4LMVA

Crystal structure of glutathione transferase gstfua2 from phanerochaete chrysosporium
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
252
structure length
252
Chain Sequence
SQPIVFYDIPSNDTLKQSPWSPNTWKIRYALNIKGIKYKTEWVEYPDIEDVVKKLGGKPTGKKPDGRDHYTVPVIYDPNTKTVVEDGIKIAKYLDDAYPDTPRLFPAGTDAFQAAFDDFVWSVTLAFPLLSLLLLDVSNSLPPRSSAYFRATREQQFGKRLEEQGGEERWQQLEAGLGKFKGYLERNGAGNDLLLMGTQGGITYSDVQIASLFVWAKVVWGEGSEKWKRLMGFHGGKWAQFCAQFAEYERAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione transferase
publication title Diversification of fungal specific class a glutathione transferases in saprotrophic fungi.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Transferase
total genus 82
structure length 252
sequence length 252
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4lmvA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4lmvA01
3HA9A 5HFKA 5G2ZA 4I6XA 2IN3A 1YKAA 2LQQA 4MH2A 3VWXA 2H01A 3HVVA 4IGJA 1ZGNA 3VURA 4XHMA 4V2MA 2LRCA 3ZLPA 3KZQA 3UARA 3TB2A 4MF7A 3BCKA 5G30A 2QKEA 1AC1A 3W8SA 5CRWA 2UZ8A 2V41A 2G0FA 1GSYA 2X8HA 1TXXA 1SL1B 1Z3EA 4AJ8A 3LWAA 4JZQA 5IOXA 1XVWA 4NV5A 2H8LA 3HCZA 2IMFA 5KN0A 5GAND 1NSWA 3ZMKA 1XBSA 1GSDA 1AQXA 2GS3A 2H73A 2IIYA 1B4QA 1Q98A 2CZ2A 2A2SA 1YY7A 2AYTA 3EMXA 1WWJA 3DXBA 1XOBA 2C3NA 3TCOA 1V40A 2DSAA 4EC0A 1C72A 3AY8A 5G5EA 4IN0A 5IM9A 5ENUA 2YANA 4PNFA 2CQ9A 2ES7A 2HZEA 4MLYA 4JR4A 1XOAA 1GULA 4YQUA 3WD6A 2FA8A 3NIVA 3Q6OA 1VF3A 2H0IA 4NHWA 5D9VA 4JU5A 2YPMA 22GSA 1TK8B 3MSZA 3JCML 3F6FA 3EU3A 5CO3A 5KEJA 2OACA 2H19A 1TU8A 1O85A 3GH9A 2FD3A 1T00A 5DJMA 4F0CA 3UL3A 5EL8A 2LKUA 4O32A 3DYRA 4F0BA 3GV1A 3IHQA 1NHOA 3I9V2 3RAZA 1T3BA 4KGIA 4KX4A 4BL7B 2YOIA 1K0MA 3ZFBA 3IC8A 2B7KA 4MJBA 1K0DA 1TRUA 2FUG2 13GSA 4IQ1A 1SK1A 3GSTA 2GZZA 3UAPA 2YNXA 5AIVA 4HOJA 2B5EA 1VRSD 3A5WA 4XS4B 1WIKA 1OE7A 3HZ8A 2E2MA 1CQHA 4BPYA 4PXOA 2C4JA 1M9AA 4BWQA 4HDEA 3C1RA 2EIQA 2LRNA 3GURA 2IMDA 4ZXGA 1FVKA 3WT1A 1ZL9A 3KXOA 1O8WA 3PINA 4KCEA 3P2AA 1ZYQB 2GDRA 2HRAA 4USSA 4IS0A 4EVMA 2DC5A 2H1DA 1T4ZA 3M0FA 2MMNA 3EWLA 1K0AA 3ZVJD 2VM1A 3H4KA 1X5EA 2B1LA 1WPIA 4MDCA 3L0HA 4EF0A 3F9UA 2DMMA 2O7KA 3RPPA 5D73A 4KNDA 3LXZA 4MF6A 2R2JA 4DSQA 4JRRA 3F63A 2FNOA 1M7TA 2V6OA 1GNEA 3FKFA 3G7JA 4I2UA 2XPDA 3IDVA 5F07A 5BMUA 1USBA 6GSVA 1TU7A 5IO2A 2XPEA 4Q5FA 3HXSA 3TJBA 2QGVA 4IVFA 1M2BA 4GF0A 4BL7A 2TIRA 4IHUA 3ZIJA 3Q74A 3N5OA 2VCQA 1Z6NA 1TTZA 4PX1A 4YH2A 2B5YA 4GRFA 4ECBA 5CYYA 1BEDA 2YZUA 3C8EA 5IMZA 2YWIA 1SD8A 1O7UA 1EWXA 4XS4A 4LL1B 4PURA 2F8FA 3J7Yk 4G2EA 1XWBA 4IW9A 5CRHA 5IMAA 2JZRA 4E8EA 4KCAA 3BJ5A 4POKA 1JZWA 4HU9A 3F4TA 1F37A 2BMXA 2HSHA 3ME7A 1J08A 4OWYA 4RQXA 4IKHA 1ZCPA 4J57E 4PQIA 2WB9A 5FHIA 3ME8A 3GYKA 12GSA 1SYRA 2ALBA 2KP2A 5ELGA 3LYKA 4JE1A 3U6VA 3LGCA 2WCIA 2P5QA 1TOFA 1PX6A 2Z9SA 4KB3A 5DQYA 2VUPA 5B6NA 4MK3A 3TRXA 2F9SA 3IAS2 1X9SB 2CX3A 2B6MA 4DSRA 2XC2A 3IBHA 5L71A 3CTFA 5CP1A 3I69A 3D22A 5C04A 1HNBA 5HR1A 1Z7RA 1PGTA 1OKDA 1DE2A 3H1NA 1A8YA 4HS1A 1GUKA 1UN2A 3GNJA 3KCMA 4K6XA 3D6IA 3QOUA 3US3A 4NV2A 4MJAA 1EGOA 3D0ZA 1XW9A 2WS2A 2VL3A 4MPGA 3C1SA 4GSNA 3FY7A 3VPQA 2C0GA 3IPZA 3LJRA 5A4WA 1WJKA 2LNTA 2NPBA 5F06A 2M80A 3CSIA 4WBJA 1GP1A 5KN3A 3QAVA 2QSIA 2WGRA 4K8MA 1EGRA 3TKPA 1RW1A 2P5RA 3KM6A 1SJ6A 2K6VA 3CYNA 1OKTA 2GSTA 1Z9HA 5ECIB 1S3DA 2L6DA 3GRXA 4F03A 3FR9A 2N5BA 4FIWA 4MF5A 3VWWA 5B8AA 2A4VA 3H79A 3E3EA 4G10A 1R26A 5INYA 1QUWA 2PUKC 4K9ZA 1OE8A 4WF5A 4MABA 1YQ1A 5HFIA 3OR5A 4EDZA 3ED3A 3UOMA 1YF1A 3VWVA 3FZ9A 2M46A 1AUCA 1O6JA 2DJ1A 2FWEA 1U87A 1E6BA 3ERFA 2WFCA 1BG5A 17GSA 2TRCP 4K0GA 4KSOA 3CMIA 2GTUA 2NBSA 1ZZYA 1XWAA 2IWTA 2VD1A 2D2ZA 1TRWA 1OC9A 2FCHA 4HEA2 3IXRA 2H1AA 4ZB8A 3BCIA 3LG6A 3GKKA 4I5QA 3KMNA 2PWJA 1GTIA 4ULXA 4XRAA 14GSA 5ECMB 1SL0B 1ERTA 3U5RE 5JWRB 4POBA 3M1GA 2ON5A 2HZFA 4BA7A 1PKWA 4YQMA 6GSSA 2LJRA 1XCCA 2JSYA 2HT9A 3CXGA 2MMAA 4KDXA 1DBYA 2CAQA 2KUCA 1URMA 3ZFLA 3S9FA 1ON4A 3C71A 4L0WA 5LNKe 1Z6MA 5D9TA 2IJYA 4IELA 5D9XA 3IAM2 2DJKA 3GH6A 1EZKA 3KTLA 1F6MC 3DGQA 4IJ3A 2YWNA 2OA7A 2P31A 4O5RA 1KNGA 2PGTA 2IL3A 4PUAA 4TN8A 4MMMA 4Q5NA 5LD0A 3EURA 1SJZA 2R37A 2VOCA 1GTUA 3GHAA 2LJKA 1GUMA 4ECIA 4GWRA 3SBCA 1THXA 1K0BA 4NWYA 1PKZA 1JZRA 2R4VA 4OFTA 1QK8A 1H4OA 2VL2C 5IMVA 2AV4A 1AXDA 3GSSA 1B8XA 2JSZA 1JLVA 4QQ7A 1A2JA 4HJ2A 4V1Ap 4O92A 3VLNA 2B5XA 3PPUA 1G6WA 2IMIA 3WT2A 1PRXA 2OE3A 4XTSA 2YV7A 2YWMA 5JCUA 1B48A 2LSTA 5ECKB 1EP8A 3GKMA 3UMAA 1BAYA 1FB6A 1JZOA 3O3TA 2LS5A 3ZYWA 2V6KA 1YEPA 3L4NA 4EKZA 3HVSA 1Z5YE 3KJYA 5D93A 1GUHA 2FWFA 3TJFA 3GUSA 4EUYA 1Z7PA 1B9XC 2RUEA 3UIWA 3A2WA 5G5FA 4Q5QA 2KLXA 4IP6A 1B4PA 1F3AA 2C1YA 1AQVA 4IP1A 1YF0A 2VO4A 3TKRA 3WGDA 2CVDA 2RIIA 2KHPA 4POMA 2DJ3A 4TKYA 4PNGA 1M9BA 2L6CA 4G0IA 2CV4A 4N10A 1YDKA 5ID2B 4KUNA 1ILOA 1S3CA 3GN3A 2YV9A 2KOKA 4ZBDA 3KP8A 5J9CA 2LTKA 4ECJA 5JCGA 3TKSC 3TRQA 2WZ9A 3IA1A 3IOSA 2DBCA 2MMZA 1K0CA 3VI5A 2NVLA 4X1UA 4OD7A 1OC8A 2AAWA 2OBKA 4BVXB 2FGXA 2F8AA 2X8GA 1GH2A 1NHYA 3RDWA 1EP7A 3QR6A 3VPTA 1DE1A 2GQMA 3UBKA 2VLVA 3LXTA 1IYIA 2N5FA 11GSA 2K18A 3QAGA 4V2LA 4EO3A 5ABRA 4WETA 2GSSA 5J9BA 1XVQA 2O85A 3VWUA 4IJIA 4GSTA 3CSJA 1GSUA 2ZNMA 1V2AA 4KF9A 5JCWA 4IQAA 2CT6A 1PMTA 1X5CA 2REMA 4OO5A 2CVBA 4TXOB 4LMVA 3P90A 1G7OA 3LSZA 1TJDA 3UVHA 3Q18A 4K0NA 1K0NA 1PN9A 3H93A 2XHFA 5ECLB 2HRKB 1J0FA 3W6GA 4KE3A 2C3QA 1M2AA 2L5OA 3IRAA 4XS1A 3ZL5A 2H1BA 3GX0A 5DCGA 1ZYEA 5E4WA 3KMOA 1VGLA 2OE0A 4D73B 4PQHA 2J23A 1TI3A 1XIYA 1G7EA 1MTCA 2C0DA 3UJ1A 3ZITA 1SYXA 3F3QA 3TGZA 1YJ6A 5J3RA 5ID2A 2VCTA 2EIOA 5C00A 3ZRDA 4G0LA 1MDKA 1MDIA 1JZDA 4L0UA 1BQ7A 1T8EB 3GKNA 4MH3A 1FB0A 4ML6A 2JZSA 1CQGA 4ZBAA 3NZNA 2GSRA 6GSTA 2GQKA 4DEJA 3QPMA 3HHVA 3GKXA 3E0UA 2O8VB 2PPTA 4BVXA 1N2AA 4BWSA 2C3TA 4N30A 1RK4A 5FT3A 4F9ZA 4TW5A 3EINA 1AIUA 2YN1A 3TUEA 1ZMAA 4HU7A 1KBNA 2FLSA 3L9UA 3A2XA 3EVIA 1M99A 3GIXA 3MNGA 1LBKA 2VIMA 1VF4A 3IV4A 4HQZA 1W89A 3APSA 2NDOA 3CRUA 3DRNA 5CAXA 1VF1A 1K3OA 1A2LA 1BJXA 5ECNB 3UEMA 3KD0A 1A24A 1K3YA 3G9BA 1OC3A 1WE0A 1QMVA 4TR4A 4TXOA 1AW9A 3Q19A 2ON7A 1O8XA 4ZB9A 3WGXA 4KA0A 1HD2A 3HYPA 1TRVA 3ZREA 3ZMLA 1XPVA 2HRKA 4K1FA 5J41A 3GL3A 4NHZA 1O73A 3ZZXA 4KH7A 4H86A 2OADA 2WDUA 2HI7A 4AJ7A 3A2VA 1WP0A 4D73A 4LL4B 3BBYA 1WRYA 3L9VA 1R4WA 2B7JA 2L57A 3D21A 2DJJA 2H0GA 4KDYA 3GL5A 3M8NA 2YWOA 1OC9B 4HQSA 1GLPA 1M2DA 3APOA 2I81A 5DAKB 4GLTA 2L4CA 1SKWB 2VLTA 4PUFC 1SL2B 1H75A 2VL2A 1A0RP 1BX9A 4RQRA 4MZBA 2L59A 8GSSA 1X0RA 3MDKA 2YJ7A 3FHKA 1K0OA 4FH8A 4OCEA 1A8LA 5HR2A 2A2RA 3EC3A 5ECRB 4K7NA 1EOHA 5JWQB 1U3IA 2C80A 1ERWA 3TJKA 1XWCA 1PX7A 3HZ4A 2YJHA 3L78A 4ECCA 3H8QA 2C0FA 2IMKA 2R5GA 2YP6A 3TJGA 1WOUA 3LQ7A 3DMLA 4WBRD 2O87A 2H76A 2FA4A 3QMXA 3KH9A 20GSA 2HSYA 3QD9A 2HSNB 1Q4JA 4EDYA 3R3EA 1WMJA 4F2IA 2HSMB 3PGTA 3K8NA 1TK5B 2JL4A 2XBIA 1DSBA 3HDCA 1G6YA 1LJRA 2JACA 4ZL9A 1UA5A 5CNWA 4G9HA 3J7Yb 3PH9A 1MDJA 1N8JA 1TW9A 2LV3A 2CZ3A 2H72A 3TKSA 3DEXA 1HNAA 2I1UA 2PN8A 3IC4A 4KW6A 4J2FA 1SK2A 5AIXA 2VCXA 3DD3A 1GTAA 5HQPA 5A4VA 1I5GA 3KEBA 1F3BA 1V98A 3G7IA 2C0EA 2IPAA 1PA3A 1MD4A 2RLIA 3IE3A 1G0TA 5DAKA 3HVXA 1AQWA 4ZIJA 2K8VA 4TOPA 4IBPA 3HJPA 3QDNA 3R2QA 2XBQA 6GSYA 1AAZA 3FZ5A 2LNSA 5F0GA 4TR1B 3P8WA 4XCSA 2AHEA 1EEJA 4MP4A 5AISA 2VCVA 1GSQA 3APQA 4MJEA 5DQSA 5A4UA 5J5NA 2V2GA 1FOVA 3CTGA 2R3XA 1FVJA 1TDIA 2PVOC 1YZXA 1NW2A 4K2DA 2H1GA 2H30A 2J9HA 4L5OA 1DUGA 1EEMA 5AGYA 2NTOA 2H66A 4ZILA 5ECSA 3UBLA 2AJQB 2KP1A 5HR3A 3EE2A 3RHBA 3TKQA 4ML1A 2M72A 1GRXA 2F3MA 1SD9A 1SKSB 3IK7A 1HQOA 1J9BA 2CVKA 1TRSA 1YKCA 4MZCA 2H71A 9GSSA 3GFKA 4PTSA 5GAPD 4GSSA 1R5PA 1Y25A 4MA9A 5IOWA 5A5KA 6GSUA 3VI7A 1I9DA 4GXZA 4EXJA 2HSMA 4GQFA 4EE0A 3EYTA 5DALB 5E59A 2RUFA 1EV9A 4I2TA 4MCUA 5KN2A 1EV4A 5IQYA 4PGTA 2E2GA 3ISOA 4HZ4A 4MJCA 1OAZA 4GCIA 2DLXA 2IFQB 1OYJA 5J4UA 5ECQB 2GZYA 4MZWA 5D9WA 4EL1A 3EU4A 2L4QA 3FK8A 4G0KA 3F4SA 1U88A 19GSA 2X8CA 4ISDA 1GSFA 3F6DA 5ECPB 3P7XA 1GLQA 4G19A 3ZIVA 2OBIA 4I97A 2MMOA 4QL7A 1GL8A 2VLUA 2H0HA 2V1MA 4TVEA 3V1WA 3QCPA 4V1Ag 1ZOFA 3TJJA 4WKWA 2C8UA 4N0VA 3RBTA 4JBBA 2BJXA 4TR1A 3GTUB 2LUSA 1V9WA 2GVPA 4KSMA 2VAFA 2HQTA 1U3AA 5B6MA 3KH7A 4F82A 1OVNA 1NM3A 4ILFA 4WEYA 4HJMA 5G31A 3MWHA 3D5JA 1A0FA 4ZL7A 2VCZA 3TKSE 4FYUA 5IMFA 2GLRA 2I3YA 3HKRA 4JR6A 3A3TA 3DKSA 3M9KA 2K9FA 2X99A 2DJ2A 1JFUA 4WR4A 2HFDA 1GWCA 1X9MB 2ZUPA 3LFLA 1GTBA 3I6AA 2FWHA 5DVBA 1TK0B 2HNLA 4RUVA 1T4YA 2VL9A 3FW2A 2OJLA 5ELAA 5EPFA 3TOTA 2HLSA 3TDGA 1GSSA 5DALA 4N11A 1K3LA 4N0ZA 1PL1A 5IMCA 2CA8A 3C73A 1LU4A 4POLA 2H74A 1PL2A 3ERGA 6GSXA 2HRNA 1KTEA 1QXHA 2IFQA 3WYWA 4XIHA 4OCFA 2HRFA 2HE3A 3CBUA 2I9HA 3LEFA 2DMLA 2AUVA 4GTUA 4X0XA 2VCWA 3UVTA 4Z7XA 2E0QA 5COHA 5H5RA 16GSA 5F8BA 2WJUA 5B8BA 2LEGA 3TOUA 2VD0A 2H70A 1JHBA 3GTUA 4KDUA 4TRXA 4Q5RA 3M3MA 5IO0A 4TR0A 4DSSB 5HR0A 3GX8A 5F05A 3CSHA 5FWGA 1XWGA 3LYPA 4J56E 4LMWA 3DWVA 1HYUA 2HYXA 5D96A 5D8IA 3L9SA 4O7HA 1GNWA 1ACVA 2H75A 2LJAA 1X9WB 3MAKA 2FHEA 1XW6A 4AJ6A 2PVQA 1SU9A 4L8EA 4FO5A 4MPFA 2MZCA 4WF4A 2JZTA 1MD3A 5G1KA 3W8JA 4AF2A 4CDOA 3BOAA 3D4MA 1YEXA 1BYEA 3GMFA 5DBQA 2ZCTA 3F3RA 4LA1A 1FG4A 3F8UA 1S3AA 1IYHA 1XXUA 2EIRA 2DJ0A 1UC7A 2I4AA 5DJLA 3GA4A 1FHEA 3FR6A 4ZB6A 5ECOB 2CAIA 1TP9A 2O89A 4WXTA 1F9MA 4HI7A 2AB6A 2CX4A 5IPGA 1SKRB 1VF2A 2E7PA 3FZ4A 5EY6A 4AGSA 5CRDA 2YCDA 1SENA 1R5AA 2H6ZA 5G1LA 3CRTA 1JLWA 5CREA 2OE1A 2DIYA 3IR4A 1F2EA 5IMDA 18GSA 2X64A 3PR8A 3E9JB 3N9JA 4OMVA 3FEUA 1T1VA 3RPNA 1XWKA 4E8HA 2PU9C 4BVYB 2OKAA 3ZTLA 2TRXA 4DSSA 4XRDA 1HNCA 2JADA 4PQ1A 4NMUA 2WULA 4TR3A 4YAVA 1GSEA 2FWGA 4HZ2A 3BD2A 1M0UA 3WGEA 2B3SA 4K7IA 1V58A 2MBSA 1FAAA 5DCHA 4OO4A 4NPBA 3FRCA 1ABAA 1R7HA 3QFBC 1KEBA 7GSSA 3C7MA 5H5QA 3F4RA 4ID0A 3HY2A 4X43A 4CW9A 1X5DA 3TRPA 2K8SA 2R6KA 4V2NA 1PD21 2PMTA 3VFIA 1MEKA 2FY6A 1W4VA 3O76A 4P3YB 1XW5A 4FQUA 2BTOT 2HXKA 5LCZA 4NXIA 2PERA 1O81A 3DVXA 5IPHA 2L5LA 3F0IA 1A23A 4DVCA 3I43A 3HD5A 3ERWA 4FYCA 1PSQA 2YZHA 1TI1A 3FYGA 2P0GA 3DVWA 3FR3A 1V57A 1ML6A 5ECHB 4OFMA 1QQ2A 3DIEA 4OFNA 2GGTA 2F51A 3VK9A 2GZPA 5GSSA 4KAEA 5IIZA 6GSWA 2QC7A 2GSQA 2LRTA 3D4TA 1U6TA 3HJOA 2V32A 5DDLA 4QL9A 5GZZB 5JWOB 4LLRA 1SK0A 4BVYA 4I8BA 4CHSA 3EMPA 2IMEA 1B9YC 3LORA 2RM5A 3QFAC 4HUAA 3M9JA 1Y6EA 1A2MA 3G7YA 1FW1A 4L5LA 5CRGA 2GT6A 4TXVA 1ST9A 4K7OA 1TKDB 4WR5A 4RI7A 1RQMA 4ACSA 1QFNA 5AN1A 2VM2A 2MBTA 4ZL8A 3QAWA 5B7CA 2G2QA 5HFGA 2H6XA 4GQCA 10GSA 2GT5A 3KGKA 2PBJA 1ERVA 3KTBA 4RI6A 3ZVJA 5GSTA 5EVOA 3NOFA 1FO5A 1QGVA 1T7PB 2GQLA 4JEDA 1XFLA 1THOA 3SWLA 1SJIA 1EOGA 3IK9A 4FYBA 4YQVA 3HJMA 3FZAA 5H5SA 4YAPA 2B1KA 3KP9A 2LQOA 3RHCA 2HZEB 4ZBBA 2WRTA 1UVZA 2DIZA 2N5AA 2RM6A 2JU5A 4NAXA 3KIJA 2MYGA 5KN1A 2H6YA 2EC4A 1XZOA 1ERUA 3O6TA 1PQNA 4XS6A 1E2YA
