 1UE7A 1QUQA 3MC0B 4BA2I 1V1QA 2E74C 1DXMA 2R93G 3VA5A 1W3SA 3NSWA 4R4CA 1HZAA 2QDLA 3HOUG 2O2LD 4IJLA 3J7YW 1HCZA 2KCNA 4R8IA 2AUKA 4XDXA 1EQRA 3TEHB 1KNAA 2OTJA 3EIVA 3A7LA 3VDYA 5EKIA 3K5NA 1Y1VH 2NB0A 4PZ7A 5IP9G 3J80E 1A3UA 4LW1A 3I72A 1GM5A 1IBLL 1XXGA 3HFZB 4DV0Q 4BA1I 3W2DA 4X66Q 2Z4HA 5M5WH 3GTJB 4PQXA 2OWOA 5M3MH 1CHPD 2Y0SE 4ZUIA 3TS0A 1PZID 5D65A 3VYSA 3LGJA 1S72A 1UE6A 1N34Q 2ASBA 1BQQT 1IKMA 1QNKA 2OT2A 1QE6A 4X64Q 1HNXL 1TIID 2DJGC 3BZDB 2KCMA 1VF7A 4JI7Q 2MP1A 4DR7Q 3FMCA 1QB5D 3KDFA 1RTOA 1Q8KA 3MZ5A 1BCPF 3ND8A 4A3EH 3I4NH 2ZJRA 3AYHB 1Q90A 2FMCA 4DF7A 2QA4A 1SYGA 2AMCB 4LF8Q 4LF9Q 4ZYSA 4HEDA 3HOYH 1S5DD 1PFBA 4XT3B 1AN8A 5E4WC 1SYBA 1X56A 4POFA 3P7JA 5C3EG 2UU9L 5FO8B 4DAPA 3H15A 2ALYB 2JSOA 4YY3Q 3MA2B 1NBWA 4NXMQ 3OWFA 2C35B 1KL9A 4KTAA 2LY7A 1LO5D 3HOZG 1V1PB 1SMYD 2MHVA 5IE8A 2HUGA 3SR1A 3VR6A 2IW3A 3FEWX 1Q8IA 3T16A 2HT1A 3AMUA 1QZGA 1VQ6A 4A3GG 4DR6L 4IURA 4PMBA 4JI4Q 1HZCA 1VQ4A 2JA6H 3MTSA 4A3KB 1G91A 4KI0A 1VQAA 1I6HB 1WTXA 1F2LA 5TSSA 2EYMA 4JI7L 1BXTA 2KBNA 2L0CA 3HOWH 1UNSA 4OX9Q 4P2CB 4PZ6A 4JYAQ 3NUCA 3CP0A 2M00A 2VQFL 5E7NA 2F0QA 2B2UC 4JYAL 3ERQA 3S15H 3NQTA 2VQFQ 5JJKA 3K5LA 4IJHA 4NDXA 4RH6A 4JI1L 3CRLC 2Z1CA 4JV5Q 2DN8A 4F87A 1Z47A 3PUXA 1B3QA 5ELOA 1DM0B 4DV0L 1DOKA 1L2FA 1E2VA 4A3DG 4DUZL 2Z0SA 4DV3L 2ZXPA 3HKZG 5FO7B 1K8AC 1EQTA 4QB4A 4YIJA 1FJGL 4DV5L 1FNVA 1K83B 3BDOA 5M9OA 5FLMH 2SNSA 1EIHA 2RVLA 2F1MA 1LTID 4CHTB 4B08A 2IPKD 4DR6Q 2EYPA 1HPCA 1SBBB 2PW5A 1R9TH 1GUWA 3RN2A 2HDLA 5GAHC 1ET6A 2ICIA 1LUZA 4JI3L 3RZDB 3HKZE 3PUZA 5ELEA 3WOFA 3FDTA 4AIMA 4PG3A 3K7UC 4JBJA 3A0JA 4KHVA 1D1IA 5CR3A 3NTKA 3PSIA 2JJQA 4YY3L 1L1OA 2VS1A 3J81L 2JA8B 2RCFA 1TR5A 2PPBC 4LF7Q 1X3FA 1W6JA 4KY7A 1M1KC 2DNCA 5J3BA 2MQHA 1LTRD 4IOAA 4U68A 1HA5A 1TY2A 1IHZA 4C56C 4EVOA 1NJIC 3IFDA 2G9DA 1V8QA 1Q46A 5JAVA 2DY8A 4LFAL 1HR0W 1VQ7A 4A3IB 1O78A 2JA5B 1LT6D 5EJWA 4OWWB 1CKOA 1HA6A 1PHJA 3C1FA 4GKJQ 2R7DA 2E2HB 3RZOB 1Y1WH 3T1YQ 4BBSH 1L0YB 4NMZA 4RCNA 5LL6S 3DWQA 5FJ8H 1TY0A 2D62A 3I56A 4R4IA 1IKLA 1PFSA 2I5HA 4MN3A 1QJOA 2EJMA 3E9IA 1J9OA 2KJXA 4WJWA 1WTQA 2RCNA 1KXLA 3CCEA 4A75A 4OELB 3CCSA 4KY5A 4IO9A 4Z9CB 3UDXA 4C2MB 5EKKA 4A93G 5ELBA 3VA7A 1ASZA 5AFWA 1XPUA 4X3UA 1JJCB 2HHHL 1ENFA 3S16B 5FO9B 3TDQA 3QOLA 1HZ9A 2Y0SB 4A3BB 4GOPB 3DM1A 4K5WA 2ICEC 3TQYA 1S5ED 4DNTB 1DGSA 3S1NB 5C3WA 1F2MA 2UXBL 4DR3Q 1JC7A 5AJ3L 1HFNA 3S14B 3GTKH 1LTAD 2MNAA 3I4NG 2MFIA 1X3QA 1HTLD 3A55A 4AQYL 1BCPB 2WAQE 4HMJA 1TWCH 3HKZB 1CFMA 4DPGA 1NE3A 2MJ8A 4I7AA 4BY7B 4RGTA 4DAYB 2O5JC 3TZDA 2UUAL 3U4VA 3WWVA 2K5NA 4OXPA 4AYBE 5IGGA 3J80c 1KHIA 2NVQB 5J22A 1GO3E 4BBRG 3RUZA 4CDCC 1B53A 2Q8RE 1J5EL 1JB3A 2NUCA 2WKCA 4DNRB 4MZ9A 5IWAL 3FVQA 4N9TA 1EY8A 5C4JB 4QUCA 1VCIA 4JG2A 1V1PA 1XNRL 4PV1C 4ZQ3A 2IHEA 1KLGD 1IYUA 4JOIC 4B9XA 3P20A 4A3JH 3G6EA 3TN2A 1IBMQ 3S1RH 1MGSA 1K0SA 4KK7A 1EUJA 3MVVA 1WCMG 2IT1A 1VQDA 1IXRA 2CH4W 2SDFA 4QY7A 1WFQA 4EQOA 2R7ZG 4A3GB 3RZDH 4AYBB 2RHQB 1SNDA 2YTVA 1O7IA 2MUYA 4NXNL 3BYTB 4UPAA 5EQ0A 2JYOA 3RLFA 1LT3D 3BVMA 2PO4A 4QIWB 4NXML 4BBSB 2EE1A 1TQOA 2SNMA 4HN7A 3A5UA 5DEHA 1NY4A 4GOPC 2PYKA 4UAIA 3J7A5 4YHHL 3BZKA 5BR8L 1NAPA 2NZHA 5EKLA 5LMNQ 1E24A 4JBWA 1YJWA 1ILPA 3SEBA 1H95A 2F0HA 2CVRA 1FNWA 3TP7A 1SN8A 2PI2A 3K0XA 5E3FA 3T13A 1TWHH 2ZJQA 1PYSB 1JWSD 4HSVA 3Q0AA 2EIFA 4Y7NH 1L0WA 1IBML 1DZ1A 1TVXA 1VQPA 3PO2B 4JV5L 2OTLA 1QZHA 2X69A 5A2QE 3Q22A 3DWAA 2M2LA 1HUNA 1YJ9A 3NPPA 4ME5A 2B8GA 4C3IB 4KD3A 2OQ0A 4IPCA 3D4WA 1RJTA 1K28A 1LTLA 4B3SQ 4KD4A 1SSOA 1X65A 4LF4Q 1B9MA 5C0XI 2EYHA 2PQEA 5K5PA 4ALPA 1PA6A 1SXTA 4C3IH 4KJOA 3ND9A 3FPUB 2C5CA 1TKWB 1F2YA 3VR3A 1ZXTA 1JICA 1PTOB 3NE5B 4APVA 4R4QA 1UE5A 1YHAA 5L37A 1DCZA 3LWEA 1SE3A 2TMPA 1SE2A 4CDEC 1SJHD 4X3KA 1KAWA 1AH9A 2BDOA 4DV1Q 2F03A 4A3CH 2BDNA 3ERSX 1S5FD 5C44H 1D5ZC 1VQHA 2IHFA 1FYCA 2BOSA 4C3HB 2YYZA 3ONAB 4A3MH 3OYYA 4IFDG 3VYUA 4C1NI 1SNMA 4YCVA 1XMOL 2WINB 2OEOA 1UUPA 1CZGA 4FF3A 4KHZA 3S1NH 4A3JB 3FPPA 1YNJD 3CCLA 4C3JH 2E2JH 1HZBA 3PIO3 2Z6KA 4JBMA 1XWEA 2UXDQ 2K04A 1Y1WG 4A3EB 3M4QA 1JE4A 3CPWA 2HCIA 4EQ5A 3HRZC 5LMNW 1NNXA 4QQBX 5ELCA 4BY7G 1G51A 2A6HD 2N8NA 3HOZH 1RD9D 3AFPA 3KFUA 1VQKA 1I3QH 1S4ZA 2EYLA 2L55A 3C1EA 2NN6H 5IYBH 4BY1H 5IODA 1PH9A 1HQRD 4RGOS 4LF7L 4OGQC 1MD2D 1MJEA 4FF1A 3S2HB 2K03A 2NVYH 4DGZA 4A3LH 4C3IG 1LT4D 2B2YC 2LSSA 3GTMB 1V1OA 4TVAB 2NVQH 2CWAA 2E2HH 1NMFA 4Q5VA 4HIKA 5LL6X 1TS4A 1G6PA 4NP5A 3ITPA 2EYFA 3MAQA 3PO2G 1PMRA 2V1CC 3AQQA 5C4HA 2K75A 1SYCA 2WB1G 3F2CA 2N88A 1IL2A 1G8ZD 2B29A 1E2WA 4LMQD 4POGA 1PH8A 2QILA 1EY6A 2KEEA 1TWGB 4ZRZA 4LFCL 1PYWD 4R4OA 1I6HH 3SHLA 2BE5D 3PF4A 3DMUA 1SMXA 2KVMA 1XMOQ 1WD0A 1TWFB 3S14H 2D0OA 4BBSG 2EXZA 1Y8OB 3QR8A 3Q23A 3UE0A 4ZCKA 4BS9A 3KLRA 2L11A 5DLQE 2F0NA 3CRKC 4X62L 1A2TA 1VQCA 2ZXRA 4L6TB 3BVZA 4DV1L 1JWUD 5M5XB 1C9OA 5C4JH 1DD2A 1E3PA 2CKZB 3S2DH 1Y14B 3PUWA 1RODA 2K05A 2KOLA 3TZUA 1PTOC 1UAPA 4TSSA 2E2DC 3URYA 4AYBG 1FVIA 4F88A 3HP3A 1BVSA 3L2PA 1VQGA 1B50A 1YIJA 5IT9E 5EPLA 4B3RL 4DR4Q 1QILA 1BR9A 2G9HD 1EEFD 4RMFA 2Q2HA 2LMCB 1JQYD 1GHKA 4K8IA 5IT9c 1VQEA 4HIOA 3OHXC 3I7FA 2PNRC 1SFOB 2QEJC 1N32Q 3M85A 2K50A 3Q8DA 4K5XA 1WTRA 2L5TA 5IGDA 1QVCA 4GLAC 2I0QA 4I7ZC 4C1NK 2IY5B 3I4NB 1F9PA 2BH8A 3CQZH 3H3VI 1A62A 5FKAC 4C3JB 5M3FB 4FXKC 1B3AA 3T51B 2N3SA 1Q1EA 1LV9A 4DUYQ 1XNQQ 1PRTB 1G2SA 3S15B 4JI2L 4BBRH 2A73B 2NWGA 4A3FH 3M4OH 4N9PA 4KJNA 3TP5A 1XNQL 1ZKOA 4C3JG 2B2YA 3T4AC 4DAVA 2HDMA 3H09A 3PO3G 4HSPA 4RHRA 4A3FG 1PFMA 4UP9A 4B9WA 1FJGQ 1VQMA 1U4LA 1SNOA 2R7ZH 3OTOQ 3S16H 4ME3A 3QOJA 1TWHB 4A3BH 1VMPA 3I90A 3R93A 4FNFA 2R92G 1Z7TA 3M7GA 2CW0C 1TS2A 4IOCA 5IYCG 1JCKB 1ZYRC 3HOXH 2RSOA 1N32L 1DYQA 4TKOB 5CV8A 1EYAA 2F0VA 2EY6A 4P72A 3J7AF 3RNUA 3VYTA 1PTOF 1QVFA 2JA5H 3MFYA 1XTCD 2DJFC 2AHOB 2Z6BA 3CCMA 4RA8A 1CKMA 2BCOA 5FOBB 3KF8A 2XRSD 2Z8LA 3NENA 4XIGS 3W5OA 3SK4A 1XPOA 1D6EC 4P71A 1X9NA 4DK0A 3ULPA 4A3EG 2A6ED 5KIXA 4P74A 1EQQA 2JA8H 1Q12A 2UUAQ 3OMGA 2X6GA 3N52A 4JI8L 5C44G 3HS0C 4L5RC 1I5FA 2IX1A 5KNCA 2R92H 2D9UA 2RDGA 5CV7A 3MWYW 1N33L 1WYDA 2CHBD 1DONA 1C8CA 4CBVA 1KTKA 3L7ZC 2DGYA 3BZCA 5I6WA 2CW0D 5ISRA 4B3ML 2A5HA 4GLVB 2PI2E 1BF4A 2JA6B 3C2PA 4OWTB 4DV3Q 1LTGD 1A8VA 3K0YA 5AJ3Q 3NBIA 5C5LA 1BCPD 4UHVA 1Q1BA 4FYDA 1G6ZA 2B2VA 2B3GA 2L9HA 1PVOA 4DV5Q 3PMFA 4DV6Q 4R1JA 3MXNB 1FD7D 1EL0A 4RCOA 2RSNA 3SK8A 4OO1H 3EJIA 3QB3A 2KA7A 2UXBQ 2MO1A 2HHHQ 4QGUA 2XN9C 4GNXC 2NVXB 4HJ9A 2CWPA 1AFPA 1H9JA 1A63A 4TQUS 4MIUA 5ELNA 2E75C 2WKDA 5C0XH 2NZOA 4KN4C 1YHQA 3HZXA 4IFDI 1WD1A 4F8MA 1EWIA 5CV9A 4GOPA 1EY9A 5GQOA 1NMGA 1YEZA 4LJZC 4EGVA 2IX3A 1JB7A 2RKSA 4A3DB 3RR5A 4XXEA 5HGQA 3MXPA 2EYOA 2VY3A 3F8TA 1I3QB 2NTSA 3HOUH 4L5QA 3K6OA 3A8IE 2LKVA 3PIOA 1XJVA 4LFAQ 1J6QA 1R4QB 2WB1E 4LUOA 1QUQB 1A0IA 4XQJA 1D2BA 1E22A 2EJGC 1GUOA 1OO9B 4HTHA 3J81i 4QL5A 2B2TC 1Q7YC 2TSSA 4A3JG 5K36H 1ET9A 1NSNS 3DXJC 1NR2A 3M9BA 1TWGH 1V9PA 3OWEB 1BBXC 1S3OA 3QJYA 1A6XA 3FRPB 1ML0D 1STAA 3ZYYX 3X3NA 1B70B 3K7AH 2XWJB 3KF6B 1YZ6A 1B7YB 1MIUA 5ELDA 1CKNB 2PQAA 2HCCA 1JT8A 1MKHA 1QCBD 3PCOB 3STBD 4K0KQ 2PZTA 2VUMH 4C3HG 2Q2TA 2GVAA 3KUPA 3M3YB 1UEAB 5DM73 4DXGA 1X3EA 4A3CG 4OO1I 1ESFA 3STBC 5C4ZA 3VR2A 4FO2A 4PMCA 2E8GA 3DUZA 4HCSA 1SROA 2BE5C 3P1HA 4M8AA 3I73A 4PNYA 5GAEC 3J7AV 5JVG3 3KLSA 1XNRQ 3A7AB 3T53B 2FMMA 3S24A 2LS01 5KGUA 1L1OC 1ENAA 4YCUA 3I4LA 1IW7C 4X6AH 1O7YA 1CI3M 3GDEA 5BN4A 5I2XA 3OMCA 4LF6Q 2H4OA 1AP0A 1V43A 4DV2L 4IUVA 3NWTA 1HQMC 2NBFA 3KBGA 3FP9A 1OXVA 3HKSA 4O1NA 4IFDJ 1PRTF 4CJ2C 2QDBA 3OPOA 5M3MG 1K3BC 1IYJB 5GROA 4IZ8A 4XTCS 4C3HH 4A3MB 1SFOH 1U4MA 2NVXH 3SXHA 1KRSA 4XYQA 1EZ8A 3CMEA 3D0FA 4GZYC 4GS3A 4KMUC 1EQVA 3E3XA 1H9MA 3CCJA 2PMZE 3IKJA 4LFCQ 4JI0Q 4J15A 3NBHB 3G6JB 2EPBA 3V96A 2F0EA 2J0TD 2JA6G 1OXUA 2FFKB 4DR3L 3CCVA 3CXCA 1E7ZA 3SDZA 5J1ZA 4J6HA 2F0WA 1FGUA 3K57A 2F0OA 1RKNA 2YTYA 1RTNA 4G7HC 1ONLA 1E0BA 4HIDA 1QOHA 2A68D 3M4YA 4BY1B 2KECA 2UUBL 5D3IB 1UE1A 2FHTA 3GV6A 1B2TA 1PZJD 2F0UA 5K36G 3V2TA 3E5SA 1YNNC 1R4PB 1TWFH 1I4XA 1Y1VG 5ELFA 5M5YH 3K7AB 