4LMVA

Crystal structure of glutathione transferase gstfua2 from phanerochaete chrysosporium
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
252
structure length
252
Chain Sequence
SQPIVFYDIPSNDTLKQSPWSPNTWKIRYALNIKGIKYKTEWVEYPDIEDVVKKLGGKPTGKKPDGRDHYTVPVIYDPNTKTVVEDGIKIAKYLDDAYPDTPRLFPAGTDAFQAAFDDFVWSVTLAFPLLSLLLLDVSNSLPPRSSAYFRATREQQFGKRLEEQGGEERWQQLEAGLGKFKGYLERNGAGNDLLLMGTQGGITYSDVQIASLFVWAKVVWGEGSEKWKRLMGFHGGKWAQFCAQFAEYERAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione transferase
publication title Diversification of fungal specific class a glutathione transferases in saprotrophic fungi.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Transferase
total genus 82
structure length 252
sequence length 252
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4lmvA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4lmvA01
2YJHA 4FYCA 1F3BA 5HFGA 3Q18A 4F0BA 2IN3A 3KZQA 2L5OA 3CXGA 2F8FA 3ZIVA 4RUVA 5D9VA 4K0GA 4BVYB 2OE3A 2H19A 2YPMA 1T1VA 3H4KA 1TI1A 2QC7A 4EC0A 1N2AA 2O85A 3DXBA 2HRKB 5B6MA 4YQVA 1M2DA 1ACVA 1X5CA 2H74A 5ECIB 1ML6A 4MCUA 3TRQA 1GL8A 1RK4A 3TOTA 5KEJA 3G7IA 6GSWA 5DQSA 1J9BA 4RI7A 4LLRA 3EE2A 2BMXA 2ZNMA 2WULA 2LQOA 3S9FA 3GSTA 2GDRA 1XWKA 3P90A 4MZBA 1SK2A 3UVHA 4DSSA 3TRPA 1A2MA 3VURA 4PQIA 2CVDA 5LCZA 5J5NA 1B48A 4CDOA 1MDJA 1EGRA 4ZXGA 2V6KA 2WFCA 1X5DA 1XIYA 1PSQA 1GUKA 2MZCA 1Q4JA 4RQXA 4BVXA 3MWHA 1SD8A 3KH9A 4KUNA 2PERA 4RQRA 2VL2C 13GSA 4XS6A 1MDIA 2B6MA 2PVQA 1FAAA 3DEXA 3CMIA 3HVVA 5DAKB 3QFBC 4EVMA 2OADA 4YQMA 4QL9A 1M2BA 2UZ8A 3KTBA 3W6GA 3HVSA 4BWSA 1A23A 4MF5A 2AJQB 1E2YA 3KGKA 1OC9A 3GH9A 3HY2A 1XVWA 1TU7A 1RW1A 3IAM2 2DC5A 1X9WB 2ES7A 1ERWA 3KP8A 4G19A 3CTGA 5IIZA 5KN0A 2K8SA 3C7MA 3TJJA 4F0CA 3FW2A 5CRWA 1NHOA 4WKWA 1GSQA 1F6MC 3PGTA 1M9AA 1AW9A 3EURA 4EDYA 3H8QA 4IP1A 5CYYA 2C0EA 1GTAA 2WJUA 3GYKA 2CX4A 2PVOC 4MJBA 3TJFA 3VWUA 3FR3A 2IJYA 5G5FA 3GX0A 3IPZA 2C0FA 1TKDB 3F3RA 5KN2A 4BL7A 1J0FA 5AIVA 4AJ6A 4KSOA 4CHSA 2EIQA 3WGDA 4DSRA 3EMXA 5ECPB 4NWYA 3KXOA 4X43A 2CT6A 1WP0A 3TCOA 1H4OA 2FNOA 1UC7A 1JLVA 1G6WA 1W4VA 2GQMA 3OR5A 1B9XC 2HXKA 1VF3A 4ECBA 2R6KA 4ULXA 1U6TA 1SKSB 5IOWA 5F05A 1PQNA 3ZIJA 3W8JA 1WPIA 2JZSA 3DYRA 4X1UA 2HE3A 5HR2A 2OE1A 4IELA 2OA7A 1NSWA 5DDLA 4ML6A 1THOA 1G7EA 4CW9A 2E7PA 1ZL9A 5FT3A 4ZILA 2PMTA 2KLXA 4KCAA 22GSA 4I5QA 3A2XA 2WGRA 3TJKA 4HZ2A 4O92A 1QXHA 2PUKC 4F2IA 2R4VA 1O6JA 2VM2A 1GSUA 2FUG2 3ZVJD 4PTSA 1NM3A 2HLSA 2M46A 5D73A 4V1Ap 4WETA 1FG4A 4GRFA 3QFAC 2E2GA 2VOCA 2CVKA 5H5QA 3HJPA 4NXIA 5HQPA 1XWAA 3CSJA 3CRUA 2VCVA 1U88A 2VIMA 1WRYA 4P3YB 1B4PA 4DEJA 4KCEA 3GURA 12GSA 5IMVA 1TRWA 4V2MA 3LYKA 1GUMA 1IYIA 1GUHA 2LSTA 1MEKA 3P7XA 2LRCA 1GSYA 3GRXA 2B7JA 2PPTA 4PNGA 5CAXA 3PINA 3FRCA 1WWJA 1B8XA 3KIJA 1S3AA 1OKDA 2L5LA 3DGQA 4ZL8A 2IFQB 3HDCA 2DJ0A 3IAS2 2IL3A 1ZCPA 2X99A 1PX6A 4N0VA 1EEJA 6GSVA 4IGJA 1DUGA 4HQZA 3CRTA 1N8JA 3F0IA 2V6OA 2C4JA 4XIHA 2YOIA 1VGLA 1I5GA 2HFDA 3TDGA 1HNAA 2AHEA 2GS3A 5COHA 3IC4A 2DSAA 6GSXA 4N11A 4TOPA 5G5EA 1QGVA 4E8HA 2VLUA 3HZ4A 4YAPA 2I81A 3VWXA 2MBTA 1VRSD 4JR4A 1AC1A 4KA0A 1BJXA 3H1NA 1HYUA 2MMAA 2P0GA 3F9UA 4JEDA 2R5GA 4I6XA 1K0OA 1WOUA 1SL2B 3UIWA 1JFUA 3PPUA 3ZMKA 4ZBAA 3EVIA 2VO4A 3ERFA 2YZHA 4KE3A 1XW5A 2TRXA 4MPFA 3LWAA 1TU8A 4K9ZA 4QQ7A 1U87A 1A2JA 4MJCA 5J9BA 8GSSA 4WBRD 3LSZA 2DJ2A 2H01A 5BMUA 5GAND 4IP6A 3W8SA 3DMLA 4L5OA 5B8BA 5B6NA 5G1LA 1PL1A 2MMOA 1Z6MA 1WJKA 4PUFC 5CREA 5C04A 5ABRA 5B7CA 2EC4A 4NV2A 2V1MA 3F3QA 2FGXA 3QCPA 1HD2A 5J3RA 5DALA 3M9JA 1M9BA 4GCIA 3BJ5A 5HR1A 4J56E 1ZYQB 2OBKA 3UMAA 5ECHB 2VLVA 2FA8A 1GNEA 4QL7A 5AIXA 2F51A 1VF1A 3KCMA 5L71A 2GGTA 5LD0A 4L0UA 2GSSA 3HD5A 2DJKA 4AJ7A 2I1UA 2IMEA 1FHEA 2OE0A 4HEA2 2LJRA 4WF4A 3D5JA 2H66A 4OMVA 2V32A 4NHWA 3ZREA 2XPDA 3J7Yk 4GSNA 3DVXA 4GWRA 5G1KA 4MZCA 10GSA 3BCIA 3P2AA 1IYHA 2CX3A 2A2SA 1G0TA 2YWOA 3ERWA 1FB0A 4G0KA 1BYEA 5FHIA 1EWXA 5ID2B 4XCSA 2CA8A 3SBCA 4N0ZA 4IQAA 2MMNA 1KTEA 1O73A 2FY6A 4KAEA 3D0ZA 3JCML 3C71A 