chains in the Genus database with same CATH superfamily
3HA9A 5HFKA 5G2ZA 4I6XA 2IN3A 1YKAA 1Y1UA 2LQQA 2R0GA 4MH2A 3VWXA 2H01A 3HVVA 4IGJA 1ZGNA 3VURA 4XHMA 4V2MA 3LW9A 2LRCA 3ZLPA 3KZQA 3UARA 3TB2A 4MF7A 3BCKA 5G30A 2QKEA 1AC1A 3W8SA 1PN0A 5CRWA 2UZ8A 2V41A 2G0FA 1GSYA 2X8HA 1TXXA 5A1NA 1SVOA 1SL1B 1Z3EA 4AJ8A 3LWAA 4JZQA 5IOXA 1XVWA 4NV5A 2H8LA 3HCZA 2IMFA 5KN0A 5GAND 1NSWA 3ZMKA 1XBSA 1GSDA 1AQXA 2GS3A 2H73A 2IIYA 1B4QA 1Q98A 2CZ2A 2A2SA 1YY7A 2AYTA 5A5HB 2EFEA 3EMXA 1WWJA 3DXBA 1XOBA 4YKGA 2C3NA 3TCOA 1V40A 1SVMA 2DSAA 4EC0A 1C72A 3AY8A 5G5EA 4IN0A 5IM9A 5ENUA 2YANA 4PNFA 2CQ9A 2ES7A 2HZEA 4MLYA 4JR4A 1XOAA 1GULA 4YQUA 3WD6A 2FA8A 3NIVA 3Q6OA 1VF3A 2H0IA 4NHWA 5D9VA 4JU5A 2YPMA 22GSA 1TK8B 3MSZA 5J40A 1ZYNA 3JCML 3F6FA 3EU3A 5CO3A 5KEJA 2OACA 2H19A 1TU8A 1O85A 3GH9A 2FD3A 1T00A 5DJMA 4FXYP 4F0CA 3UL3A 5EL8A 2LKUA 4O32A 3DYRA 4F0BA 3GV1A 3IHQA 1NHOA 3I9V2 3RAZA 1T3BA 4KGIA 4KX4A 4BL7B 2YOIA 1K0MA 3ZFBA 3IC8A 2B7KA 4MJBA 1K0DA 1TRUA 2FUG2 4PI0C 13GSA 4IQ1A 1SK1A 3GSTA 2GZZA 3UAPA 2YNXA 5AIVA 4HOJA 2B5EA 4X4JA 1VRSD 3A5WA 4XS4B 1WIKA 1OE7A 4GDFA 3HZ8A 2E2MA 1CQHA 4BPYA 4PXOA 2C4JA 1M9AA 4BWQA 4HDEA 3C1RA 2EIQA 2LRNA 3GURA 2IMDA 4ZXGA 1FVKA 3WT1A 1ZL9A 3KXOA 1O8WA 3PINA 4KCEA 3P2AA 1ZYQB 2GDRA 2HRAA 4USSA 4IS0A 4EVMA 2DC5A 2H1DA 1T4ZA 3M0FA 2MMNA 2WVZA 3EWLA 1K0AA 3ZVJD 2VM1A 3H4KA 1X5EA 2B1LA 1WPIA 4MDCA 3L0HA 4EF0A 3F9UA 2DMMA 2O7KA 3RPPA 5D73A 4KNDA 3LXZA 4MF6A 2R2JA 4DSQA 4JRRA 3F63A 2FNOA 2WW3A 1M7TA 2V6OA 1GNEA 3FKFA 3G7JA 4I2UA 2XPDA 3IDVA 5F07A 5BMUA 1USBA 6GSVA 1TU7A 5IO2A 2XPEA 4Q5FA 3HXSA 3TJBA 2QGVA 4IVFA 1M2BA 4GF0A 5J4YA 4BL7A 2TIRA 4IHUA 3ZIJA 3Q74A 3N5OA 4PHZC 2VCQA 1Z6NA 1TTZA 4PX1A 4YH2A 2B5YA 4GRFA 4ECBA 5CYYA 1BEDA 2YZUA 3C8EA 4W66A 5IMZA 2YWIA 1SD8A 1O7UA 1EWXA 4XS4A 4LL1B 4PURA 2F8FA 3J7Yk 4G2EA 1XWBA 4IW9A 5CRHA 5IMAA 2JZRA 4E8EA 4KCAA 3BJ5A 4POKA 1JZWA 4HU9A 1XG8A 3F4TA 1F37A 2BMXA 2HSHA 3ME7A 1J08A 4OWYA 4O5UA 4RQXA 4IKHA 1ZCPA 4J57E 4PQIA 3EPTA 2WB9A 5FHIA 3ME8A 3GYKA 12GSA 1SYRA 4Z2TA 2ALBA 2KP2A 5ELGA 3LYKA 4JE1A 2UV8G 3U6VA 3LGCA 2WCIA 2P5QA 1TOFA 1PX6A 2Z9SA 3MYDA 4KB3A 5DQYA 3CWGA 2VUPA 4O5QA 5B6NA 4MK3A 3TRXA 2F9SA 3IAS2 1X9SB 2CX3A 2B6MA 4DSRA 2XC2A 3IBHA 5L71A 3CTFA 5CP1A 3I69A 4PI2C 3D22A 5C04A 1HNBA 5HR1A 4QMKA 1Z7RA 1PGTA 1OKDA 1DE2A 4YKFA 3H1NA 1A8YA 4HS1A 3RGBC 1GUKA 1UN2A 3GNJA 3KCMA 4K6XA 3D6IA 3QOUA 3US3A 4NV2A 4MJAA 4G01A 1EGOA 3D0ZA 1XW9A 2WS2A 2VL3A 4MPGA 3C1SA 4GSNA 3FY7A 3VPQA 2C0GA 3IPZA 3LJRA 5A4WA 1WJKA 2LNTA 2NPBA 5F06A 2M80A 1BG1A 3CSIA 4WBJA 1GP1A 5KN3A 3QAVA 2QSIA 2WGRA 4K8MA 1EGRA 3TKPA 1RW1A 2P5RA 3KM6A 1SJ6A 2K6VA 4AKXB 3CYNA 1OKTA 2GSTA 1Z9HA 5ECIB 1S3DA 2L6DA 3GRXA 4F03A 3FR9A 2N5BA 4FIWA 4MF5A 3VWWA 5B8AA 2A4VA 3H79A 3E3EA 4G10A 1R26A 5INYA 1QUWA 2PUKC 4K9ZA 1OE8A 4WF5A 4MABA 1YQ1A 5HFIA 3OR5A 4EDZA 5A1NB 3ED3A 3UOMA 1YF1A 3VWVA 1N25A 3FZ9A 2M46A 1AUCA 1O6JA 2DJ1A 2FWEA 1I1IP 1U87A 1E6BA 3ERFA 2WFCA 1BG5A 17GSA 2TRCP 4K0GA 4KSOA 3CMIA 2GTUA 2NBSA 1ZZYA 1FOHA 1XWAA 2IWTA 2VD1A 1S3RA 2D2ZA 1TRWA 1OC9A 2FCHA 4HEA2 3IXRA 2H1AA 4ZB8A 3BCIA 3LG6A 3GKKA 4I5QA 3KMNA 2PWJA 1GTIA 4ULXA 4XRAA 14GSA 2O36A 5ECMB 1SL0B 1ERTA 3U5RE 5JWRB 4POBA 3M1GA 2ON5A 2HZFA 4BA7A 1PKWA 4YQMA 6GSSA 2LJRA 1XCCA 2JSYA 2HT9A 3CXGA 2MMAA 4KDXA 1DBYA 2CAQA 2KUCA 1URMA 3ZFLA 3S9FA 1ON4A 3C71A 4L0WA 5LNKe 1Z6MA 5D9TA 1TXUA 2IJYA 4IELA 5D9XA 3IAM2 2DJKA 3GH6A 1ZYPA 1EZKA 4BIKA 3KTLA 1F6MC 3DGQA 4IJ3A 2YWNA 2OA7A 2P31A 4O5RA 1KNGA 2PGTA 2IL3A 4PUAA 4TN8A 4MMMA 4Q5NA 5LD0A 3EURA 1SJZA 2R37A 3FMWA 2VOCA 1GTUA 2HSNA 3GHAA 2LJKA 1GUMA 4ECIA 4GWRA 4A5PA 3SBCA 1THXA 1K0BA 4NWYA 1PKZA 1JZRA 2R4VA 4OFTA 4HSCX 1QK8A 2QA1A 1H4OA 2VL2C 5IMVA 2AV4A 1AXDA 3GSSA 1B8XA 2JSZA 1JLVA 4QQ7A 1A2JA 4HJ2A 4V1Ap 4O92A 3VLNA 2B5XA 3PPUA 1G6WA 2IMIA 3WT2A 1PRXA 2EFDA 2OE3A 4XTSA 2YV7A 2YWMA 5JCUA 1B48A 2LSTA 5ECKB 1EP8A 3GKMA 3UMAA 1BAYA 1FB6A 1JZOA 3O3TA 2LS5A 3ZYWA 2V6KA 1YEPA 3L4NA 4EKZA 3HVSA 1Z5YE 3KJYA 5D93A 1GUHA 2FWFA 3TJFA 3GUSA 4EUYA 1Z7PA 1B9XC 2RUEA 3UIWA 3A2WA 5G5FA 4Q5QA 2KLXA 4IP6A 1B4PA 2WVXB 1F3AA 2C1YA 1AQVA 4IP1A 1YF0A 2VO4A 3TKRA 3WGDA 2CVDA 2RIIA 2KHPA 4POMA 2DJ3A 4TKYA 4PNGA 1M9BA 2L6CA 4G0IA 2CV4A 4N10A 1YDKA 5ID2B 4KUNA 5BMUB 1ILOA 1S3CA 3GN3A 2YV9A 2KOKA 4ZBDA 3KP8A 5J9CA 2LTKA 4ECJA 5JCGA 3TKSC 3TRQA 2WZ9A 2O3EA 3IA1A 3IOSA 2DBCA 2MMZA 1K0CA 3VI5A 2NVLA 4X1UA 4OD7A 1OC8A 2AAWA 2OBKA 4BVXB 2FGXA 2F8AA 2X8GA 1GH2A 1NHYA 3RDWA 1EP7A 3QR6A 5A34B 3VPTA 1DE1A 2GQMA 3UBKA 2VLVA 3LXTA 1IYIA 2N5FA 11GSA 2K18A 3QAGA 4V2LA 4EO3A 5ABRA 4WETA 2GSSA 5J9BA 1XVQA 2O85A 3VWUA 4IJIA 4GSTA 3CSJA 1GSUA 2ZNMA 2EFCA 1V2AA 4KF9A 5JCWA 4IQAA 2CT6A 1PMTA 1X5CA 2REMA 4OO5A 2CVBA 4TXOB 4LMVA 3P90A 1G7OA 3LSZA 1TJDA 3UVHA 3Q18A 4K0NA 1K0NA 1PN9A 3H93A 2QA2A 2XHFA 5ECLB 2HRKB 1J0FA 3W6GA 4KE3A 2C3QA 1M2AA 2L5OA 3IRAA 4XS1A 3ZL5A 2H1BA 3GX0A 5DCGA 2WVXA 1ZYEA 5E4WA 3KMOA 1VGLA 2OE0A 4D73B 4PQHA 2J23A 1TI3A 1XIYA 1G7EA 1MTCA 2C0DA 3UJ1A 3ZITA 3RFRC 1SYXA 3F3QA 3TGZA 1S4BP 1YJ6A 5J3RA 5ID2A 2VCTA 2EIOA 5C00A 3ZRDA 4G0LA 1MDKA 1MDIA 1JZDA 4L0UA 1BQ7A 1T8EB 3GKNA 4MH3A 1FB0A 4ML6A 2JZSA 1CQGA 4ZBAA 3NZNA 2GSRA 6GSTA 2GQKA 4DEJA 3QPMA 3HHVA 3GKXA 3E0UA 2O8VB 2PPTA 4BVXA 1N2AA 4BWSA 2C3TA 4N30A 1RK4A 5FT3A 4F9ZA 5A34A 4TW5A 3EINA 1AIUA 2YN1A 3TUEA 1ZMAA 4HU7A 1KBNA 4AKIA 2FLSA 3L9UA 3A2XA 3EVIA 1M99A 3GIXA 3MNGA 1LBKA 2VIMA 1VF4A 3IV4A 4HQZA 4ZB7A 1W89A 3APSA 2NDOA 3CRUA 3DRNA 3HVNA 5CAXA 1VF1A 1K3OA 1A2LA 1BJXA 5ECNB 3UEMA 3KD0A 1A24A 1K3YA 3G9BA 1OC3A 1WE0A 1QMVA 4TR4A 4TXOA 1AW9A 3Q19A 2ON7A 1O8XA 4ZB9A 1YVLA 3WGXA 4KA0A 1HD2A 3HYPA 1TRVA 1SVLA 3ZREA 5J47A 3ZMLA 1XPVA 2HRKA 4K1FA 5J41A 3GL3A 4NHZA 1O73A 3ZZXA 4KH7A 4H86A 2OADA 2WDUA 2HI7A 4AJ7A 3A2VA 1WP0A 4D73A 4LL4B 3BBYA 1WRYA 3L9VA 1R4WA 2B7JA 2L57A 3D21A 2DJJA 2H0GA 4KDYA 3GL5A 4Z2RA 3M8NA 2YWOA 1OC9B 4HQSA 1GLPA 1M2DA 3APOA 2I81A 5DAKB 4GLTA 2L4CA 1SKWB 2VLTA 2X4AA 4PUFC 4AKGA 4EIPA 1SL2B 1H75A 2VL2A 1A0RP 1BX9A 4RQRA 4MZBA 2L59A 8GSSA 1X0RA 3MDKA 2YJ7A 3FHKA 1K0OA 4FH8A 4OCEA 1A8LA 5HR2A 2A2RA 1M3JA 3EC3A 5ECRB 4K7NA 1EOHA 5JWQB 1U3IA 2C80A 1ERWA 3TJKA 1XWCA 1PX7A 3HZ4A 2YJHA 3L78A 4ECCA 3H8QA 2C0FA 2IMKA 2R5GA 2YP6A 3TJGA 1WOUA 3LQ7A 3DMLA 2X49A 4WBRD 2O87A 2H76A 2FA4A 3QMXA 3KH9A 20GSA 2HSYA 3QD9A 2HSNB 1Q4JA 4EDYA 3R3EA 1WMJA 4F2IA 2HSMB 2A4HA 3PGTA 3K8NA 1TK5B 2JL4A 4AKHA 2XBIA 1DSBA 3HDCA 1G6YA 1LJRA 2JACA 3A5IA 4ZL9A 1UA5A 5CNWA 4G9HA 3J7Yb 3PH9A 1MDJA 1N8JA 1TW9A 2LV3A 2CZ3A 2H72A 3TKSA 3DEXA 1HNAA 2I1UA 2PN8A 3IC4A 4KW6A 4N3ZA 4J2FA 1SK2A 5AIXA 2VCXA 3DD3A 1GTAA 5HQPA 5A4VA 1I5GA 3KEBA 1F3BA 1V98A 3G7IA 2C0EA 2IPAA 1PA3A 1MD4A 2RLIA 3IE3A 1G0TA 3HMJG 5DAKA 3HVXA 1AQWA 4ZIJA 2K8VA 2R0CA 4TOPA 4IBPA 3HJPA 3QDNA 4K5RA 3R2QA 2XBQA 6GSYA 2VKZG 1AAZA 3FZ5A 2LNSA 5F0GA 4TR1B 3P8WA 4XCSA 2AHEA 2H1LA 1EEJA 4MP4A 5AISA 2VCVA 1GSQA 3APQA 4MJEA 5DQSA 5A4UA 5J5NA 2V2GA 1FOVA 3CTGA 2R3XA 3IHGA 1FVJA 1TDIA 2PVOC 1YZXA 1NW2A 4K2DA 2H1GA 2H30A 2J9HA 4L5OA 1DUGA 1EEMA 5AGYA 2NTOA 2H66A 4ZILA 5ECSA 3UBLA 2AJQB 2KP1A 5HR3A 5KOXA 3EE2A 3RHBA 3TKQA 4ML1A 2M72A 1GRXA 2F3MA 1SD9A 1SKSB 3IK7A 1HQOA 1J9BA 2CVKA 1TRSA 1YKCA 4MZCA 2H71A 9GSSA 3GFKA 4PTSA 5GAPD 4GSSA 1R5PA 1Y25A 4MA9A 5IOWA 5A5KA 6GSUA 3VI7A 1I9DA 4GXZA 4EXJA 2HSMA 4GQFA 4EE0A 3EYTA 5DALB 5E59A 2RUFA 1EV9A 4I2TA 4MCUA 5KN2A 1EV4A 5IQYA 4PGTA 2E2GA 3ISOA 4HZ4A 4MJCA 1OAZA 4GCIA 2DLXA 2IFQB 1OYJA 5J4UA 5ECQB 2GZYA 4MZWA 5D9WA 4EL1A 3EU4A 2L4QA 3FK8A 4G0KA 3F4SA 1U88A 19GSA 2X8CA 4ISDA 1GSFA 3F6DA 5ECPB 3P7XA 1GLQA 3MIXA 4G19A 3ZIVA 2OBIA 4I97A 2MMOA 4QL7A 1GL8A 2VLUA 2H0HA 2V1MA 4TVEA 3V1WA 3QCPA 4V1Ag 1ZOFA 3TJJA 4WKWA 2C8UA 4N0VA 3RBTA 3TU3B 4JBBA 2BJXA 4TR1A 3GTUB 2LUSA 1V9WA 2GVPA 4KSMA 2VAFA 2WZSA 2HQTA 1U3AA 5B6MA 3KH7A 4F82A 1OVNA 1NM3A 4ILFA 4E68A 4WEYA 4HJMA 5G31A 3MWHA 3D5JA 1A0FA 4ZL7A 2VCZA 3TKSE 4FYUA 5IMFA 2GLRA 2I3YA 3HKRA 4JR6A 3A3TA 3DKSA 3M9KA 2K9FA 2X99A 2DJ2A 1JFUA 4WR4A 2HFDA 1GWCA 1X9MB 2ZUPA 3LFLA 1GTBA 3I6AA 2FWHA 5DVBA 1TK0B 2HNLA 4RUVA 1T4YA 2VL9A 3FW2A 2OJLA 5ELAA 5EPFA 3TOTA 4Z2UA 2HLSA 3TDGA 1GSSA 5DALA 4N11A 1K3LA 4N0ZA 1PL1A 5IMCA 2CA8A 3C73A 1LU4A 4POLA 2H74A 1PL2A 3ERGA 6GSXA 2HRNA 1M3IA 1KTEA 1QXHA 2IFQA 3WYWA 4XIHA 4OCFA 2HRFA 2HE3A 2WW2A 3CBUA 2I9HA 3LEFA 2DMLA 2AUVA 4GTUA 4X0XA 2VCWA 3UVTA 4Z7XA 2E0QA 5COHA 5H5RA 16GSA 5F8BA 2WJUA 5B8BA 2LEGA 3TOUA 2VD0A 2EFHA 2R0PA 2H70A 1JHBA 3GTUA 4KDUA 4TRXA 4Q5RA 3M3MA 5A5HA 5IO0A 4TR0A 4DSSB 5HR0A 3GX8A 5F05A 3CSHA 5FWGA 1XWGA 3LYPA 4J56E 4LMWA 3DWVA 1HYUA 4EIQA 2HYXA 5D96A 5D8IA 3L9SA 4O7HA 1GNWA 1ACVA 2H75A 2LJAA 1X9WB 3MAKA 5KOWA 2FHEA 1XW6A 4AJ6A 2PVQA 2OT3A 1SU9A 4L8EA 4FO5A 4MPFA 2MZCA 4WF4A 2JZTA 1MD3A 4ICYA 