4WJ3M 3HOWB 3HOUB 1JJ2A 5C4XH 5C44B 2A8VA 1EY4A 3PF5A 4QUFA 4LF8L 4IUUA 5EBDA 4N8FA 4G4KA 4FXDA 1SYEA 4GLXA 2I07B 1WTOA 4JCVE 1N8RC 1XX8A 2F3VA 3T1HL 1AEXA 2YU9B 1PZKD 1PH6A 2WV6D 4DR4L 1IZ6A 2B39A 1SE4A 4LNQA 1Z9FA 4DAMA 2C9OA 2F0SA 1VQNA 1KIXA 3K80C 2WAQG 4DUYL 2ZT9C 3GTGB 5JVH3 4IPDA 2R92B 3DWPA 3E9HA 1PH2A 3U9OA 4P73A 2F3WA 3PQIA 5IP7H 2PCFB 3MXGA 1K8GA 3TMEA 1EIFA 3UDIA 2NN6I 2K33A 1SNPA 5IYDG 4J8QA 3FKIB 3K59A 2Y0SG 2L15A 2B63G 2GN5A 2K4KA 4DK3C 4KV6A 1GHJA 1VF5C 1X54A 1F9QA 3GQBA 3QWNA 3K81C 4FF4A 1BKBA 2QKIC 1PFNA 3J80L 1D7QA 4HJ8A 3AB9A 2AWOA 4DV4L 1F2ZA 5KNDA 2JE6I 4DKAC 1Y69U 3H0GH 5FJ8G 3JAML 5M3FG 1WJJA 1NTGA 4X3TA 3HOVH 2HQLA 1KDAA 1JE5A 4GKJL 3BYYB 2E2IH 1CA5A 3KBXA 3KOJA 1YNXA 1K73C 2E5LL 1N33Q 1I4HA 4H7BA 4RGNA 3K58A 1JOKA 4ZKCB 5FLXc 1GUSA 1B4OA 3K5MA 1FL0A 1JWMD 1WTWA 1Y1VB 4XYOA 3L0OA 3T1YL 5I9OA 1CSQA 1E1TA 4LF4L 4JW0A 2JA5G 1CT1D 4OO1G 1F9RA 3T1HQ 1CSPA 4K8JA 2XTIA 1ASYA 1GVPA 3NHHA 4WFN3 4MTKA 4BY1G 5IYBG 2EJFC 2K14A 4H02A 3I91A 4YHHQ 4FDBA 1STGA 2ZJPA 4YCWA 1PDQA 3M4PA 1KDBA 3J7ZC 1X3PA 4JC0A 3EN2A 4DXFA 3I4MH 1II3A 2OQKA 3GD7A 3BS1A 3E6ZX 3GTMH 1HR0L 4ZAIA 4X65Q 3LNNA 3CD6A 3MFGA 3BG3A 1BBWA 1TU2B 3CAMA 5FLMG 2ZM6Q 5T1GA 2R3ZA 1RDPD 1EOTA 2RDFA 3B6YA 1K9MC 2K7VA 3HOXB 2HIVA 1HR0Q 1K8MA 5J39A 1GXDC 1SRUA 2KHJA 1G2TA 4L5TA 3FKIG 3QO2A 3C46A 4A3MG 2BA0A 1VQFA 2JQOA 5I2YA 2UU9Q 4LK1C 1EOVA 5A35A 3CCQA 2L1BA 1U5KA 5DNFA 3S17H 2PMZB 3HEJA 2E2IB 5I9PA 5CV4A 4DUZQ 1YI2A 5JJZA 3H3VC 1A2UA 4LUZA 2I5MX 1VQ5A 2LFNA 1Q81C 3T56B 2ZTEA 1TS3A 5IGBA 2WIIB 5IP7G 5IYCH 3TRZA 2O4XA 3I8ZA 1EU3A 1MI2A 1QWYA 3F2UA 3GTLH 2D5DA 2UUBQ 4CDFC 1ICFB 5KEEA 1LACA 1SMYC 1K0RA 4OX9L 1PLFA 1A15A 2KENA 1PYBA 3GTGH 4DV4Q 2XIWA 4DV6L 5JJLA 3M3YH 4NPSA 2EVBA 4AQYQ 1PXUA 1SAPA 2E76C 2RF4A 4LWCA 2H1EA 2QEXA 2UXCQ 3NTIA 1YHBA 2UXDL 2YV5A 1EYDA 3EROA 3EQLC 5BN3A 3GTJH 5M5WB 3GTPB 2K6AA 2JEAI 2Q8TA 4EQNA 2ZTCA 3CCRA 1YBYA 2K1BA 1DJRD 1PTOD 1HNWL 3A56A 1E1OA 2F0PA 1M8AA 3A8JE 4ID6A 2JN4A 4EX5A 1C0AA 3A74A 1HTPA 4R4TA 3BDCA 4IUPA 2UUCQ 1W6KA 4OL7A 1UEBA 1U0LA 4JOIA 2JA7G 1JORA 2A69D 4JI8Q 4GN4B 2SOBA 4JI6L 4O0AA 3EA6A 4PMWA 3JAME 2B2WC 2F0GA 4OEMB 4DV2Q 2LXJA 5IGCA 2XSCA 5C3EH 4BBRB 4IPGA 1HJPA 1EWHA 3NQIA 5D3DA 1HNXQ 3HOVB 1XMQL 3PGZA 1GKHA 2UXCL 1CK1A 3CCUA 3SE0A 5KNBA 1OXXK 2I5LX 3DEPA 3LWUA 1WVLA 1I50H 2VW9A 1VQOA 2E2JB 2NVYB 2NN6G 1PH4A 1J8IA 1P16A 4DR5L 3R8BA 3MEHA 3CF5A 2K32A 1XMQQ 1I94Q 4IALA 5DAUA 5A2QL 1F77A 4DV7L 2NVTB 4MTNA 3L3OC 2F0DA 4U673 2MPMA 4HJAA 3S1MB 3HOVG 3I4OA 5EBCA 3W1GA 3OW2A 1K3RA 2AKWB 1K83H 1STNA 4DU9A 4YWMA 5GAGC 1SE8A 3X3MA 3HOYG 1GJXA 4CKCA 2K01A 2KEDA 4K2KA 3D4RA 4CGYB 1X32A 2EZVA 2CQOA 5M5YB 2QW7A 2HIXA 5IT9L 1Z6HA 1I4PA 2A68C 3CW2C 4IN3A 1E2ZA 5LMNL 1B8AA 1IBKQ 1SNCA 3S1RB 1HHVA 4QMGA 2F4VQ 4A93B 2PZWA 1MSGA 2AQ1B 5CORA 2VQEL 4IFDH 4CJ0B 1T9HA 2DUDA 3D6WA 1HNZL 1BO0A 1EY0A 4AH6A 4RKLA 1VQ9A 4HR7B 1XYIA 3GTQB 2VB2X 1I4GA 4NXNQ 2KCTA 1ESRA 1YNJC 4C2MH 1BCPC 2F0JA 1PTOH 1WOCA 3AU7A 1YITA 1U4PA 5G3LD 3TP8A 3RD4A 4HAEA 2JXMB 1TWAB 3GTLB 5CC4A 5FLXL 2B2TA 2KHSA 2KCCA 5C6AA 2R93H 3VR4A 1Y8NB 2A6HC 1SYDA 3N6RA 1PH3A 1VQ8A 2F0FA 2IL8A 5FLXE 4DK1A 5C0XG 2EDGA 3O13A 4KKUA 1IW7D 4UP8A 5COYA 4DR2L 5C5MA 5JJIA 4IUNA 1U9RA 1LM0A 3U9SA 3CU7A 2KQ3A 3VYRA 4K0KL 4A76A 5C4XB 1FGBD 3NXWA 4DR1L 2CH4A 2F3IA 1ENCA 1WCMH 4OIKA 1IL8A 1VS0A 3RN5A 2X6LA 1D1KA 1OXSC 4N8X1 3LX0A 1EWCA 1SEBD 4A3FB 1K8OA 1LTTD 3PO3B 4K6DA 3W1BA 2FJ2A 1CTMA 2R61A 1S5BD 4LF9L 4ZKBB 3TS2A 1N36Q 2PZUA 1CQVA 1SJED 2NTTA 3UE1A 4JI5Q 3SVMA 4LF5L 2Z9HA 3I4MG 2K5WA 1GOZA 3D4DA 1W2BA 3ULJA 2EQSA 5IIFA 4LF5Q 1O80A 3VR5A 1PV4A 5C4XG 3TBIB 4K6LA 2QCPX 1EIGA 3RZOH 1NUCA 1N36L 5C0XJ 1H9SA 3D8GA 3CPFA 4IUTA 3PO2H 3NTHA 1HXYD 4DFAA 1BBUA 4B3TL 1G291 1UWVA 3G4SA 3P75A 2F0MA 3K5OA 1B44D 4B3RQ 4LUVA 3FHWA 2BA1A 1KC8C 1SR3A 4ZK9B 1C4QA 4ODGA 4CKBA 1N34L 3CC4A 3Q6SA 1F9SA 4H0LC 1GUGA 4G57A 1YJNA 1J5EQ 4B3TQ 1GUTA 1RL2A 3TREA 3HOWG 3L9AX 3MXUA 1Y8PB 4JI5L 3U58A 3RMHA 1IBLQ 4X64L 1GUNA 1KAAA 1ZYRD 4RKBA 5NUCA 3S17B 4NW2A 2FXQA 4H44C 5EPKA 2Q2UA 4LAAA 1JMCA 2O5IC 1STYA 1STEA 2KHIA 4ULLA 4DA2A 2BH2A 5E4XA 3WDNA 4A3GH 1JOQA 4XQNA 4KY6A 3SK5A 1CQFA 1TS5A 3OIPA 3G71A 2A69C 3S1QH 1CA6A 4X66L 3PUVA 2AQ3B 3TP6A 2Q8IB 3MHBA 5JEAG 1H9RA 3PO3H 3NELA 3D6CA 5T1IA 5C3EB 1JOOA 1M90C 2F4IA 3GTQH 4B3MQ 5IGEA 2B63B 4KKSA 4J1MA 5M5XH 3MEFA 1B1ZA 2A19A 3E0JA 3U50C 2EY2A 1D5MC 1BOSA 2F52A 2HD3A 4JK1C 2ZTDA 4RWSC 5M3MB 1BDOA 3IAYA 2L12A 2RDHA 3F1ZA 5KYLA 3KJPA 2F4VL 1T5EA 3Q24A 4GKKL 1GD7A 2K5HA 5HGTA 5EGTA 4DR2Q 3QG1A 4KKTA 1HRJA 1I4RA 5LHY1 2GVBA 2OF1A 2ES2A 1TWCB 1JJGA 1IYVA 4OWXB 2CQAA 2RA4A 2JEBI 3ICEA 1Q3LA 1RF2D 4MHEA 1Q86C 1O7LA 1STBA 4GN5A 4DR5Q 1WTPA 2NVTH 1N9WA 4QJFA 2RHSB 3RLNA 2I46A 3SK6A 4JI4L 3H3VH 2B2UA 5GADC 2VQEQ 3NK9A 4HMIA 5CV6A 4DK6C 1R9TB 5JOBA 3S2HH 2DY7A 2XRQD 1PH7A 1OXTA 3UDGA 1X6OA 3M7NA 3OTOL 1AE2A 4A3KH 3BU2A 2JK8A 2JA7B 3G7LA 3PIP3 2ZM6L 4Y52H 3HOZB 1Y1WB 1X3GA 2Z6KC 2N78A 4L5SA 3G48A 3GP7A 4S3SA 2NZ1D 1TT2A 5BN5A 4A3KG 1AE3A 1KNEA 1LABA 3J80i 4PZ8A 3A5ZB 1FNUA 5IP9H 1YNND 3A8KE 3OSOA 2M9VA 1O7ZA 1PH5A 1AZPA 4JI2Q 2V4DA 5LMUL 4Y7NB 1EIYB 3AFQA 1XPRA 2R93B 1JR0D 1VQIA 2WFWA 3OW7A 3RLOA 2WACA 4MNOA 1D8LA 2F0IA 1CM9A 1I94L 4V0BA 4WJ4A 3PV0A 4OONA 3D3RA 2VB3X 3HOYB 1AW7A 3HGBA 3IFTA 4A3IH 1KD1C 2AUJD 2ATWA 3M4OB 4HCEA 1BUVT 4O42A 2XWBB 4DR1Q 5JEAH 3J81E 4LF6L 2K5VA 2HQEA 2Q2IA 1S5CD 1I6VC 4ILWA 1HFGA 4A93H 3S9WA 3KDFB 2OCEA 4G7OC 4FP5D 1TWAH 2F0TA 2N49A 4YWLA 4K14A 2CFMA 3MXNA 4P75A 3H0GG 3ER0A 1VMCA 4XT1B 1RIPA 4JVZA 2PNHA 4B3SL 2G5DA 4RFBA 3F2DA 4BY7H 1LTSD 3J81c 3HOXG 1QG7A 1EY7A 1PH1A 5EPJA 3NP8A 4KLKA 4X62Q 2D2CC 2EY5A 3NWSA 2IJ0A 2XNAC 5IYDH 1T5XD 2IX0A 4O2DA 2YTXA 4QIWE 3GTKB 5CBAE 4E6IA 3ULLA 1C48A 2J7ZA 2OXPA 3KLSX 4GNXA 3GTPH 4RAUC 5I6YA 5G3LF 1SLJA 4IUQA 3EBEA 2K28A 2R7ZB 1LLRD 1L1OB 5JPNC 4CJ1B 3S1MH 5LMUQ 5IY0A 2RQXA 4BXXH 3OOCA 1HNZQ 3W3AA 4OIJA 1LT5D 4HIMA 3C3LA 2ZXOA 4UDUC 1CUKA 4X65L 3CMAA 1NR4A 3I3CA 4UY8C 4ZLTF 1WTHA 5CV5A 4RHSA 2JA7H 1IBKL 3H6MA 5D14A 1U4RA 1WCMB 4X3SA 1MJCA 2DNEA 5M3FH 4R8NA 3WOEA 4L8JA 4GN3B 1EEID 1KLUD 2LXKA 2MO0A 3CQZB 1I50B 3V05A 3UI2A 1CKNA 2PQAB 2L4NA 1DOLA 1LYLA 2QGQA 3JC66 2Z4IA 3GO5A 5I4DA 2YU9H 3E0EA 2QF7A 2VNUD 1A3VA 1TXYA 1P8LA 3KYHC 2VUMG 3DEOA 3KLWA 3H94A 4DV7Q 1RCVD 2WP8J 3I55A 2VZAA 1KDCA 5DM63 2N55A 2PW7A 4DN4M 1L0XB
chains in the Genus database with same CATH topology
2ENBA 1AZQA 3CKIB 4R9WA 4I65A 5HURA 2IWHA 3R2TA 4K2LA 1MBYA 1A3TA 3I70A 4TRDA 1SNQA 1EYCA 5C3XA 1EU4A 2JP1A 1H9SB 3D31A 4FXGC 1EY5A 4BWGB 2F0KA 4M1UB 4V190 3CHBD 3PUYA 2RBMA 3R2IA 2AQ2B 1EFID 4DAYA 1ILQA 1D5XC 2B8FA 2B2VC 3S1QB 1CZWA 3DHQA 1PRTD 2J4XA 4G7ZC 1RHPA 1HUMA 3H91A 4KN7C 1SDFA 4IQZA 2NYZD 4QF4A 3EFXD 1PRTC 5IOCA 1ZEQX 4H13C 4L63B 4ABNA 2R6GA 3BDLA 1CHQD 2A6EC 2XVSA 3GV3A 4F7XA 2EOTA 2SEBD 4OHJA 4EQPA 1I4QA 1STHA 2K5DA 2A74C 3GTOB 5KRUA 5CMDA 1MSHA 3KK7A 1BNZA 3A54A 1DOMA 5JPMC 2VXWA 2K5QA 3BVGA 1SYFA 5CYUA 3QIAA 4NKLA 5JEAJ 1H9KA 2F0LA 4XQQA 2WB1B 4Q0FA 3I4MB 3EVQA 1WTVA 3OIQA 4QCLA 4WRDA 4ZUJA 5KYIA 1B9NA 2WAQB 2AWNA 3HG9A 4CKEA 3H0GB 5CGKA 2EYJA 2GA4B 4RGMA 1QNUA 4FF2A 2VUMB 1EZ6A 2B2WA 5CBEE 3TSSA 1NCVA 5IGFA 1VDZA 1LTBD 4FVMA 1FR3A 5F2DA 3NBHA 1ICWA 5E1FA 3IL8A 2ID0A 3S2DB 3R3OA 1KABA 5FK9C 2KUMA 4K5VA 2EY1A 2FINB 2MGSA 4WORA 1M4VA 4BA2I 3MC0B 2E74C 1DXMA 3VA5A 3NSWA 2O2LD 3J7YW 1HCZA 2KCNA 4R8IA 2AUKA 4XDXA 1KNAA 3A7LA 5EKIA 3K5NA 2NB0A 3J80E 1A3UA 3I72A 1XXGA 4BA1I 3W2DA 2Z4HA 3GTJB 4PQXA 1CHPD 4ZUIA 1PZID 5D65A 3VYSA 1BQQT 1IKMA 1QNKA 2OT2A 1QE6A 1TIID 3BZDB 1VF7A 2MP1A 3FMCA 1QB5D 1RTOA 1BCPF 3MZ5A 3ND8A 1Q90A 2FMCA 4DF7A 1SYGA 4ZYSA 4HEDA 1S5DD 1PFBA 4XT3B 1AN8A 5E4WC 1SYBA 3P7JA 5FO8B 4DAPA 2JSOA 3MA2B 3OWFA 4KTAA 2LY7A 1LO5D 1V1PB 1SMYD 2MHVA 2HUGA 3SR1A 3VR6A 2IW3A 3FEWX 1Q8IA 3T16A 3AMUA 4IURA 4PMBA 3MTSA 4A3KB 1G91A 4KI0A 1I6HB 1WTXA 1F2LA 5TSSA 2EYMA 1BXTA 2L0CA 1UNSA 4P2CB 3NUCA 2M00A 2F0QA 2B2UC 3ERQA 3NQTA 3K5LA 4NDXA 4RH6A 3CRLC 2Z1CA 2DN8A 