1V98A 3LXZA 5JCGA 2H72A 1Y25A 4KX4A 1E6BA 2HRAA 3G7JA 2FA4A 1PA3A 2HYXA 2HZEA 20GSA 2HSYA 2RM5A 4OFNA 4RI6A 4MA9A 4MLYA 2R3XA 3FR6A 2BTOT 2AUVA 3GTUA 2I3YA 4GF0A 4KB3A 1XVQA 1A0RP 1JZWA 4TXOA 3GH6A 1UA5A 2KP2A 3LFLA 2EIRA 3IRAA 3ISOA 3UBKA 2I9HA 1SYRA 4GQCA 5CP1A 3FZ4A 2H70A 1XXUA 2KP1A 3GL5A 4FYBA 1XW9A 5D93A 1F2EA 5CRHA 3VI7A 4IKHA 1XOAA 2FWGA 1K3YA 2RUFA 2ON7A 2JU5A 3IK9A 1GLQA 1K0MA 3KH7A 1OE8A 7GSSA 1GNWA 1GTBA 4IS0A 1T7PB 4IBPA 3ZL5A 4XS1A 1DE1A 4EUYA 5E59A 5D9TA 4ACSA 1BAYA 2K18A 2X8CA 11GSA 1ST9A 4IVFA 1SJ6A 3F4RA 1XOBA 1AUCA 3MNGA 1V9WA 4TR4A 4PQHA 4K7NA 2IMDA 2K8VA 2N5AA 4OO5A 3ZLPA 1B9YC 4ZBBA 2H0GA 4OCFA 2DJ3A 5HFIA 4GTUA 2DMLA 3EU4A 1XBSA 2KUCA 4MMMA 2RLIA 2O87A 3I6AA 4PX1A 4XS4A 16GSA 1SKRB 4LA1A 2NVLA 1JHBA 2LEGA 3GSSA 1TRVA 3SWLA 2YWIA 2JZTA 5HFKA 3HZ8A 5E4WA 1OC8A 4HU7A 1YF1A 4L5LA 4H86A 2C3NA 3M0FA 2YANA 3IHQA 2GVPA 3IC8A 3RDWA 1SD9A 2C3QA 1TP9A 4JBBA 3C1RA 3EMPA 3WT1A 4DSSB 4MK3A 1BX9A 3QAVA 1EP7A 1YEPA 4I2UA 5JCUA 4K6XA 2VCZA 2LNSA 4WEYA 3UAPA 5GAPD 3I9V2 4LL4B 1XWBA 2VAFA 3IBHA 1SU9A 3M9KA 2L59A 5IPHA 1JZRA 2HQTA 4ECIA 1YEXA 4EE0A 4BPYA 4I8BA 4BVXB 2LUSA 3RHCA 5F07A 4J57E 5GSTA 5ELAA 2YJ7A 4LL1B 2BJXA 3UJ1A 2MBSA 3LEFA 2O8VB 1SL1B 1MTCA 3DD3A 2HT9A 2YNXA 1LU4A 1JZDA 2NBSA 2M80A 1XW6A 4TR1A 2GZPA 1ZGNA 4KDYA 1OC9B 4F03A 5DCGA 2NTOA 3GKMA 2H71A 3TKSA 3EWLA 1QQ2A 2WB9A 4ZB8A 4MP4A 1PL2A 3F4TA 4TKYA 1MD4A 3UEMA 2E2MA 4G2EA 4L8EA 4MJAA 14GSA 5KN3A 2PN8A 2DIYA 1EP8A 5DJLA 4I97A 1XPVA 3TGZA 4ZIJA 3KMOA 1PKWA 4MABA 3F6FA 1KBNA 3E0UA 1QFNA 3IXRA 3ZMLA 1TOFA 5EVOA 5HR3A 5EL8A 4BL7B 3M3MA 2ON5A 1GSDA 2VM1A 1HQOA 1ZOFA 3Q74A 4OFTA 4MDCA 4OD7A 2C3TA 1Z3EA 3RPPA 1DSBA 2I4AA 4PNFA 3A3TA 3HYPA 4XRDA 5IO0A 4BWQA 1PMTA 3J7Yb 5CNWA 3KEBA 5DBQA 3I43A 2QSIA 3HKRA 1GSEA 5G31A 3NZNA 3VPQA 4HZ4A 1G6YA 6GSYA 5D9WA 1YZXA 2VCXA 5ECMB 4FYUA 1TK5B 1TXXA 1X0RA 4PURA 1TW9A 1Z7PA 4G0LA 1PX7A 4LMWA 3TOUA 3GHAA 3VWWA 1H75A 3ERGA 2H6ZA 3TJGA 3E9JB 2J23A 1AQXA 3L9VA 4PGTA 2YWMA 4ILFA 5INYA 1SKWB 3GKXA 4HJMA 2YN1A 3O6TA 1OE7A 1OC3A 2MYGA 4KW6A 17GSA 3FZ9A 4ISDA 5AGYA 3MDKA 2R2JA 3PR8A 6GSSA 3QR6A 2ALBA 4LMVA 5J9CA 2H1DA 2N5BA 1ERUA 2JSYA 3FK8A 3A2WA 3KM6A 1T4YA 1QMVA 1NW2A 5ECLB 4HUAA 3FHKA 4EKZA 5B8AA 4TN8A 1R5AA 2B5XA 3RBTA 4PXOA 1PRXA 1RQMA 5H5RA 1AXDA 2GZYA 3TUEA 4Q5RA 2JL4A 1YKAA 3QD9A 1X9MB 1DE2A 2FWHA 5IO2A 3TKSE 5JWQB 5IMAA 4D73A 2LRTA 2GT5A 3DKSA 2F3MA 2VL3A 3VPTA 1AIUA 2X64A 1S3DA 3TKPA 3GIXA 4EF0A 2YV7A 5FWGA 2VCQA 1YKCA 3QMXA 4J2FA 3CBUA 2CZ3A 3FZAA 4MJEA 2XBQA 4OWYA 5A4UA 2H1AA 3EINA 2GQKA 19GSA 2H30A 2AAWA 2L4CA 18GSA 4G0IA 4HDEA 4JE1A 1A2LA 3LJRA 1FW1A 2HSMA 4WR5A 3D4TA 4POMA 4ECCA 1BEDA 1TK8B 3UVTA 4KH7A 5JWOB 4Q5QA 3QAWA 1TTZA 1DBYA 3Q6OA 4IJIA 4MF6A 1Z6NA 3LXTA 1O7UA 3D21A 3GUSA 2B1LA 3GKNA 3ZVJA 2LV3A 3APSA 4E8EA 2JADA 3GV1A 2HRNA 1URMA 1OAZA 1M2AA 2B3SA 3GMFA 3ME8A 2XC2A 5GZZB 1F9MA 2LKUA 3HXSA 5D96A 1OYJA 3EU3A 2L6DA 4JZQA 2CAIA 4OCEA 3F6DA 3KJYA 2HSNB 2DIZA 2CV4A 1A8YA 5DALB 1ABAA 3VI5A 3F4SA 2AYTA 1GSSA 1YDKA 5ECQB 1T4ZA 4G9HA 5D8IA 3BOAA 1V57A 3CYNA 1T00A 2YV9A 2H75A 1UVZA 4YQUA 5IMZA 1V58A 1GULA 2PBJA 2HZFA 1K0DA 1SJZA 1MDKA 1BG5A 3LQ7A 5J41A 3DVWA 1EGOA 2XHFA 1K3LA 1AAZA 2DMMA 2WS2A 4BVYA 3V1WA 2NPBA 1O85A 4IQ1A 4MPGA 4KNDA 1O8WA 5IMDA 1GRXA 5ENUA 1QK8A 5IMFA 3QOUA 3ZRDA 1R7HA 1CQHA 2HRKA 2QGVA 3CSHA 2K6VA 2REMA 3IA1A 1FOVA 3RHBA 2GT6A 4HQSA 5J4UA 5AN1A 4AF2A 3TB2A 3IE3A 4JRRA 2LRNA 2IIYA 1GTIA 2G2QA 3PH9A 4IN0A 2WRTA 2GSRA 1GH2A 2QKEA 4EO3A 5IMCA 4FIWA 4O7HA 3KTLA 2VD1A 1M99A 4MF7A 3M8NA 1JLWA 1C72A 6GSTA 5DQYA 5KN1A 1O8XA 2HZEB 2TIRA 5A5KA 2VD0A 5JWRB 1OVNA 3Q19A 1THXA 2FCHA 3L9SA 2IWTA 3FYGA 4ZB6A 3GTUB 1GTUA 2LQQA 4TXOB 4ZB9A 5IOXA 2B5EA 1MD3A 2P5RA 3AY8A 3L78A 3NOFA 5F06A 2Z9SA 4NMUA 2GSQA 5D9XA 3BD2A 2PGTA 4EXJA 4AJ8A 1FVJA 3IV4A 5DAKA 2H76A 4NV5A 2TRCP 1G7OA 2K9FA 1K3OA 3WD6A 5C00A 4V2NA 5GSSA 1WMJA 2ZUPA 4F9ZA 3MSZA 5AISA 3GA4A 2CQ9A 4HU9A 3D22A 2L6CA 1V2AA 4HI7A 5DVBA 1M7TA 4JR6A 3ZFBA 2G0FA 5H5SA 