5G1KA 3W8JA 4AF2A 4CDOA 3BOAA 3D4MA 1YEXA 1BYEA 3GMFA 5DBQA 2ZCTA 3F3RA 1YEWC 4LA1A 1FG4A 3F8UA 1S3AA 1IYHA 1XXUA 2EIRA 2DJ0A 5BRTA 1UC7A 2I4AA 3CHXC 5DJLA 3GA4A 1FHEA 3FR6A 4ZB6A 5ECOB 2CAIA 1TP9A 2O89A 4WXTA 1F9MA 4HI7A 2AB6A 2CX4A 5IPGA 1SKRB 1VF2A 4CY6A 2E7PA 3FZ4A 5EY6A 4AGSA 5CRDA 2YCDA 1SENA 1R5AA 2H6ZA 5G1LA 3CRTA 1JLWA 5CREA 2WW1A 2OE1A 2DIYA 3IR4A 1F2EA 5IMDA 18GSA 2X64A 3PR8A 3E9JB 3N9JA 4OMVA 1PFOA 3FEUA 1T1VA 3RPNA 1XWKA 2DKHA 4E8HA 2PU9C 4BVYB 2OKAA 3ZTLA 2TRXA 2WW0A 4DSSA 4XRDA 1HNCA 2JADA 4K5SA 4PQ1A 4NMUA 2WULA 4TR3A 4YAVA 1GSEA 2FWGA 4HZ2A 3BD2A 1M0UA 3WGEA 2B3SA 4K7IA 1V58A 2MBSA 1FAAA 5DCHA 4OO4A 4NPBA 3FRCA 1ABAA 1R7HA 3QFBC 1KEBA 7GSSA 3C7MA 5H5QA 3F4RA 4ID0A 3HY2A 4X43A 4CW9A 1X5DA 3TRPA 2DKIA 2K8SA 2R6KA 4V2NA 1PD21 2PMTA 3VFIA 1MEKA 2FY6A 1W4VA 3O76A 4P3YB 1XW5A 4FQUA 2BTOT 2HXKA 5LCZA 4NXIA 2PERA 1O81A 3DVXA 5IPHA 2L5LA 3F0IA 1A23A 4DVCA 3I43A 3HD5A 3ERWA 4FYCA 4AI6A 1PSQA 1BF5A 2YZHA 1TI1A 3FYGA 5J4VA 2P0GA 3DVWA 3FR3A 1V57A 1ML6A 5ECHB 4OFMA 1QQ2A 3DIEA 4OFNA 2GGTA 2F51A 3VK9A 2GZPA 5GSSA 4KAEA 5IIZA 6GSWA 4K2XA 2QC7A 3CQFA 2GSQA 2LRTA 3D4TA 1U6TA 3HJOA 2V32A 5DDLA 4QL9A 5GZZB 5JWOB 4LLRA 1SK0A 4BVYA 4I8BA 4CHSA 3EMPA 2IMEA 1B9YC 3LORA 2RM5A 3QFAC 4HUAA 3M9JA 1Y6EA 1A2MA 3G7YA 1FW1A 4L5LA 5CRGA 2GT6A 4TXVA 1ST9A 4K7OA 1TKDB 4WR5A 4CY8A 4RI7A 1RQMA 4ACSA 1QFNA 5AN1A 2VM2A 2MBTA 4ZL8A 3QAWA 5B7CA 2G2QA 5HFGA 2H6XA 4GQCA 10GSA 2GT5A 3KGKA 2PBJA 1ERVA 4MNNA 3KTBA 2A2PA 4RI6A 3ZVJA 5GSTA 5EVOA 3NOFA 1FO5A 1QGVA 1T7PB 2GQLA 4JEDA 1XFLA 1THOA 3SWLA 1SJIA 1EOGA 3IK9A 4FYBA 4YQVA 3HJMA 3FZAA 5H5SA 4YAPA 2B1KA 3KP9A 2LQOA 3RHCA 2HZEB 4ZBBA 2WRTA 1UVZA 2DIZA 2N5AA 2RM6A 2JU5A 4NAXA 3KIJA 2MYGA 5KN1A 2H6YA 2EC4A 2O5VA 2WVYA 1XZOA 1ERUA 3O6TA 1PQNA 4XS6A 1E2YA
chains in the Genus database with same CATH topology
3HA9A 5HFKA 5G2ZA 4I6XA 2IN3A 1YKAA 1Y1UA 2LQQA 2R0GA 4MH2A 3VWXA 2H01A 3HVVA 4IGJA 1ZGNA 3VURA 4XHMA 4V2MA 3LW9A 2LRCA 3ZLPA 3KZQA 3UARA 3TB2A 4MF7A 3BCKA 5G30A 2QKEA 1AC1A 3W8SA 1PN0A 5CRWA 2UZ8A 2V41A 2G0FA 1GSYA 2X8HA 1TXXA 5A1NA 1SVOA 1SL1B 1Z3EA 4AJ8A 3LWAA 4JZQA 5IOXA 1XVWA 4NV5A 2H8LA 3HCZA 2IMFA 5KN0A 5GAND 1NSWA 3ZMKA 1XBSA 1GSDA 1AQXA 2GS3A 2H73A 2IIYA 1B4QA 1Q98A 2CZ2A 2A2SA 1YY7A 2AYTA 5A5HB 2EFEA 3EMXA 1WWJA 3DXBA 1XOBA 4YKGA 2C3NA 3TCOA 1V40A 1SVMA 2DSAA 4EC0A 1C72A 3AY8A 5G5EA 4IN0A 5IM9A 5ENUA 2YANA 4PNFA 2CQ9A 2ES7A 2HZEA 4MLYA 4JR4A 1XOAA 1GULA 4YQUA 3WD6A 2FA8A 3NIVA 3Q6OA 1VF3A 2H0IA 4NHWA 5D9VA 4JU5A 2YPMA 22GSA 1TK8B 3MSZA 5J40A 1ZYNA 3JCML 3F6FA 3EU3A 5CO3A 5KEJA 2OACA 2H19A 1TU8A 1O85A 3GH9A 2FD3A 1T00A 5DJMA 4F0CA 3UL3A 5EL8A 2LKUA 4O32A 3DYRA 4F0BA 3GV1A 3IHQA 1NHOA 3I9V2 3RAZA 1T3BA 4KGIA 4KX4A 4BL7B 2YOIA 1K0MA 3ZFBA 3IC8A 2B7KA 4MJBA 1K0DA 1TRUA 2FUG2 13GSA 4IQ1A 1SK1A 3GSTA 2GZZA 3UAPA 2YNXA 5AIVA 4HOJA 2B5EA 4X4JA 1VRSD 3A5WA 4XS4B 1WIKA 1OE7A 4GDFA 3HZ8A 2E2MA 1CQHA 4BPYA 4PXOA 2C4JA 1M9AA 4BWQA 4HDEA 3C1RA 2EIQA 2LRNA 3GURA 2IMDA 4ZXGA 1FVKA 3WT1A 1ZL9A 3KXOA 1O8WA 3PINA 4KCEA 3P2AA 1ZYQB 2GDRA 2HRAA 4USSA 4IS0A 4EVMA 2DC5A 2H1DA 1T4ZA 3M0FA 2MMNA 3EWLA 1K0AA 3ZVJD 2VM1A 3H4KA 1X5EA 2B1LA 1WPIA 4MDCA 3L0HA 4EF0A 3F9UA 2DMMA 2O7KA 3RPPA 5D73A 4KNDA 3LXZA 4MF6A 2R2JA 4DSQA 4JRRA 3F63A 2FNOA 1M7TA 2V6OA 1GNEA 3FKFA 3G7JA 4I2UA 2XPDA 3IDVA 5F07A 5BMUA 1USBA 6GSVA 1TU7A 5IO2A 2XPEA 4Q5FA 3HXSA 3TJBA 2QGVA 4IVFA 1M2BA 4GF0A 5J4YA 4BL7A 2TIRA 4IHUA 3ZIJA 3Q74A 3N5OA 2VCQA 1Z6NA 1TTZA 4PX1A 4YH2A 2B5YA 4GRFA 4ECBA 5CYYA 1BEDA 2YZUA 3C8EA 4W66A 5IMZA 2YWIA 1SD8A 1O7UA 1EWXA 4XS4A 4LL1B 4PURA 2F8FA 3J7Yk 4G2EA 1XWBA 4IW9A 5CRHA 5IMAA 2JZRA 4E8EA 4KCAA 3BJ5A 4POKA 1JZWA 4HU9A 3F4TA 1F37A 2BMXA 2HSHA 3ME7A 1J08A 4OWYA 4O5UA 4RQXA 4IKHA 1ZCPA 4J57E 4PQIA 3EPTA 2WB9A 5FHIA 3ME8A 3GYKA 12GSA 1SYRA 4Z2TA 2ALBA 2KP2A 5ELGA 3LYKA 4JE1A 2UV8G 3U6VA 3LGCA 2WCIA 2P5QA 1TOFA 1PX6A 2Z9SA 3MYDA 4KB3A 5DQYA 3CWGA 2VUPA 4O5QA 5B6NA 4MK3A 3TRXA 2F9SA 3IAS2 1X9SB 2CX3A 2B6MA 4DSRA 2XC2A 3IBHA 5L71A 3CTFA 5CP1A 3I69A 3D22A 5C04A 1HNBA 5HR1A 4QMKA 1Z7RA 1PGTA 1OKDA 1DE2A 4YKFA 3H1NA 1A8YA 4HS1A 1GUKA 1UN2A 3GNJA 3KCMA 4K6XA 3D6IA 3QOUA 3US3A 4NV2A 4MJAA 4G01A 1EGOA 3D0ZA 1XW9A 2WS2A 2VL3A 4MPGA 3C1SA 4GSNA 3FY7A 3VPQA 2C0GA 3IPZA 3LJRA 5A4WA 1WJKA 2LNTA 2NPBA 5F06A 2M80A 1BG1A 3CSIA 4WBJA 1GP1A 5KN3A 3QAVA 2QSIA 2WGRA 4K8MA 1EGRA 3TKPA 1RW1A 2P5RA 3KM6A 1SJ6A 2K6VA 4AKXB 3CYNA 1OKTA 2GSTA 1Z9HA 5ECIB 1S3DA 2L6DA 3GRXA 4F03A 3FR9A 2N5BA 4FIWA 4MF5A 3VWWA 5B8AA 2A4VA 3H79A 3E3EA 4G10A 1R26A 5INYA 1QUWA 2PUKC 4K9ZA 1OE8A 4WF5A 4MABA 1YQ1A 5HFIA 3OR5A 4EDZA 5A1NB 3ED3A 3UOMA 1YF1A 3VWVA 1N25A 3FZ9A 2M46A 1AUCA 1O6JA 2DJ1A 2FWEA 1U87A 1E6BA 3ERFA 2WFCA 1BG5A 17GSA 2TRCP 4K0GA 4KSOA 3CMIA 2GTUA 2NBSA 1ZZYA 1FOHA 1XWAA 2IWTA 2VD1A 2D2ZA 1TRWA 1OC9A 2FCHA 4HEA2 3IXRA 2H1AA 4ZB8A 3BCIA 3LG6A 3GKKA 4I5QA 3KMNA 2PWJA 1GTIA 4ULXA 4XRAA 14GSA 5ECMB 1SL0B 1ERTA 3U5RE 5JWRB 4POBA 3M1GA 2ON5A 2HZFA 4BA7A 1PKWA 4YQMA 6GSSA 2LJRA 1XCCA 2JSYA 2HT9A 3CXGA 2MMAA 4KDXA 1DBYA 2CAQA 2KUCA 1URMA 3ZFLA 3S9FA 1ON4A 3C71A 4L0WA 5LNKe 1Z6MA 5D9TA 1TXUA 2IJYA 4IELA 5D9XA 3IAM2 2DJKA 3GH6A 1ZYPA 1EZKA 3KTLA 1F6MC 3DGQA 4IJ3A 2YWNA 2OA7A 2P31A 4O5RA 1KNGA 2PGTA 2IL3A 4PUAA 4TN8A 4MMMA 4Q5NA 5LD0A 3EURA 1SJZA 2R37A 3FMWA 2VOCA 1GTUA 2HSNA 3GHAA 2LJKA 1GUMA 4ECIA 4GWRA 4A5PA 3SBCA 1THXA 1K0BA 4NWYA 1PKZA 1JZRA 2R4VA 4OFTA 1QK8A 2QA1A 1H4OA 2VL2C 5IMVA 2AV4A 1AXDA 3GSSA 1B8XA 2JSZA 1JLVA 4QQ7A 1A2JA 4HJ2A 4V1Ap 4O92A 3VLNA 2B5XA 3PPUA 1G6WA 2IMIA 3WT2A 1PRXA 2EFDA 2OE3A 4XTSA 2YV7A 2YWMA 5JCUA 1B48A 2LSTA 5ECKB 1EP8A 3GKMA 3UMAA 1BAYA 1FB6A 1JZOA 3O3TA 2LS5A 3ZYWA 2V6KA 1YEPA 3L4NA 4EKZA 3HVSA 1Z5YE 3KJYA 5D93A 1GUHA 2FWFA 3TJFA 3GUSA 4EUYA 1Z7PA 1B9XC 2RUEA 3UIWA 3A2WA 5G5FA 4Q5QA 2KLXA 4IP6A 1B4PA 1F3AA 2C1YA 1AQVA 4IP1A 1YF0A 2VO4A 3TKRA 3WGDA 2CVDA 2RIIA 2KHPA 4POMA 2DJ3A 4TKYA 4PNGA 1M9BA 2L6CA 4G0IA 2CV4A 4N10A 1YDKA 5ID2B 4KUNA 5BMUB 1ILOA 1S3CA 3GN3A 2YV9A 2KOKA 4ZBDA 3KP8A 5J9CA 2LTKA 4ECJA 5JCGA 3TKSC 3TRQA 2WZ9A 3IA1A 3IOSA 2DBCA 2MMZA 1K0CA 3VI5A 2NVLA 4X1UA 4OD7A 1OC8A 2AAWA 2OBKA 4BVXB 2FGXA 2F8AA 2X8GA 1GH2A 1NHYA 3RDWA 1EP7A 3QR6A 5A34B 3VPTA 1DE1A 2GQMA 3UBKA 2VLVA 3LXTA 1IYIA 2N5FA 11GSA 2K18A 3QAGA 4V2LA 4EO3A 5ABRA 4WETA 2GSSA 5J9BA 1XVQA 2O85A 3VWUA 4IJIA 4GSTA 3CSJA 1GSUA 2ZNMA 2EFCA 1V2AA 4KF9A 5JCWA 4IQAA 2CT6A 1PMTA 1X5CA 2REMA 4OO5A 2CVBA 4TXOB 4LMVA 3P90A 1G7OA 3LSZA 1TJDA 3UVHA 3Q18A 4K0NA 1K0NA 1PN9A 3H93A 2QA2A 2XHFA 5ECLB 2HRKB 1J0FA 3W6GA 4KE3A 2C3QA 1M2AA 2L5OA 3IRAA 4XS1A 3ZL5A 2H1BA 3GX0A 5DCGA 1ZYEA 5E4WA 3KMOA 1VGLA 2OE0A 4D73B 4PQHA 2J23A 1TI3A 1XIYA 1G7EA 1MTCA 2C0DA 3UJ1A 3ZITA 1SYXA 3F3QA 3TGZA 1YJ6A 5J3RA 5ID2A 2VCTA 2EIOA 5C00A 3ZRDA 4G0LA 1MDKA 1MDIA 1JZDA 4L0UA 1BQ7A 1T8EB 3GKNA 4MH3A 1FB0A 4ML6A 2JZSA 1CQGA 4ZBAA 3NZNA 2GSRA 6GSTA 2GQKA 4DEJA 3QPMA 3HHVA 3GKXA 3E0UA 2O8VB 2PPTA 4BVXA 1N2AA 4BWSA 2C3TA 4N30A 1RK4A 5FT3A 4F9ZA 5A34A 4TW5A 3EINA 1AIUA 2YN1A 3TUEA 1ZMAA 4HU7A 1KBNA 4AKIA 2FLSA 3L9UA 3A2XA 3EVIA 1M99A 3GIXA 3MNGA 1LBKA 2VIMA 1VF4A 3IV4A 4HQZA 4ZB7A 1W89A 3APSA 2NDOA 3CRUA 3DRNA 5CAXA 1VF1A 1K3OA 1A2LA 1BJXA 5ECNB 3UEMA 3KD0A 1A24A 1K3YA 3G9BA 1OC3A 1WE0A 1QMVA 4TR4A 4TXOA 1AW9A 3Q19A 2ON7A 1O8XA 4ZB9A 1YVLA 3WGXA 4KA0A 1HD2A 3HYPA 1TRVA 1SVLA 3ZREA 5J47A 3ZMLA 1XPVA 2HRKA 4K1FA 5J41A 3GL3A 4NHZA 1O73A 3ZZXA 4KH7A 4H86A 2OADA 2WDUA 2HI7A 4AJ7A 3A2VA 1WP0A 4D73A 4LL4B 3BBYA 1WRYA 3L9VA 1R4WA 2B7JA 2L57A 3D21A 2DJJA 2H0GA 4KDYA 3GL5A 4Z2RA 3M8NA 2YWOA 1OC9B 4HQSA 1GLPA 1M2DA 3APOA 2I81A 5DAKB 4GLTA 2L4CA 1SKWB 2VLTA 2X4AA 4PUFC 4AKGA 4EIPA 1SL2B 1H75A 2VL2A 1A0RP 1BX9A 4RQRA 4MZBA 2L59A 8GSSA 1X0RA 3MDKA 2YJ7A 3FHKA 1K0OA 4FH8A 4OCEA 1A8LA 5HR2A 2A2RA 3EC3A 5ECRB 4K7NA 1EOHA 5JWQB 1U3IA 2C80A 1ERWA 3TJKA 1XWCA 1PX7A 3HZ4A 2YJHA 3L78A 4ECCA 3H8QA 2C0FA 2IMKA 2R5GA 2YP6A 3TJGA 1WOUA 3LQ7A 3DMLA 2X49A 4WBRD 2O87A 2H76A 2FA4A 3QMXA 3KH9A 20GSA 2HSYA 3QD9A 2HSNB 1Q4JA 4EDYA 3R3EA 1WMJA 4F2IA 2HSMB 2A4HA 3PGTA 3K8NA 1TK5B 2JL4A 4AKHA 2XBIA 1DSBA 3HDCA 1G6YA 1LJRA 2JACA 3A5IA 4ZL9A 1UA5A 5CNWA 4G9HA 3J7Yb 3PH9A 1MDJA 1N8JA 1TW9A 2LV3A 2CZ3A 2H72A 3TKSA 3DEXA 1HNAA 2I1UA 2PN8A 3IC4A 4KW6A 4N3ZA 4J2FA 1SK2A 5AIXA 2VCXA 3DD3A 1GTAA 5HQPA 5A4VA 1I5GA 3KEBA 1F3BA 1V98A 3G7IA 2C0EA 2IPAA 1PA3A 1MD4A 2RLIA 3IE3A 1G0TA 3HMJG 5DAKA 3HVXA 1AQWA 4ZIJA 2K8VA 2R0CA 4TOPA 4IBPA 3HJPA 3QDNA 4K5RA 3R2QA 2XBQA 6GSYA 2VKZG 1AAZA 3FZ5A 2LNSA 5F0GA 4TR1B 3P8WA 4XCSA 2AHEA 2H1LA 1EEJA 4MP4A 5AISA 2VCVA 1GSQA 3APQA 4MJEA 5DQSA 5A4UA 5J5NA 2V2GA 1FOVA 3CTGA 2R3XA 3IHGA 1FVJA 1TDIA 2PVOC 1YZXA 1NW2A 4K2DA 2H1GA 2H30A 2J9HA 4L5OA 1DUGA 1EEMA 5AGYA 2NTOA 2H66A 4ZILA 5ECSA 3UBLA 2AJQB 2KP1A 5HR3A 5KOXA 3EE2A 3RHBA 3TKQA 4ML1A 2M72A 1GRXA 2F3MA 1SD9A 1SKSB 3IK7A 1HQOA 1J9BA 2CVKA 1TRSA 1YKCA 4MZCA 2H71A 9GSSA 3GFKA 4PTSA 5GAPD 4GSSA 1R5PA 1Y25A 4MA9A 5IOWA 5A5KA 6GSUA 3VI7A 1I9DA 4GXZA 4EXJA 2HSMA 4GQFA 4EE0A 3EYTA 5DALB 5E59A 2RUFA 1EV9A 4I2TA 4MCUA 5KN2A 1EV4A 5IQYA 4PGTA 2E2GA 3ISOA 4HZ4A 4MJCA 1OAZA 4GCIA 2DLXA 2IFQB 1OYJA 5J4UA 5ECQB 2GZYA 4MZWA 5D9WA 4EL1A 3EU4A 2L4QA 3FK8A 4G0KA 3F4SA 1U88A 19GSA 2X8CA 4ISDA 1GSFA 3F6DA 5ECPB 3P7XA 1GLQA 3MIXA 4G19A 3ZIVA 2OBIA 4I97A 2MMOA 4QL7A 1GL8A 2VLUA 2H0HA 2V1MA 4TVEA 3V1WA 3QCPA 4V1Ag 1ZOFA 3TJJA 4WKWA 2C8UA 4N0VA 3RBTA 3TU3B 4JBBA 2BJXA 4TR1A 3GTUB 2LUSA 1V9WA 2GVPA 4KSMA 2VAFA 2HQTA 1U3AA 5B6MA 3KH7A 4F82A 1OVNA 1NM3A 4ILFA 4E68A 4WEYA 4HJMA 5G31A 3MWHA 3D5JA 1A0FA 4ZL7A 2VCZA 3TKSE 4FYUA 5IMFA 2GLRA 2I3YA 3HKRA 4JR6A 3A3TA 3DKSA 3M9KA 2K9FA 2X99A 2DJ2A 1JFUA 4WR4A 2HFDA 1GWCA 1X9MB 2ZUPA 3LFLA 1GTBA 3I6AA 