4F87A 1Z47A 3PUXA 1DM0B 1DOKA 1E2VA 2ZXPA 5FO7B 1EQTA 4QB4A 4YIJA 1FNVA 1K83B 3BDOA 5M9OA 2SNSA 1EIHA 2RVLA 2F1MA 4CHTB 1LTID 4B08A 2IPKD 2EYPA 1HPCA 1SBBB 2PW5A 1GUWA 2HDLA 1ET6A 2ICIA 3RZDB 3PUZA 5ELEA 3WOFA 3FDTA 4KHVA 1D1IA 5CR3A 3NTKA 2JA8B 3J81L 2PPBC 1TR5A 1W6JA 4KY7A 2DNCA 1LTRD 4U68A 1HA5A 1TY2A 1IHZA 4C56C 4EVOA 3IFDA 2G9DA 1V8QA 5JAVA 2DY8A 2JA5B 4A3IB 1O78A 1LT6D 5EJWA 1HA6A 3C1FA 2E2HB 3RZOB 1L0YB 4NMZA 4RCNA 5LL6S 3DWQA 1TY0A 2D62A 1IKLA 1QJOA 4MN3A 2EJMA 1J9OA 2KJXA 4WJWA 1WTQA 4KY5A 4Z9CB 4C2MB 5EKKA 5ELBA 3VA7A 5AFWA 4X3UA 1ENFA 3S16B 5FO9B 3TDQA 2Y0SB 3QOLA 4A3BB 3DM1A 4K5WA 2ICEC 1S5ED 4DNTB 3S1NB 5C3WA 1F2MA 1JC7A 1HFNA 3S14B 1LTAD 1X3QA 1HTLD 3A55A 1BCPB 4HMJA 3HKZB 1CFMA 2MJ8A 4BY7B 4RGTA 2O5JC 3TZDA 5IGGA 2NVQB 5J22A 3RUZA 1B53A 2Q8RE 1JB3A 2NUCA 2WKCA 4DNRB 3FVQA 4N9TA 1EY8A 5C4JB 4QUCA 1VCIA 1V1PA 4PV1C 4ZQ3A 1KLGD 1IYUA 4B9XA 3P20A 3TN2A 1MGSA 4KK7A 3MVVA 2IT1A 2SDFA 4EQOA 4A3GB 4AYBB 1SNDA 2MUYA 3BYTB 5EQ0A 2JYOA 3RLFA 1LT3D 3BVMA 2PO4A 4QIWB 4BBSB 2EE1A 1TQOA 2SNMA 4HN7A 5DEHA 2PYKA 4UAIA 1NAPA 5EKLA 4JBWA 1ILPA 3SEBA 2F0HA 2CVRA 1FNWA 3TP7A 5E3FA 3T13A 1JWSD 4HSVA 3Q0AA 1DZ1A 1TVXA 3PO2B 2X69A 5A2QE 3Q22A 3DWAA 2M2LA 1HUNA 3NPPA 4ME5A 2B8GA 4C3IB 4KD3A 3D4WA 1RJTA 4KD4A 1SSOA 1B9MA 5C0XI 2EYHA 2PQEA 5K5PA 1SXTA 4KJOA 3ND9A 3FPUB 2C5CA 1TKWB 1F2YA 3VR3A 1ZXTA 1JICA 1PTOB 3NE5B 1DCZA 3LWEA 1SE3A 2TMPA 1SE2A 1SJHD 4X3KA 2BDOA 2F03A 2BDNA 1S5FD 1D5ZC 1FYCA 2BOSA 4C3HB 2YYZA 3ONAB 4IFDG 3VYUA 4C1NI 1SNMA 2WINB 2OEOA 1UUPA 1CZGA 4FF3A 4KHZA 4A3JB 3FPPA 1YNJD 3PIO3 1XWEA 2K04A 4A3EB 1JE4A 2HCIA 3HRZC 5ELCA 2A6HD 1RD9D 1S4ZA 2EYLA 2L55A 3C1EA 2NN6H 5IODA 1HQRD 4RGOS 4OGQC 1MD2D 4FF1A 3S2HB 2K03A 4DGZA 4C3IG 1LT4D 2B2YC 3GTMB 1V1OA 4Q5VA 5LL6X 1TS4A 4NP5A 3ITPA 2EYFA 3MAQA 1PMRA 5C4HA 1SYCA 2N88A 1G8ZD 1E2WA 4LMQD 2QILA 1EY6A 2KEEA 1TWGB 4ZRZA 1PYWD 3SHLA 2BE5D 3DMUA 2KVMA 1WD0A 1TWFB 2EXZA 1Y8OB 3Q23A 4BS9A 3KLRA 2L11A 2F0NA 3CRKC 1A2TA 2ZXRA 4L6TB 3BVZA 1JWUD 5M5XB 1DD2A 3PUWA 1RODA 2K05A 2KOLA 3TZUA 1PTOC 4F88A 1UAPA 2E2DC 4TSSA 3URYA 3HP3A 1B50A 5IT9E 5EPLA 1QILA 1BR9A 2G9HD 1EEFD 2LMCB 1JQYD 1GHKA 4K8IA 3OHXC 2PNRC 1SFOB 2QEJC 3M85A 4K5XA 1WTRA 2L5TA 5IGDA 4I7ZC 4C1NK 3I4NB 1F9PA 5FKAC 4C3JB 5M3FB 4FXKC 1B3AA 3T51B 1Q1EA 1LV9A 1PRTB 1G2SA 3S15B 2A73B 2NWGA 4N9PA 4KJNA 3TP5A 1ZKOA 4C3JG 2B2YA 3T4AC 4DAVA 2HDMA 3H09A 4HSPA 4RHRA 1PFMA 4B9WA 1U4LA 1SNOA 3QOJA 1TWHB 1VMPA 3I90A 3R93A 4FNFA 1Z7TA 3M7GA 2CW0C 1TS2A 1JCKB 1ZYRC 2RSOA 1DYQA 4TKOB 5CV8A 1EYAA 2F0VA 2EY6A 3J7AF 3VYTA 1PTOF 3MFYA 1XTCD 4RA8A 5FOBB 2BCOA 3KF8A 2XRSD 2Z8LA 4XIGS 3SK4A 1D6EC 4DK0A 2A6ED 5KIXA 1Q12A 3OMGA 2X6GA 3N52A 3HS0C 2IX1A 5KNCA 2D9UA 2RDGA 5CV7A 3MWYW 1DONA 2CHBD 1C8CA 4CBVA 1KTKA 3L7ZC 5I6WA 2CW0D 5ISRA 2A5HA 1BF4A 2JA6B 3C2PA 1LTGD 3K0YA 3NBIA 5C5LA 1BCPD 1Q1BA 4FYDA 1G6ZA 2B2VA 2L9HA 3PMFA 1FD7D 1EL0A 4RCOA 2RSNA 3SK8A 4OO1H 3EJIA 3QB3A 2KA7A 2XN9C 2NVXB 1AFPA 1H9JA 4TQUS 4MIUA 2E75C 2WKDA 5C0XH 4KN4C 3HZXA 4IFDI 1WD1A 4F8MA 5CV9A 1EY9A 4LJZC 4EGVA 2IX3A 2RKSA 4A3DB 4XXEA 3MXPA 2EYOA 1I3QB 2NTSA 3K6OA 3A8IE 2LKVA 1R4QB 4XQJA 1D2BA 2EJGC 1GUOA 1OO9B 4HTHA 2B2TC 2TSSA 5K36H 1ET9A 1NSNS 3DXJC 1NR2A 3OWEB 1BBXC 3QJYA 1A6XA 3FRPB 1ML0D 1STAA 3ZYYX 3X3NA 2XWJB 5ELDA 2HCCA 1QCBD 2PZTA 4C3HG 3KUPA 3M3YB 1UEAB 5DM73 4DXGA 4OO1I 1ESFA 5C4ZA 3VR2A 4FO2A 4PMCA 3DUZA 4HCSA 2BE5C 3P1HA 4M8AA 3I73A 4PNYA 3J7AV 5JVG3 3KLSA 3A7AB 3T53B 2FMMA 2LS01 5KGUA 1ENAA 3I4LA 1IW7C 1O7YA 1CI3M 5BN4A 5I2XA 3OMCA 2H4OA 1AP0A 1V43A 4IUVA 3NWTA 1HQMC 2NBFA 3KBGA 1OXVA 4O1NA 4IFDJ 1PRTF 4CJ2C 2QDBA 3OPOA 4IZ8A 4XTCS 4A3MB 1U4MA 3SXHA 4XYQA 1EZ8A 4GZYC 4KMUC 1EQVA 1H9MA 3IKJA 3G6JB 2EPBA 3V96A 2F0EA 2J0TD 1OXUA 2FFKB 3SDZA 5J1ZA 4J6HA 2F0WA 3K57A 2F0OA 1RKNA 1RTNA 4G7HC 1ONLA 1E0BA 1QOHA 2A68D 3M4YA 4BY1B 2KECA 5D3IB 2FHTA 3GV6A 1B2TA 1PZJD 2F0UA 5K36G 3V2TA 3E5SA 1YNNC 1R4PB 1I4XA 5ELFA 3K7AB 3HOWB 3HOUB 5C44B 1EY4A 4QUFA 4IUUA 5EBDA 4G4KA 4FXDA 1SYEA 2I07B 1WTOA 1XX8A 2F3VA 1AEXA 2YU9B 1PZKD 2WV6D 2B39A 1SE4A 2C9OA 2F0SA 2ZT9C 3GTGB 5JVH3 2R92B 3DWPA 3U9OA 2F3WA 2PCFB 3MXGA 3TMEA 2NN6I 2K33A 1SNPA 4J8QA 3FKIB 3K59A 4KV6A 1GHJA 1VF5C 1F9QA 3GQBA 3QWNA 4FF4A 3J80L 2QKIC 1PFNA 3AB9A 2AWOA 1Y69U 1F2ZA 5KNDA 2JE6I 3JAML 4X3TA 1KDAA 3BYYB 1CA5A 3KBXA 1I4HA 4H7BA 4RGNA 3K58A 1JOKA 4ZKCB 1GUSA 1B4OA 3K5MA 1JWMD 1WTWA 1Y1VB 4XYOA 5I9OA 1CT1D 4OO1G 1F9RA 4K8JA 3NHHA 4WFN3 2EJFC 3I91A 1STGA 1PDQA 1KDBA 1X3PA 4DXFA 1II3A 3GD7A 3BS1A 3E6ZX 4ZAIA 3LNNA 3MFGA 3BG3A 1TU2B 5T1GA 2R3ZA 1RDPD 1EOTA 2RDFA 2K7VA 3HOXB 1K8MA 5J39A 1GXDC 1G2TA 3QO2A 3C46A 2BA0A 5I2YA 4LK1C 5A35A 2L1BA 5DNFA 2PMZB 3HEJA 2E2IB 5I9PA 5CV4A 5JJZA 3H3VC 1A2UA 2LFNA 3T56B 1TS3A 5IGBA 2WIIB 2O4XA 3I8ZA 1EU3A 1MI2A 1QWYA 3F2UA 2D5DA 5KEEA 1LACA 1SMYC 1PLFA 1A15A 2XIWA 2EVBA 1PXUA 1SAPA 2E76C 2H1EA 3NTIA 1EYDA 3EROA 3EQLC 5BN3A 5M5WB 3GTPB 2K6AA 2JEAI 2Q8TA 4EQNA 2K1BA 1DJRD 1PTOD 3A56A 2F0PA 1M8AA 3A8JE 4ID6A 1HTPA 3BDCA 4IUPA 1W6KA 4OL7A 1JORA 2A69D 2SOBA 3EA6A 4PMWA 3JAME 2B2WC 2F0GA 5IGCA 2XSCA 4BBRB 1EWHA 3NQIA 5D3DA 3HOVB 1CK1A 3SE0A 5KNBA 1OXXK 3DEPA 1WVLA 3LWUA 2E2JB 2NVYB 2NN6G 1J8IA 3R8BA 3MEHA 2K32A 4IALA 5DAUA 5A2QL 1F77A 2NVTB 3L3OC 2F0DA 4U673 2MPMA 3S1MB 5EBCA 1STNA 4DU9A 3X3MA 1GJXA 4CKCA 2K01A 2KEDA 4K2KA 3D4RA 4CGYB 1X32A 2EZVA 5M5YB 5IT9L 1Z6HA 1I4PA 2A68C 4IN3A 1E2ZA 1SNCA 3S1RB 1HHVA 4QMGA 4A93B 2PZWA 1MSGA 2AQ1B 5CORA 4IFDH 4CJ0B 3D6WA 1BO0A 1EY0A 4RKLA 4HR7B 1XYIA 3GTQB 2VB2X 1I4GA 1ESRA 1YNJC 1BCPC 2F0JA 1PTOH 3AU7A 1U4PA 5G3LD 3TP8A 3RD4A 4HAEA 2JXMB 1TWAB 3GTLB 5CC4A 5FLXL 2B2TA 2KHSA 2KCCA 5C6AA 3VR4A 1Y8NB 2A6HC 1SYDA 3N6RA 2F0FA 2IL8A 5FLXE 4DK1A 5C0XG 2EDGA 3O13A 4KKUA 1IW7D 5COYA 5C5MA 4IUNA 1U9RA 3U9SA 3CU7A 2KQ3A 3VYRA 5C4XB 1FGBD 3NXWA 1ENCA 4OIKA 1IL8A 2X6LA 1D1KA 1OXSC 3LX0A 1EWCA 1SEBD 4A3FB 1K8OA 1LTTD 3PO3B 4K6DA 2FJ2A 1CTMA 2R61A 1S5BD 4ZKBB 2PZUA 1CQVA 1SJED 2NTTA 3SVMA 2K5WA 1GOZA 3D4DA 5IIFA 1O80A 3VR5A 3TBIB 4K6LA 2QCPX 1EIGA 1NUCA 5C0XJ 1H9SA 3D8GA 4IUTA 3NTHA 1HXYD 4DFAA 1G291 3P75A 2F0MA 3K5OA 1B44D 2BA1A 4ZK9B 1C4QA 4ODGA 4CKBA 3Q6SA 1F9SA 4H0LC 1GUGA 4G57A 1GUTA 3L9AX 3MXUA 1Y8PB 3RMHA 1GUNA 1KAAA 1ZYRD 4RKBA 5NUCA 3S17B 4NW2A 4H44C 5EPKA 4LAAA 2O5IC 1STYA 1STEA 4ULLA 4DA2A 5E4XA 3WDNA 1JOQA 4XQNA 4KY6A 3SK5A 1CQFA 1TS5A 3OIPA 2A69C 1CA6A 3PUVA 2AQ3B 3TP6A 2Q8IB 3MHBA 5JEAG 1H9RA 5T1IA 3D6CA 5C3EB 1JOOA 2F4IA 5IGEA 2B63B 4KKSA 4J1MA 1B1ZA 3E0JA 2EY2A 1D5MC 1BOSA 4JK1C 4RWSC 5M3MB 1BDOA 3IAYA 2L12A 2RDHA 5KYLA 1T5EA 3Q24A 5HGTA 5EGTA 3QG1A 4KKTA 1HRJA 1I4RA 5LHY1 2OF1A 1TWCB 1IYVA 2CQAA 2RA4A 2JEBI 1Q3LA 1RF2D 4MHEA 1O7LA 1STBA 1WTPA 2I46A 3SK6A 2B2UA 3NK9A 4HMIA 5CV6A 1R9TB 5JOBA 2DY7A 2XRQD 1OXTA 3M7NA 2JA7B 3G7LA 3PIP3 3HOZB 1Y1WB 3GP7A 4S3SA 2NZ1D 1TT2A 5BN5A 1KNEA 1LABA 1FNUA 1YNND 3A8KE 3OSOA 2M9VA 1O7ZA 1AZPA 2V4DA 4Y7NB 2R93B 1JR0D 3OW7A 2WACA 2F0IA 1CM9A 4V0BA 3PV0A 3D3RA 2VB3X 3HOYB 1AW7A 3HGBA 3IFTA 2AUJD 3M4OB 4HCEA 1BUVT 4O42A 2XWBB 5JEAH 3J81E 2HQEA 1S5CD 1I6VC 4ILWA 1HFGA 3S9WA 4G7OC 4FP5D 2F0TA 4K14A 3MXNA 1VMCA 4XT1B 4RFBA 1LTSD 1QG7A 1EY7A 5EPJA 3NP8A 2D2CC 2EY5A 3NWSA 2IJ0A 2XNAC 1T5XD 2IX0A 3GTKB 5CBAE 4E6IA 1C48A 2J7ZA 2OXPA 3KLSX 4RAUC 5I6YA 5G3LF 4IUQA 2K28A 2R7ZB 1LLRD 5JPNC 4CJ1B 2RQXA 3OOCA 3W3AA 4OIJA 1LT5D 3C3LA 2ZXOA 4UDUC 1NR4A 3I3CA 4ZLTF 5CV5A 4RHSA 3H6MA 5D14A 1U4RA 1WCMB 4X3SA 2DNEA 4R8NA 3WOEA 4L8JA 1EEID 1KLUD 3CQZB 1I50B 3V05A 3UI2A 2L4NA 1DOLA 2Z4IA 3GO5A 5I4DA 2QF7A 2VNUD 1A3VA 3DEOA 3H94A 1RCVD 2WP8J 1KDCA 5DM63 2N55A 2PW7A 4DN4M 1L0XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X69 A;  4OIK A;  4IUV A;  1B3A A;  1IL8 A;  1HFG A;  1QNK A;  1AZQ A;  4RWS C;  1DOK A;  2X6L A;  1WTV A;  2L1B A;  1QE6 A;  4R9W A;  2M2L A;  1LV9 A;  1HUN A;  2L12 A;  4CJ2 C;  5DNF A;  1G2S A;  2NWG A;  1HFN A;  1EQT A;  2B2Y A;  1VMC A;  4XT1 B;  5JJZ A;  2FJ2 A;  1U4M A;  2MP1 A;  1X3Q A;  2HDM A;  2MPM A;  2N88 A;  1RJT A;  4ZKB B;  