5JCWA 3DWVA 3ED3A 4NPBA 4WBJA 4NAXA 3BBYA 1EZKA 2VL2A 2IMFA 1EEMA 4JU5A 1EV9A 1HNBA 2XPEA 3IOSA 4WF5A 3VK9A 2VCTA 4NHZA 2GZZA 3D4MA 5IM9A 3O76A 2GTUA 2IMKA 3H79A 2V2GA 5ECNB 3ZTLA 4TR3A 3N5OA 2HRFA 3QAGA 5G2ZA 1KNGA 2LJKA 2H6YA 2MMZA 5CRGA 3O3TA 2OKAA 5EY6A 4OFMA 2O7KA 2H6XA 1FVKA 3GL3A 1AQVA 2LJAA 2ZCTA 1SJIA 1TK0B 1BQ7A 1YY7A 1F3AA 2CAQA 1UN2A 2EIOA 2LNTA 3QDNA 3TKRA 4XS4B 1M0UA 3DIEA 3ZITA 2OBIA 2PU9C 2D2ZA 2H0HA 2JZRA 3GKKA 3QPMA 4FO5A 2X8HA 3A2VA 1U3AA 4ZL7A 4O5RA 4K8MA 4KDUA 3C73A 5A4VA 2H8LA 5CRDA 1TI3A 4GSSA 2B7KA 2P5QA 5EPFA 4KF9A 2FHEA 1T8EB 3HVXA 1TDIA 4K7OA 2L57A 1R26A 3TKSC 4IW9A 4DSQA 4XHMA 1WE0A 4XRAA 1KEBA 1K0BA 2JSZA 3FR9A 5ELGA 4N30A 4MZWA 3NIVA 5ECKB 2KOKA 4TRXA 4ZBDA 2FD3A 4EL1A 1K0NA 2C8UA 2DJJA 4Q5NA 2KHPA 2FWEA 3C8EA 2O89A 2DJ1A 4MH3A 2H1GA 5F8BA 4DVCA 2LS5A 4POKA 3IDVA 4TR1B 3VLNA 4HOJA 1EV4A 1Z5YE 1S3CA 1VF4A 4KDXA 3HCZA 4V2LA 1A8LA 1YF0A 3A5WA 2A4VA 1EOHA 3F8UA 1PGTA 5F0GA 2HI7A 2IFQA 1QUWA 1I9DA 4G10A 3GN3A 2C80A 3C1SA 2IMIA 1GSFA 3N9JA 1SENA 1Y6EA 1ZMAA 2C0GA 1XZOA 3GFKA 4YAVA 4AGSA 4TXVA 1R5PA 3EC3A 1TRSA 1T3BA 4K7IA 3UOMA 4PUAA 2B5YA 4USSA 3FZ5A 2M72A 4L0WA 2YCDA 1GLPA 5ECOB 1V40A 3HJOA 4I2TA 4ML1A 3L9UA 1PN9A 1A0FA 4K0NA 3KD0A 1F37A 5IPGA 4POBA 1AQWA 3FKFA 1OKTA 1WIKA 3GX8A 3VFIA 1SK0A 1XCCA 1SL0B 5DCHA 4GQFA 3ZFLA 1SK1A 1USBA 4ID0A 1K0CA 2HSHA 3BCKA 3G9BA 2J9HA 3MAKA 4KGIA 3G7YA 4MH2A 3HJMA 3ZZXA 4HJ2A 1ERTA 2R37A 4BA7A 2VCWA 5ECSA 2C0DA 4IJ3A 1LJRA 1GP1A 4TR0A 4OO4A 2WDUA 2P31A 1LBKA 1VF2A 4F82A 2WZ9A 1PD21 1TRUA 2A2RA 4X0XA 3CSIA 4XTSA 2E0QA 1X9SB 5HR0A 3M1GA 3U5RE 2B1KA 3APQA 1EOGA 4Z7XA 1X5EA 4GSTA 2GLRA 1Z9HA 3K8NA 5G30A 2PWJA 3FEUA 2CVBA 2FLSA 3VWVA 4GXZA 4POLA 3I69A 6GSUA 4O32A 1XWGA 2FWFA 1K0AA 2GSTA 2YWNA 3US3A 2OACA 2H0IA 1TJDA 3L0HA 4ZL9A 3RAZA 2H1BA 1JZOA 1GWCA 4K1FA 2YZUA 3ZYWA 3U6VA 5A4WA 3DRNA 1SYXA 1ON4A 4D73B 2JACA 2RIIA 3GNJA 4FQUA 1ILOA 1Q98A 4HS1A 2DBCA 4K2DA 3LORA 2F8AA 2LTKA 5ID2A 2VLTA 3E3EA 4KSMA 2CZ2A 4PQ1A 3CTFA 2F9SA 9GSSA 3LG6A 4YH2A 1XWCA 2OJLA 2C1YA 1U3IA 3F63A 3WT2A 4IHUA 1FO5A 2HSMB 5IQYA 1YJ6A 3FY7A 1CQGA 5ECRB 4Q5FA 2RM6A 3P8WA 4N10A 5DJMA 2HNLA 3WYWA 2VL9A 3R3EA 2N5FA 3EYTA 1PKZA 1ZZYA 3TRXA 2AV4A 3H93A 1O81A 4EDZA 2RUEA 4WR4A 3TKQA 3IR4A 3TJBA 3APOA 3R2QA 3LGCA 1ZYEA 4TW5A 3WGXA 1J08A 1ERVA 1W89A 4V1Ag 4TVEA 2XBIA 3UARA 3L4NA 5LNKe 2DLXA 3ME7A 1R4WA 3KP9A 4ECJA 5CO3A 2AB6A 3HHVA 4FH8A 4WXTA 3RPNA 2YP6A 2GQLA 1YQ1A 1XFLA 2X8GA 3D6IA 3LYPA 2WCIA 1A24A 1B4QA 1NHYA 2H73A 1FB6A 3UBLA 2IPAA 3HA9A 2VUPA 2V41A 2L4QA 3IK7A 4GLTA 3UL3A 3KMNA 2NDOA 1HNCA 1Z7RA 3WGEA
chains in the Genus database with same CATH superfamily
2YJHA 4FYCA 1F3BA 5HFGA 3Q18A 4F0BA 1M3JA 2IN3A 3KZQA 2L5OA 3CXGA 2F8FA 3ZIVA 4RUVA 5D9VA 4K0GA 4BVYB 2OE3A 2H19A 2YPMA 1T1VA 3H4KA 1TI1A 2QC7A 4EC0A 1N2AA 2O85A 3DXBA 2HRKB 5B6MA 4YQVA 1M2DA 1ACVA 1X5CA 2H74A 5ECIB 1ML6A 4MCUA 3TRQA 1GL8A 1RK4A 3TOTA 5KEJA 3G7IA 6GSWA 5DQSA 1J9BA 4RI7A 4LLRA 3EE2A 2BMXA 2ZNMA 2WULA 2LQOA 3S9FA 3GSTA 2GDRA 4QMKA 1XWKA 3P90A 4MZBA 1SK2A 3UVHA 4DSSA 3TRPA 1A2MA 3VURA 4PQIA 2CVDA 5LCZA 5J5NA 1B48A 4CDOA 1MDJA 1EGRA 4ZXGA 2V6KA 2WFCA 2H1LA 1X5DA 1XIYA 1PSQA 1GUKA 2MZCA 1Q4JA 4RQXA 4BVXA 3MWHA 1SD8A 3KH9A 4KUNA 2PERA 4RQRA 2VL2C 13GSA 4XS6A 1MDIA 2B6MA 2EFHA 2PVQA 1FAAA 3DEXA 3CMIA 3HVVA 5DAKB 2R0PA 3QFBC 4EVMA 2OADA 4YQMA 4QL9A 1M2BA 2UZ8A 3KTBA 3W6GA 3HVSA 4BWSA 1A23A 4MF5A 2AJQB 1E2YA 3KGKA 1OC9A 3GH9A 3HY2A 1I1IP 1XVWA 1TU7A 4X4JA 1RW1A 3IAM2 2DC5A 1X9WB 2ES7A 1ERWA 3KP8A 4G19A 3CTGA 5IIZA 5KN0A 1YVLA 2K8SA 3C7MA 3TJJA 4F0CA 3FW2A 5CRWA 1NHOA 4Z2UA 4WKWA 1PFOA 4BIKA 1GSQA 1F6MC 3PGTA 1M9AA 1AW9A 3EURA 4A5PA 1XG8A 4EDYA 3H8QA 4IP1A 5CYYA 2C0EA 1GTAA 2WJUA 3GYKA 1Y1UA 2CX4A 2PVOC 4MJBA 3TJFA 3VWUA 3FR3A 2IJYA 5G5FA 3GX0A 3IPZA 2C0FA 1TKDB 3F3RA 5KN2A 4BL7A 3LW9A 1J0FA 5AIVA 4AJ6A 4KSOA 4CHSA 2QA1A 2EIQA 3WGDA 5A1NA 4DSRA 3EMXA 5ECPB 4NWYA 3KXOA 4X43A 2CT6A 1WP0A 3TCOA 1H4OA 2FNOA 1UC7A 1JLVA 1G6WA 1W4VA 2GQMA 3OR5A 