2FWHA 5DVBA 1TK0B 2HNLA 4RUVA 1T4YA 2VL9A 3FW2A 2OJLA 5ELAA 5EPFA 3TOTA 4Z2UA 2HLSA 3TDGA 1GSSA 5DALA 4N11A 1K3LA 4N0ZA 1PL1A 5IMCA 2CA8A 3C73A 1LU4A 4POLA 2H74A 1PL2A 3ERGA 6GSXA 2HRNA 1KTEA 1QXHA 2IFQA 3WYWA 4XIHA 4OCFA 2HRFA 2HE3A 3CBUA 2I9HA 3LEFA 2DMLA 2AUVA 4GTUA 4X0XA 2VCWA 3UVTA 4Z7XA 2E0QA 5COHA 5H5RA 16GSA 5F8BA 2WJUA 5B8BA 2LEGA 3TOUA 2VD0A 2EFHA 2R0PA 2H70A 1JHBA 3GTUA 4KDUA 4TRXA 4Q5RA 3M3MA 5A5HA 5IO0A 4TR0A 4DSSB 5HR0A 3GX8A 5F05A 3CSHA 5FWGA 1XWGA 3LYPA 4J56E 4LMWA 3DWVA 1HYUA 4EIQA 2HYXA 5D96A 5D8IA 3L9SA 4O7HA 1GNWA 1ACVA 2H75A 2LJAA 1X9WB 3MAKA 5KOWA 2FHEA 1XW6A 4AJ6A 2PVQA 2OT3A 1SU9A 4L8EA 4FO5A 4MPFA 2MZCA 4WF4A 2JZTA 1MD3A 4ICYA 5G1KA 3W8JA 4AF2A 4CDOA 3BOAA 3D4MA 1YEXA 1BYEA 3GMFA 5DBQA 2ZCTA 3F3RA 4LA1A 1FG4A 3F8UA 1S3AA 1IYHA 1XXUA 2EIRA 2DJ0A 5BRTA 1UC7A 2I4AA 5DJLA 3GA4A 1FHEA 3FR6A 4ZB6A 5ECOB 2CAIA 1TP9A 2O89A 4WXTA 1F9MA 4HI7A 2AB6A 2CX4A 5IPGA 1SKRB 1VF2A 4CY6A 2E7PA 3FZ4A 5EY6A 4AGSA 5CRDA 2YCDA 1SENA 1R5AA 2H6ZA 5G1LA 3CRTA 1JLWA 5CREA 2OE1A 2DIYA 3IR4A 1F2EA 5IMDA 18GSA 2X64A 3PR8A 3E9JB 3N9JA 4OMVA 3FEUA 1T1VA 3RPNA 1XWKA 2DKHA 4E8HA 2PU9C 4BVYB 2OKAA 3ZTLA 2TRXA 4DSSA 4XRDA 1HNCA 2JADA 4K5SA 4PQ1A 4NMUA 2WULA 4TR3A 4YAVA 1GSEA 2FWGA 4HZ2A 3BD2A 1M0UA 3WGEA 2B3SA 4K7IA 1V58A 2MBSA 1FAAA 5DCHA 4OO4A 4NPBA 3FRCA 1ABAA 1R7HA 3QFBC 1KEBA 7GSSA 3C7MA 5H5QA 3F4RA 4ID0A 3HY2A 4X43A 4CW9A 1X5DA 3TRPA 2DKIA 2K8SA 2R6KA 4V2NA 1PD21 2PMTA 3VFIA 1MEKA 2FY6A 1W4VA 3O76A 4P3YB 1XW5A 4FQUA 2BTOT 2HXKA 5LCZA 4NXIA 2PERA 1O81A 3DVXA 5IPHA 2L5LA 3F0IA 1A23A 4DVCA 3I43A 3HD5A 3ERWA 4FYCA 4AI6A 1PSQA 1BF5A 2YZHA 1TI1A 3FYGA 5J4VA 2P0GA 3DVWA 3FR3A 1V57A 1ML6A 5ECHB 4OFMA 1QQ2A 3DIEA 4OFNA 2GGTA 2F51A 3VK9A 2GZPA 5GSSA 4KAEA 5IIZA 6GSWA 4K2XA 2QC7A 2GSQA 2LRTA 3D4TA 1U6TA 3HJOA 2V32A 5DDLA 4QL9A 5GZZB 5JWOB 4LLRA 1SK0A 4BVYA 4I8BA 4CHSA 3EMPA 2IMEA 1B9YC 3LORA 2RM5A 3QFAC 4HUAA 3M9JA 1Y6EA 1A2MA 3G7YA 1FW1A 4L5LA 5CRGA 2GT6A 4TXVA 1ST9A 4K7OA 1TKDB 4WR5A 4CY8A 4RI7A 1RQMA 4ACSA 1QFNA 5AN1A 2VM2A 2MBTA 4ZL8A 3QAWA 5B7CA 2G2QA 5HFGA 2H6XA 4GQCA 10GSA 2GT5A 3KGKA 2PBJA 1ERVA 4MNNA 3KTBA 2A2PA 4RI6A 3ZVJA 5GSTA 5EVOA 3NOFA 1FO5A 1QGVA 1T7PB 2GQLA 4JEDA 1XFLA 1THOA 3SWLA 1SJIA 1EOGA 3IK9A 4FYBA 4YQVA 3HJMA 3FZAA 5H5SA 4YAPA 2B1KA 3KP9A 2LQOA 3RHCA 2HZEB 4ZBBA 2WRTA 1UVZA 2DIZA 2N5AA 2RM6A 2JU5A 4NAXA 3KIJA 2MYGA 5KN1A 2H6YA 2EC4A 2O5VA 1XZOA 1ERUA 3O6TA 1PQNA 4XS6A 1E2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HA9 A;  5HFK A;  5G2Z A;  4I6X A;  2IN3 A;  1YKA A;  2LQQ A;  4MH2 A;  3VWX A;  2H01 A;  3HVV A;  4IGJ A;  1ZGN A;  3VUR A;  4XHM A;  4V2M A;  2LRC A;  3ZLP A;  3KZQ A;  3UAR A;  3TB2 A;  4MF7 A;  3BCK A;  5G30 A;  2QKE A;  1AC1 A;  3W8S A;  5CRW A;  2UZ8 A;  2V41 A;  2G0F A;  1GSY A;  2X8H A;  1TXX A;  1SL1 B;  1Z3E A;  4AJ8 A;  3LWA A;  4JZQ A;  5IOX A;  1XVW A;  4NV5 A;  2H8L A;  3HCZ A;  2IMF A;  5KN0 A;  5GAN D;  1NSW A;  3ZMK A;  1XBS A;  1GSD A;  1AQX A;  2GS3 A;  2H73 A;  2IIY A;  1B4Q A;  1Q98 A;  2CZ2 A;  2A2S A;  1YY7 A;  2AYT A;  3EMX A;  1WWJ A;  3DXB A;  1XOB A;  2C3N A;  3TCO A;  1V40 A;  2DSA A;  4EC0 A;  1C72 A;  3AY8 A;  5G5E A;  4IN0 A;  5IM9 A;  5ENU A;  2YAN A;  4PNF A;  2CQ9 A;  2ES7 A;  2HZE A;  4MLY A;  4JR4 A;  1XOA A;  1GUL A;  4YQU A;  3WD6 A;  2FA8 A;  3NIV A;  3Q6O A;  1VF3 A;  2H0I A;  4NHW A;  5D9V A;  4JU5 A;  2YPM A;  22GS A;  1TK8 B;  3MSZ A;  3JCM L;  3F6F A;  3EU3 A;  5CO3 A;  5KEJ A;  2OAC A;  2H19 A;  1TU8 A;  1O85 A;  3GH9 A;  2FD3 A;  1T00 A;  5DJM A;  4F0C A;  3UL3 A;  5EL8 A;  2LKU A;  4O32 A;  3DYR A;  4F0B A;  3GV1 A;  3IHQ A;  1NHO A;  3I9V 2;  3RAZ A;  1T3B A;  4KGI A;  4KX4 A;  4BL7 B;  2YOI A;  1K0M A;  3ZFB A;  3IC8 A;  2B7K A;  4MJB A;  1K0D A;  1TRU A;  2FUG 2;  13GS A;  4IQ1 A;  1SK1 A;  3GST A;  2GZZ A;  3UAP A;  2YNX A;  5AIV A;  4HOJ A;  2B5E A;  1VRS D;  3A5W A;  4XS4 B;  1WIK A;  1OE7 A;  3HZ8 A;  2E2M A;  1CQH A;  4BPY A;  4PXO A;  2C4J A;  1M9A A;  4BWQ A;  4HDE A;  3C1R A;  2EIQ A;  2LRN A;  3GUR A;  2IMD A;  4ZXG A;  1FVK A;  3WT1 A;  1ZL9 A;  3KXO A;  1O8W A;  3PIN A;  4KCE A;  3P2A A;  1ZYQ B;  2GDR A;  2HRA A;  4USS A;  4IS0 A;  4EVM A;  2DC5 A;  2H1D A;  1T4Z A;  3M0F A;  2MMN A;  3EWL A;  1K0A A;  3ZVJ D;  2VM1 A;  3H4K A;  1X5E A;  2B1L A;  1WPI A;  4MDC A;  3L0H A;  4EF0 A;  3F9U A;  2DMM A;  2O7K A;  3RPP A;  5D73 A;  4KND A;  3LXZ A;  4MF6 A;  2R2J A;  4DSQ A;  4JRR A;  3F63 A;  2FNO A;  1M7T A;  2V6O A;  1GNE A;  3FKF A;  3G7J A;  4I2U A;  2XPD A;  3IDV A;  5F07 A;  5BMU A;  1USB A;  6GSV A;  1TU7 A;  5IO2 A;  2XPE A;  4Q5F A;  3HXS A;  3TJB A;  2QGV A;  4IVF A;  1M2B A;  4GF0 A;  4BL7 A;  2TIR A;  4IHU A;  3ZIJ A;  3Q74 A;  3N5O A;  2VCQ A;  1Z6N A;  1TTZ A;  4PX1 A;  4YH2 A;  2B5Y A;  4GRF A;  4ECB A;  5CYY A;  1BED A;  2YZU A;  3C8E A;  5IMZ A;  2YWI A;  1SD8 A;  1O7U A;  1EWX A;  4XS4 A;  4LL1 B;  4PUR A;  2F8F A;  3J7Y k;  4G2E A;  1XWB A;  4IW9 A;  5CRH A;  5IMA A;  2JZR A;  4E8E A;  4KCA A;  3BJ5 A;  4POK A;  1JZW A;  4HU9 A;  3F4T A;  1F37 A;  2BMX A;  2HSH A;  3ME7 A;  1J08 A;  4OWY A;  4RQX A;  4IKH A;  1ZCP A;  4J57 E;  4PQI A;  2WB9 A;  5FHI A;  3ME8 A;  3GYK A;  12GS A;  1SYR A;  2ALB A;  2KP2 A;  5ELG A;  3LYK A;  4JE1 A;  3U6V A;  3LGC A;  2WCI A;  2P5Q A;  1TOF A;  1PX6 A;  2Z9S A;  4KB3 A;  5DQY A;  2VUP A;  5B6N A;  4MK3 A;  3TRX A;  2F9S A;  3IAS 2;  1X9S B;  2CX3 A;  2B6M A;  4DSR A;  2XC2 A;  3IBH A;  5L71 A;  3CTF A;  5CP1 A;  3I69 A;  3D22 A;  5C04 A;  1HNB A;  5HR1 A;  1Z7R A;  1PGT A;  1OKD A;  1DE2 A;  3H1N A;  1A8Y A;  4HS1 A;  1GUK A;  1UN2 A;  3GNJ A;  3KCM A;  4K6X A;  3D6I A;  3QOU A;  3US3 A;  4NV2 A;  4MJA A;  1EGO A;  3D0Z A;  1XW9 A;  2WS2 A;  2VL3 A;  4MPG A;  3C1S A;  4GSN A;  3FY7 A;  3VPQ A;  2C0G A;  3IPZ A;  3LJR A;  5A4W A;  1WJK A;  2LNT A;  2NPB A;  5F06 A;  2M80 A;  3CSI A;  4WBJ A;  1GP1 A;  5KN3 A;  3QAV A;  2QSI A;  2WGR A;  4K8M A;  1EGR A;  3TKP A;  1RW1 A;  2P5R A;  3KM6 A;  1SJ6 A;  2K6V A;  3CYN A;  1OKT A;  2GST A;  1Z9H A;  5ECI B;  1S3D A;  2L6D A;  3GRX A;  4F03 A;  3FR9 A;  2N5B A;  4FIW A;  4MF5 A;  3VWW A;  5B8A A;  2A4V A;  3H79 A;  3E3E A;  4G10 A;  1R26 A;  5INY A;  1QUW A;  2PUK C;  4K9Z A;  1OE8 A;  4WF5 A;  4MAB A;  1YQ1 A;  5HFI A;  3OR5 A;  4EDZ A;  3ED3 A;  3UOM A;  1YF1 A;  3VWV A;  3FZ9 A;  2M46 A;  1AUC A;  1O6J A;  2DJ1 A;  2FWE A;  1U87 A;  1E6B A;  3ERF A;  2WFC A;  1BG5 A;  17GS A;  2TRC P;  4K0G A;  4KSO A;  3CMI A;  2GTU A;  2NBS A;  1ZZY A;  1XWA A;  2IWT A;  2VD1 A;  2D2Z A;  1TRW A;  1OC9 A;  2FCH A;  4HEA 2;  3IXR A;  2H1A A;  4ZB8 A;  3BCI A;  3LG6 A;  3GKK A;  4I5Q A;  3KMN A;  2PWJ A;  1GTI A;  4ULX A;  4XRA A;  14GS A;  5ECM B;  1SL0 B;  1ERT A;  3U5R E;  5JWR B;  4POB A;  3M1G A;  2ON5 A;  2HZF A;  4BA7 A;  1PKW A;  4YQM A;  6GSS A;  2LJR A;  1XCC A;  2JSY A;  2HT9 A;  3CXG A;  2MMA A;  4KDX A;  1DBY A;  2CAQ A;  2KUC A;  1URM A;  3ZFL A;  3S9F A;  1ON4 A;  3C71 A;  4L0W A;  5LNK e;  1Z6M A;  5D9T A;  2IJY A;  4IEL A;  5D9X A;  3IAM 2;  2DJK A;  3GH6 A;  1EZK A;  3KTL A;  1F6M C;  3DGQ A;  4IJ3 A;  2YWN A;  2OA7 A;  2P31 A;  4O5R A;  1KNG A;  2PGT A;  2IL3 A;  4PUA A;  4TN8 A;  4MMM A;  4Q5N A;  5LD0 A;  3EUR A;  1SJZ A;  2R37 A;  2VOC A;  1GTU A;  3GHA A;  2LJK A;  1GUM A;  4ECI A;  4GWR A;  3SBC A;  1THX A;  1K0B A;  4NWY A;  1PKZ A;  1JZR A;  2R4V A;  4OFT A;  1QK8 A;  1H4O A;  2VL2 C;  5IMV A;  2AV4 A;  1AXD A;  3GSS A;  1B8X A;  2JSZ A;  1JLV A;  4QQ7 A;  1A2J A;  4HJ2 A;  4V1A p;  4O92 A;  3VLN A;  2B5X A;  3PPU A;  1G6W A;  2IMI A;  3WT2 A;  1PRX A;  2OE3 A;  4XTS A;  2YV7 A;  2YWM A;  5JCU A;  1B48 A;  2LST A;  5ECK B;  1EP8 A;  3GKM A;  3UMA A;  1BAY A;  1FB6 A;  1JZO A;  3O3T A;  2LS5 A;  3ZYW A;  2V6K A;  1YEP A;  3L4N A;  4EKZ A;  3HVS A;  1Z5Y E;  3KJY A;  5D93 A;  1GUH A;  2FWF A;  3TJF A;  3GUS A;  4EUY A;  1Z7P A;  1B9X C;  2RUE A;  3UIW A;  3A2W A;  5G5F A;  4Q5Q A;  2KLX A;  4IP6 A;  1B4P A;  1F3A A;  2C1Y A;  1AQV A;  4IP1 A;  1YF0 A;  2VO4 A;  3TKR A;  3WGD A;  2CVD A;  2RII A;  2KHP A;  4POM A;  2DJ3 A;  4TKY A;  4PNG A;  1M9B A;  2L6C A;  4G0I A;  2CV4 A;  4N10 A;  1YDK A;  5ID2 B;  4KUN A;  1ILO A;  1S3C A;  3GN3 A;  2YV9 A;  2KOK A;  4ZBD A;  3KP8 A;  5J9C A;  2LTK A;  4ECJ A;  5JCG A;  3TKS C;  3TRQ A;  2WZ9 A;  3IA1 A;  3IOS A;  2DBC A;  2MMZ A;  1K0C A;  3VI5 A;  2NVL A;  4X1U A;  4OD7 A;  1OC8 A;  2AAW A;  2OBK A;  4BVX B;  2FGX A;  2F8A A;  2X8G A;  1GH2 A;  1NHY A;  3RDW A;  1EP7 A;  3QR6 A;  3VPT A;  1DE1 A;  2GQM A;  3UBK A;  2VLV A;  3LXT A;  1IYI A;  2N5F A;  11GS A;  2K18 A;  3QAG A;  4V2L A;  4EO3 A;  5ABR A;  4WET A;  2GSS A;  5J9B A;  1XVQ A;  2O85 A;  3VWU A;  4IJI A;  4GST A;  3CSJ A;  1GSU A;  2ZNM A;  1V2A A;  4KF9 A;  5JCW A;  4IQA A;  2CT6 A;  1PMT A;  1X5C A;  2REM A;  4OO5 A;  2CVB A;  4TXO B;  4LMV A;  3P90 A;  1G7O A;  3LSZ A;  1TJD A;  3UVH A;  3Q18 A;  4K0N A;  1K0N A;  1PN9 A;  3H93 A;  2XHF A;  5ECL B;  2HRK B;  1J0F A;  3W6G A;  4KE3 A;  2C3Q A;  1M2A A;  2L5O A;  3IRA A;  4XS1 A;  3ZL5 A;  2H1B A;  3GX0 A;  5DCG A;  1ZYE A;  5E4W A;  3KMO A;  1VGL A;  2OE0 A;  4D73 B;  4PQH A;  2J23 A;  1TI3 A;  1XIY A;  1G7E A;  1MTC A;  2C0D A;  3UJ1 A;  3ZIT A;  1SYX A;  3F3Q A;  3TGZ A;  1YJ6 A;  5J3R A;  5ID2 A;  2VCT A;  2EIO A;  5C00 A;  3ZRD A;  4G0L A;  1MDK A;  1MDI A;  1JZD A;  4L0U A;  1BQ7 A;  1T8E B;  3GKN A;  4MH3 A;  1FB0 A;  4ML6 A;  2JZS A;  1CQG A;  4ZBA A;  3NZN A;  2GSR A;  6GST A;  2GQK A;  4DEJ A;  3QPM A;  3HHV A;  3GKX A;  