1HRJ A;  1WD1 A;  1EIH A;  1PFM A;  1RTO A;  4LMQ D;  2RVL A;  1SSO A;  1F9Q A;  1QG7 A;  1U4L A;  2JP1 A;  1PFN A;  5EPJ A;  3I8Z A;  1GUW A;  3SVM A;  2HDL A;  1VMP A;  2KEE A;  2MJ8 A;  2RA4 A;  3I90 A;  3R93 A;  1MI2 A;  2B2W A;  3F2U A;  4X3T A;  2K01 A;  2KED A;  1Q3L A;  4MHE A;  5CBE E;  1O80 A;  1X32 A;  1NCV A;  2KVM A;  3FDT A;  3FPU B;  2RSO A;  1WTP A;  1EIG A;  2EPB A;  4HED A;  3TZD A;  5CBA E;  1WD0 A;  2J7Z A;  1ZXT A;  1PFB A;  2FFK B;  4XT3 B;  1CA5 A;  3KBX A;  1JIC A;  1ICW A;  1PLF A;  1ILQ A;  1A15 A;  5E4W C;  4IUT A;  4RAU C;  2B2V C;  1HHV A;  2L11 A;  3IL8 A;  2B2U A;  3LWE A;  4IUQ A;  4ZKC B;  3P7J A;  1B53 A;  1B4O A;  2B2T C;  2K28 A;  1MSG A;  2Q8R E;  2XIW A;  1WTW A;  4RA8 A;  5COR A;  1RTN A;  4X3K A;  1NR2 A;  1HUM A;  1RHP A;  1SAP A;  2DY7 A;  4U68 A;  4CJ1 B;  1E0B A;  2KUM A;  4CJ0 B;  1BBX C;  3H91 A;  4QUC A;  2H1E A;  3D6W A;  2FIN B;  1SDF A;  1BO0 A;  2BDN A;  2KEC A;  2MGS A;  3IFD A;  1ML0 D;  1XYI A;  2NYZ D;  1F9R A;  4OIJ A;  3G7L A;  3ONA B;  4ZK9 B;  2FHT A;  2DY8 A;  1ROD A;  3GV6 A;  1ESR A;  2K05 A;  3TN2 A;  2HUG A;  1B2T A;  3Q6S A;  1F9S A;  2KOL A;  2Q8T A;  1NR4 A;  5EJW A;  1MGS A;  2X6G A;  3I3C A;  3N52 A;  2NZ1 D;  4ZLT F;  2K1B A;  1HA6 A;  1KNE A;  3HP3 A;  1U4P A;  3I91 A;  2HCC A;  1O7Z A;  2D9U A;  4IUR A;  2SDF A;  3MWY W;  1AZP A;  1B50 A;  1PDQ A;  1M8A A;  5D14 A;  4HAE A;  1U4R A;  5EPL A;  4R8I A;  4XDX A;  1C8C A;  4NW2 A;  1DON A;  1X3P A;  3MTS A;  3GV3 A;  4X3S A;  1KNA A;  2B2T A;  2EOT A;  1G91 A;  5EPK A;  1WTX A;  1F2L A;  4IUP A;  2K04 A;  4QUF A;  5EKI A;  4IUU A;  5EQ0 A;  2JYO A;  1BF4 A;  1IKL A;  5E4X A;  1JE4 A;  3KUP A;  2HCI A;  4ZAI A;  4MN3 A;  2EE1 A;  3UI2 A;  1J9O A;  1WTO A;  1CM9 A;  1WTQ A;  1CA6 A;  2L4N A;  1XX8 A;  1DOL A;  2IL8 A;  4UAI A;  5CMD A;  1MSH A;  5T1G A;  2R3Z A;  1NAP A;  2B2W C;  1BNZ A;  1EOT A;  4HCS A;  5T1I A;  1J8I A;  2B2U C;  1ILP A;  1WTR A;  5COY A;  1G6Z A;  2B2V A;  1DOM A;  2L9H A;  2CVR A;  3DEO A;  1S4Z A;  2VXW A;  5AFW A;  4X3U A;  4O42 A;  2FMM A;  3DEP A;  1G2T A;  1WVL A;  5D65 A;  1EL0 A;  2RSN A;  4HSV A;  2K03 A;  1F9P A;  3QO2 A;  2N55 A;  3DM1 A;  1O7Y A;  4DN4 M;  1TVX A;  1DZ1 A;  2B2Y C;  1IKM A;  1AP0 A; 
#chains in the Genus database with same CATH topology
 4GNX B;  2ENB A;  1AZQ A;  3CKI B;  4R9W A;  3ZJY C;  4I65 A;  5HUR A;  4JI3 Q;  2IWH A;  3R2T A;  4K2L A;  1MBY A;  1A3T A;  3I70 A;  4TRD A;  3J81 j;  4KHP Q;  1SNQ A;  2E5L Q;  1KRT A;  1EYC A;  5C3X A;  3I2Z A;  1EU4 A;  2EXD A;  3CC2 A;  2UUC L;  2JP1 A;  1HNW Q;  1H9S B;  3D31 A;  4FXG C;  1EY5 A;  4BWG B;  2F0K A;  4M1U B;  2B63 H;  4V19 0;  3CHB D;  3PUY A;  4JI6 Q;  2RBM A;  2XGT A;  1VQJ A;  3PIP A;  3AEV A;  4HJ7 A;  3KF8 B;  3R2I A;  2AQ2 B;  1EFI D;  4DAY A;  4CDD C;  3BJU A;  1ILQ A;  1D5X C;  2B8F A;  2B2V C;  3S1Q B;  1CZW A;  3DM3 A;  1VQL A;  3DHQ A;  1PRT D;  2J4X A;  4IPH A;  3K8A A;  5EAY A;  4JI1 Q;  4LFB L;  4G7Z C;  1YVC A;  1HUM A;  1RHP A;  3NEM A;  3CC7 A;  3H91 A;  4KN7 C;  1SDF A;  4IQZ A;  5HY6 A;  2NYZ D;  1XTD A;  2JA9 A;  4QF4 A;  4YWK A;  3EFX D;  1PRT C;  5IOC A;  1ZEQ X;  4H13 C;  4LFB Q;  2VL6 A;  4L63 B;  3SGI A;  4RG1 A;  4ABN A;  2R6G A;  3BDL A;  1CHQ D;  2A6E C;  3JAM i;  2XVS A;  3GV3 A;  4F7X A;  2D0P A;  2EOT A;  2K52 A;  2JA8 G;  2SEB D;  4OHJ A;  3IRB A;  4EQP A;  1I4Q A;  2P5Z X;  1STH A;  2K5D A;  2A74 C;  3GTO B;  5KRU A;  1HH2 P;  1KQS A;  5CMD A;  1MSH A;  3KK7 A;  3JAM c;  3DLL A;  1BNZ A;  4BXX G;  3A54 A;  2A1A A;  1QVG A;  1DOM A;  1VQB A;  4KHP L;  5BR8 Q;  5JPM C;  2VXW A;  4JPB W;  2K5Q A;  3BVG A;  1SYF A;  5CYU A;  3QIA A;  4NKL A;  5JEA J;  1EFW A;  1H9K A;  2F0L A;  4XQQ A;  4NB3 A;  2WB1 B;  4UP7 A;  3GTO H;  4A3D H;  4Q0F A;  3U4Z A;  3KJO A;  1EYG A;  1OTC A;  3I4M B;  3EVQ A;  3F2B A;  3UDF A;  1WTV A;  3OIQ A;  3FKI H;  4QCL A;  4WRD A;  5H1S E;  4ZUJ A;  5KYI A;  1B9N A;  2WAQ B;  1WI5 A;  2AWN A;  4A3L G;  3HG9 A;  2H5X A;  4CKE A;  4A3B G;  1C7Y A;  1Q82 C;  3H0G B;  5CGK A;  4JBK A;  2EYJ A;  4DR7 L;  5IWA Q;  2GA4 B;  4RGM A;  1QNU A;  4FF2 A;  2VUM B;  4JI0 L;  1EZ6 A;  4A4I A;  1MHW C;  2B2W A;  5CBE E;  3TSS A;  1NCV A;  5IGF A;  1VDZ A;  1LTB D;  4FVM A;  1X55 A;  1FR3 A;  5F2D A;  3NBH A;  1ICW A;  2R7F A;  4DNI A;  5E1F A;  4HJ5 A;  4GKK Q;  3IL8 A;  3KF6 A;  2ID0 A;  3S2D B;  2CCZ A;  3R3O A;  1KAB A;  5FK9 C;  2KUM A;  4K5V A;  2EY1 A;  1S40 A;  2FIN B;  2MGS A;  4WOR A;  1M4V A;  4A3I G;  1UE7 A;  1QUQ A;  3MC0 B;  4BA2 I;  1V1Q A;  2E74 C;  1DXM A;  2R93 G;  3VA5 A;  1W3S A;  3NSW A;  4R4C A;  1HZA A;  2QDL A;  3HOU G;  2O2L D;  4IJL A;  3J7Y W;  1HCZ A;  2KCN A;  4R8I A;  2AUK A;  4XDX A;  1EQR A;  3TEH B;  1KNA A;  2OTJ A;  3EIV A;  3A7L A;  3VDY A;  5EKI A;  3K5N A;  1Y1V H;  2NB0 A;  4PZ7 A;  5IP9 G;  3J80 E;  1A3U A;  4LW1 A;  3I72 A;  1GM5 A;  1IBL L;  1XXG A;  3HFZ B;  4DV0 Q;  4BA1 I;  3W2D A;  4X66 Q;  2Z4H A;  5M5W H;  3GTJ B;  4PQX A;  2OWO A;  5M3M H;  1CHP D;  2Y0S E;  4ZUI A;  3TS0 A;  1PZI D;  5D65 A;  3VYS A;  3LGJ A;  1S72 A;  1UE6 A;  1N34 Q;  2ASB A;  1BQQ T;  1IKM A;  1QNK A;  2OT2 A;  1QE6 A;  4X64 Q;  1HNX L;  1TII D;  2DJG C;  3BZD B;  2KCM A;  1VF7 A;  4JI7 Q;  2MP1 A;  4DR7 Q;  3FMC A;  1QB5 D;  3KDF A;  1RTO A;  1Q8K A;  3MZ5 A;  1BCP F;  3ND8 A;  4A3E H;  3I4N H;  2ZJR A;  3AYH B;  1Q90 A;  2FMC A;  4DF7 A;  2QA4 A;  1SYG A;  2AMC B;  4LF8 Q;  4LF9 Q;  4ZYS A;  4HED A;  3HOY H;  1S5D D;  1PFB A;  4XT3 B;  1AN8 A;  5E4W C;  1SYB A;  1X56 A;  4POF A;  3P7J A;  5C3E G;  2UU9 L;  5FO8 B;  4DAP A;  3H15 A;  2ALY B;  2JSO A;  4YY3 Q;  3MA2 B;  1NBW A;  4NXM Q;  3OWF A;  2C35 B;  1KL9 A;  4KTA A;  2LY7 A;  1LO5 D;  3HOZ G;  1V1P B;  1SMY D;  2MHV A;  5IE8 A;  2HUG A;  3SR1 A;  3VR6 A;  2IW3 A;  3FEW X;  1Q8I A;  3T16 A;  2HT1 A;  3AMU A;  1QZG A;  1VQ6 A;  4A3G G;  4DR6 L;  4IUR A;  4PMB A;  4JI4 Q;  1HZC A;  1VQ4 A;  2JA6 H;  3MTS A;  4A3K B;  1G91 A;  4KI0 A;  1VQA A;  1I6H B;  1WTX A;  1F2L A;  5TSS A;  2EYM A;  4JI7 L;  1BXT A;  2KBN A;  2L0C A;  3HOW H;  1UNS A;  4OX9 Q;  4P2C B;  4PZ6 A;  4JYA Q;  3NUC A;  3CP0 A;  2M00 A;  2VQF L;  5E7N A;  2F0Q A;  2B2U C;  4JYA L;  3ERQ A;  3S15 H;  3NQT A;  2VQF Q;  5JJK A;  3K5L A;  4IJH A;  4NDX A;  4RH6 A;  4JI1 L;  3CRL C;  2Z1C A;  4JV5 Q;  2DN8 A;  4F87 A;  1Z47 A;  3PUX A;  1B3Q A;  5ELO A;  1DM0 B;  4DV0 L;  1DOK A;  1L2F A;  1E2V A;  4A3D G;  4DUZ L;  2Z0S A;  4DV3 L;  2ZXP A;  3HKZ G;  5FO7 B;  1K8A C;  1EQT A;  4QB4 A;  4YIJ A;  1FJG L;  4DV5 L;  1FNV A;  1K83 B;  3BDO A;  5M9O A;  5FLM H;  2SNS A;  1EIH A;  2RVL A;  2F1M A;  1LTI D;  4CHT B;  4B08 A;  2IPK D;  4DR6 Q;  2EYP A;  1HPC A;  1SBB B;  2PW5 A;  1R9T H;  1GUW A;  3RN2 A;  2HDL A;  5GAH C;  1ET6 A;  2ICI A;  1LUZ A;  4JI3 L;  3RZD B;  3HKZ E;  3PUZ A;  5ELE A;  3WOF A;  3FDT A;  4AIM A;  4PG3 A;  3K7U C;  4JBJ A;  3A0J A;  4KHV A;  1D1I A;  5CR3 A;  3NTK A;  3PSI A;  2JJQ A;  4YY3 L;  1L1O A;  2VS1 A;  3J81 L;  2JA8 B;  2RCF A;  1TR5 A;  2PPB C;  4LF7 Q;  1X3F A;  1W6J A;  4KY7 A;  1M1K C;  2DNC A;  5J3B A;  2MQH A;  1LTR D;  4IOA A;  4U68 A;  1HA5 A;  1TY2 A;  1IHZ A;  4C56 C;  4EVO A;  1NJI C;  3IFD A;  2G9D A;  1V8Q A;  1Q46 A;  5JAV A;  2DY8 A;  4LFA L;  1HR0 W;  1VQ7 A;  4A3I B;  1O78 A;  2JA5 B;  1LT6 D;  5EJW A;  4OWW B;  1CKO A;  1HA6 A;  1PHJ A;  3C1F A;  4GKJ Q;  2R7D A;  2E2H B;  3RZO B;  1Y1W H;  3T1Y Q;  4BBS H;  1L0Y B;  4NMZ A;  4RCN A;  5LL6 S;  3DWQ A;  5FJ8 H;  1TY0 A;  2D62 A;  3I56 A;  4R4I A;  1IKL A;  1PFS A;  2I5H A;  4MN3 A;  1QJO A;  2EJM A;  3E9I A;  1J9O A;  2KJX A;  4WJW A;  1WTQ A;  2RCN A;  1KXL A;  3CCE A;  4A75 A;  4OEL B;  3CCS A;  4KY5 A;  4IO9 A;  4Z9C B;  3UDX A;  4C2M B;  5EKK A;  4A93 G;  5ELB A;  3VA7 A;  1ASZ A;  5AFW A;  1XPU A;  4X3U A;  1JJC B;  2HHH L;  1ENF A;  3S16 B;  5FO9 