1B9XC 2HXKA 1VF3A 4ECBA 2R6KA 4ULXA 1U6TA 1SKSB 5IOWA 3CHXC 5F05A 1PQNA 3ZIJA 3W8JA 1WPIA 2JZSA 3DYRA 4N3ZA 2HE3A 4X1UA 5HR2A 4K5RA 2OE1A 4IELA 2OA7A 1NSWA 5DDLA 4ML6A 1THOA 4AI6A 1G7EA 4CW9A 2E7PA 1ZL9A 5FT3A 4ZILA 2PMTA 2KLXA 4KCAA 22GSA 4I5QA 3A2XA 2WGRA 3TJKA 4HZ2A 4O92A 1QXHA 2PUKC 4F2IA 2R4VA 1O6JA 2VM2A 1GSUA 5KOWA 2FUG2 3ZVJD 4PTSA 4AKHA 1NM3A 2HLSA 2M46A 5D73A 4V1Ap 4WETA 1FG4A 4GRFA 3QFAC 2E2GA 2VOCA 2CVKA 5H5QA 3HJPA 4NXIA 5HQPA 1XWAA 3CSJA 3CRUA 2VCVA 1U88A 2VIMA 1WRYA 4P3YB 1B4PA 4DEJA 4KCEA 3GURA 12GSA 5IMVA 1TRWA 4V2MA 3LYKA 1GUMA 1IYIA 4MNNA 1GUHA 2LSTA 1MEKA 3P7XA 2LRCA 1GSYA 3GRXA 2B7JA 2PPTA 4PNGA 5CAXA 3PINA 3FRCA 1WWJA 1B8XA 3KIJA 1S3AA 1OKDA 2L5LA 3DGQA 4ZL8A 2IFQB 3HDCA 2DJ0A 3IAS2 2IL3A 1ZCPA 4O5UA 2X99A 1PX6A 4N0VA 1EEJA 6GSVA 4IGJA 1DUGA 4HQZA 3CRTA 1N8JA 3F0IA 2V6OA 2C4JA 5A34B 1SVLA 4XIHA 2YOIA 1VGLA 1I5GA 2HFDA 3TDGA 1HNAA 2AHEA 2GS3A 5COHA 3IC4A 2DSAA 6GSXA 4N11A 4TOPA 5G5EA 1QGVA 4E8HA 2VLUA 2VKZG 3HZ4A 4YAPA 2I81A 3VWXA 2MBTA 1VRSD 4JR4A 1AC1A 4KA0A 1BJXA 3H1NA 2X4AA 1HYUA 2MMAA 2P0GA 2QA2A 3F9UA 4JEDA 2R5GA 4I6XA 1K0OA 1WOUA 1SL2B 3UIWA 1JFUA 3PPUA 3ZMKA 4ZBAA 3EVIA 2VO4A 3ERFA 2YZHA 4KE3A 1XW5A 2TRXA 4ICYA 4MPFA 3LWAA 1TU8A 4K9ZA 4QQ7A 1U87A 1A2JA 4MJCA 5J9BA 8GSSA 4WBRD 3LSZA 2DJ2A 2H01A 5BMUA 5GAND 4IP6A 3W8SA 3DMLA 4L5OA 5B8BA 5B6NA 5G1LA 1PL1A 2MMOA 2HSNA 1Z6MA 1WJKA 4PUFC 5KOXA 5CREA 5C04A 5ABRA 5B7CA 2EC4A 4NV2A 2V1MA 3F3QA 2FGXA 3QCPA 1HD2A 5J3RA 5DALA 3M9JA 1M9BA 4GCIA 3BJ5A 5HR1A 4J56E 2WW2A 1N25A 1ZYQB 2OBKA 3UMAA 5ECHB 2VLVA 2FA8A 1GNEA 4QL7A 5AIXA 2F51A 1VF1A 2X49A 3KCMA 5L71A 2GGTA 5LD0A 4L0UA 2GSSA 3HD5A 2DJKA 4AJ7A 2I1UA 2IMEA 1FHEA 2OE0A 4HEA2 2LJRA 4WF4A 3D5JA 4HSCX 2H66A 4OMVA 2V32A 4NHWA 3ZREA 2XPDA 3J7Yk 4GSNA 3DVXA 4GWRA 5G1KA 4MZCA 10GSA 3BCIA 3P2AA 1IYHA 4PI0C 2CX3A 2A2SA 1G0TA 3ERWA 2YWOA 1FB0A 4G0KA 1BYEA 5FHIA 1EWXA 5ID2B 4XCSA 2CA8A 3SBCA 2WZSA 4N0ZA 1ZYNA 4IQAA 2MMNA 1SVMA 1KTEA 1O73A 2FY6A 4KAEA 2R0CA 3D0ZA 3JCML 3C71A 1V98A 3LXZA 5JCGA 2H72A 1Y25A 4KX4A 1E6BA 2HRAA 3G7JA 2FA4A 1PA3A 2HYXA 2HZEA 20GSA 2HSYA 2RM5A 4OFNA 4RI6A 4MA9A 4MLYA 2R3XA 1M3IA 3FR6A 2BTOT 2AUVA 3GTUA 2I3YA 4GF0A 4KB3A 1XVQA 1A0RP 1JZWA 4TXOA 3GH6A 1UA5A 2KP2A 3LFLA 2EIRA 3IRAA 3ISOA 3UBKA 2I9HA 1SYRA 4GQCA 5CP1A 3FZ4A 2H70A 1XXUA 2KP1A 3GL5A 4FYBA 1XW9A 1PN0A 5D93A 1F2EA 5CRHA 3VI7A 4IKHA 1XOAA 2FWGA 1K3YA 2RUFA 2ON7A 2JU5A 3IK9A 1GLQA 1K0MA 3KH7A 1OE8A 7GSSA 1GNWA 1GTBA 4IS0A 4PHZC 1T7PB 4IBPA 3ZL5A 4XS1A 1DE1A 4EUYA 5E59A 5D9TA 4ACSA 2WW0A 1BAYA 2K18A 2X8CA 11GSA 1ST9A 2WW3A 4IVFA 1SJ6A 3F4RA 1XOBA 1AUCA 3MNGA 1V9WA 2A4HA 4TR4A 4PQHA 4K7NA 2IMDA 2K8VA 2N5AA 4OO5A 3ZLPA 1B9YC 4ZBBA 2H0GA 4OCFA 2DJ3A 5HFIA 4GTUA 3EU4A 2DMLA 1XBSA 2KUCA 4MMMA 2RLIA 2O87A 3I6AA 4PX1A 4XS4A 16GSA 1SKRB 4LA1A 2NVLA 1JHBA 2LEGA 3GSSA 2UV8G 1TRVA 3SWLA 2YWIA 2JZTA 5HFKA 3HZ8A 5E4WA 1OC8A 4HU7A 1YF1A 4L5LA 4H86A 2C3NA 3M0FA 2YANA 3IHQA 2GVPA 3IC8A 3RDWA 1SD9A 2C3QA 1TP9A 4JBBA 3C1RA 3EMPA 3WT1A 4DSSB 4MK3A 1BX9A 3QAVA 1EP7A 1YEPA 4I2UA 5JCUA 4K6XA 2VCZA 2LNSA 4WEYA 3UAPA 5GAPD 5BRTA 3I9V2 4LL4B 1XWBA 2VAFA 3IBHA 1SU9A 3M9KA 2L59A 5IPHA 1JZRA 4AKXB 2HQTA 4ECIA 1YEXA 4EE0A 4BPYA 4I8BA 4BVXB 2LUSA 3RHCA 5F07A 4J57E 3HMJG 5GSTA 5ELAA 2YJ7A 4LL1B 2BJXA 3UJ1A 2MBSA 3LEFA 2O8VB 4YKFA 1SL1B 1MTCA 3DD3A 2HT9A 2YNXA 1LU4A 1JZDA 2NBSA 2M80A 1XW6A 4TR1A 2GZPA 1ZGNA 4KDYA 1OC9B 4F03A 5DCGA 2NTOA 3GKMA 2H71A 3TKSA 4Z2RA 3EWLA 1QQ2A 2WB9A 4ZB8A 4MP4A 1PL2A 3F4TA 4TKYA 1MD4A 3UEMA 2E2MA 4G2EA 4L8EA 4MJAA 14GSA 5KN3A 2PN8A 2DIYA 1EP8A 5DJLA 4I97A 1XPVA 3TGZA 4ZIJA 3KMOA 4K5SA 5A5HA 1PKWA 4MABA 3F6FA 1KBNA 3E0UA 1QFNA 3IXRA 3ZMLA 1TOFA 5EVOA 5HR3A 5EL8A 4BL7B 5J40A 3M3MA 2ON5A 1GSDA 2VM1A 1HQOA 5A1NB 1ZOFA 3Q74A 4OFTA 4MDCA 4OD7A 2C3TA 1Z3EA 3RPPA 1DSBA 2I4AA 4PNFA 3A3TA 3HYPA 4XRDA 5IO0A 4BWQA 1PMTA 3J7Yb 5CNWA 3KEBA 5DBQA 3I43A 2QSIA 3HKRA 1GSEA 5G31A 3NZNA 3VPQA 4HZ4A 1G6YA 2EFCA 1FOHA 6GSYA 5D9WA 1YZXA 2VCXA 5ECMB 4FYUA 