3E0U A;  2O8V B;  2PPT A;  4BVX A;  1N2A A;  4BWS A;  2C3T A;  4N30 A;  1RK4 A;  5FT3 A;  4F9Z A;  4TW5 A;  3EIN A;  1AIU A;  2YN1 A;  3TUE A;  1ZMA A;  4HU7 A;  1KBN A;  2FLS A;  3L9U A;  3A2X A;  3EVI A;  1M99 A;  3GIX A;  3MNG A;  1LBK A;  2VIM A;  1VF4 A;  3IV4 A;  4HQZ A;  1W89 A;  3APS A;  2NDO A;  3CRU A;  3DRN A;  5CAX A;  1VF1 A;  1K3O A;  1A2L A;  1BJX A;  5ECN B;  3UEM A;  3KD0 A;  1A24 A;  1K3Y A;  3G9B A;  1OC3 A;  1WE0 A;  1QMV A;  4TR4 A;  4TXO A;  1AW9 A;  3Q19 A;  2ON7 A;  1O8X A;  4ZB9 A;  3WGX A;  4KA0 A;  1HD2 A;  3HYP A;  1TRV A;  3ZRE A;  3ZML A;  1XPV A;  2HRK A;  4K1F A;  5J41 A;  3GL3 A;  4NHZ A;  1O73 A;  3ZZX A;  4KH7 A;  4H86 A;  2OAD A;  2WDU A;  2HI7 A;  4AJ7 A;  3A2V A;  1WP0 A;  4D73 A;  4LL4 B;  3BBY A;  1WRY A;  3L9V A;  1R4W A;  2B7J A;  2L57 A;  3D21 A;  2DJJ A;  2H0G A;  4KDY A;  3GL5 A;  3M8N A;  2YWO A;  1OC9 B;  4HQS A;  1GLP A;  1M2D A;  3APO A;  2I81 A;  5DAK B;  4GLT A;  2L4C A;  1SKW B;  2VLT A;  4PUF C;  1SL2 B;  1H75 A;  2VL2 A;  1A0R P;  1BX9 A;  4RQR A;  4MZB A;  2L59 A;  8GSS A;  1X0R A;  3MDK A;  2YJ7 A;  3FHK A;  1K0O A;  4FH8 A;  4OCE A;  1A8L A;  5HR2 A;  2A2R A;  3EC3 A;  5ECR B;  4K7N A;  1EOH A;  5JWQ B;  1U3I A;  2C80 A;  1ERW A;  3TJK A;  1XWC A;  1PX7 A;  3HZ4 A;  2YJH A;  3L78 A;  4ECC A;  3H8Q A;  2C0F A;  2IMK A;  2R5G A;  2YP6 A;  3TJG A;  1WOU A;  3LQ7 A;  3DML A;  4WBR D;  2O87 A;  2H76 A;  2FA4 A;  3QMX A;  3KH9 A;  20GS A;  2HSY A;  3QD9 A;  2HSN B;  1Q4J A;  4EDY A;  3R3E A;  1WMJ A;  4F2I A;  2HSM B;  3PGT A;  3K8N A;  1TK5 B;  2JL4 A;  2XBI A;  1DSB A;  3HDC A;  1G6Y A;  1LJR A;  2JAC A;  4ZL9 A;  1UA5 A;  5CNW A;  4G9H A;  3J7Y b;  3PH9 A;  1MDJ A;  1N8J A;  1TW9 A;  2LV3 A;  2CZ3 A;  2H72 A;  3TKS A;  3DEX A;  1HNA A;  2I1U A;  2PN8 A;  3IC4 A;  4KW6 A;  4J2F A;  1SK2 A;  5AIX A;  2VCX A;  3DD3 A;  1GTA A;  5HQP A;  5A4V A;  1I5G A;  3KEB A;  1F3B A;  1V98 A;  3G7I A;  2C0E A;  2IPA A;  1PA3 A;  1MD4 A;  2RLI A;  3IE3 A;  1G0T A;  5DAK A;  3HVX A;  1AQW A;  4ZIJ A;  2K8V A;  4TOP A;  4IBP A;  3HJP A;  3QDN A;  3R2Q A;  2XBQ A;  6GSY A;  1AAZ A;  3FZ5 A;  2LNS A;  5F0G A;  4TR1 B;  3P8W A;  4XCS A;  2AHE A;  1EEJ A;  4MP4 A;  5AIS A;  2VCV A;  1GSQ A;  3APQ A;  4MJE A;  5DQS A;  5A4U A;  5J5N A;  2V2G A;  1FOV A;  3CTG A;  2R3X A;  1FVJ A;  1TDI A;  2PVO C;  1YZX A;  1NW2 A;  4K2D A;  2H1G A;  2H30 A;  2J9H A;  4L5O A;  1DUG A;  1EEM A;  5AGY A;  2NTO A;  2H66 A;  4ZIL A;  5ECS A;  3UBL A;  2AJQ B;  2KP1 A;  5HR3 A;  3EE2 A;  3RHB A;  3TKQ A;  4ML1 A;  2M72 A;  1GRX A;  2F3M A;  1SD9 A;  1SKS B;  3IK7 A;  1HQO A;  1J9B A;  2CVK A;  1TRS A;  1YKC A;  4MZC A;  2H71 A;  9GSS A;  3GFK A;  4PTS A;  5GAP D;  4GSS A;  1R5P A;  1Y25 A;  4MA9 A;  5IOW A;  5A5K A;  6GSU A;  3VI7 A;  1I9D A;  4GXZ A;  4EXJ A;  2HSM A;  4GQF A;  4EE0 A;  3EYT A;  5DAL B;  5E59 A;  2RUF A;  1EV9 A;  4I2T A;  4MCU A;  5KN2 A;  1EV4 A;  5IQY A;  4PGT A;  2E2G A;  3ISO A;  4HZ4 A;  4MJC A;  1OAZ A;  4GCI A;  2DLX A;  2IFQ B;  1OYJ A;  5J4U A;  5ECQ B;  2GZY A;  4MZW A;  5D9W A;  4EL1 A;  3EU4 A;  2L4Q A;  3FK8 A;  4G0K A;  3F4S A;  1U88 A;  19GS A;  2X8C A;  4ISD A;  1GSF A;  3F6D A;  5ECP B;  3P7X A;  1GLQ A;  4G19 A;  3ZIV A;  2OBI A;  4I97 A;  2MMO A;  4QL7 A;  1GL8 A;  2VLU A;  2H0H A;  2V1M A;  4TVE A;  3V1W A;  3QCP A;  4V1A g;  1ZOF A;  3TJJ A;  4WKW A;  2C8U A;  4N0V A;  3RBT A;  4JBB A;  2BJX A;  4TR1 A;  3GTU B;  2LUS A;  1V9W A;  2GVP A;  4KSM A;  2VAF A;  2HQT A;  1U3A A;  5B6M A;  3KH7 A;  4F82 A;  1OVN A;  1NM3 A;  4ILF A;  4WEY A;  4HJM A;  5G31 A;  3MWH A;  3D5J A;  1A0F A;  4ZL7 A;  2VCZ A;  3TKS E;  4FYU A;  5IMF A;  2GLR A;  2I3Y A;  3HKR A;  4JR6 A;  3A3T A;  3DKS A;  3M9K A;  2K9F A;  2X99 A;  2DJ2 A;  1JFU A;  4WR4 A;  2HFD A;  1GWC A;  1X9M B;  2ZUP A;  3LFL A;  1GTB A;  3I6A A;  2FWH A;  5DVB A;  1TK0 B;  2HNL A;  4RUV A;  1T4Y A;  2VL9 A;  3FW2 A;  2OJL A;  5ELA A;  5EPF A;  3TOT A;  2HLS A;  3TDG A;  1GSS A;  5DAL A;  4N11 A;  1K3L A;  4N0Z A;  1PL1 A;  5IMC A;  2CA8 A;  3C73 A;  1LU4 A;  4POL A;  2H74 A;  1PL2 A;  3ERG A;  6GSX A;  2HRN A;  1KTE A;  1QXH A;  2IFQ A;  3WYW A;  4XIH A;  4OCF A;  2HRF A;  2HE3 A;  3CBU A;  2I9H A;  3LEF A;  2DML A;  2AUV A;  4GTU A;  4X0X A;  2VCW A;  3UVT A;  4Z7X A;  2E0Q A;  5COH A;  5H5R A;  16GS A;  5F8B A;  2WJU A;  5B8B A;  2LEG A;  3TOU A;  2VD0 A;  2H70 A;  1JHB A;  3GTU A;  4KDU A;  4TRX A;  4Q5R A;  3M3M A;  5IO0 A;  4TR0 A;  4DSS B;  5HR0 A;  3GX8 A;  5F05 A;  3CSH A;  5FWG A;  1XWG A;  3LYP A;  4J56 E;  4LMW A;  3DWV A;  1HYU A;  2HYX A;  5D96 A;  5D8I A;  3L9S A;  4O7H A;  1GNW A;  1ACV A;  2H75 A;  2LJA A;  1X9W B;  3MAK A;  2FHE A;  1XW6 A;  4AJ6 A;  2PVQ A;  1SU9 A;  4L8E A;  4FO5 A;  4MPF A;  2MZC A;  4WF4 A;  2JZT A;  1MD3 A;  5G1K A;  3W8J A;  4AF2 A;  4CDO A;  3BOA A;  3D4M A;  1YEX A;  1BYE A;  3GMF A;  5DBQ A;  2ZCT A;  3F3R A;  4LA1 A;  1FG4 A;  3F8U A;  1S3A A;  1IYH A;  1XXU A;  2EIR A;  2DJ0 A;  1UC7 A;  2I4A A;  5DJL A;  3GA4 A;  1FHE A;  3FR6 A;  4ZB6 A;  5ECO B;  2CAI A;  1TP9 A;  2O89 A;  4WXT A;  1F9M A;  4HI7 A;  2AB6 A;  2CX4 A;  5IPG A;  1SKR B;  1VF2 A;  2E7P A;  3FZ4 A;  5EY6 A;  4AGS A;  5CRD A;  2YCD A;  1SEN A;  1R5A A;  2H6Z A;  5G1L A;  3CRT A;  1JLW A;  5CRE A;  2OE1 A;  2DIY A;  3IR4 A;  1F2E A;  5IMD A;  18GS A;  2X64 A;  3PR8 A;  3E9J B;  3N9J A;  4OMV A;  3FEU A;  1T1V A;  3RPN A;  1XWK A;  4E8H A;  2PU9 C;  4BVY B;  2OKA A;  3ZTL A;  2TRX A;  4DSS A;  4XRD A;  1HNC A;  2JAD A;  4PQ1 A;  4NMU A;  2WUL A;  4TR3 A;  4YAV A;  1GSE A;  2FWG A;  4HZ2 A;  3BD2 A;  1M0U A;  3WGE A;  2B3S A;  4K7I A;  1V58 A;  2MBS A;  1FAA A;  5DCH A;  4OO4 A;  4NPB A;  3FRC A;  1ABA A;  1R7H A;  3QFB C;  1KEB A;  7GSS A;  3C7M A;  5H5Q A;  3F4R A;  4ID0 A;  3HY2 A;  4X43 A;  4CW9 A;  1X5D A;  3TRP A;  2K8S A;  2R6K A;  4V2N A;  1PD2 1;  2PMT A;  3VFI A;  1MEK A;  2FY6 A;  1W4V A;  3O76 A;  4P3Y B;  1XW5 A;  4FQU A;  2BTO T;  2HXK A;  5LCZ A;  4NXI A;  2PER A;  1O81 A;  3DVX A;  5IPH A;  2L5L A;  3F0I A;  1A23 A;  4DVC A;  3I43 A;  3HD5 A;  3ERW A;  4FYC A;  1PSQ A;  2YZH A;  1TI1 A;  3FYG A;  2P0G A;  3DVW A;  3FR3 A;  1V57 A;  1ML6 A;  5ECH B;  4OFM A;  1QQ2 A;  3DIE A;  4OFN A;  2GGT A;  2F51 A;  3VK9 A;  2GZP A;  5GSS A;  4KAE A;  5IIZ A;  6GSW A;  2QC7 A;  2GSQ A;  2LRT A;  3D4T A;  1U6T A;  3HJO A;  2V32 A;  5DDL A;  4QL9 A;  5GZZ B;  5JWO B;  4LLR A;  1SK0 A;  4BVY A;  4I8B A;  4CHS A;  3EMP A;  2IME A;  1B9Y C;  3LOR A;  2RM5 A;  3QFA C;  4HUA A;  3M9J A;  1Y6E A;  1A2M A;  3G7Y A;  1FW1 A;  4L5L A;  5CRG A;  2GT6 A;  4TXV A;  1ST9 A;  4K7O A;  1TKD B;  4WR5 A;  4RI7 A;  1RQM A;  4ACS A;  1QFN A;  5AN1 A;  2VM2 A;  2MBT A;  4ZL8 A;  3QAW A;  5B7C A;  2G2Q A;  5HFG A;  2H6X A;  4GQC A;  10GS A;  2GT5 A;  3KGK A;  2PBJ A;  1ERV A;  3KTB A;  4RI6 A;  3ZVJ A;  5GST A;  5EVO A;  3NOF A;  1FO5 A;  1QGV A;  1T7P B;  2GQL A;  4JED A;  1XFL A;  1THO A;  3SWL A;  1SJI A;  1EOG A;  3IK9 A;  4FYB A;  4YQV A;  3HJM A;  3FZA A;  5H5S A;  4YAP A;  2B1K A;  3KP9 A;  2LQO A;  3RHC A;  2HZE B;  4ZBB A;  2WRT A;  1UVZ A;  2DIZ A;  2N5A A;  2RM6 A;  2JU5 A;  4NAX A;  3KIJ A;  2MYG A;  5KN1 A;  2H6Y A;  2EC4 A;  1XZO A;  1ERU A;  3O6T A;  1PQN A;  4XS6 A;  1E2Y A; 
#chains in the Genus database with same CATH topology
 3HA9 A;  5HFK A;  5G2Z A;  4I6X A;  2IN3 A;  1YKA A;  1Y1U A;  2LQQ A;  2R0G A;  4MH2 A;  3VWX A;  2H01 A;  3HVV A;  4IGJ A;  1ZGN A;  3VUR A;  4XHM A;  4V2M A;  3LW9 A;  2LRC A;  3ZLP A;  3KZQ A;  3UAR A;  3TB2 A;  4MF7 A;  3BCK A;  5G30 A;  2QKE A;  1AC1 A;  3W8S A;  1PN0 A;  5CRW A;  2UZ8 A;  2V41 A;  2G0F A;  1GSY A;  2X8H A;  1TXX A;  5A1N A;  1SVO A;  1SL1 B;  1Z3E A;  4AJ8 A;  3LWA A;  4JZQ A;  5IOX A;  1XVW A;  4NV5 A;  2H8L A;  3HCZ A;  2IMF A;  5KN0 A;  5GAN D;  1NSW A;  3ZMK A;  1XBS A;  1GSD A;  1AQX A;  2GS3 A;  2H73 A;  2IIY A;  1B4Q A;  1Q98 A;  2CZ2 A;  2A2S A;  1YY7 A;  2AYT A;  5A5H B;  2EFE A;  3EMX A;  1WWJ A;  3DXB A;  1XOB A;  4YKG A;  2C3N A;  3TCO A;  1V40 A;  1SVM A;  2DSA A;  4EC0 A;  1C72 A;  3AY8 A;  5G5E A;  4IN0 A;  5IM9 A;  5ENU A;  2YAN A;  4PNF A;  2CQ9 A;  2ES7 A;  2HZE A;  4MLY A;  4JR4 A;  1XOA A;  1GUL A;  4YQU A;  3WD6 A;  2FA8 A;  3NIV A;  3Q6O A;  1VF3 A;  2H0I A;  4NHW A;  5D9V A;  4JU5 A;  2YPM A;  22GS A;  1TK8 B;  3MSZ A;  5J40 A;  1ZYN A;  3JCM L;  3F6F A;  3EU3 A;  5CO3 A;  5KEJ A;  2OAC A;  2H19 A;  1TU8 A;  1O85 A;  3GH9 A;  2FD3 A;  1T00 A;  5DJM A;  4FXY P;  4F0C A;  3UL3 A;  5EL8 A;  2LKU A;  4O32 A;  3DYR A;  4F0B A;  3GV1 A;  3IHQ A;  1NHO A;  3I9V 2;  3RAZ A;  1T3B A;  4KGI A;  4KX4 A;  4BL7 B;  2YOI A;  1K0M A;  3ZFB A;  3IC8 A;  2B7K A;  4MJB A;  1K0D A;  1TRU A;  2FUG 2;  4PI0 C;  13GS A;  4IQ1 A;  1SK1 A;  3GST A;  2GZZ A;  3UAP A;  2YNX A;  5AIV A;  4HOJ A;  2B5E A;  4X4J A;  1VRS D;  3A5W A;  4XS4 B;  1WIK A;  1OE7 A;  4GDF A;  3HZ8 A;  2E2M A;  1CQH A;  4BPY A;  4PXO A;  2C4J A;  1M9A A;  4BWQ A;  4HDE A;  3C1R A;  2EIQ A;  2LRN A;  3GUR A;  2IMD A;  4ZXG A;  1FVK A;  3WT1 A;  1ZL9 A;  3KXO A;  1O8W A;  3PIN A;  4KCE A;  3P2A A;  1ZYQ B;  2GDR A;  2HRA A;  4USS A;  4IS0 A;  4EVM A;  2DC5 A;  2H1D A;  1T4Z A;  3M0F A;  2MMN A;  2WVZ A;  3EWL A;  1K0A A;  3ZVJ D;  2VM1 A;  3H4K A;  1X5E A;  2B1L A;  1WPI A;  4MDC A;  3L0H A;  4EF0 A;  3F9U A;  2DMM A;  2O7K A;  3RPP A;  5D73 A;  4KND A;  3LXZ A;  4MF6 A;  2R2J A;  4DSQ A;  4JRR A;  3F63 A;  2FNO A;  2WW3 A;  1M7T A;  2V6O A;  1GNE A;  