B;  3TDQ A;  3QOL A;  1HZ9 A;  2Y0S B;  4A3B B;  4GOP B;  3DM1 A;  4K5W A;  2ICE C;  3TQY A;  1S5E D;  4DNT B;  1DGS A;  3S1N B;  5C3W A;  1F2M A;  2UXB L;  4DR3 Q;  1JC7 A;  5AJ3 L;  1HFN A;  3S14 B;  3GTK H;  1LTA D;  2MNA A;  3I4N G;  2MFI A;  1X3Q A;  1HTL D;  3A55 A;  4AQY L;  1BCP B;  2WAQ E;  4HMJ A;  1TWC H;  3HKZ B;  1CFM A;  4DPG A;  1NE3 A;  2MJ8 A;  4I7A A;  4BY7 B;  4RGT A;  4DAY B;  2O5J C;  3TZD A;  2UUA L;  3U4V A;  3WWV A;  2K5N A;  4OXP A;  4AYB E;  5IGG A;  3J80 c;  1KHI A;  2NVQ B;  5J22 A;  1GO3 E;  4BBR G;  3RUZ A;  4CDC C;  1B53 A;  2Q8R E;  1J5E L;  1JB3 A;  2NUC A;  2WKC A;  4DNR B;  4MZ9 A;  5IWA L;  3FVQ A;  4N9T A;  1EY8 A;  5C4J B;  4QUC A;  1VCI A;  4JG2 A;  1V1P A;  1XNR L;  4PV1 C;  4ZQ3 A;  2IHE A;  1KLG D;  1IYU A;  4JOI C;  4B9X A;  3P20 A;  4A3J H;  3G6E A;  3TN2 A;  1IBM Q;  3S1R H;  1MGS A;  1K0S A;  4KK7 A;  1EUJ A;  3MVV A;  1WCM G;  2IT1 A;  1VQD A;  1IXR A;  2CH4 W;  2SDF A;  4QY7 A;  1WFQ A;  4EQO A;  2R7Z G;  4A3G B;  3RZD H;  4AYB B;  2RHQ B;  1SND A;  2YTV A;  1O7I A;  2MUY A;  4NXN L;  3BYT B;  4UPA A;  5EQ0 A;  2JYO A;  3RLF A;  1LT3 D;  3BVM A;  2PO4 A;  4QIW B;  4NXM L;  4BBS B;  2EE1 A;  1TQO A;  2SNM A;  4HN7 A;  3A5U A;  5DEH A;  1NY4 A;  4GOP C;  2PYK A;  4UAI A;  3J7A 5;  4YHH L;  3BZK A;  5BR8 L;  1NAP A;  2NZH A;  5EKL A;  5LMN Q;  1E24 A;  4JBW A;  1YJW A;  1ILP A;  3SEB A;  1H95 A;  2F0H A;  2CVR A;  1FNW A;  3TP7 A;  1SN8 A;  2PI2 A;  3K0X A;  5E3F A;  3T13 A;  1TWH H;  2ZJQ A;  1PYS B;  1JWS D;  4HSV A;  3Q0A A;  2EIF A;  4Y7N H;  1L0W A;  1IBM L;  1DZ1 A;  1TVX A;  1VQP A;  3PO2 B;  4JV5 L;  2OTL A;  1QZH A;  2X69 A;  5A2Q E;  3Q22 A;  3DWA A;  2M2L A;  1HUN A;  1YJ9 A;  3NPP A;  4ME5 A;  2B8G A;  4C3I B;  4KD3 A;  2OQ0 A;  4IPC A;  3D4W A;  1RJT A;  1K28 A;  1LTL A;  4B3S Q;  4KD4 A;  1SSO A;  1X65 A;  4LF4 Q;  1B9M A;  5C0X I;  2EYH A;  2PQE A;  5K5P A;  4ALP A;  1PA6 A;  1SXT A;  4C3I H;  4KJO A;  3ND9 A;  3FPU B;  2C5C A;  1TKW B;  1F2Y A;  3VR3 A;  1ZXT A;  1JIC A;  1PTO B;  3NE5 B;  4APV A;  4R4Q A;  1UE5 A;  1YHA A;  5L37 A;  1DCZ A;  3LWE A;  1SE3 A;  2TMP A;  1SE2 A;  4CDE C;  1SJH D;  4X3K A;  1KAW A;  1AH9 A;  2BDO A;  4DV1 Q;  2F03 A;  4A3C H;  2BDN A;  3ERS X;  1S5F D;  5C44 H;  1D5Z C;  1VQH A;  2IHF A;  1FYC A;  2BOS A;  4C3H B;  2YYZ A;  3ONA B;  4A3M H;  3OYY A;  4IFD G;  3VYU A;  4C1N I;  1SNM A;  4YCV A;  1XMO L;  2WIN B;  2OEO A;  1UUP A;  1CZG A;  4FF3 A;  4KHZ A;  3S1N H;  4A3J B;  3FPP A;  1YNJ D;  3CCL A;  4C3J H;  2E2J H;  1HZB A;  3PIO 3;  2Z6K A;  4JBM A;  1XWE A;  2UXD Q;  2K04 A;  1Y1W G;  4A3E B;  3M4Q A;  1JE4 A;  3CPW A;  2HCI A;  4EQ5 A;  3HRZ C;  5LMN W;  1NNX A;  4QQB X;  5ELC A;  4BY7 G;  1G51 A;  2A6H D;  2N8N A;  3HOZ H;  1RD9 D;  3AFP A;  3KFU A;  1VQK A;  1I3Q H;  1S4Z A;  2EYL A;  2L55 A;  3C1E A;  2NN6 H;  5IYB H;  4BY1 H;  5IOD A;  1PH9 A;  1HQR D;  4RGO S;  4LF7 L;  4OGQ C;  1MD2 D;  1MJE A;  4FF1 A;  3S2H B;  2K03 A;  2NVY H;  4DGZ A;  4A3L H;  4C3I G;  1LT4 D;  2B2Y C;  2LSS A;  3GTM B;  1V1O A;  4TVA B;  2NVQ H;  2CWA A;  2E2H H;  1NMF A;  4Q5V A;  4HIK A;  5LL6 X;  1TS4 A;  1G6P A;  4NP5 A;  3ITP A;  2EYF A;  3MAQ A;  3PO2 G;  1PMR A;  2V1C C;  3AQQ A;  5C4H A;  2K75 A;  1SYC A;  2WB1 G;  3F2C A;  2N88 A;  1IL2 A;  1G8Z D;  2B29 A;  1E2W A;  4LMQ D;  4POG A;  1PH8 A;  2QIL A;  1EY6 A;  2KEE A;  1TWG B;  4ZRZ A;  4LFC L;  1PYW D;  4R4O A;  1I6H H;  3SHL A;  2BE5 D;  3PF4 A;  3DMU A;  1SMX A;  2KVM A;  1XMO Q;  1WD0 A;  1TWF B;  3S14 H;  2D0O A;  4BBS G;  2EXZ A;  1Y8O B;  3QR8 A;  3Q23 A;  3UE0 A;  4ZCK A;  4BS9 A;  3KLR A;  2L11 A;  5DLQ E;  2F0N A;  3CRK C;  4X62 L;  1A2T A;  1VQC A;  2ZXR A;  4L6T B;  3BVZ A;  4DV1 L;  1JWU D;  5M5X B;  1C9O A;  5C4J H;  1DD2 A;  1E3P A;  2CKZ B;  3S2D H;  1Y14 B;  3PUW A;  1ROD A;  2K05 A;  2KOL A;  3TZU A;  1PTO C;  1UAP A;  4TSS A;  2E2D C;  3URY A;  4AYB G;  1FVI A;  4F88 A;  3HP3 A;  1BVS A;  3L2P A;  1VQG A;  1B50 A;  1YIJ A;  5IT9 E;  5EPL A;  4B3R L;  4DR4 Q;  1QIL A;  1BR9 A;  2G9H D;  1EEF D;  4RMF A;  2Q2H A;  2LMC B;  1JQY D;  1GHK A;  4K8I A;  5IT9 c;  1VQE A;  4HIO A;  3OHX C;  3I7F A;  2PNR C;  1SFO B;  2QEJ C;  1N32 Q;  3M85 A;  2K50 A;  3Q8D A;  4K5X A;  1WTR A;  2L5T A;  5IGD A;  1QVC A;  4GLA C;  2I0Q A;  4I7Z C;  4C1N K;  2IY5 B;  3I4N B;  1F9P A;  2BH8 A;  3CQZ H;  3H3V I;  1A62 A;  5FKA C;  4C3J B;  5M3F B;  4FXK C;  1B3A A;  3T51 B;  2N3S A;  1Q1E A;  1LV9 A;  4DUY Q;  1XNQ Q;  1PRT B;  1G2S A;  3S15 B;  4JI2 L;  4BBR H;  2A73 B;  2NWG A;  4A3F H;  3M4O H;  4N9P A;  4KJN A;  3TP5 A;  1XNQ L;  1ZKO A;  4C3J G;  2B2Y A;  3T4A C;  4DAV A;  2HDM A;  3H09 A;  3PO3 G;  4HSP A;  4RHR A;  4A3F G;  1PFM A;  4UP9 A;  4B9W A;  1FJG Q;  1VQM A;  1U4L A;  1SNO A;  2R7Z H;  3OTO Q;  3S16 H;  4ME3 A;  3QOJ A;  1TWH B;  4A3B H;  1VMP A;  3I90 A;  3R93 A;  4FNF A;  2R92 G;  1Z7T A;  3M7G A;  2CW0 C;  1TS2 A;  4IOC A;  5IYC G;  1JCK B;  1ZYR C;  3HOX H;  2RSO A;  1N32 L;  1DYQ A;  4TKO B;  5CV8 A;  1EYA A;  2F0V A;  2EY6 A;  4P72 A;  3J7A F;  3RNU A;  3VYT A;  1PTO F;  1QVF A;  2JA5 H;  3MFY A;  1XTC D;  2DJF C;  2AHO B;  2Z6B A;  3CCM A;  4RA8 A;  1CKM A;  2BCO A;  5FOB B;  3KF8 A;  2XRS D;  2Z8L A;  3NEN A;  4XIG S;  3W5O A;  3SK4 A;  1XPO A;  1D6E C;  4P71 A;  1X9N A;  4DK0 A;  3ULP A;  4A3E G;  2A6E D;  5KIX A;  4P74 A;  1EQQ A;  2JA8 H;  1Q12 A;  2UUA Q;  3OMG A;  2X6G A;  3N52 A;  4JI8 L;  5C44 G;  3HS0 C;  4L5R C;  1I5F A;  2IX1 A;  5KNC A;  2R92 H;  2D9U A;  2RDG A;  5CV7 A;  3MWY W;  1N33 L;  1WYD A;  2CHB D;  1DON A;  1C8C A;  4CBV A;  1KTK A;  3L7Z C;  2DGY A;  3BZC A;  5I6W A;  2CW0 D;  5ISR A;  4B3M L;  2A5H A;  4GLV B;  2PI2 E;  1BF4 A;  2JA6 B;  3C2P A;  4OWT B;  4DV3 Q;  1LTG D;  1A8V A;  3K0Y A;  5AJ3 Q;  3NBI A;  5C5L A;  1BCP D;  4UHV A;  1Q1B A;  4FYD A;  1G6Z A;  2B2V A;  2B3G A;  2L9H A;  1PVO A;  4DV5 Q;  3PMF A;  4DV6 Q;  4R1J A;  3MXN B;  1FD7 D;  1EL0 A;  4RCO A;  2RSN A;  3SK8 A;  4OO1 H;  3EJI A;  3QB3 A;  2KA7 A;  2UXB Q;  2MO1 A;  2HHH Q;  4QGU A;  2XN9 C;  4GNX C;  2NVX B;  4HJ9 A;  2CWP A;  1AFP A;  1H9J A;  1A63 A;  4TQU S;  4MIU A;  5ELN A;  2E75 C;  2WKD A;  5C0X H;  2NZO A;  4KN4 C;  1YHQ A;  3HZX A;  4IFD I;  1WD1 A;  4F8M A;  1EWI A;  5CV9 A;  4GOP A;  1EY9 A;  5GQO A;  1NMG A;  1YEZ A;  4LJZ C;  4EGV A;  2IX3 A;  1JB7 A;  2RKS A;  4A3D B;  3RR5 A;  4XXE A;  5HGQ A;  3MXP A;  2EYO A;  2VY3 A;  3F8T A;  1I3Q B;  2NTS A;  3HOU H;  4L5Q A;  3K6O A;  3A8I E;  2LKV A;  3PIO A;  1XJV A;  4LFA Q;  1J6Q A;  1R4Q B;  2WB1 E;  4LUO A;  1QUQ B;  1A0I A;  4XQJ A;  1D2B A;  1E22 A;  2EJG C;  1GUO A;  1OO9 B;  4HTH A;  3J81 i;  4QL5 A;  2B2T C;  1Q7Y C;  2TSS A;  4A3J G;  5K36 H;  1ET9 A;  1NSN S;  3DXJ C;  1NR2 A;  3M9B A;  1TWG H;  1V9P A;  3OWE B;  1BBX C;  1S3O A;  3QJY A;  1A6X A;  3FRP B;  1ML0 D;  1STA A;  3ZYY X;  3X3N A;  1B70 B;  3K7A H;  2XWJ B;  3KF6 B;  1YZ6 A;  1B7Y B;  1MIU A;  5ELD A;  1CKN B;  2PQA A;  2HCC A;  1JT8 A;  1MKH A;  1QCB D;  3PCO B;  3STB D;  4K0K Q;  2PZT A;  2VUM H;  4C3H G;  2Q2T A;  2GVA A;  3KUP A;  3M3Y B;  1UEA B;  5DM7 3;  4DXG A;  1X3E A;  4A3C G;  4OO1 I;  1ESF A;  3STB C;  5C4Z A;  3VR2 A;  4FO2 A;  4PMC A;  2E8G A;  3DUZ A;  4HCS A;  1SRO A;  2BE5 C;  3P1H A;  4M8A A;  3I73 A;  4PNY A;  5GAE C;  3J7A V;  5JVG 3;  3KLS A;  1XNR Q;  3A7A B;  3T53 B;  2FMM A;  3S24 A;  2LS0 1;  5KGU A;  1L1O C;  1ENA A;  4YCU A;  3I4L A;  1IW7 C;  4X6A H;  1O7Y A;  1CI3 M;  3GDE A;  5BN4 A;  5I2X A;  3OMC A;  4LF6 Q;  2H4O A;  1AP0 A;  1V43 A;  4DV2 L;  4IUV A;  3NWT A;  1HQM C;  2NBF A;  3KBG A;  3FP9 A;  1OXV A;  3HKS A;  4O1N A;  4IFD J;  1PRT F;  4CJ2 C;  2QDB A;  3OPO A;  5M3M G;  1K3B C;  1IYJ B;  5GRO A;  4IZ8 A;  4XTC S;  4C3H H;  4A3M B;  1SFO H;  1U4M A;  2NVX H;  3SXH A;  1KRS A;  4XYQ A;  1EZ8 A;  3CME A;  3D0F A;  4GZY C;  