1TK5B 1TXXA 1X0RA 4PURA 1TW9A 1Z7PA 4G0LA 1PX7A 4LMWA 3TOUA 3GHAA 3VWWA 1H75A 3ERGA 2H6ZA 3TJGA 3E9JB 2J23A 1AQXA 3L9VA 4PGTA 2YWMA 4ILFA 5INYA 1SKWB 3GKXA 4HJMA 2YN1A 3O6TA 1OE7A 1OC3A 2MYGA 4KW6A 17GSA 3FZ9A 4ISDA 5AGYA 3MDKA 2R2JA 3PR8A 6GSSA 3QR6A 2ALBA 4LMVA 5J9CA 2H1DA 2N5BA 1ERUA 2JSYA 3FK8A 3A2WA 3KM6A 1T4YA 1QMVA 1NW2A 5ECLB 4HUAA 3FHKA 4AKIA 4EKZA 5B8AA 4TN8A 1R5AA 2B5XA 3RBTA 4PXOA 1PRXA 1RQMA 5H5RA 4E68A 1AXDA 2GZYA 3TUEA 4Q5RA 2JL4A 1YKAA 3QD9A 1X9MB 1DE2A 3MYDA 2FWHA 5IO2A 3TKSE 5JWQB 5IMAA 4D73A 2LRTA 2GT5A 3DKSA 2F3MA 2VL3A 3VPTA 1AIUA 2X64A 1S3DA 3TKPA 3GIXA 4EF0A 2YV7A 5FWGA 2VCQA 1YKCA 3FMWA 3QMXA 4J2FA 3CBUA 2CZ3A 3FZAA 4MJEA 2XBQA 1S4BP 4OWYA 5A4UA 3HVNA 2H1AA 3EINA 2GQKA 19GSA 2H30A 2AAWA 2L4CA 18GSA 4G0IA 4HDEA 4JE1A 1A2LA 3LJRA 1FW1A 2HSMA 4WR5A 3D4TA 4POMA 4ECCA 1BEDA 1TK8B 3UVTA 4KH7A 5JWOB 4Q5QA 3QAWA 1TTZA 1DBYA 3Q6OA 4IJIA 4MF6A 1Z6NA 3LXTA 1O7UA 3D21A 3GUSA 3MIXA 2B1LA 3GKNA 2WVXA 3ZVJA 2LV3A 3APSA 4E8EA 2JADA 3GV1A 2HRNA 1URMA 5BMUB 1OAZA 1M2AA 2B3SA 3GMFA 3ME8A 2XC2A 5GZZB 1F9MA 2LKUA 3HXSA 5D96A 1OYJA 3EU3A 2L6DA 4JZQA 2CAIA 4OCEA 3F6DA 3KJYA 2HSNB 2DIZA 2CV4A 1A8YA 5DALB 1ABAA 3VI5A 3F4SA 2AYTA 1GSSA 1YDKA 5ECQB 1T4ZA 4G9HA 5D8IA 3CWGA 3BOAA 1V57A 3CYNA 1T00A 2YV9A 2H75A 1UVZA 4YQUA 5IMZA 1V58A 1GULA 2PBJA 2DKHA 2HZFA 1K0DA 1SJZA 1MDKA 4EIQA 1BG5A 3LQ7A 5J41A 3DVWA 1EGOA 4K2XA 2XHFA 1K3LA 1AAZA 2DMMA 2WS2A 4BVYA 3V1WA 2NPBA 1O85A 4IQ1A 4MPGA 4KNDA 1O8WA 5IMDA 1GRXA 5ENUA 1QK8A 5IMFA 3QOUA 3ZRDA 1R7HA 1CQHA 2HRKA 2QGVA 3CSHA 2K6VA 2REMA 3IA1A 1FOVA 3RHBA 2GT6A 4HQSA 5J4UA 5AN1A 4AF2A 3TB2A 3IE3A 4JRRA 2LRNA 2IIYA 1GTIA 2G2QA 3PH9A 4IN0A 2WRTA 2GSRA 1GH2A 2QKEA 4EO3A 5IMCA 4FIWA 3RFRC 4O7HA 1SVOA 3KTLA 2VD1A 1M99A 4MF7A 3M8NA 1JLWA 1C72A 6GSTA 5DQYA 5KN1A 1O8XA 2HZEB 2TIRA 5A5KA 2VD0A 5JWRB 1OVNA 3Q19A 1THXA 2FCHA 3L9SA 2IWTA 3FYGA 4ZB6A 2WVZA 3GTUB 1GTUA 2LQQA 4TXOB 4ZB9A 5IOXA 2B5EA 1MD3A 2P5RA 3AY8A 3L78A 3NOFA 5F06A 2Z9SA 4NMUA 2GSQA 5D9XA 3BD2A 2PGTA 4EXJA 4AJ8A 1FVJA 3IV4A 2O36A 5DAKA 2H76A 4NV5A 2TRCP 1G7OA 4EIPA 2K9FA 1K3OA 3WD6A 5C00A 4V2NA 5GSSA 1WMJA 2ZUPA 4PI2C 3MSZA 4F9ZA 5AISA 3GA4A 2CQ9A 5J47A 4FXYP 4HU9A 3D22A 2L6CA 1V2AA 4HI7A 1BG1A 5DVBA 1M7TA 4JR6A 3ZFBA 2G0FA 5H5SA 5JCWA 3DWVA 3ED3A 4NPBA 4WBJA 4NAXA 3BBYA 1EZKA 2VL2A 3CQFA 2IMFA 1EEMA 4JU5A 1EV9A 1HNBA 3IOSA 2XPEA 4WF5A 3VK9A 2VCTA 4NHZA 2GZZA 3D4MA 5IM9A 3O76A 2GTUA 2IMKA 3H79A 5J4VA 2V2GA 5ECNB 3ZTLA 4TR3A 3N5OA 2HRFA 3QAGA 5G2ZA 1BF5A 1KNGA 2LJKA 2H6YA 2MMZA 5CRGA 3O3TA 2OKAA 5EY6A 4OFMA 2O7KA 4YKGA 2H6XA 1FVKA 3GL3A 1AQVA 2LJAA 2ZCTA 1SJIA 1TK0B 1BQ7A 1YY7A 1F3AA 2O5VA 2CAQA 1UN2A 2EIOA 2LNTA 3QDNA 3TKRA 4XS4B 1M0UA 3DIEA 3ZITA 2OBIA 2PU9C 2D2ZA 2H0HA 3RGBC 2JZRA 3GKKA 3QPMA 4FO5A 2X8HA 3A2VA 1U3AA 4ZL7A 4O5RA 4K8MA 4KDUA 3C73A 5A4VA 2H8LA 5CRDA 1TI3A 4GSSA 2EFEA 2B7KA 3IHGA 2P5QA 5EPFA 4KF9A 2FHEA 1T8EB 3HVXA 2OT3A 1TDIA 4K7OA 2L57A 1R26A 3TKSC 4IW9A 4DSQA 4XHMA 1WE0A 4XRAA 1KEBA 1K0BA 2JSZA 3FR9A 5ELGA 4N30A 3A5IA 4MZWA 3NIVA 5ECKB 2KOKA 4TRXA 4ZBDA 2FD3A 4EL1A 1K0NA 4AKGA 2C8UA 2DJJA 4Q5NA 2KHPA 2FWEA 3C8EA 2O89A 2DJ1A 4MH3A 2H1GA 5F8BA 4DVCA 2LS5A 4POKA 3IDVA 4TR1B 3VLNA 4HOJA 1EV4A 1Z5YE 1S3CA 1VF4A 4KDXA 2O3EA 3HCZA 4V2LA 1A8LA 2EFDA 1YF0A 3A5WA 2A4VA 1EOHA 1ZYPA 3F8UA 1PGTA 5F0GA 2HI7A 1S3RA 2IFQA 4GDFA 1QUWA 1I9DA 4CY6A 4G10A 3GN3A 2C80A 3C1SA 2IMIA 5A5HB 1GSFA 3N9JA 1SENA 1Y6EA 1ZMAA 2C0GA 1XZOA 3GFKA 4YAVA 4AGSA 4TXVA 1TXUA 1R5PA 3EC3A 1TRSA 1T3BA 5A34A 4K7IA 4CY8A 3UOMA 4PUAA 2B5YA 4USSA 3FZ5A 2M72A 4L0WA 2YCDA 1GLPA 5ECOB 1V40A 3HJOA 4I2TA 4ML1A 3L9UA 1PN9A 1A0FA 4K0NA 2A2PA 1F37A 3KD0A 5IPGA 4POBA 1AQWA 3FKFA 1OKTA 1WIKA 3GX8A 3VFIA 1SK0A 1XCCA 1SL0B 5DCHA 4GQFA 3ZFLA 1SK1A 1USBA 4ID0A 1K0CA 2HSHA 3BCKA 3G9BA 2J9HA 3MAKA 4KGIA 3G7YA 4MH2A 3HJMA 3ZZXA 4HJ2A 2WW1A 1ERTA 2R37A 4BA7A 2VCWA 5ECSA 2C0DA 2WVYA 4IJ3A 1LJRA 1GP1A 4TR0A 4OO4A 2WDUA 2P31A 1LBKA 1VF2A 4F82A 2WZ9A 1PD21 1YEWC 1TRUA 2A2RA 4X0XA 