3FKF A;  3G7J A;  4I2U A;  2XPD A;  3IDV A;  5F07 A;  5BMU A;  1USB A;  6GSV A;  1TU7 A;  5IO2 A;  2XPE A;  4Q5F A;  3HXS A;  3TJB A;  2QGV A;  4IVF A;  1M2B A;  4GF0 A;  5J4Y A;  4BL7 A;  2TIR A;  4IHU A;  3ZIJ A;  3Q74 A;  3N5O A;  4PHZ C;  2VCQ A;  1Z6N A;  1TTZ A;  4PX1 A;  4YH2 A;  2B5Y A;  4GRF A;  4ECB A;  5CYY A;  1BED A;  2YZU A;  3C8E A;  4W66 A;  5IMZ A;  2YWI A;  1SD8 A;  1O7U A;  1EWX A;  4XS4 A;  4LL1 B;  4PUR A;  2F8F A;  3J7Y k;  4G2E A;  1XWB A;  4IW9 A;  5CRH A;  5IMA A;  2JZR A;  4E8E A;  4KCA A;  3BJ5 A;  4POK A;  1JZW A;  4HU9 A;  1XG8 A;  3F4T A;  1F37 A;  2BMX A;  2HSH A;  3ME7 A;  1J08 A;  4OWY A;  4O5U A;  4RQX A;  4IKH A;  1ZCP A;  4J57 E;  4PQI A;  3EPT A;  2WB9 A;  5FHI A;  3ME8 A;  3GYK A;  12GS A;  1SYR A;  4Z2T A;  2ALB A;  2KP2 A;  5ELG A;  3LYK A;  4JE1 A;  2UV8 G;  3U6V A;  3LGC A;  2WCI A;  2P5Q A;  1TOF A;  1PX6 A;  2Z9S A;  3MYD A;  4KB3 A;  5DQY A;  3CWG A;  2VUP A;  4O5Q A;  5B6N A;  4MK3 A;  3TRX A;  2F9S A;  3IAS 2;  1X9S B;  2CX3 A;  2B6M A;  4DSR A;  2XC2 A;  3IBH A;  5L71 A;  3CTF A;  5CP1 A;  3I69 A;  4PI2 C;  3D22 A;  5C04 A;  1HNB A;  5HR1 A;  4QMK A;  1Z7R A;  1PGT A;  1OKD A;  1DE2 A;  4YKF A;  3H1N A;  1A8Y A;  4HS1 A;  3RGB C;  1GUK A;  1UN2 A;  3GNJ A;  3KCM A;  4K6X A;  3D6I A;  3QOU A;  3US3 A;  4NV2 A;  4MJA A;  4G01 A;  1EGO A;  3D0Z A;  1XW9 A;  2WS2 A;  2VL3 A;  4MPG A;  3C1S A;  4GSN A;  3FY7 A;  3VPQ A;  2C0G A;  3IPZ A;  3LJR A;  5A4W A;  1WJK A;  2LNT A;  2NPB A;  5F06 A;  2M80 A;  1BG1 A;  3CSI A;  4WBJ A;  1GP1 A;  5KN3 A;  3QAV A;  2QSI A;  2WGR A;  4K8M A;  1EGR A;  3TKP A;  1RW1 A;  2P5R A;  3KM6 A;  1SJ6 A;  2K6V A;  4AKX B;  3CYN A;  1OKT A;  2GST A;  1Z9H A;  5ECI B;  1S3D A;  2L6D A;  3GRX A;  4F03 A;  3FR9 A;  2N5B A;  4FIW A;  4MF5 A;  3VWW A;  5B8A A;  2A4V A;  3H79 A;  3E3E A;  4G10 A;  1R26 A;  5INY A;  1QUW A;  2PUK C;  4K9Z A;  1OE8 A;  4WF5 A;  4MAB A;  1YQ1 A;  5HFI A;  3OR5 A;  4EDZ A;  5A1N B;  3ED3 A;  3UOM A;  1YF1 A;  3VWV A;  1N25 A;  3FZ9 A;  2M46 A;  1AUC A;  1O6J A;  2DJ1 A;  2FWE A;  1I1I P;  1U87 A;  1E6B A;  3ERF A;  2WFC A;  1BG5 A;  17GS A;  2TRC P;  4K0G A;  4KSO A;  3CMI A;  2GTU A;  2NBS A;  1ZZY A;  1FOH A;  1XWA A;  2IWT A;  2VD1 A;  1S3R A;  2D2Z A;  1TRW A;  1OC9 A;  2FCH A;  4HEA 2;  3IXR A;  2H1A A;  4ZB8 A;  3BCI A;  3LG6 A;  3GKK A;  4I5Q A;  3KMN A;  2PWJ A;  1GTI A;  4ULX A;  4XRA A;  14GS A;  2O36 A;  5ECM B;  1SL0 B;  1ERT A;  3U5R E;  5JWR B;  4POB A;  3M1G A;  2ON5 A;  2HZF A;  4BA7 A;  1PKW A;  4YQM A;  6GSS A;  2LJR A;  1XCC A;  2JSY A;  2HT9 A;  3CXG A;  2MMA A;  4KDX A;  1DBY A;  2CAQ A;  2KUC A;  1URM A;  3ZFL A;  3S9F A;  1ON4 A;  3C71 A;  4L0W A;  5LNK e;  1Z6M A;  5D9T A;  1TXU A;  2IJY A;  4IEL A;  5D9X A;  3IAM 2;  2DJK A;  3GH6 A;  1ZYP A;  1EZK A;  4BIK A;  3KTL A;  1F6M C;  3DGQ A;  4IJ3 A;  2YWN A;  2OA7 A;  2P31 A;  4O5R A;  1KNG A;  2PGT A;  2IL3 A;  4PUA A;  4TN8 A;  4MMM A;  4Q5N A;  5LD0 A;  3EUR A;  1SJZ A;  2R37 A;  3FMW A;  2VOC A;  1GTU A;  2HSN A;  3GHA A;  2LJK A;  1GUM A;  4ECI A;  4GWR A;  4A5P A;  3SBC A;  1THX A;  1K0B A;  4NWY A;  1PKZ A;  1JZR A;  2R4V A;  4OFT A;  4HSC X;  1QK8 A;  2QA1 A;  1H4O A;  2VL2 C;  5IMV A;  2AV4 A;  1AXD A;  3GSS A;  1B8X A;  2JSZ A;  1JLV A;  4QQ7 A;  1A2J A;  4HJ2 A;  4V1A p;  4O92 A;  3VLN A;  2B5X A;  3PPU A;  1G6W A;  2IMI A;  3WT2 A;  1PRX A;  2EFD A;  2OE3 A;  4XTS A;  2YV7 A;  2YWM A;  5JCU A;  1B48 A;  2LST A;  5ECK B;  1EP8 A;  3GKM A;  3UMA A;  1BAY A;  1FB6 A;  1JZO A;  3O3T A;  2LS5 A;  3ZYW A;  2V6K A;  1YEP A;  3L4N A;  4EKZ A;  3HVS A;  1Z5Y E;  3KJY A;  5D93 A;  1GUH A;  2FWF A;  3TJF A;  3GUS A;  4EUY A;  1Z7P A;  1B9X C;  2RUE A;  3UIW A;  3A2W A;  5G5F A;  4Q5Q A;  2KLX A;  4IP6 A;  1B4P A;  2WVX B;  1F3A A;  2C1Y A;  1AQV A;  4IP1 A;  1YF0 A;  2VO4 A;  3TKR A;  3WGD A;  2CVD A;  2RII A;  2KHP A;  4POM A;  2DJ3 A;  4TKY A;  4PNG A;  1M9B A;  2L6C A;  4G0I A;  2CV4 A;  4N10 A;  1YDK A;  5ID2 B;  4KUN A;  5BMU B;  1ILO A;  1S3C A;  3GN3 A;  2YV9 A;  2KOK A;  4ZBD A;  3KP8 A;  5J9C A;  2LTK A;  4ECJ A;  5JCG A;  3TKS C;  3TRQ A;  2WZ9 A;  2O3E A;  3IA1 A;  3IOS A;  2DBC A;  2MMZ A;  1K0C A;  3VI5 A;  2NVL A;  4X1U A;  4OD7 A;  1OC8 A;  2AAW A;  2OBK A;  4BVX B;  2FGX A;  2F8A A;  2X8G A;  1GH2 A;  1NHY A;  3RDW A;  1EP7 A;  3QR6 A;  5A34 B;  3VPT A;  1DE1 A;  2GQM A;  3UBK A;  2VLV A;  3LXT A;  1IYI A;  2N5F A;  11GS A;  2K18 A;  3QAG A;  4V2L A;  4EO3 A;  5ABR A;  4WET A;  2GSS A;  5J9B A;  1XVQ A;  2O85 A;  3VWU A;  4IJI A;  4GST A;  3CSJ A;  1GSU A;  2ZNM A;  2EFC A;  1V2A A;  4KF9 A;  5JCW A;  4IQA A;  2CT6 A;  1PMT A;  1X5C A;  2REM A;  4OO5 A;  2CVB A;  4TXO B;  4LMV A;  3P90 A;  1G7O A;  3LSZ A;  1TJD A;  3UVH A;  3Q18 A;  4K0N A;  1K0N A;  1PN9 A;  3H93 A;  2QA2 A;  2XHF A;  5ECL B;  2HRK B;  1J0F A;  3W6G A;  4KE3 A;  2C3Q A;  1M2A A;  2L5O A;  3IRA A;  4XS1 A;  3ZL5 A;  2H1B A;  3GX0 A;  5DCG A;  2WVX A;  1ZYE A;  5E4W A;  3KMO A;  1VGL A;  2OE0 A;  4D73 B;  4PQH A;  2J23 A;  1TI3 A;  1XIY A;  1G7E A;  1MTC A;  2C0D A;  3UJ1 A;  3ZIT A;  3RFR C;  1SYX A;  3F3Q A;  3TGZ A;  1S4B P;  1YJ6 A;  5J3R A;  5ID2 A;  2VCT A;  2EIO A;  5C00 A;  3ZRD A;  4G0L A;  1MDK A;  1MDI A;  1JZD A;  4L0U A;  1BQ7 A;  1T8E B;  3GKN A;  4MH3 A;  1FB0 A;  4ML6 A;  2JZS A;  1CQG A;  4ZBA A;  3NZN A;  2GSR A;  6GST A;  2GQK A;  4DEJ A;  3QPM A;  3HHV A;  3GKX A;  3E0U A;  2O8V B;  2PPT A;  4BVX A;  1N2A A;  4BWS A;  2C3T A;  4N30 A;  1RK4 A;  5FT3 A;  4F9Z A;  5A34 A;  4TW5 A;  3EIN A;  1AIU A;  2YN1 A;  3TUE A;  1ZMA A;  4HU7 A;  1KBN A;  4AKI A;  2FLS A;  3L9U A;  3A2X A;  3EVI A;  1M99 A;  3GIX A;  3MNG A;  1LBK A;  2VIM A;  1VF4 A;  3IV4 A;  4HQZ A;  4ZB7 A;  1W89 A;  3APS A;  2NDO A;  3CRU A;  3DRN A;  3HVN A;  5CAX A;  1VF1 A;  1K3O A;  1A2L A;  1BJX A;  5ECN B;  3UEM A;  3KD0 A;  1A24 A;  1K3Y A;  3G9B A;  1OC3 A;  1WE0 A;  1QMV A;  4TR4 A;  4TXO A;  1AW9 A;  3Q19 A;  2ON7 A;  1O8X A;  4ZB9 A;  1YVL A;  3WGX A;  4KA0 A;  1HD2 A;  3HYP A;  1TRV A;  1SVL A;  3ZRE A;  5J47 A;  3ZML A;  1XPV A;  2HRK A;  4K1F A;  5J41 A;  3GL3 A;  4NHZ A;  1O73 A;  3ZZX A;  4KH7 A;  4H86 A;  2OAD A;  2WDU A;  2HI7 A;  4AJ7 A;  3A2V A;  1WP0 A;  4D73 A;  4LL4 B;  3BBY A;  1WRY A;  3L9V A;  1R4W A;  2B7J A;  2L57 A;  3D21 A;  2DJJ A;  2H0G A;  4KDY A;  3GL5 A;  4Z2R A;  3M8N A;  2YWO A;  1OC9 B;  4HQS A;  1GLP A;  1M2D A;  3APO A;  2I81 A;  5DAK B;  4GLT A;  2L4C A;  1SKW B;  2VLT A;  2X4A A;  4PUF C;  4AKG A;  4EIP A;  1SL2 B;  1H75 A;  2VL2 A;  1A0R P;  1BX9 A;  4RQR A;  4MZB A;  2L59 A;  8GSS A;  1X0R A;  3MDK A;  2YJ7 A;  3FHK A;  1K0O A;  4FH8 A;  4OCE A;  1A8L A;  5HR2 A;  2A2R A;  1M3J A;  3EC3 A;  5ECR B;  4K7N A;  1EOH A;  5JWQ B;  1U3I A;  2C80 A;  1ERW A;  3TJK A;  1XWC A;  1PX7 A;  3HZ4 A;  2YJH A;  3L78 A;  4ECC A;  3H8Q A;  2C0F A;  2IMK A;  2R5G A;  2YP6 A;  3TJG A;  1WOU A;  3LQ7 A;  3DML A;  2X49 A;  4WBR D;  2O87 A;  2H76 A;  2FA4 A;  3QMX A;  3KH9 A;  20GS A;  2HSY A;  3QD9 A;  2HSN B;  1Q4J A;  4EDY A;  3R3E A;  1WMJ A;  4F2I A;  2HSM B;  2A4H A;  3PGT A;  3K8N A;  1TK5 B;  2JL4 A;  4AKH A;  2XBI A;  1DSB A;  3HDC A;  1G6Y A;  1LJR A;  2JAC A;  3A5I A;  4ZL9 A;  1UA5 A;  5CNW A;  4G9H A;  3J7Y b;  3PH9 A;  1MDJ A;  1N8J A;  1TW9 A;  2LV3 A;  2CZ3 A;  2H72 A;  3TKS A;  3DEX A;  1HNA A;  2I1U A;  2PN8 A;  3IC4 A;  4KW6 A;  4N3Z A;  4J2F A;  1SK2 A;  5AIX A;  2VCX A;  3DD3 A;  1GTA A;  5HQP A;  5A4V A;  1I5G A;  3KEB A;  1F3B A;  1V98 A;  3G7I A;  2C0E A;  2IPA A;  1PA3 A;  1MD4 A;  2RLI A;  3IE3 A;  1G0T A;  3HMJ G;  5DAK A;  3HVX A;  1AQW A;  4ZIJ A;  2K8V A;  2R0C A;  4TOP A;  4IBP A;  3HJP A;  3QDN A;  4K5R A;  3R2Q A;  2XBQ A;  6GSY A;  2VKZ G;  1AAZ A;  3FZ5 A;  2LNS A;  5F0G A;  4TR1 B;  3P8W A;  4XCS A;  2AHE A;  2H1L A;  1EEJ A;  4MP4 A;  5AIS A;  2VCV A;  1GSQ A;  3APQ A;  4MJE A;  5DQS A;  5A4U A;  5J5N A;  2V2G A;  1FOV A;  3CTG A;  2R3X A;  3IHG A;  1FVJ A;  1TDI A;  2PVO C;  1YZX A;  1NW2 A;  4K2D A;  2H1G A;  2H30 A;  2J9H A;  4L5O A;  1DUG A;  1EEM A;  5AGY A;  2NTO A;  2H66 A;  4ZIL A;  5ECS A;  3UBL A;  2AJQ B;  2KP1 A;  5HR3 A;  5KOX A;  3EE2 A;  3RHB A;  3TKQ A;  4ML1 A;  2M72 A;  1GRX A;  2F3M A;  1SD9 A;  1SKS B;  3IK7 A;  1HQO A;  1J9B A;  2CVK A;  1TRS A;  1YKC A;  4MZC A;  2H71 A;  9GSS A;  3GFK A;  4PTS A;  5GAP D;  4GSS A;  1R5P A;  1Y25 A;  4MA9 A;  5IOW A;  5A5K A;  6GSU A;  3VI7 A;  1I9D A;  4GXZ A;  4EXJ A;  2HSM A;  4GQF A;  4EE0 A;  3EYT A;  5DAL B;  5E59 A;  2RUF A;  1EV9 A;  4I2T A;  4MCU A;  5KN2 A;  1EV4 A;  5IQY A;  4PGT A;  2E2G A;  3ISO A;  4HZ4 A;  4MJC A;  1OAZ A;  4GCI A;  2DLX A;  2IFQ B;  1OYJ A;  5J4U A;  5ECQ B;  2GZY A;  4MZW A;  5D9W A;  4EL1 A;  3EU4 A;  2L4Q A;  3FK8 A;  4G0K A;  3F4S A;  1U88 A;  19GS A;  2X8C A;  4ISD A;  1GSF A;  3F6D A;  5ECP B;  3P7X A;  1GLQ A;  3MIX A;  4G19 A;  3ZIV A;  2OBI A;  4I97 A;  2MMO A;  4QL7 A;  1GL8 A;  2VLU A;  2H0H A;  2V1M A;  4TVE A;  3V1W A;  3QCP A;  4V1A g;  1ZOF A;  3TJJ A;  4WKW A;  2C8U A;  4N0V A;  3RBT A;  3TU3 B;  4JBB A;  2BJX A;  4TR1 A;  3GTU B;  2LUS A;  1V9W A;  2GVP A;  4KSM A;  2VAF A;  2WZS A;  2HQT A;  1U3A A;  5B6M A;  3KH7 A;  4F82 A;  1OVN A;  1NM3 A;  4ILF A;  4E68 A;  4WEY A;  4HJM A;  5G31 A;  3MWH A;  3D5J A;  1A0F A;  4ZL7 A;  2VCZ A;  3TKS E;  4FYU A;  5IMF A;  2GLR A;  2I3Y A;  3HKR A;  4JR6 A;  3A3T A;  3DKS A;  3M9K A;  2K9F A;  2X99 A;  2DJ2 A;  1JFU A;  4WR4 A;  2HFD A;  1GWC