4GS3 A;  4KMU C;  1EQV A;  3E3X A;  1H9M A;  3CCJ A;  2PMZ E;  3IKJ A;  4LFC Q;  4JI0 Q;  4J15 A;  3NBH B;  3G6J B;  2EPB A;  3V96 A;  2F0E A;  2J0T D;  2JA6 G;  1OXU A;  2FFK B;  4DR3 L;  3CCV A;  3CXC A;  1E7Z A;  3SDZ A;  5J1Z A;  4J6H A;  2F0W A;  1FGU A;  3K57 A;  2F0O A;  1RKN A;  2YTY A;  1RTN A;  4G7H C;  1ONL A;  1E0B A;  4HID A;  1QOH A;  2A68 D;  3M4Y A;  4BY1 B;  2KEC A;  2UUB L;  5D3I B;  1UE1 A;  2FHT A;  3GV6 A;  1B2T A;  1PZJ D;  2F0U A;  5K36 G;  3V2T A;  3E5S A;  1YNN C;  1R4P B;  1TWF H;  1I4X A;  1Y1V G;  5ELF A;  5M5Y H;  3K7A B;  4WJ3 M;  3HOW B;  3HOU B;  1JJ2 A;  5C4X H;  5C44 B;  2A8V A;  1EY4 A;  3PF5 A;  4QUF A;  4LF8 L;  4IUU A;  5EBD A;  4N8F A;  4G4K A;  4FXD A;  1SYE A;  4GLX A;  2I07 B;  1WTO A;  4JCV E;  1N8R C;  1XX8 A;  2F3V A;  3T1H L;  1AEX A;  2YU9 B;  1PZK D;  1PH6 A;  2WV6 D;  4DR4 L;  1IZ6 A;  2B39 A;  1SE4 A;  4LNQ A;  1Z9F A;  4DAM A;  2C9O A;  2F0S A;  1VQN A;  1KIX A;  3K80 C;  2WAQ G;  4DUY L;  2ZT9 C;  3GTG B;  5JVH 3;  4IPD A;  2R92 B;  3DWP A;  3E9H A;  1PH2 A;  3U9O A;  4P73 A;  2F3W A;  3PQI A;  5IP7 H;  2PCF B;  3MXG A;  1K8G A;  3TME A;  1EIF A;  3UDI A;  2NN6 I;  2K33 A;  1SNP A;  5IYD G;  4J8Q A;  3FKI B;  3K59 A;  2Y0S G;  2L15 A;  2B63 G;  2GN5 A;  2K4K A;  4DK3 C;  4KV6 A;  1GHJ A;  1VF5 C;  1X54 A;  1F9Q A;  3GQB A;  3QWN A;  3K81 C;  4FF4 A;  1BKB A;  2QKI C;  1PFN A;  3J80 L;  1D7Q A;  4HJ8 A;  3AB9 A;  2AWO A;  4DV4 L;  1F2Z A;  5KND A;  2JE6 I;  4DKA C;  1Y69 U;  3H0G H;  5FJ8 G;  3JAM L;  5M3F G;  1WJJ A;  1NTG A;  4X3T A;  3HOV H;  2HQL A;  1KDA A;  1JE5 A;  4GKJ L;  3BYY B;  2E2I H;  1CA5 A;  3KBX A;  3KOJ A;  1YNX A;  1K73 C;  2E5L L;  1N33 Q;  1I4H A;  4H7B A;  4RGN A;  3K58 A;  1JOK A;  4ZKC B;  5FLX c;  1GUS A;  1B4O A;  3K5M A;  1FL0 A;  1JWM D;  1WTW A;  1Y1V B;  4XYO A;  3L0O A;  3T1Y L;  5I9O A;  1CSQ A;  1E1T A;  4LF4 L;  4JW0 A;  2JA5 G;  1CT1 D;  4OO1 G;  1F9R A;  3T1H Q;  1CSP A;  4K8J A;  2XTI A;  1ASY A;  1GVP A;  3NHH A;  4WFN 3;  4MTK A;  4BY1 G;  5IYB G;  2EJF C;  2K14 A;  4H02 A;  3I91 A;  4YHH Q;  4FDB A;  1STG A;  2ZJP A;  4YCW A;  1PDQ A;  3M4P A;  1KDB A;  3J7Z C;  1X3P A;  4JC0 A;  3EN2 A;  4DXF A;  3I4M H;  1II3 A;  2OQK A;  3GD7 A;  3BS1 A;  3E6Z X;  3GTM H;  1HR0 L;  4ZAI A;  4X65 Q;  3LNN A;  3CD6 A;  3MFG A;  3BG3 A;  1BBW A;  1TU2 B;  3CAM A;  5FLM G;  2ZM6 Q;  5T1G A;  2R3Z A;  1RDP D;  1EOT A;  2RDF A;  3B6Y A;  1K9M C;  2K7V A;  3HOX B;  2HIV A;  1HR0 Q;  1K8M A;  5J39 A;  1GXD C;  1SRU A;  2KHJ A;  1G2T A;  4L5T A;  3FKI G;  3QO2 A;  3C46 A;  4A3M G;  2BA0 A;  1VQF A;  2JQO A;  5I2Y A;  2UU9 Q;  4LK1 C;  1EOV A;  5A35 A;  3CCQ A;  2L1B A;  1U5K A;  5DNF A;  3S17 H;  2PMZ B;  3HEJ A;  2E2I B;  5I9P A;  5CV4 A;  4DUZ Q;  1YI2 A;  5JJZ A;  3H3V C;  1A2U A;  4LUZ A;  2I5M X;  1VQ5 A;  2LFN A;  1Q81 C;  3T56 B;  2ZTE A;  1TS3 A;  5IGB A;  2WII B;  5IP7 G;  5IYC H;  3TRZ A;  2O4X A;  3I8Z A;  1EU3 A;  1MI2 A;  1QWY A;  3F2U A;  3GTL H;  2D5D A;  2UUB Q;  4CDF C;  1ICF B;  5KEE A;  1LAC A;  1SMY C;  1K0R A;  4OX9 L;  1PLF A;  1A15 A;  2KEN A;  1PYB A;  3GTG H;  4DV4 Q;  2XIW A;  4DV6 L;  5JJL A;  3M3Y H;  4NPS A;  2EVB A;  4AQY Q;  1PXU A;  1SAP A;  2E76 C;  2RF4 A;  4LWC A;  2H1E A;  2QEX A;  2UXC Q;  3NTI A;  1YHB A;  2UXD L;  2YV5 A;  1EYD A;  3ERO A;  3EQL C;  5BN3 A;  3GTJ H;  5M5W B;  3GTP B;  2K6A A;  2JEA I;  2Q8T A;  4EQN A;  2ZTC A;  3CCR A;  1YBY A;  2K1B A;  1DJR D;  1PTO D;  1HNW L;  3A56 A;  1E1O A;  2F0P A;  1M8A A;  3A8J E;  4ID6 A;  2JN4 A;  4EX5 A;  1C0A A;  3A74 A;  1HTP A;  4R4T A;  3BDC A;  4IUP A;  2UUC Q;  1W6K A;  4OL7 A;  1UEB A;  1U0L A;  4JOI A;  2JA7 G;  1JOR A;  2A69 D;  4JI8 Q;  4GN4 B;  2SOB A;  4JI6 L;  4O0A A;  3EA6 A;  4PMW A;  3JAM E;  2B2W C;  2F0G A;  4OEM B;  4DV2 Q;  2LXJ A;  5IGC A;  2XSC A;  5C3E H;  4BBR B;  4IPG A;  1HJP A;  1EWH A;  3NQI A;  5D3D A;  1HNX Q;  3HOV B;  1XMQ L;  3PGZ A;  1GKH A;  2UXC L;  1CK1 A;  3CCU A;  3SE0 A;  5KNB A;  1OXX K;  2I5L X;  3DEP A;  3LWU A;  1WVL A;  1I50 H;  2VW9 A;  1VQO A;  2E2J B;  2NVY B;  2NN6 G;  1PH4 A;  1J8I A;  1P16 A;  4DR5 L;  3R8B A;  3MEH A;  3CF5 A;  2K32 A;  1XMQ Q;  1I94 Q;  4IAL A;  5DAU A;  5A2Q L;  1F77 A;  4DV7 L;  2NVT B;  4MTN A;  3L3O C;  2F0D A;  4U67 3;  2MPM A;  4HJA A;  3S1M B;  3HOV G;  3I4O A;  5EBC A;  3W1G A;  3OW2 A;  1K3R A;  2AKW B;  1K83 H;  1STN A;  4DU9 A;  4YWM A;  5GAG C;  1SE8 A;  3X3M A;  3HOY G;  1GJX A;  4CKC A;  2K01 A;  2KED A;  4K2K A;  3D4R A;  4CGY B;  1X32 A;  2EZV A;  2CQO A;  5M5Y B;  2QW7 A;  2HIX A;  5IT9 L;  1Z6H A;  1I4P A;  2A68 C;  3CW2 C;  4IN3 A;  1E2Z A;  5LMN L;  1B8A A;  1IBK Q;  1SNC A;  3S1R B;  1HHV A;  4QMG A;  2F4V Q;  4A93 B;  2PZW A;  1MSG A;  2AQ1 B;  5COR A;  2VQE L;  4IFD H;  4CJ0 B;  1T9H A;  2DUD A;  3D6W A;  1HNZ L;  1BO0 A;  1EY0 A;  4AH6 A;  4RKL A;  1VQ9 A;  4HR7 B;  1XYI A;  3GTQ B;  2VB2 X;  1I4G A;  4NXN Q;  2KCT A;  1ESR A;  1YNJ C;  4C2M H;  1BCP C;  2F0J A;  1PTO H;  1WOC A;  3AU7 A;  1YIT A;  1U4P A;  5G3L D;  3TP8 A;  3RD4 A;  4HAE A;  2JXM B;  1TWA B;  3GTL B;  5CC4 A;  5FLX L;  2B2T A;  2KHS A;  2KCC A;  5C6A A;  2R93 H;  3VR4 A;  1Y8N B;  2A6H C;  1SYD A;  3N6R A;  1PH3 A;  1VQ8 A;  2F0F A;  2IL8 A;  5FLX E;  4DK1 A;  5C0X G;  2EDG A;  3O13 A;  4KKU A;  1IW7 D;  4UP8 A;  5COY A;  4DR2 L;  5C5M A;  5JJI A;  4IUN A;  1U9R A;  1LM0 A;  3U9S A;  3CU7 A;  2KQ3 A;  3VYR A;  4K0K L;  4A76 A;  5C4X B;  1FGB D;  3NXW A;  4DR1 L;  2CH4 A;  2F3I A;  1ENC A;  1WCM H;  4OIK A;  1IL8 A;  1VS0 A;  3RN5 A;  2X6L A;  1D1K A;  1OXS C;  4N8X 1;  3LX0 A;  1EWC A;  1SEB D;  4A3F B;  1K8O A;  1LTT D;  3PO3 B;  4K6D A;  3W1B A;  2FJ2 A;  1CTM A;  2R61 A;  1S5B D;  4LF9 L;  4ZKB B;  3TS2 A;  1N36 Q;  2PZU A;  1CQV A;  1SJE D;  2NTT A;  3UE1 A;  4JI5 Q;  3SVM A;  4LF5 L;  2Z9H A;  3I4M G;  2K5W A;  1GOZ A;  3D4D A;  1W2B A;  3ULJ A;  2EQS A;  5IIF A;  4LF5 Q;  1O80 A;  3VR5 A;  1PV4 A;  5C4X G;  3TBI B;  4K6L A;  2QCP X;  1EIG A;  3RZO H;  1NUC A;  1N36 L;  5C0X J;  1H9S A;  3D8G A;  3CPF A;  4IUT A;  3PO2 H;  3NTH A;  1HXY D;  4DFA A;  1BBU A;  4B3T L;  1G29 1;  1UWV A;  3G4S A;  3P75 A;  2F0M A;  3K5O A;  1B44 D;  4B3R Q;  4LUV A;  3FHW A;  2BA1 A;  1KC8 C;  1SR3 A;  4ZK9 B;  1C4Q A;  4ODG A;  4CKB A;  1N34 L;  3CC4 A;  3Q6S A;  1F9S A;  4H0L C;  1GUG A;  4G57 A;  1YJN A;  1J5E Q;  4B3T Q;  1GUT A;  1RL2 A;  3TRE A;  3HOW G;  3L9A X;  3MXU A;  1Y8P B;  4JI5 L;  3U58 A;  3RMH A;  1IBL Q;  4X64 L;  1GUN A;  1KAA A;  1ZYR D;  4RKB A;  5NUC A;  3S17 B;  4NW2 A;  2FXQ A;  4H44 C;  5EPK A;  2Q2U A;  4LAA A;  1JMC A;  2O5I C;  1STY A;  1STE A;  2KHI A;  4ULL A;  4DA2 A;  2BH2 A;  5E4X A;  3WDN A;  4A3G H;  1JOQ A;  4XQN A;  4KY6 A;  3SK5 A;  1CQF A;  1TS5 A;  3OIP A;  3G71 A;  2A69 C;  3S1Q H;  1CA6 A;  4X66 L;  3PUV A;  2AQ3 B;  3TP6 A;  2Q8I B;  3MHB A;  5JEA G;  1H9R A;  3PO3 H;  3NEL A;  3D6C A;  5T1I A;  5C3E B;  1JOO A;  1M90 C;  2F4I A;  3GTQ H;  4B3M Q;  5IGE A;  2B63 B;  4KKS A;  4J1M A;  5M5X H;  3MEF A;  1B1Z A;  2A19 A;  3E0J A;  3U50 C;  2EY2 A;  1D5M C;  1BOS A;  2F52 A;  2HD3 A;  4JK1 C;  2ZTD A;  4RWS C;  5M3M B;  1BDO A;  3IAY A;  2L12 A;  2RDH A;  3F1Z A;  5KYL A;  3KJP A;  2F4V L;  1T5E A;  3Q24 A;  4GKK L;  1GD7 A;  2K5H A;  5HGT A;  5EGT A;  4DR2 Q;  3QG1 A;  4KKT A;  1HRJ A;  1I4R A;  5LHY 1;  2GVB A;  2OF1 A;  2ES2 A;  1TWC B;  1JJG A;  1IYV A;  4OWX B;  2CQA A;  2RA4 A;  2JEB I;  3ICE A;  1Q3L A;  1RF2 D;  4MHE A;  1Q86 C;  1O7L A;  1STB A;  4GN5 A;  4DR5 Q;  1WTP A;  2NVT H;  1N9W A;  4QJF A;  2RHS B;  3RLN A;  2I46 A;  3SK6 A;  4JI4 L;  3H3V H;  2B2U A;  5GAD C;  2VQE Q;  3NK9 A;  4HMI A;  5CV6 A;  4DK6 C;  1R9T B;  5JOB A;  3S2H H;  2DY7 A;  2XRQ D;  1PH7 A;  1OXT A;  3UDG A;  1X6O A;  3M7N A;  3OTO L;  1AE2 A;  4A3K H;  3BU2 A;  2JK8 A;  2JA7 B;  3G7L A;  3PIP 3;  2ZM6 L;  4Y52 