3CSIA 4XTSA 2E0QA 1X9SB 4G01A 3M1GA 5HR0A 3U5RE 2B1KA 3APQA 1EOGA 4Z7XA 1X5EA 4GSTA 2GLRA 1Z9HA 3K8NA 5G30A 2PWJA 3FEUA 2CVBA 2FLSA 3VWVA 4GXZA 4POLA 3I69A 6GSUA 4O32A 1XWGA 2FWFA 1K0AA 2GSTA 2YWNA 3US3A 2OACA 2H0IA 1TJDA 3L0HA 4ZL9A 3RAZA 2H1BA 1JZOA 1GWCA 4K1FA 2YZUA 3ZYWA 3U6VA 5A4WA 2DKIA 3DRNA 1SYXA 1ON4A 4D73B 2JACA 2RIIA 3GNJA 4FQUA 2R0GA 1ILOA 4W66A 1Q98A 4HS1A 2DBCA 4K2DA 3LORA 2F8AA 2LTKA 5ID2A 2VLTA 3E3EA 4KSMA 2CZ2A 4PQ1A 3CTFA 2F9SA 9GSSA 3LG6A 4YH2A 1XWCA 2OJLA 2C1YA 1U3IA 3F63A 3WT2A 4IHUA 1FO5A 2HSMB 5IQYA 5J4YA 1YJ6A 3FY7A 1CQGA 5ECRB 4Q5FA 2RM6A 3P8WA 4N10A 5DJMA 2HNLA 3WYWA 2VL9A 3R3EA 2N5FA 3EYTA 1PKZA 4Z2TA 1ZZYA 3TRXA 2AV4A 3H93A 1O81A 4EDZA 2RUEA 4WR4A 3TKQA 3IR4A 3TJBA 2WVXB 3APOA 3R2QA 3LGCA 1ZYEA 4TW5A 3WGXA 1J08A 1ERVA 4O5QA 1W89A 4V1Ag 4TVEA 2XBIA 3UARA 3L4NA 5LNKe 2DLXA 3ME7A 1R4WA 3KP9A 4ECJA 5CO3A 2AB6A 3HHVA 4FH8A 4WXTA 3RPNA 4ZB7A 2YP6A 2GQLA 1YQ1A 1XFLA 2X8GA 3D6IA 3LYPA 2WCIA 1A24A 1B4QA 1NHYA 2H73A 1FB6A 3UBLA 2IPAA 3HA9A 2VUPA 2V41A 2L4QA 3IK7A 3TU3B 4GLTA 3UL3A 3EPTA 3KMNA 2NDOA 1HNCA 1Z7RA 3WGEA
chains in the Genus database with same CATH topology
2YJHA 4FYCA 1F3BA 5HFGA 3Q18A 4F0BA 2IN3A 3KZQA 2L5OA 3CXGA 2F8FA 3ZIVA 4RUVA 5D9VA 4K0GA 4BVYB 2OE3A 2H19A 2YPMA 1T1VA 3H4KA 1TI1A 2QC7A 4EC0A 1N2AA 2O85A 3DXBA 2HRKB 5B6MA 4YQVA 1M2DA 1ACVA 1X5CA 2H74A 5ECIB 1ML6A 4MCUA 3TRQA 1GL8A 1RK4A 3TOTA 5KEJA 3G7IA 6GSWA 5DQSA 1J9BA 4RI7A 4LLRA 3EE2A 2BMXA 2ZNMA 2WULA 2LQOA 3S9FA 3GSTA 2GDRA 4QMKA 1XWKA 3P90A 4MZBA 1SK2A 3UVHA 4DSSA 3TRPA 1A2MA 3VURA 4PQIA 2CVDA 5LCZA 5J5NA 1B48A 4CDOA 1MDJA 1EGRA 4ZXGA 2V6KA 2WFCA 2H1LA 1X5DA 1XIYA 1PSQA 1GUKA 2MZCA 1Q4JA 4RQXA 4BVXA 3MWHA 1SD8A 3KH9A 4KUNA 2PERA 4RQRA 2VL2C 13GSA 4XS6A 1MDIA 2B6MA 2EFHA 2PVQA 1FAAA 3DEXA 3CMIA 3HVVA 5DAKB 2R0PA 3QFBC 4EVMA 2OADA 4YQMA 4QL9A 1M2BA 2UZ8A 3KTBA 3W6GA 3HVSA 4BWSA 1A23A 4MF5A 2AJQB 1E2YA 3KGKA 1OC9A 3GH9A 3HY2A 1XVWA 1TU7A 4X4JA 1RW1A 3IAM2 2DC5A 1X9WB 2ES7A 1ERWA 3KP8A 4G19A 3CTGA 5IIZA 5KN0A 1YVLA 2K8SA 3C7MA 3TJJA 4F0CA 3FW2A 5CRWA 1NHOA 4Z2UA 4WKWA 1GSQA 1F6MC 3PGTA 1M9AA 1AW9A 3EURA 4A5PA 4EDYA 3H8QA 4IP1A 5CYYA 2C0EA 1GTAA 2WJUA 3GYKA 1Y1UA 2CX4A 2PVOC 4MJBA 3TJFA 3VWUA 3FR3A 2IJYA 5G5FA 3GX0A 3IPZA 2C0FA 1TKDB 3F3RA 5KN2A 4BL7A 3LW9A 1J0FA 5AIVA 4AJ6A 4KSOA 4CHSA 2QA1A 2EIQA 3WGDA 5A1NA 4DSRA 3EMXA 5ECPB 4NWYA 3KXOA 4X43A 2CT6A 1WP0A 3TCOA 1H4OA 2FNOA 1UC7A 1JLVA 1G6WA 1W4VA 2GQMA 3OR5A 1B9XC 2HXKA 1VF3A 4ECBA 2R6KA 4ULXA 1U6TA 1SKSB 5IOWA 5F05A 1PQNA 3ZIJA 3W8JA 1WPIA 2JZSA 3DYRA 4N3ZA 2HE3A 4X1UA 5HR2A 4K5RA 2OE1A 4IELA 2OA7A 1NSWA 5DDLA 4ML6A 1THOA 4AI6A 1G7EA 4CW9A 2E7PA 1ZL9A 5FT3A 4ZILA 2PMTA 2KLXA 4KCAA 22GSA 4I5QA 3A2XA 2WGRA 3TJKA 4HZ2A 4O92A 1QXHA 2PUKC 4F2IA 2R4VA 1O6JA 2VM2A 1GSUA 5KOWA 2FUG2 3ZVJD 4PTSA 4AKHA 1NM3A 2HLSA 2M46A 5D73A 4V1Ap 4WETA 1FG4A 4GRFA 3QFAC 2E2GA 2VOCA 2CVKA 5H5QA 3HJPA 4NXIA 5HQPA 1XWAA 3CSJA 3CRUA 2VCVA 1U88A 2VIMA 1WRYA 4P3YB 1B4PA 4DEJA 4KCEA 3GURA 12GSA 5IMVA 1TRWA 4V2MA 3LYKA 1GUMA 1IYIA 4MNNA 1GUHA 2LSTA 1MEKA 3P7XA 2LRCA 1GSYA 3GRXA 2B7JA 2PPTA 4PNGA 5CAXA 3PINA 3FRCA 1WWJA 1B8XA 3KIJA 1S3AA 1OKDA 2L5LA 3DGQA 4ZL8A 2IFQB 3HDCA 2DJ0A 3IAS2 2IL3A 1ZCPA 4O5UA 2X99A 1PX6A 4N0VA 1EEJA 6GSVA 4IGJA 1DUGA 4HQZA 3CRTA 1N8JA 3F0IA 2V6OA 2C4JA 5A34B 1SVLA 4XIHA 2YOIA 1VGLA 1I5GA 2HFDA 3TDGA 1HNAA 2AHEA 2GS3A 5COHA 3IC4A 2DSAA 6GSXA 4N11A 4TOPA 5G5EA 1QGVA 4E8HA 2VLUA 2VKZG 3HZ4A 4YAPA 2I81A 3VWXA 2MBTA 1VRSD 4JR4A 1AC1A 4KA0A 1BJXA 3H1NA 2X4AA 1HYUA 2MMAA 2P0GA 2QA2A 3F9UA 4JEDA 2R5GA 4I6XA 1K0OA 1WOUA 1SL2B 3UIWA 1JFUA 3PPUA 3ZMKA 4ZBAA 3EVIA 2VO4A 3ERFA 2YZHA 4KE3A 1XW5A 2TRXA 4ICYA 4MPFA 3LWAA 1TU8A 4K9ZA 4QQ7A 1U87A 1A2JA 4MJCA 5J9BA 8GSSA 4WBRD 3LSZA 2DJ2A 2H01A 5BMUA 5GAND 4IP6A 3W8SA 3DMLA 4L5OA 5B8BA 5B6NA 5G1LA 1PL1A 2MMOA 2HSNA 1Z6MA 1WJKA 4PUFC 5KOXA 5CREA 5C04A 5ABRA 5B7CA 2EC4A 4NV2A 2V1MA 3F3QA 2FGXA 3QCPA 1HD2A 5J3RA 5DALA 3M9JA 1M9BA 4GCIA 3BJ5A 5HR1A 4J56E 