A;  1X9M B;  2ZUP A;  3LFL A;  1GTB A;  3I6A A;  2FWH A;  5DVB A;  1TK0 B;  2HNL A;  4RUV A;  1T4Y A;  2VL9 A;  3FW2 A;  2OJL A;  5ELA A;  5EPF A;  3TOT A;  4Z2U A;  2HLS A;  3TDG A;  1GSS A;  5DAL A;  4N11 A;  1K3L A;  4N0Z A;  1PL1 A;  5IMC A;  2CA8 A;  3C73 A;  1LU4 A;  4POL A;  2H74 A;  1PL2 A;  3ERG A;  6GSX A;  2HRN A;  1M3I A;  1KTE A;  1QXH A;  2IFQ A;  3WYW A;  4XIH A;  4OCF A;  2HRF A;  2HE3 A;  2WW2 A;  3CBU A;  2I9H A;  3LEF A;  2DML A;  2AUV A;  4GTU A;  4X0X A;  2VCW A;  3UVT A;  4Z7X A;  2E0Q A;  5COH A;  5H5R A;  16GS A;  5F8B A;  2WJU A;  5B8B A;  2LEG A;  3TOU A;  2VD0 A;  2EFH A;  2R0P A;  2H70 A;  1JHB A;  3GTU A;  4KDU A;  4TRX A;  4Q5R A;  3M3M A;  5A5H A;  5IO0 A;  4TR0 A;  4DSS B;  5HR0 A;  3GX8 A;  5F05 A;  3CSH A;  5FWG A;  1XWG A;  3LYP A;  4J56 E;  4LMW A;  3DWV A;  1HYU A;  4EIQ A;  2HYX A;  5D96 A;  5D8I A;  3L9S A;  4O7H A;  1GNW A;  1ACV A;  2H75 A;  2LJA A;  1X9W B;  3MAK A;  5KOW A;  2FHE A;  1XW6 A;  4AJ6 A;  2PVQ A;  2OT3 A;  1SU9 A;  4L8E A;  4FO5 A;  4MPF A;  2MZC A;  4WF4 A;  2JZT A;  1MD3 A;  4ICY A;  5G1K A;  3W8J A;  4AF2 A;  4CDO A;  3BOA A;  3D4M A;  1YEX A;  1BYE A;  3GMF A;  5DBQ A;  2ZCT A;  3F3R A;  1YEW C;  4LA1 A;  1FG4 A;  3F8U A;  1S3A A;  1IYH A;  1XXU A;  2EIR A;  2DJ0 A;  5BRT A;  1UC7 A;  2I4A A;  3CHX C;  5DJL A;  3GA4 A;  1FHE A;  3FR6 A;  4ZB6 A;  5ECO B;  2CAI A;  1TP9 A;  2O89 A;  4WXT A;  1F9M A;  4HI7 A;  2AB6 A;  2CX4 A;  5IPG A;  1SKR B;  1VF2 A;  4CY6 A;  2E7P A;  3FZ4 A;  5EY6 A;  4AGS A;  5CRD A;  2YCD A;  1SEN A;  1R5A A;  2H6Z A;  5G1L A;  3CRT A;  1JLW A;  5CRE A;  2WW1 A;  2OE1 A;  2DIY A;  3IR4 A;  1F2E A;  5IMD A;  18GS A;  2X64 A;  3PR8 A;  3E9J B;  3N9J A;  4OMV A;  1PFO A;  3FEU A;  1T1V A;  3RPN A;  1XWK A;  2DKH A;  4E8H A;  2PU9 C;  4BVY B;  2OKA A;  3ZTL A;  2TRX A;  2WW0 A;  4DSS A;  4XRD A;  1HNC A;  2JAD A;  4K5S A;  4PQ1 A;  4NMU A;  2WUL A;  4TR3 A;  4YAV A;  1GSE A;  2FWG A;  4HZ2 A;  3BD2 A;  1M0U A;  3WGE A;  2B3S A;  4K7I A;  1V58 A;  2MBS A;  1FAA A;  5DCH A;  4OO4 A;  4NPB A;  3FRC A;  1ABA A;  1R7H A;  3QFB C;  1KEB A;  7GSS A;  3C7M A;  5H5Q A;  3F4R A;  4ID0 A;  3HY2 A;  4X43 A;  4CW9 A;  1X5D A;  3TRP A;  2DKI A;  2K8S A;  2R6K A;  4V2N A;  1PD2 1;  2PMT A;  3VFI A;  1MEK A;  2FY6 A;  1W4V A;  3O76 A;  4P3Y B;  1XW5 A;  4FQU A;  2BTO T;  2HXK A;  5LCZ A;  4NXI A;  2PER A;  1O81 A;  3DVX A;  5IPH A;  2L5L A;  3F0I A;  1A23 A;  4DVC A;  3I43 A;  3HD5 A;  3ERW A;  4FYC A;  4AI6 A;  1PSQ A;  1BF5 A;  2YZH A;  1TI1 A;  3FYG A;  5J4V A;  2P0G A;  3DVW A;  3FR3 A;  1V57 A;  1ML6 A;  5ECH B;  4OFM A;  1QQ2 A;  3DIE A;  4OFN A;  2GGT A;  2F51 A;  3VK9 A;  2GZP A;  5GSS A;  4KAE A;  5IIZ A;  6GSW A;  4K2X A;  2QC7 A;  3CQF A;  2GSQ A;  2LRT A;  3D4T A;  1U6T A;  3HJO A;  2V32 A;  5DDL A;  4QL9 A;  5GZZ B;  5JWO B;  4LLR A;  1SK0 A;  4BVY A;  4I8B A;  4CHS A;  3EMP A;  2IME A;  1B9Y C;  3LOR A;  2RM5 A;  3QFA C;  4HUA A;  3M9J A;  1Y6E A;  1A2M A;  3G7Y A;  1FW1 A;  4L5L A;  5CRG A;  2GT6 A;  4TXV A;  1ST9 A;  4K7O A;  1TKD B;  4WR5 A;  4CY8 A;  4RI7 A;  1RQM A;  4ACS A;  1QFN A;  5AN1 A;  2VM2 A;  2MBT A;  4ZL8 A;  3QAW A;  5B7C A;  2G2Q A;  5HFG A;  2H6X A;  4GQC A;  10GS A;  2GT5 A;  3KGK A;  2PBJ A;  1ERV A;  4MNN A;  3KTB A;  2A2P A;  4RI6 A;  3ZVJ A;  5GST A;  5EVO A;  3NOF A;  1FO5 A;  1QGV A;  1T7P B;  2GQL A;  4JED A;  1XFL A;  1THO A;  3SWL A;  1SJI A;  1EOG A;  3IK9 A;  4FYB A;  4YQV A;  3HJM A;  3FZA A;  5H5S A;  4YAP A;  2B1K A;  3KP9 A;  2LQO A;  3RHC A;  2HZE B;  4ZBB A;  2WRT A;  1UVZ A;  2DIZ A;  2N5A A;  2RM6 A;  2JU5 A;  4NAX A;  3KIJ A;  2MYG A;  5KN1 A;  2H6Y A;  2EC4 A;  2O5V A;  2WVY A;  1XZO A;  1ERU A;  3O6T A;  1PQN A;  4XS6 A;  1E2Y A; 
#chains in the Genus database with same CATH homology
 3HA9 A;  5HFK A;  5G2Z A;  4I6X A;  2IN3 A;  1YKA A;  1Y1U A;  2LQQ A;  2R0G A;  4MH2 A;  3VWX A;  2H01 A;  3HVV A;  4IGJ A;  1ZGN A;  3VUR A;  4XHM A;  4V2M A;  3LW9 A;  2LRC A;  3ZLP A;  3KZQ A;  3UAR A;  3TB2 A;  4MF7 A;  3BCK A;  5G30 A;  2QKE A;  1AC1 A;  3W8S A;  1PN0 A;  5CRW A;  2UZ8 A;  2V41 A;  2G0F A;  1GSY A;  2X8H A;  1TXX A;  5A1N A;  1SVO A;  1SL1 B;  1Z3E A;  4AJ8 A;  3LWA A;  4JZQ A;  5IOX A;  1XVW A;  4NV5 A;  2H8L A;  3HCZ A;  2IMF A;  5KN0 A;  5GAN D;  1NSW A;  3ZMK A;  1XBS A;  1GSD A;  1AQX A;  2GS3 A;  2H73 A;  2IIY A;  1B4Q A;  1Q98 A;  2CZ2 A;  2A2S A;  1YY7 A;  2AYT A;  5A5H B;  2EFE A;  3EMX A;  1WWJ A;  3DXB A;  1XOB A;  4YKG A;  2C3N A;  3TCO A;  1V40 A;  1SVM A;  2DSA A;  4EC0 A;  1C72 A;  3AY8 A;  5G5E A;  4IN0 A;  5IM9 A;  5ENU A;  2YAN A;  4PNF A;  2CQ9 A;  2ES7 A;  2HZE A;  4MLY A;  4JR4 A;  1XOA A;  1GUL A;  4YQU A;  3WD6 A;  2FA8 A;  3NIV A;  3Q6O A;  1VF3 A;  2H0I A;  4NHW A;  5D9V A;  4JU5 A;  2YPM A;  22GS A;  1TK8 B;  3MSZ A;  5J40 A;  1ZYN A;  3JCM L;  3F6F A;  3EU3 A;  5CO3 A;  5KEJ A;  2OAC A;  2H19 A;  1TU8 A;  1O85 A;  3GH9 A;  2FD3 A;  1T00 A;  5DJM A;  4F0C A;  3UL3 A;  5EL8 A;  2LKU A;  4O32 A;  3DYR A;  4F0B A;  3GV1 A;  3IHQ A;  1NHO A;  3I9V 2;  3RAZ A;  1T3B A;  4KGI A;  4KX4 A;  4BL7 B;  2YOI A;  1K0M A;  3ZFB A;  3IC8 A;  2B7K A;  4MJB A;  1K0D A;  1TRU A;  2FUG 2;  13GS A;  4IQ1 A;  1SK1 A;  3GST A;  2GZZ A;  3UAP A;  2YNX A;  5AIV A;  4HOJ A;  2B5E A;  4X4J A;  1VRS D;  3A5W A;  4XS4 B;  1WIK A;  1OE7 A;  4GDF A;  3HZ8 A;  2E2M A;  1CQH A;  4BPY A;  4PXO A;  2C4J A;  1M9A A;  4BWQ A;  4HDE A;  3C1R A;  2EIQ A;  2LRN A;  3GUR A;  2IMD A;  4ZXG A;  1FVK A;  3WT1 A;  1ZL9 A;  3KXO A;  1O8W A;  3PIN A;  4KCE A;  3P2A A;  1ZYQ B;  2GDR A;  2HRA A;  4USS A;  4IS0 A;  4EVM A;  2DC5 A;  2H1D A;  1T4Z A;  3M0F A;  2MMN A;  3EWL A;  1K0A A;  3ZVJ D;  2VM1 A;  3H4K A;  1X5E A;  2B1L A;  1WPI A;  4MDC A;  3L0H A;  4EF0 A;  3F9U A;  2DMM A;  2O7K A;  3RPP A;  5D73 A;  4KND A;  3LXZ A;  4MF6 A;  2R2J A;  4DSQ A;  4JRR A;  3F63 A;  2FNO A;  1M7T A;  2V6O A;  1GNE A;  3FKF A;  3G7J A;  4I2U A;  2XPD A;  3IDV A;  5F07 A;  5BMU A;  1USB A;  6GSV A;  1TU7 A;  5IO2 A;  2XPE A;  4Q5F A;  3HXS A;  3TJB A;  2QGV A;  4IVF A;  1M2B A;  4GF0 A;  5J4Y A;  4BL7 A;  2TIR A;  4IHU A;  3ZIJ A;  3Q74 A;  3N5O A;  2VCQ A;  1Z6N A;  1TTZ A;  4PX1 A;  4YH2 A;  2B5Y A;  4GRF A;  4ECB A;  5CYY A;  1BED A;  2YZU A;  3C8E A;  4W66 A;  5IMZ A;  2YWI A;  1SD8 A;  1O7U A;  1EWX A;  4XS4 A;  4LL1 B;  4PUR A;  2F8F A;  3J7Y k;  4G2E A;  1XWB A;  4IW9 A;  5CRH A;  5IMA A;  2JZR A;  4E8E A;  4KCA A;  3BJ5 A;  4POK A;  1JZW A;  4HU9 A;  3F4T A;  1F37 A;  2BMX A;  2HSH A;  3ME7 A;  1J08 A;  4OWY A;  4O5U A;  4RQX A;  4IKH A;  1ZCP A;  4J57 E;  4PQI A;  3EPT A;  2WB9 A;  5FHI A;  3ME8 A;  3GYK A;  12GS A;  1SYR A;  4Z2T A;  2ALB A;  2KP2 A;  5ELG A;  3LYK A;  4JE1 A;  2UV8 G;  3U6V A;  3LGC A;  2WCI A;  2P5Q A;  1TOF A;  1PX6 A;  2Z9S A;  3MYD A;  4KB3 A;  5DQY A;  3CWG A;  2VUP A;  4O5Q A;  5B6N A;  4MK3 A;  3TRX A;  2F9S A;  3IAS 2;  1X9S B;  2CX3 A;  2B6M A;  4DSR A;  2XC2 A;  3IBH A;  5L71 A;  3CTF A;  5CP1 A;  3I69 A;  3D22 A;  5C04 A;  1HNB A;  5HR1 A;  4QMK A;  1Z7R A;  1PGT A;  1OKD A;  1DE2 A;  4YKF A;  3H1N A;  1A8Y A;  4HS1 A;  1GUK A;  1UN2 A;  3GNJ A;  3KCM A;  4K6X A;  3D6I A;  3QOU A;  3US3 A;  4NV2 A;  4MJA A;  4G01 A;  1EGO A;  3D0Z A;  1XW9 A;  2WS2 A;  2VL3 A;  4MPG A;  3C1S A;  4GSN A;  3FY7 A;  3VPQ A;  2C0G A;  3IPZ A;  3LJR A;  5A4W A;  1WJK A;  2LNT A;  2NPB A;  5F06 A;  2M80 A;  1BG1 A;  3CSI A;  4WBJ A;  1GP1 A;  5KN3 A;  3QAV A;  2QSI A;  2WGR A;  4K8M A;  1EGR A;  3TKP A;  1RW1 A;  2P5R A;  3KM6 A;  1SJ6 A;  2K6V A;  4AKX B;  3CYN A;  1OKT A;  2GST A;  1Z9H A;  5ECI B;  1S3D A;  2L6D A;  3GRX A;  4F03 A;  3FR9 A;  2N5B A;  4FIW A;  4MF5 A;  3VWW A;  5B8A A;  2A4V A;  3H79 A;  3E3E A;  4G10 A;  1R26 A;  5INY A;  1QUW A;  2PUK C;  4K9Z A;  1OE8 A;  4WF5 A;  4MAB A;  1YQ1 A;  5HFI A;  3OR5 A;  4EDZ A;  5A1N B;  3ED3 A;  3UOM A;  1YF1 A;  3VWV A;  1N25 A;  3FZ9 A;  2M46 A;  1AUC A;  1O6J A;  2DJ1 A;  2FWE A;  1U87 A;  1E6B A;  3ERF A;  2WFC A;  1BG5 A;  17GS A;  2TRC P;  4K0G A;  4KSO A;  3CMI A;  2GTU A;  2NBS A;  1ZZY A;  1FOH A;  1XWA A;  2IWT A;  2VD1 A;  2D2Z A;  1TRW A;  1OC9 A;  2FCH A;  4HEA 2;  3IXR A;  2H1A A;  4ZB8 A;  3BCI A;  3LG6 A;  3GKK A;  4I5Q A;  3KMN A;  2PWJ A;  1GTI A;  4ULX A;  4XRA A;  14GS A;  5ECM B;  1SL0 B;  1ERT A;  3U5R E;  5JWR B;  4POB A;  3M1G A;  2ON5 A;  2HZF A;  4BA7 A;  1PKW A;  4YQM A;  6GSS A;  2LJR A;  1XCC A;  2JSY A;  2HT9 A;  3CXG A;  2MMA A;  4KDX A;  1DBY A;  2CAQ A;  2KUC A;  1URM A;  3ZFL A;  3S9F A;  1ON4 A;  3C71 A;  4L0W A;  5LNK e;  1Z6M A;  5D9T A;  1TXU A;  2IJY A;  4IEL A;  5D9X A;  3IAM 2;  2DJK A;  3GH6 A;  1ZYP A;  1EZK A;  3KTL A;  1F6M C;  3DGQ A;  4IJ3 A;  2YWN A;  2OA7 A;  2P31 A;  4O5R A;  1KNG A;  2PGT A;  2IL3 A;  4PUA A;  4TN8 A;  4MMM A;  4Q5N A;  5LD0 A;  3EUR A;  1SJZ A;  2R37 A;  3FMW A;  2VOC A;  1GTU A;  2HSN A;  3GHA A;  2LJK A;  1GUM A;  4ECI A;  4GWR A;  4A5P A;  3SBC A;  1THX A;  1K0B A;  4NWY A;  1PKZ A;  1JZR A;  2R4V A;  4OFT A;  1QK8 A;  2QA1 A;  1H4O A;  2VL2 C;  5IMV A;  2AV4 A;  1AXD A;  3GSS A;  1B8X A;  2JSZ A;  1JLV A;  4QQ7 A;  1A2J A;  4HJ2 A;  4V1A p;  4O92 A;  3VLN A;  2B5X A;  3PPU A;  1G6W A;  2IMI A;  3WT2 A;  1PRX A;  2EFD A;  2OE3 A;  4XTS A;  2YV7 A;  2YWM A;  5JCU A;  1B48 A;  2LST A;  5ECK B;  1EP8 A;  3GKM A;  3UMA A;  1BAY A;  1FB6 A;  1JZO A;  3O3T A;  2LS5 A;  3ZYW A;  2V6K A;  1YEP A;  3L4N A;  4EKZ A;  3HVS A;  1Z5Y E;  3KJY A;  5D93 A;  