H;  3HOZ B;  1Y1W B;  1X3G A;  2Z6K C;  2N78 A;  4L5S A;  3G48 A;  3GP7 A;  4S3S A;  2NZ1 D;  1TT2 A;  5BN5 A;  4A3K G;  1AE3 A;  1KNE A;  1LAB A;  3J80 i;  4PZ8 A;  3A5Z B;  1FNU A;  5IP9 H;  1YNN D;  3A8K E;  3OSO A;  2M9V A;  1O7Z A;  1PH5 A;  1AZP A;  4JI2 Q;  2V4D A;  5LMU L;  4Y7N B;  1EIY B;  3AFQ A;  1XPR A;  2R93 B;  1JR0 D;  1VQI A;  2WFW A;  3OW7 A;  3RLO A;  2WAC A;  4MNO A;  1D8L A;  2F0I A;  1CM9 A;  1I94 L;  4V0B A;  4WJ4 A;  3PV0 A;  4OON A;  3D3R A;  2VB3 X;  3HOY B;  1AW7 A;  3HGB A;  3IFT A;  4A3I H;  1KD1 C;  2AUJ D;  2ATW A;  3M4O B;  4HCE A;  1BUV T;  4O42 A;  2XWB B;  4DR1 Q;  5JEA H;  3J81 E;  4LF6 L;  2K5V A;  2HQE A;  2Q2I A;  1S5C D;  1I6V C;  4ILW A;  1HFG A;  4A93 H;  3S9W A;  3KDF B;  2OCE A;  4G7O C;  4FP5 D;  1TWA H;  2F0T A;  2N49 A;  4YWL A;  4K14 A;  2CFM A;  3MXN A;  4P75 A;  3H0G G;  3ER0 A;  1VMC A;  4XT1 B;  1RIP A;  4JVZ A;  2PNH A;  4B3S L;  2G5D A;  4RFB A;  3F2D A;  4BY7 H;  1LTS D;  3J81 c;  3HOX G;  1QG7 A;  1EY7 A;  1PH1 A;  5EPJ A;  3NP8 A;  4KLK A;  4X62 Q;  2D2C C;  2EY5 A;  3NWS A;  2IJ0 A;  2XNA C;  5IYD H;  1T5X D;  2IX0 A;  4O2D A;  2YTX A;  4QIW E;  3GTK B;  5CBA E;  4E6I A;  3ULL A;  1C48 A;  2J7Z A;  2OXP A;  3KLS X;  4GNX A;  3GTP H;  4RAU C;  5I6Y A;  5G3L F;  1SLJ A;  4IUQ A;  3EBE A;  2K28 A;  2R7Z B;  1LLR D;  1L1O B;  5JPN C;  4CJ1 B;  3S1M H;  5LMU Q;  5IY0 A;  2RQX A;  4BXX H;  3OOC A;  1HNZ Q;  3W3A A;  4OIJ A;  1LT5 D;  4HIM A;  3C3L A;  2ZXO A;  4UDU C;  1CUK A;  4X65 L;  3CMA A;  1NR4 A;  3I3C A;  4UY8 C;  4ZLT F;  1WTH A;  5CV5 A;  4RHS A;  2JA7 H;  1IBK L;  3H6M A;  5D14 A;  1U4R A;  1WCM B;  4X3S A;  1MJC A;  2DNE A;  5M3F H;  4R8N A;  3WOE A;  4L8J A;  4GN3 B;  1EEI D;  1KLU D;  2LXK A;  2MO0 A;  3CQZ B;  1I50 B;  3V05 A;  3UI2 A;  1CKN A;  2PQA B;  2L4N A;  1DOL A;  1LYL A;  2QGQ A;  3JC6 6;  2Z4I A;  3GO5 A;  5I4D A;  2YU9 H;  3E0E A;  2QF7 A;  2VNU D;  1A3V A;  1TXY A;  1P8L A;  3KYH C;  2VUM G;  3DEO A;  3KLW A;  3H94 A;  4DV7 Q;  1RCV D;  2WP8 J;  3I55 A;  2VZA A;  1KDC A;  5DM6 3;  2N55 A;  2PW7 A;  4DN4 M;  1L0X B; 
#chains in the Genus database with same CATH homology
 2ENB A;  1AZQ A;  3CKI B;  4R9W A;  4I65 A;  5HUR A;  2IWH A;  3R2T A;  4K2L A;  1MBY A;  1A3T A;  3I70 A;  4TRD A;  1SNQ A;  1EYC A;  5C3X A;  1EU4 A;  2JP1 A;  1H9S B;  3D31 A;  4FXG C;  1EY5 A;  4BWG B;  2F0K A;  4M1U B;  4V19 0;  3CHB D;  3PUY A;  2RBM A;  3R2I A;  2AQ2 B;  1EFI D;  4DAY A;  1ILQ A;  1D5X C;  2B8F A;  2B2V C;  3S1Q B;  1CZW A;  3DHQ A;  1PRT D;  2J4X A;  4G7Z C;  1RHP A;  1HUM A;  3H91 A;  4KN7 C;  1SDF A;  4IQZ A;  2NYZ D;  4QF4 A;  3EFX D;  1PRT C;  5IOC A;  1ZEQ X;  4H13 C;  4L63 B;  4ABN A;  2R6G A;  3BDL A;  1CHQ D;  2A6E C;  2XVS A;  3GV3 A;  4F7X A;  2EOT A;  2SEB D;  4OHJ A;  4EQP A;  1I4Q A;  1STH A;  2K5D A;  2A74 C;  3GTO B;  5KRU A;  5CMD A;  1MSH A;  3KK7 A;  1BNZ A;  3A54 A;  1DOM A;  5JPM C;  2VXW A;  2K5Q A;  3BVG A;  1SYF A;  5CYU A;  3QIA A;  4NKL A;  5JEA J;  1H9K A;  2F0L A;  4XQQ A;  2WB1 B;  4Q0F A;  3I4M B;  3EVQ A;  1WTV A;  3OIQ A;  4QCL A;  4WRD A;  4ZUJ A;  5KYI A;  1B9N A;  2WAQ B;  2AWN A;  3HG9 A;  4CKE A;  3H0G B;  5CGK A;  2EYJ A;  2GA4 B;  4RGM A;  1QNU A;  4FF2 A;  2VUM B;  1EZ6 A;  2B2W A;  5CBE E;  3TSS A;  1NCV A;  5IGF A;  1VDZ A;  1LTB D;  4FVM A;  1FR3 A;  5F2D A;  3NBH A;  1ICW A;  5E1F A;  3IL8 A;  2ID0 A;  3S2D B;  3R3O A;  1KAB A;  5FK9 C;  2KUM A;  4K5V A;  2EY1 A;  2FIN B;  2MGS A;  4WOR A;  1M4V A;  4BA2 I;  3MC0 B;  2E74 C;  1DXM A;  3VA5 A;  3NSW A;  2O2L D;  3J7Y W;  1HCZ A;  2KCN A;  4R8I A;  2AUK A;  4XDX A;  1KNA A;  3A7L A;  5EKI A;  3K5N A;  2NB0 A;  3J80 E;  1A3U A;  3I72 A;  1XXG A;  4BA1 I;  3W2D A;  2Z4H A;  3GTJ B;  4PQX A;  1CHP D;  4ZUI A;  1PZI D;  5D65 A;  3VYS A;  1BQQ T;  1IKM A;  1QNK A;  2OT2 A;  1QE6 A;  1TII D;  3BZD B;  1VF7 A;  2MP1 A;  3FMC A;  1QB5 D;  1RTO A;  1BCP F;  3MZ5 A;  3ND8 A;  1Q90 A;  2FMC A;  4DF7 A;  1SYG A;  4ZYS A;  4HED A;  1S5D D;  1PFB A;  4XT3 B;  1AN8 A;  5E4W C;  1SYB A;  3P7J A;  5FO8 B;  4DAP A;  2JSO A;  3MA2 B;  3OWF A;  4KTA A;  2LY7 A;  1LO5 D;  1V1P B;  1SMY D;  2MHV A;  2HUG A;  3SR1 A;  3VR6 A;  2IW3 A;  3FEW X;  1Q8I A;  3T16 A;  3AMU A;  4IUR A;  4PMB A;  3MTS A;  4A3K B;  1G91 A;  4KI0 A;  1I6H B;  1WTX A;  1F2L A;  5TSS A;  2EYM A;  1BXT A;  2L0C A;  1UNS A;  4P2C B;  3NUC A;  2M00 A;  2F0Q A;  2B2U C;  3ERQ A;  3NQT A;  3K5L A;  4NDX A;  4RH6 A;  3CRL C;  2Z1C A;  2DN8 A;  4F87 A;  1Z47 A;  3PUX A;  1DM0 B;  1DOK A;  1E2V A;  2ZXP A;  5FO7 B;  1EQT A;  4QB4 A;  4YIJ A;  1FNV A;  1K83 B;  3BDO A;  5M9O A;  2SNS A;  1EIH A;  2RVL A;  2F1M A;  4CHT B;  1LTI D;  4B08 A;  2IPK D;  2EYP A;  1HPC A;  1SBB B;  2PW5 A;  1GUW A;  2HDL A;  1ET6 A;  2ICI A;  3RZD B;  3PUZ A;  5ELE A;  3WOF A;  3FDT A;  4KHV A;  1D1I A;  5CR3 A;  3NTK A;  2JA8 B;  3J81 L;  2PPB C;  1TR5 A;  1W6J A;  4KY7 A;  2DNC A;  1LTR D;  4U68 A;  1HA5 A;  1TY2 A;  1IHZ A;  4C56 C;  4EVO A;  3IFD A;  2G9D A;  1V8Q A;  5JAV A;  2DY8 A;  2JA5 B;  4A3I B;  1O78 A;  1LT6 D;  5EJW A;  1HA6 A;  3C1F A;  2E2H B;  3RZO B;  1L0Y B;  4NMZ A;  4RCN A;  5LL6 S;  3DWQ A;  1TY0 A;  2D62 A;  1IKL A;  1QJO A;  4MN3 A;  2EJM A;  1J9O A;  2KJX A;  4WJW A;  1WTQ A;  4KY5 A;  4Z9C B;  4C2M B;  5EKK A;  5ELB A;  3VA7 A;  5AFW A;  4X3U A;  1ENF A;  3S16 B;  5FO9 B;  3TDQ A;  2Y0S B;  3QOL A;  4A3B B;  3DM1 A;  4K5W A;  2ICE C;  1S5E D;  4DNT B;  3S1N B;  5C3W A;  1F2M A;  1JC7 A;  1HFN A;  3S14 B;  1LTA D;  1X3Q A;  1HTL D;  3A55 A;  1BCP B;  4HMJ A;  3HKZ B;  1CFM A;  2MJ8 A;  4BY7 B;  4RGT A;  2O5J C;  3TZD A;  5IGG A;  2NVQ B;  5J22 A;  3RUZ A;  1B53 A;  2Q8R E;  1JB3 A;  2NUC A;  2WKC A;  4DNR B;  3FVQ A;  4N9T A;  1EY8 A;  5C4J B;  4QUC A;  1VCI A;  1V1P A;  4PV1 C;  4ZQ3 A;  1KLG D;  1IYU A;  4B9X A;  3P20 A;  3TN2 A;  1MGS A;  4KK7 A;  3MVV A;  2IT1 A;  2SDF A;  4EQO A;  4A3G B;  4AYB B;  1SND A;  2MUY A;  3BYT B;  5EQ0 A;  2JYO A;  3RLF A;  1LT3 D;  3BVM A;  2PO4 A;  4QIW B;  4BBS B;  2EE1 A;  1TQO A;  2SNM A;  4HN7 A;  5DEH A;  2PYK A;  4UAI A;  1NAP A;  5EKL A;  4JBW A;  1ILP A;  3SEB A;  2F0H A;  2CVR A;  1FNW A;  3TP7 A;  5E3F A;  3T13 A;  1JWS D;  4HSV A;  3Q0A A;  1DZ1 A;  1TVX A;  3PO2 B;  2X69 A;  5A2Q E;  3Q22 A;  3DWA A;  2M2L A;  1HUN A;  3NPP A;  4ME5 A;  2B8G A;  4C3I B;  4KD3 A;  3D4W A;  1RJT A;  4KD4 A;  1SSO A;  1B9M A;  5C0X I;  2EYH A;  2PQE A;  5K5P A;  1SXT A;  4KJO A;  3ND9 A;  3FPU B;  2C5C A;  1TKW B;  1F2Y A;  3VR3 A;  1ZXT A;  1JIC A;  1PTO B;  3NE5 B;  1DCZ A;  3LWE A;  1SE3 A;  2TMP A;  1SE2 A;  1SJH D;  4X3K A;  2BDO A;  2F03 A;  2BDN A;  1S5F D;  1D5Z C;  1FYC A;  2BOS A;  4C3H B;  2YYZ A;  3ONA B;  4IFD G;  3VYU A;  4C1N I;  1SNM A;  2WIN B;  2OEO A;  1UUP A;  1CZG A;  4FF3 A;  4KHZ A;  4A3J B;  3FPP A;  1YNJ D;  3PIO 3;  1XWE A;  2K04 A;  4A3E B;  1JE4 A;  2HCI A;  3HRZ C;  5ELC A;  2A6H D;  1RD9 D;  1S4Z A;  2EYL A;  2L55 A;  3C1E A;  2NN6 H;  5IOD A;  1HQR D;  4RGO S;  4OGQ C;  1MD2 D;  4FF1 A;  3S2H B;  2K03 A;  4DGZ A;  4C3I G;  1LT4 D;  2B2Y C;  3GTM B;  1V1O A;  4Q5V A;  5LL6 X;  1TS4 A;  4NP5 A;  3ITP A;  2EYF A;  3MAQ A;  1PMR A;  5C4H A;  1SYC A;  2N88 A;  1G8Z D;  1E2W A;  4LMQ D;  2QIL A;  1EY6 A;  2KEE A;  1TWG B;  4ZRZ A;  1PYW D;  3SHL A;  2BE5 D;  3DMU A;  2KVM A;  1WD0 A;  1TWF B;  2EXZ A;  1Y8O B;  3Q23 A;  4BS9 A;  3KLR A;  2L11 A;  2F0N A;  3CRK C;  1A2T A;  2ZXR A;  4L6T B;  3BVZ A;  1JWU D;  5M5X B;  1DD2 A;  3PUW A;  1ROD A;  2K05 A;  2KOL A;  3TZU A;  1PTO C;  4F88 A;  1UAP A;  2E2D C;  4TSS A;  3URY A;  3HP3 A;  1B50 A;  5IT9 E;  5EPL A;  1QIL A;  1BR9 A;  2G9H D;  1EEF D;  2LMC B;  1JQY D;  1GHK A;  4K8I A;  3OHX C;  2PNR C;  1SFO B;  2QEJ C;  3M85 A;  4K5X A;  1WTR A;  2L5T A;  5IGD A;  4I7Z C;  4C1N K;  3I4N B;  1F9P A;  5FKA C;  4C3J B;  5M3F B;  4FXK C;  