1N25A 1ZYQB 2OBKA 3UMAA 5ECHB 2VLVA 2FA8A 1GNEA 4QL7A 5AIXA 2F51A 1VF1A 2X49A 3KCMA 5L71A 2GGTA 5LD0A 4L0UA 2GSSA 3HD5A 2DJKA 4AJ7A 2I1UA 2IMEA 1FHEA 2OE0A 4HEA2 2LJRA 4WF4A 3D5JA 2H66A 4OMVA 2V32A 4NHWA 3ZREA 2XPDA 3J7Yk 4GSNA 3DVXA 4GWRA 5G1KA 4MZCA 10GSA 3BCIA 3P2AA 1IYHA 2CX3A 2A2SA 1G0TA 3ERWA 2YWOA 1FB0A 4G0KA 1BYEA 5FHIA 1EWXA 5ID2B 4XCSA 2CA8A 3SBCA 4N0ZA 1ZYNA 4IQAA 2MMNA 1SVMA 1KTEA 1O73A 2FY6A 4KAEA 2R0CA 3D0ZA 3JCML 3C71A 1V98A 3LXZA 5JCGA 2H72A 1Y25A 4KX4A 1E6BA 2HRAA 3G7JA 2FA4A 1PA3A 2HYXA 2HZEA 20GSA 2HSYA 2RM5A 4OFNA 4RI6A 4MA9A 4MLYA 2R3XA 3FR6A 2BTOT 2AUVA 3GTUA 2I3YA 4GF0A 4KB3A 1XVQA 1A0RP 1JZWA 4TXOA 3GH6A 1UA5A 2KP2A 3LFLA 2EIRA 3IRAA 3ISOA 3UBKA 2I9HA 1SYRA 4GQCA 5CP1A 3FZ4A 2H70A 1XXUA 2KP1A 3GL5A 4FYBA 1XW9A 1PN0A 5D93A 1F2EA 5CRHA 3VI7A 4IKHA 1XOAA 2FWGA 1K3YA 2RUFA 2ON7A 2JU5A 3IK9A 1GLQA 1K0MA 3KH7A 1OE8A 7GSSA 1GNWA 1GTBA 4IS0A 1T7PB 4IBPA 3ZL5A 4XS1A 1DE1A 4EUYA 5E59A 5D9TA 4ACSA 1BAYA 2K18A 2X8CA 11GSA 1ST9A 4IVFA 1SJ6A 3F4RA 1XOBA 1AUCA 3MNGA 1V9WA 2A4HA 4TR4A 4PQHA 4K7NA 2IMDA 2K8VA 2N5AA 4OO5A 3ZLPA 1B9YC 4ZBBA 2H0GA 4OCFA 2DJ3A 5HFIA 4GTUA 2DMLA 3EU4A 1XBSA 2KUCA 4MMMA 2RLIA 2O87A 3I6AA 4PX1A 4XS4A 16GSA 1SKRB 4LA1A 2NVLA 1JHBA 2LEGA 3GSSA 2UV8G 1TRVA 3SWLA 2YWIA 2JZTA 5HFKA 3HZ8A 5E4WA 1OC8A 4HU7A 1YF1A 4L5LA 4H86A 2C3NA 3M0FA 2YANA 3IHQA 2GVPA 3IC8A 3RDWA 1SD9A 2C3QA 1TP9A 4JBBA 3C1RA 3EMPA 3WT1A 4DSSB 4MK3A 1BX9A 3QAVA 1EP7A 1YEPA 4I2UA 5JCUA 4K6XA 2VCZA 2LNSA 4WEYA 3UAPA 5GAPD 5BRTA 3I9V2 4LL4B 1XWBA 2VAFA 3IBHA 1SU9A 3M9KA 2L59A 5IPHA 1JZRA 4AKXB 2HQTA 4ECIA 1YEXA 4EE0A 4BPYA 4I8BA 4BVXB 2LUSA 3RHCA 5F07A 4J57E 3HMJG 5GSTA 5ELAA 2YJ7A 4LL1B 2BJXA 3UJ1A 2MBSA 3LEFA 2O8VB 4YKFA 1SL1B 1MTCA 3DD3A 2HT9A 2YNXA 1LU4A 1JZDA 2NBSA 2M80A 1XW6A 4TR1A 2GZPA 1ZGNA 4KDYA 1OC9B 4F03A 5DCGA 2NTOA 3GKMA 2H71A 3TKSA 4Z2RA 3EWLA 1QQ2A 2WB9A 4ZB8A 4MP4A 1PL2A 3F4TA 4TKYA 1MD4A 3UEMA 2E2MA 4G2EA 4L8EA 4MJAA 14GSA 5KN3A 2PN8A 2DIYA 1EP8A 5DJLA 4I97A 1XPVA 3TGZA 4ZIJA 3KMOA 4K5SA 5A5HA 1PKWA 4MABA 3F6FA 1KBNA 3E0UA 1QFNA 3IXRA 3ZMLA 1TOFA 5EVOA 5HR3A 5EL8A 4BL7B 5J40A 3M3MA 2ON5A 1GSDA 2VM1A 1HQOA 5A1NB 1ZOFA 3Q74A 4OFTA 4MDCA 4OD7A 2C3TA 1Z3EA 3RPPA 1DSBA 2I4AA 4PNFA 3A3TA 3HYPA 4XRDA 5IO0A 4BWQA 1PMTA 3J7Yb 5CNWA 3KEBA 5DBQA 3I43A 2QSIA 3HKRA 1GSEA 5G31A 3NZNA 3VPQA 4HZ4A 1G6YA 2EFCA 1FOHA 6GSYA 5D9WA 1YZXA 2VCXA 5ECMB 4FYUA 1TK5B 1TXXA 1X0RA 4PURA 1TW9A 1Z7PA 4G0LA 1PX7A 4LMWA 3TOUA 3GHAA 3VWWA 1H75A 3ERGA 2H6ZA 3TJGA 3E9JB 2J23A 1AQXA 3L9VA 4PGTA 2YWMA 4ILFA 5INYA 1SKWB 3GKXA 4HJMA 2YN1A 3O6TA 1OE7A 1OC3A 2MYGA 4KW6A 17GSA 3FZ9A 4ISDA 5AGYA 3MDKA 2R2JA 3PR8A 6GSSA 3QR6A 2ALBA 4LMVA 5J9CA 2H1DA 2N5BA 1ERUA 2JSYA 3FK8A 3A2WA 3KM6A 1T4YA 1QMVA 1NW2A 5ECLB 4HUAA 3FHKA 4AKIA 4EKZA 5B8AA 4TN8A 1R5AA 2B5XA 3RBTA 4PXOA 1PRXA 1RQMA 5H5RA 4E68A 1AXDA 2GZYA 3TUEA 4Q5RA 2JL4A 1YKAA 3QD9A 1X9MB 1DE2A 3MYDA 2FWHA 5IO2A 3TKSE 5JWQB 5IMAA 4D73A 2LRTA 2GT5A 3DKSA 2F3MA 2VL3A 3VPTA 1AIUA 2X64A 1S3DA 3TKPA 3GIXA 4EF0A 2YV7A 5FWGA 2VCQA 1YKCA 3FMWA 3QMXA 4J2FA 3CBUA 2CZ3A 3FZAA 4MJEA 2XBQA 4OWYA 5A4UA 2H1AA 3EINA 2GQKA 19GSA 2H30A 2AAWA 2L4CA 18GSA 4G0IA 4HDEA 4JE1A 1A2LA 3LJRA 1FW1A 2HSMA 4WR5A 3D4TA 4POMA 4ECCA 1BEDA 1TK8B 3UVTA 4KH7A 5JWOB 4Q5QA 3QAWA 1TTZA 1DBYA 3Q6OA 4IJIA 4MF6A 1Z6NA 3LXTA 1O7UA 3D21A 3GUSA 3MIXA 2B1LA 3GKNA 3ZVJA 2LV3A 3APSA 4E8EA 2JADA 3GV1A 2HRNA 1URMA 5BMUB 1OAZA 1M2AA 2B3SA 3GMFA 3ME8A 2XC2A 5GZZB 1F9MA 2LKUA 3HXSA 5D96A 1OYJA 3EU3A 2L6DA 4JZQA 2CAIA 4OCEA 3F6DA 3KJYA 2HSNB 2DIZA 2CV4A 1A8YA 5DALB 1ABAA 3VI5A 3F4SA 2AYTA 1GSSA 1YDKA 5ECQB 1T4ZA 4G9HA 5D8IA 3CWGA 3BOAA 1V57A 3CYNA 1T00A 2YV9A 2H75A 1UVZA 4YQUA 5IMZA 1V58A 1GULA 2PBJA 2DKHA 2HZFA 1K0DA 1SJZA 1MDKA 4EIQA 1BG5A 3LQ7A 5J41A 3DVWA 1EGOA 4K2XA 2XHFA 1K3LA 1AAZA 2DMMA 2WS2A 4BVYA 3V1WA 2NPBA 1O85A 4IQ1A 4MPGA 4KNDA 1O8WA 5IMDA 1GRXA 5ENUA 1QK8A 5IMFA 3QOUA 3ZRDA 1R7HA 1CQHA 2HRKA 2QGVA 3CSHA 2K6VA 2REMA 3IA1A 1FOVA 3RHBA 2GT6A 