1GUH A;  2FWF A;  3TJF A;  3GUS A;  4EUY A;  1Z7P A;  1B9X C;  2RUE A;  3UIW A;  3A2W A;  5G5F A;  4Q5Q A;  2KLX A;  4IP6 A;  1B4P A;  1F3A A;  2C1Y A;  1AQV A;  4IP1 A;  1YF0 A;  2VO4 A;  3TKR A;  3WGD A;  2CVD A;  2RII A;  2KHP A;  4POM A;  2DJ3 A;  4TKY A;  4PNG A;  1M9B A;  2L6C A;  4G0I A;  2CV4 A;  4N10 A;  1YDK A;  5ID2 B;  4KUN A;  5BMU B;  1ILO A;  1S3C A;  3GN3 A;  2YV9 A;  2KOK A;  4ZBD A;  3KP8 A;  5J9C A;  2LTK A;  4ECJ A;  5JCG A;  3TKS C;  3TRQ A;  2WZ9 A;  3IA1 A;  3IOS A;  2DBC A;  2MMZ A;  1K0C A;  3VI5 A;  2NVL A;  4X1U A;  4OD7 A;  1OC8 A;  2AAW A;  2OBK A;  4BVX B;  2FGX A;  2F8A A;  2X8G A;  1GH2 A;  1NHY A;  3RDW A;  1EP7 A;  3QR6 A;  5A34 B;  3VPT A;  1DE1 A;  2GQM A;  3UBK A;  2VLV A;  3LXT A;  1IYI A;  2N5F A;  11GS A;  2K18 A;  3QAG A;  4V2L A;  4EO3 A;  5ABR A;  4WET A;  2GSS A;  5J9B A;  1XVQ A;  2O85 A;  3VWU A;  4IJI A;  4GST A;  3CSJ A;  1GSU A;  2ZNM A;  2EFC A;  1V2A A;  4KF9 A;  5JCW A;  4IQA A;  2CT6 A;  1PMT A;  1X5C A;  2REM A;  4OO5 A;  2CVB A;  4TXO B;  4LMV A;  3P90 A;  1G7O A;  3LSZ A;  1TJD A;  3UVH A;  3Q18 A;  4K0N A;  1K0N A;  1PN9 A;  3H93 A;  2QA2 A;  2XHF A;  5ECL B;  2HRK B;  1J0F A;  3W6G A;  4KE3 A;  2C3Q A;  1M2A A;  2L5O A;  3IRA A;  4XS1 A;  3ZL5 A;  2H1B A;  3GX0 A;  5DCG A;  1ZYE A;  5E4W A;  3KMO A;  1VGL A;  2OE0 A;  4D73 B;  4PQH A;  2J23 A;  1TI3 A;  1XIY A;  1G7E A;  1MTC A;  2C0D A;  3UJ1 A;  3ZIT A;  1SYX A;  3F3Q A;  3TGZ A;  1YJ6 A;  5J3R A;  5ID2 A;  2VCT A;  2EIO A;  5C00 A;  3ZRD A;  4G0L A;  1MDK A;  1MDI A;  1JZD A;  4L0U A;  1BQ7 A;  1T8E B;  3GKN A;  4MH3 A;  1FB0 A;  4ML6 A;  2JZS A;  1CQG A;  4ZBA A;  3NZN A;  2GSR A;  6GST A;  2GQK A;  4DEJ A;  3QPM A;  3HHV A;  3GKX A;  3E0U A;  2O8V B;  2PPT A;  4BVX A;  1N2A A;  4BWS A;  2C3T A;  4N30 A;  1RK4 A;  5FT3 A;  4F9Z A;  5A34 A;  4TW5 A;  3EIN A;  1AIU A;  2YN1 A;  3TUE A;  1ZMA A;  4HU7 A;  1KBN A;  4AKI A;  2FLS A;  3L9U A;  3A2X A;  3EVI A;  1M99 A;  3GIX A;  3MNG A;  1LBK A;  2VIM A;  1VF4 A;  3IV4 A;  4HQZ A;  4ZB7 A;  1W89 A;  3APS A;  2NDO A;  3CRU A;  3DRN A;  5CAX A;  1VF1 A;  1K3O A;  1A2L A;  1BJX A;  5ECN B;  3UEM A;  3KD0 A;  1A24 A;  1K3Y A;  3G9B A;  1OC3 A;  1WE0 A;  1QMV A;  4TR4 A;  4TXO A;  1AW9 A;  3Q19 A;  2ON7 A;  1O8X A;  4ZB9 A;  1YVL A;  3WGX A;  4KA0 A;  1HD2 A;  3HYP A;  1TRV A;  1SVL A;  3ZRE A;  5J47 A;  3ZML A;  1XPV A;  2HRK A;  4K1F A;  5J41 A;  3GL3 A;  4NHZ A;  1O73 A;  3ZZX A;  4KH7 A;  4H86 A;  2OAD A;  2WDU A;  2HI7 A;  4AJ7 A;  3A2V A;  1WP0 A;  4D73 A;  4LL4 B;  3BBY A;  1WRY A;  3L9V A;  1R4W A;  2B7J A;  2L57 A;  3D21 A;  2DJJ A;  2H0G A;  4KDY A;  3GL5 A;  4Z2R A;  3M8N A;  2YWO A;  1OC9 B;  4HQS A;  1GLP A;  1M2D A;  3APO A;  2I81 A;  5DAK B;  4GLT A;  2L4C A;  1SKW B;  2VLT A;  2X4A A;  4PUF C;  4AKG A;  4EIP A;  1SL2 B;  1H75 A;  2VL2 A;  1A0R P;  1BX9 A;  4RQR A;  4MZB A;  2L59 A;  8GSS A;  1X0R A;  3MDK A;  2YJ7 A;  3FHK A;  1K0O A;  4FH8 A;  4OCE A;  1A8L A;  5HR2 A;  2A2R A;  3EC3 A;  5ECR B;  4K7N A;  1EOH A;  5JWQ B;  1U3I A;  2C80 A;  1ERW A;  3TJK A;  1XWC A;  1PX7 A;  3HZ4 A;  2YJH A;  3L78 A;  4ECC A;  3H8Q A;  2C0F A;  2IMK A;  2R5G A;  2YP6 A;  3TJG A;  1WOU A;  3LQ7 A;  3DML A;  2X49 A;  4WBR D;  2O87 A;  2H76 A;  2FA4 A;  3QMX A;  3KH9 A;  20GS A;  2HSY A;  3QD9 A;  2HSN B;  1Q4J A;  4EDY A;  3R3E A;  1WMJ A;  4F2I A;  2HSM B;  2A4H A;  3PGT A;  3K8N A;  1TK5 B;  2JL4 A;  4AKH A;  2XBI A;  1DSB A;  3HDC A;  1G6Y A;  1LJR A;  2JAC A;  3A5I A;  4ZL9 A;  1UA5 A;  5CNW A;  4G9H A;  3J7Y b;  3PH9 A;  1MDJ A;  1N8J A;  1TW9 A;  2LV3 A;  2CZ3 A;  2H72 A;  3TKS A;  3DEX A;  1HNA A;  2I1U A;  2PN8 A;  3IC4 A;  4KW6 A;  4N3Z A;  4J2F A;  1SK2 A;  5AIX A;  2VCX A;  3DD3 A;  1GTA A;  5HQP A;  5A4V A;  1I5G A;  3KEB A;  1F3B A;  1V98 A;  3G7I A;  2C0E A;  2IPA A;  1PA3 A;  1MD4 A;  2RLI A;  3IE3 A;  1G0T A;  3HMJ G;  5DAK A;  3HVX A;  1AQW A;  4ZIJ A;  2K8V A;  2R0C A;  4TOP A;  4IBP A;  3HJP A;  3QDN A;  4K5R A;  3R2Q A;  2XBQ A;  6GSY A;  2VKZ G;  1AAZ A;  3FZ5 A;  2LNS A;  5F0G A;  4TR1 B;  3P8W A;  4XCS A;  2AHE A;  2H1L A;  1EEJ A;  4MP4 A;  5AIS A;  2VCV A;  1GSQ A;  3APQ A;  4MJE A;  5DQS A;  5A4U A;  5J5N A;  2V2G A;  1FOV A;  3CTG A;  2R3X A;  3IHG A;  1FVJ A;  1TDI A;  2PVO C;  1YZX A;  1NW2 A;  4K2D A;  2H1G A;  2H30 A;  2J9H A;  4L5O A;  1DUG A;  1EEM A;  5AGY A;  2NTO A;  2H66 A;  4ZIL A;  5ECS A;  3UBL A;  2AJQ B;  2KP1 A;  5HR3 A;  5KOX A;  3EE2 A;  3RHB A;  3TKQ A;  4ML1 A;  2M72 A;  1GRX A;  2F3M A;  1SD9 A;  1SKS B;  3IK7 A;  1HQO A;  1J9B A;  2CVK A;  1TRS A;  1YKC A;  4MZC A;  2H71 A;  9GSS A;  3GFK A;  4PTS A;  5GAP D;  4GSS A;  1R5P A;  1Y25 A;  4MA9 A;  5IOW A;  5A5K A;  6GSU A;  3VI7 A;  1I9D A;  4GXZ A;  4EXJ A;  2HSM A;  4GQF A;  4EE0 A;  3EYT A;  5DAL B;  5E59 A;  2RUF A;  1EV9 A;  4I2T A;  4MCU A;  5KN2 A;  1EV4 A;  5IQY A;  4PGT A;  2E2G A;  3ISO A;  4HZ4 A;  4MJC A;  1OAZ A;  4GCI A;  2DLX A;  2IFQ B;  1OYJ A;  5J4U A;  5ECQ B;  2GZY A;  4MZW A;  5D9W A;  4EL1 A;  3EU4 A;  2L4Q A;  3FK8 A;  4G0K A;  3F4S A;  1U88 A;  19GS A;  2X8C A;  4ISD A;  1GSF A;  3F6D A;  5ECP B;  3P7X A;  1GLQ A;  3MIX A;  4G19 A;  3ZIV A;  2OBI A;  4I97 A;  2MMO A;  4QL7 A;  1GL8 A;  2VLU A;  2H0H A;  2V1M A;  4TVE A;  3V1W A;  3QCP A;  4V1A g;  1ZOF A;  3TJJ A;  4WKW A;  2C8U A;  4N0V A;  3RBT A;  3TU3 B;  4JBB A;  2BJX A;  4TR1 A;  3GTU B;  2LUS A;  1V9W A;  2GVP A;  4KSM A;  2VAF A;  2HQT A;  1U3A A;  5B6M A;  3KH7 A;  4F82 A;  1OVN A;  1NM3 A;  4ILF A;  4E68 A;  4WEY A;  4HJM A;  5G31 A;  3MWH A;  3D5J A;  1A0F A;  4ZL7 A;  2VCZ A;  3TKS E;  4FYU A;  5IMF A;  2GLR A;  2I3Y A;  3HKR A;  4JR6 A;  3A3T A;  3DKS A;  3M9K A;  2K9F A;  2X99 A;  2DJ2 A;  1JFU A;  4WR4 A;  2HFD A;  1GWC A;  1X9M B;  2ZUP A;  3LFL A;  1GTB A;  3I6A A;  2FWH A;  5DVB A;  1TK0 B;  2HNL A;  4RUV A;  1T4Y A;  2VL9 A;  3FW2 A;  2OJL A;  5ELA A;  5EPF A;  3TOT A;  4Z2U A;  2HLS A;  3TDG A;  1GSS A;  5DAL A;  4N11 A;  1K3L A;  4N0Z A;  1PL1 A;  5IMC A;  2CA8 A;  3C73 A;  1LU4 A;  4POL A;  2H74 A;  1PL2 A;  3ERG A;  6GSX A;  2HRN A;  1KTE A;  1QXH A;  2IFQ A;  3WYW A;  4XIH A;  4OCF A;  2HRF A;  2HE3 A;  3CBU A;  2I9H A;  3LEF A;  2DML A;  2AUV A;  4GTU A;  4X0X A;  2VCW A;  3UVT A;  4Z7X A;  2E0Q A;  5COH A;  5H5R A;  16GS A;  5F8B A;  2WJU A;  5B8B A;  2LEG A;  3TOU A;  2VD0 A;  2EFH A;  2R0P A;  2H70 A;  1JHB A;  3GTU A;  4KDU A;  4TRX A;  4Q5R A;  3M3M A;  5A5H A;  5IO0 A;  4TR0 A;  4DSS B;  5HR0 A;  3GX8 A;  5F05 A;  3CSH A;  5FWG A;  1XWG A;  3LYP A;  4J56 E;  4LMW A;  3DWV A;  1HYU A;  4EIQ A;  2HYX A;  5D96 A;  5D8I A;  3L9S A;  4O7H A;  1GNW A;  1ACV A;  2H75 A;  2LJA A;  1X9W B;  3MAK A;  5KOW A;  2FHE A;  1XW6 A;  4AJ6 A;  2PVQ A;  2OT3 A;  1SU9 A;  4L8E A;  4FO5 A;  4MPF A;  2MZC A;  4WF4 A;  2JZT A;  1MD3 A;  4ICY A;  5G1K A;  3W8J A;  4AF2 A;  4CDO A;  3BOA A;  3D4M A;  1YEX A;  1BYE A;  3GMF A;  5DBQ A;  2ZCT A;  3F3R A;  4LA1 A;  1FG4 A;  3F8U A;  1S3A A;  1IYH A;  1XXU A;  2EIR A;  2DJ0 A;  5BRT A;  1UC7 A;  2I4A A;  5DJL A;  3GA4 A;  1FHE A;  3FR6 A;  4ZB6 A;  5ECO B;  2CAI A;  1TP9 A;  2O89 A;  4WXT A;  1F9M A;  4HI7 A;  2AB6 A;  2CX4 A;  5IPG A;  1SKR B;  1VF2 A;  4CY6 A;  2E7P A;  3FZ4 A;  5EY6 A;  4AGS A;  5CRD A;  2YCD A;  1SEN A;  1R5A A;  2H6Z A;  5G1L A;  3CRT A;  1JLW A;  5CRE A;  2OE1 A;  2DIY A;  3IR4 A;  1F2E A;  5IMD A;  18GS A;  2X64 A;  3PR8 A;  3E9J B;  3N9J A;  4OMV A;  3FEU A;  1T1V A;  3RPN A;  1XWK A;  2DKH A;  4E8H A;  2PU9 C;  4BVY B;  2OKA A;  3ZTL A;  2TRX A;  4DSS A;  4XRD A;  1HNC A;  2JAD A;  4K5S A;  4PQ1 A;  4NMU A;  2WUL A;  4TR3 A;  4YAV A;  1GSE A;  2FWG A;  4HZ2 A;  3BD2 A;  1M0U A;  3WGE A;  2B3S A;  4K7I A;  1V58 A;  2MBS A;  1FAA A;  5DCH A;  4OO4 A;  4NPB A;  3FRC A;  1ABA A;  1R7H A;  3QFB C;  1KEB A;  7GSS A;  3C7M A;  5H5Q A;  3F4R A;  4ID0 A;  3HY2 A;  4X43 A;  4CW9 A;  1X5D A;  3TRP A;  2DKI A;  2K8S A;  2R6K A;  4V2N A;  1PD2 1;  2PMT A;  3VFI A;  1MEK A;  2FY6 A;  1W4V A;  3O76 A;  4P3Y B;  1XW5 A;  4FQU A;  2BTO T;  2HXK A;  5LCZ A;  4NXI A;  2PER A;  1O81 A;  3DVX A;  5IPH A;  2L5L A;  3F0I A;  1A23 A;  4DVC A;  3I43 A;  3HD5 A;  3ERW A;  4FYC A;  4AI6 A;  1PSQ A;  1BF5 A;  2YZH A;  1TI1 A;  3FYG A;  5J4V A;  2P0G A;  3DVW A;  3FR3 A;  1V57 A;  1ML6 A;  5ECH B;  4OFM A;  1QQ2 A;  3DIE A;  4OFN A;  2GGT A;  2F51 A;  3VK9 A;  2GZP A;  5GSS A;  4KAE A;  5IIZ A;  6GSW A;  4K2X A;  2QC7 A;  2GSQ A;  2LRT A;  3D4T A;  1U6T A;  3HJO A;  2V32 A;  5DDL A;  4QL9 A;  5GZZ B;  5JWO B;  4LLR A;  1SK0 A;  4BVY A;  4I8B A;  4CHS A;  3EMP A;  2IME A;  1B9Y C;  3LOR A;  2RM5 A;  3QFA C;  4HUA A;  3M9J A;  1Y6E A;  1A2M A;  3G7Y A;  1FW1 A;  4L5L A;  5CRG A;  2GT6 A;  4TXV A;  1ST9 A;  4K7O A;  1TKD B;  4WR5 A;  4CY8 A;  4RI7 A;  1RQM A;  4ACS A;  1QFN A;  5AN1 A;  2VM2 A;  2MBT A;  4ZL8 A;  3QAW A;  5B7C A;  2G2Q A;  5HFG A;  2H6X A;  4GQC A;  10GS A;  2GT5 A;  3KGK A;  2PBJ A;  1ERV A;  4MNN A;  3KTB A;  2A2P A;  4RI6 A;  3ZVJ A;  5GST A;  5EVO A;  3NOF A;  1FO5 A;  1QGV A;  1T7P B;  2GQL A;  4JED A;  1XFL A;  1THO A;  3SWL A;  1SJI A;  1EOG A;  3IK9 A;  4FYB A;  4YQV A;  3HJM A;  3FZA A;  5H5S A;  4YAP A;  2B1K A;  3KP9 A;  2LQO A;  3RHC A;  2HZE B;  4ZBB A;  2WRT A;  1UVZ A;  2DIZ A;  2N5A A;  2RM6 A;  2JU5 A;  4NAX A;  3KIJ A;  2MYG A;  5KN1 A;  2H6Y A;  2EC4 A;  2O5V A;  1XZO A;  1ERU A;  3O6T A;  1PQN A;  4XS6 A;  1E2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...