1B3A A;  3T51 B;  1Q1E A;  1LV9 A;  1PRT B;  1G2S A;  3S15 B;  2A73 B;  2NWG A;  4N9P A;  4KJN A;  3TP5 A;  1ZKO A;  4C3J G;  2B2Y A;  3T4A C;  4DAV A;  2HDM A;  3H09 A;  4HSP A;  4RHR A;  1PFM A;  4B9W A;  1U4L A;  1SNO A;  3QOJ A;  1TWH B;  1VMP A;  3I90 A;  3R93 A;  4FNF A;  1Z7T A;  3M7G A;  2CW0 C;  1TS2 A;  1JCK B;  1ZYR C;  2RSO A;  1DYQ A;  4TKO B;  5CV8 A;  1EYA A;  2F0V A;  2EY6 A;  3J7A F;  3VYT A;  1PTO F;  3MFY A;  1XTC D;  4RA8 A;  5FOB B;  2BCO A;  3KF8 A;  2XRS D;  2Z8L A;  4XIG S;  3SK4 A;  1D6E C;  4DK0 A;  2A6E D;  5KIX A;  1Q12 A;  3OMG A;  2X6G A;  3N52 A;  3HS0 C;  2IX1 A;  5KNC A;  2D9U A;  2RDG A;  5CV7 A;  3MWY W;  1DON A;  2CHB D;  1C8C A;  4CBV A;  1KTK A;  3L7Z C;  5I6W A;  2CW0 D;  5ISR A;  2A5H A;  1BF4 A;  2JA6 B;  3C2P A;  1LTG D;  3K0Y A;  3NBI A;  5C5L A;  1BCP D;  1Q1B A;  4FYD A;  1G6Z A;  2B2V A;  2L9H A;  3PMF A;  1FD7 D;  1EL0 A;  4RCO A;  2RSN A;  3SK8 A;  4OO1 H;  3EJI A;  3QB3 A;  2KA7 A;  2XN9 C;  2NVX B;  1AFP A;  1H9J A;  4TQU S;  4MIU A;  2E75 C;  2WKD A;  5C0X H;  4KN4 C;  3HZX A;  4IFD I;  1WD1 A;  4F8M A;  5CV9 A;  1EY9 A;  4LJZ C;  4EGV A;  2IX3 A;  2RKS A;  4A3D B;  4XXE A;  3MXP A;  2EYO A;  1I3Q B;  2NTS A;  3K6O A;  3A8I E;  2LKV A;  1R4Q B;  4XQJ A;  1D2B A;  2EJG C;  1GUO A;  1OO9 B;  4HTH A;  2B2T C;  2TSS A;  5K36 H;  1ET9 A;  1NSN S;  3DXJ C;  1NR2 A;  3OWE B;  1BBX C;  3QJY A;  1A6X A;  3FRP B;  1ML0 D;  1STA A;  3ZYY X;  3X3N A;  2XWJ B;  5ELD A;  2HCC A;  1QCB D;  2PZT A;  4C3H G;  3KUP A;  3M3Y B;  1UEA B;  5DM7 3;  4DXG A;  4OO1 I;  1ESF A;  5C4Z A;  3VR2 A;  4FO2 A;  4PMC A;  3DUZ A;  4HCS A;  2BE5 C;  3P1H A;  4M8A A;  3I73 A;  4PNY A;  3J7A V;  5JVG 3;  3KLS A;  3A7A B;  3T53 B;  2FMM A;  2LS0 1;  5KGU A;  1ENA A;  3I4L A;  1IW7 C;  1O7Y A;  1CI3 M;  5BN4 A;  5I2X A;  3OMC A;  2H4O A;  1AP0 A;  1V43 A;  4IUV A;  3NWT A;  1HQM C;  2NBF A;  3KBG A;  1OXV A;  4O1N A;  4IFD J;  1PRT F;  4CJ2 C;  2QDB A;  3OPO A;  4IZ8 A;  4XTC S;  4A3M B;  1U4M A;  3SXH A;  4XYQ A;  1EZ8 A;  4GZY C;  4KMU C;  1EQV A;  1H9M A;  3IKJ A;  3G6J B;  2EPB A;  3V96 A;  2F0E A;  2J0T D;  1OXU A;  2FFK B;  3SDZ A;  5J1Z A;  4J6H A;  2F0W A;  3K57 A;  2F0O A;  1RKN A;  1RTN A;  4G7H C;  1ONL A;  1E0B A;  1QOH A;  2A68 D;  3M4Y A;  4BY1 B;  2KEC A;  5D3I B;  2FHT A;  3GV6 A;  1B2T A;  1PZJ D;  2F0U A;  5K36 G;  3V2T A;  3E5S A;  1YNN C;  1R4P B;  1I4X A;  5ELF A;  3K7A B;  3HOW B;  3HOU B;  5C44 B;  1EY4 A;  4QUF A;  4IUU A;  5EBD A;  4G4K A;  4FXD A;  1SYE A;  2I07 B;  1WTO A;  1XX8 A;  2F3V A;  1AEX A;  2YU9 B;  1PZK D;  2WV6 D;  2B39 A;  1SE4 A;  2C9O A;  2F0S A;  2ZT9 C;  3GTG B;  5JVH 3;  2R92 B;  3DWP A;  3U9O A;  2F3W A;  2PCF B;  3MXG A;  3TME A;  2NN6 I;  2K33 A;  1SNP A;  4J8Q A;  3FKI B;  3K59 A;  4KV6 A;  1GHJ A;  1VF5 C;  1F9Q A;  3GQB A;  3QWN A;  4FF4 A;  3J80 L;  2QKI C;  1PFN A;  3AB9 A;  2AWO A;  1Y69 U;  1F2Z A;  5KND A;  2JE6 I;  3JAM L;  4X3T A;  1KDA A;  3BYY B;  1CA5 A;  3KBX A;  1I4H A;  4H7B A;  4RGN A;  3K58 A;  1JOK A;  4ZKC B;  1GUS A;  1B4O A;  3K5M A;  1JWM D;  1WTW A;  1Y1V B;  4XYO A;  5I9O A;  1CT1 D;  4OO1 G;  1F9R A;  4K8J A;  3NHH A;  4WFN 3;  2EJF C;  3I91 A;  1STG A;  1PDQ A;  1KDB A;  1X3P A;  4DXF A;  1II3 A;  3GD7 A;  3BS1 A;  3E6Z X;  4ZAI A;  3LNN A;  3MFG A;  3BG3 A;  1TU2 B;  5T1G A;  2R3Z A;  1RDP D;  1EOT A;  2RDF A;  2K7V A;  3HOX B;  1K8M A;  5J39 A;  1GXD C;  1G2T A;  3QO2 A;  3C46 A;  2BA0 A;  5I2Y A;  4LK1 C;  5A35 A;  2L1B A;  5DNF A;  2PMZ B;  3HEJ A;  2E2I B;  5I9P A;  5CV4 A;  5JJZ A;  3H3V C;  1A2U A;  2LFN A;  3T56 B;  1TS3 A;  5IGB A;  2WII B;  2O4X A;  3I8Z A;  1EU3 A;  1MI2 A;  1QWY A;  3F2U A;  2D5D A;  5KEE A;  1LAC A;  1SMY C;  1PLF A;  1A15 A;  2XIW A;  2EVB A;  1PXU A;  1SAP A;  2E76 C;  2H1E A;  3NTI A;  1EYD A;  3ERO A;  3EQL C;  5BN3 A;  5M5W B;  3GTP B;  2K6A A;  2JEA I;  2Q8T A;  4EQN A;  2K1B A;  1DJR D;  1PTO D;  3A56 A;  2F0P A;  1M8A A;  3A8J E;  4ID6 A;  1HTP A;  3BDC A;  4IUP A;  1W6K A;  4OL7 A;  1JOR A;  2A69 D;  2SOB A;  3EA6 A;  4PMW A;  3JAM E;  2B2W C;  2F0G A;  5IGC A;  2XSC A;  4BBR B;  1EWH A;  3NQI A;  5D3D A;  3HOV B;  1CK1 A;  3SE0 A;  5KNB A;  1OXX K;  3DEP A;  1WVL A;  3LWU A;  2E2J B;  2NVY B;  2NN6 G;  1J8I A;  3R8B A;  3MEH A;  2K32 A;  4IAL A;  5DAU A;  5A2Q L;  1F77 A;  2NVT B;  3L3O C;  2F0D A;  4U67 3;  2MPM A;  3S1M B;  5EBC A;  1STN A;  4DU9 A;  3X3M A;  1GJX A;  4CKC A;  2K01 A;  2KED A;  4K2K A;  3D4R A;  4CGY B;  1X32 A;  2EZV A;  5M5Y B;  5IT9 L;  1Z6H A;  1I4P A;  2A68 C;  4IN3 A;  1E2Z A;  1SNC A;  3S1R B;  1HHV A;  4QMG A;  4A93 B;  2PZW A;  1MSG A;  2AQ1 B;  5COR A;  4IFD H;  4CJ0 B;  3D6W A;  1BO0 A;  1EY0 A;  4RKL A;  4HR7 B;  1XYI A;  3GTQ B;  2VB2 X;  1I4G A;  1ESR A;  1YNJ C;  1BCP C;  2F0J A;  1PTO H;  3AU7 A;  1U4P A;  5G3L D;  3TP8 A;  3RD4 A;  4HAE A;  2JXM B;  1TWA B;  3GTL B;  5CC4 A;  5FLX L;  2B2T A;  2KHS A;  2KCC A;  5C6A A;  3VR4 A;  1Y8N B;  2A6H C;  1SYD A;  3N6R A;  2F0F A;  2IL8 A;  5FLX E;  4DK1 A;  5C0X G;  2EDG A;  3O13 A;  4KKU A;  1IW7 D;  5COY A;  5C5M A;  4IUN A;  1U9R A;  3U9S A;  3CU7 A;  2KQ3 A;  3VYR A;  5C4X B;  1FGB D;  3NXW A;  1ENC A;  4OIK A;  1IL8 A;  2X6L A;  1D1K A;  1OXS C;  3LX0 A;  1EWC A;  1SEB D;  4A3F B;  1K8O A;  1LTT D;  3PO3 B;  4K6D A;  2FJ2 A;  1CTM A;  2R61 A;  1S5B D;  4ZKB B;  2PZU A;  1CQV A;  1SJE D;  2NTT A;  3SVM A;  2K5W A;  1GOZ A;  3D4D A;  5IIF A;  1O80 A;  3VR5 A;  3TBI B;  4K6L A;  2QCP X;  1EIG A;  1NUC A;  5C0X J;  1H9S A;  3D8G A;  4IUT A;  3NTH A;  1HXY D;  4DFA A;  1G29 1;  3P75 A;  2F0M A;  3K5O A;  1B44 D;  2BA1 A;  4ZK9 B;  1C4Q A;  4ODG A;  4CKB A;  3Q6S A;  1F9S A;  4H0L C;  1GUG A;  4G57 A;  1GUT A;  3L9A X;  3MXU A;  1Y8P B;  3RMH A;  1GUN A;  1KAA A;  1ZYR D;  4RKB A;  5NUC A;  3S17 B;  4NW2 A;  4H44 C;  5EPK A;  4LAA A;  2O5I C;  1STY A;  1STE A;  4ULL A;  4DA2 A;  5E4X A;  3WDN A;  1JOQ A;  4XQN A;  4KY6 A;  3SK5 A;  1CQF A;  1TS5 A;  3OIP A;  2A69 C;  1CA6 A;  3PUV A;  2AQ3 B;  3TP6 A;  2Q8I B;  3MHB A;  5JEA G;  1H9R A;  5T1I A;  3D6C A;  5C3E B;  1JOO A;  2F4I A;  5IGE A;  2B63 B;  4KKS A;  4J1M A;  1B1Z A;  3E0J A;  2EY2 A;  1D5M C;  1BOS A;  4JK1 C;  4RWS C;  5M3M B;  1BDO A;  3IAY A;  2L12 A;  2RDH A;  5KYL A;  1T5E A;  3Q24 A;  5HGT A;  5EGT A;  3QG1 A;  4KKT A;  1HRJ A;  1I4R A;  5LHY 1;  2OF1 A;  1TWC B;  1IYV A;  2CQA A;  2RA4 A;  2JEB I;  1Q3L A;  1RF2 D;  4MHE A;  1O7L A;  1STB A;  1WTP A;  2I46 A;  3SK6 A;  2B2U A;  3NK9 A;  4HMI A;  5CV6 A;  1R9T B;  5JOB A;  2DY7 A;  2XRQ D;  1OXT A;  3M7N A;  2JA7 B;  3G7L A;  3PIP 3;  3HOZ B;  1Y1W B;  3GP7 A;  4S3S A;  2NZ1 D;  1TT2 A;  5BN5 A;  1KNE A;  1LAB A;  1FNU A;  1YNN D;  3A8K E;  3OSO A;  2M9V A;  1O7Z A;  1AZP A;  2V4D A;  4Y7N B;  2R93 B;  1JR0 D;  3OW7 A;  2WAC A;  2F0I A;  1CM9 A;  4V0B A;  3PV0 A;  3D3R A;  2VB3 X;  3HOY B;  1AW7 A;  3HGB A;  3IFT A;  2AUJ D;  3M4O B;  4HCE A;  1BUV T;  4O42 A;  2XWB B;  5JEA H;  3J81 E;  2HQE A;  1S5C D;  1I6V C;  4ILW A;  1HFG A;  3S9W A;  4G7O C;  4FP5 D;  2F0T A;  4K14 A;  3MXN A;  1VMC A;  4XT1 B;  4RFB A;  1LTS D;  1QG7 A;  1EY7 A;  5EPJ A;  3NP8 A;  2D2C C;  2EY5 A;  3NWS A;  2IJ0 A;  2XNA C;  1T5X D;  2IX0 A;  3GTK B;  5CBA E;  4E6I A;  1C48 A;  2J7Z A;  2OXP A;  3KLS X;  4RAU C;  5I6Y A;  5G3L F;  4IUQ A;  2K28 A;  2R7Z B;  1LLR D;  5JPN C;  4CJ1 B;  2RQX A;  3OOC A;  3W3A A;  4OIJ A;  1LT5 D;  3C3L A;  2ZXO A;  4UDU C;  1NR4 A;  3I3C A;  4ZLT F;  5CV5 A;  4RHS A;  3H6M A;  5D14 A;  1U4R A;  1WCM B;  4X3S A;  2DNE A;  4R8N A;  3WOE A;  4L8J A;  1EEI D;  1KLU D;  3CQZ B;  1I50 B;  3V05 A;  3UI2 A;  2L4N A;  1DOL A;  2Z4I A;  3GO5 A;  5I4D A;  2QF7 A;  2VNU D;  1A3V A;  3DEO A;  3H94 A;  1RCV D;  2WP8 J;  1KDC A;  5DM6 3;  2N55 A;  2PW7 A;  4DN4 M;  1L0X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...