4HQSA 5J4UA 5AN1A 4AF2A 3TB2A 3IE3A 4JRRA 2LRNA 2IIYA 1GTIA 2G2QA 3PH9A 4IN0A 2WRTA 2GSRA 1GH2A 2QKEA 4EO3A 5IMCA 4FIWA 4O7HA 1SVOA 3KTLA 2VD1A 1M99A 4MF7A 3M8NA 1JLWA 1C72A 6GSTA 5DQYA 5KN1A 1O8XA 2HZEB 2TIRA 5A5KA 2VD0A 5JWRB 1OVNA 3Q19A 1THXA 2FCHA 3L9SA 2IWTA 3FYGA 4ZB6A 3GTUB 1GTUA 2LQQA 4TXOB 4ZB9A 5IOXA 2B5EA 1MD3A 2P5RA 3AY8A 3L78A 3NOFA 5F06A 2Z9SA 4NMUA 2GSQA 5D9XA 3BD2A 2PGTA 4EXJA 4AJ8A 1FVJA 3IV4A 5DAKA 2H76A 4NV5A 2TRCP 1G7OA 4EIPA 2K9FA 1K3OA 3WD6A 5C00A 4V2NA 5GSSA 1WMJA 2ZUPA 4F9ZA 3MSZA 5AISA 3GA4A 2CQ9A 5J47A 4HU9A 3D22A 2L6CA 1V2AA 4HI7A 1BG1A 5DVBA 1M7TA 4JR6A 3ZFBA 2G0FA 5H5SA 5JCWA 3DWVA 3ED3A 4NPBA 4WBJA 4NAXA 3BBYA 1EZKA 2VL2A 2IMFA 1EEMA 4JU5A 1EV9A 1HNBA 3IOSA 2XPEA 4WF5A 3VK9A 2VCTA 4NHZA 2GZZA 3D4MA 5IM9A 3O76A 2GTUA 2IMKA 3H79A 5J4VA 2V2GA 5ECNB 3ZTLA 4TR3A 3N5OA 2HRFA 3QAGA 5G2ZA 1BF5A 1KNGA 2LJKA 2H6YA 2MMZA 5CRGA 3O3TA 2OKAA 5EY6A 4OFMA 2O7KA 4YKGA 2H6XA 1FVKA 3GL3A 1AQVA 2LJAA 2ZCTA 1SJIA 1TK0B 1BQ7A 1YY7A 1F3AA 2O5VA 2CAQA 1UN2A 2EIOA 2LNTA 3QDNA 3TKRA 4XS4B 1M0UA 3DIEA 3ZITA 2OBIA 2PU9C 2D2ZA 2H0HA 2JZRA 3GKKA 3QPMA 4FO5A 2X8HA 3A2VA 1U3AA 4ZL7A 4O5RA 4K8MA 4KDUA 3C73A 5A4VA 2H8LA 5CRDA 1TI3A 4GSSA 2EFEA 2B7KA 3IHGA 2P5QA 5EPFA 4KF9A 2FHEA 1T8EB 3HVXA 2OT3A 1TDIA 4K7OA 2L57A 1R26A 3TKSC 4IW9A 4DSQA 4XHMA 1WE0A 4XRAA 1KEBA 1K0BA 2JSZA 3FR9A 5ELGA 4N30A 3A5IA 4MZWA 3NIVA 5ECKB 2KOKA 4TRXA 4ZBDA 2FD3A 4EL1A 1K0NA 4AKGA 2C8UA 2DJJA 4Q5NA 2KHPA 2FWEA 3C8EA 2O89A 2DJ1A 4MH3A 2H1GA 5F8BA 4DVCA 2LS5A 4POKA 3IDVA 4TR1B 3VLNA 4HOJA 1EV4A 1Z5YE 1S3CA 1VF4A 4KDXA 3HCZA 4V2LA 1A8LA 2EFDA 1YF0A 3A5WA 2A4VA 1EOHA 1ZYPA 3F8UA 1PGTA 5F0GA 2HI7A 2IFQA 4GDFA 1QUWA 1I9DA 4CY6A 4G10A 3GN3A 2C80A 3C1SA 2IMIA 5A5HB 1GSFA 3N9JA 1SENA 1Y6EA 1ZMAA 2C0GA 1XZOA 3GFKA 4YAVA 4AGSA 4TXVA 1TXUA 1R5PA 3EC3A 1TRSA 1T3BA 5A34A 4K7IA 4CY8A 3UOMA 4PUAA 2B5YA 4USSA 3FZ5A 2M72A 4L0WA 2YCDA 1GLPA 5ECOB 1V40A 3HJOA 4I2TA 4ML1A 3L9UA 1PN9A 1A0FA 4K0NA 2A2PA 1F37A 3KD0A 5IPGA 4POBA 1AQWA 3FKFA 1OKTA 1WIKA 3GX8A 3VFIA 1SK0A 1XCCA 1SL0B 5DCHA 4GQFA 3ZFLA 1SK1A 1USBA 4ID0A 1K0CA 2HSHA 3BCKA 3G9BA 2J9HA 3MAKA 4KGIA 3G7YA 4MH2A 3HJMA 3ZZXA 4HJ2A 1ERTA 2R37A 4BA7A 2VCWA 5ECSA 2C0DA 4IJ3A 1LJRA 1GP1A 4TR0A 4OO4A 2WDUA 2P31A 1LBKA 1VF2A 4F82A 2WZ9A 1PD21 1TRUA 2A2RA 4X0XA 3CSIA 4XTSA 2E0QA 1X9SB 4G01A 3M1GA 5HR0A 3U5RE 2B1KA 3APQA 1EOGA 4Z7XA 1X5EA 4GSTA 2GLRA 1Z9HA 3K8NA 5G30A 2PWJA 3FEUA 2CVBA 2FLSA 3VWVA 4GXZA 4POLA 3I69A 6GSUA 4O32A 1XWGA 2FWFA 1K0AA 2GSTA 2YWNA 3US3A 2OACA 2H0IA 1TJDA 3L0HA 4ZL9A 3RAZA 2H1BA 1JZOA 1GWCA 4K1FA 2YZUA 3ZYWA 3U6VA 5A4WA 2DKIA 3DRNA 1SYXA 1ON4A 4D73B 2JACA 2RIIA 3GNJA 4FQUA 2R0GA 1ILOA 4W66A 1Q98A 4HS1A 2DBCA 4K2DA 3LORA 2F8AA 2LTKA 5ID2A 2VLTA 3E3EA 4KSMA 2CZ2A 4PQ1A 3CTFA 2F9SA 9GSSA 3LG6A 4YH2A 1XWCA 2OJLA 2C1YA 1U3IA 3F63A 3WT2A 4IHUA 1FO5A 2HSMB 5IQYA 5J4YA 1YJ6A 3FY7A 1CQGA 5ECRB 4Q5FA 2RM6A 3P8WA 4N10A 5DJMA 2HNLA 3WYWA 2VL9A 3R3EA 2N5FA 3EYTA 1PKZA 4Z2TA 1ZZYA 3TRXA 2AV4A 3H93A 1O81A 4EDZA 2RUEA 4WR4A 3TKQA 3IR4A 3TJBA 3APOA 3R2QA 3LGCA 1ZYEA 4TW5A 3WGXA 1J08A 1ERVA 4O5QA 1W89A 4V1Ag 4TVEA 2XBIA 3UARA 3L4NA 5LNKe 2DLXA 3ME7A 1R4WA 3KP9A 4ECJA 5CO3A 2AB6A 3HHVA 4FH8A 4WXTA 3RPNA 4ZB7A 2YP6A 2GQLA 1YQ1A 1XFLA 2X8GA 3D6IA 3LYPA 2WCIA 1A24A 1B4QA 1NHYA 2H73A 1FB6A 3UBLA 2IPAA 3HA9A 2VUPA 2V41A 2L4QA 3IK7A 3TU3B 4GLTA 3UL3A 3EPTA 3KMNA 2NDOA 1HNCA 1Z7RA 3WGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJH A;  4FYC A;  1F3B A;  5HFG A;  3Q18 A;  4F0B A;  2IN3 A;  3KZQ A;  2L5O A;  3CXG A;  2F8F A;  3ZIV A;  4RUV A;  5D9V A;  4K0G A;  4BVY B;  2OE3 A;  2H19 A;  2YPM A;  1T1V A;  3H4K A;  1TI1 A;  2QC7 A;  4EC0 A;  1N2A A;  2O85 A;  3DXB A;  2HRK B;  5B6M A;  4YQV A;  1M2D A;  1ACV A;  1X5C A;  2H74 A;  5ECI B;  1ML6 A;  4MCU A;  3TRQ A;  1GL8 A;  1RK4 A;  3TOT A;  5KEJ A;  3G7I A;  6GSW A;  5DQS A;  1J9B A;  4RI7 A;  4LLR A;  3EE2 A;  2BMX A;  2ZNM A;  2WUL A;  2LQO A;  3S9F A;  3GST A;  2GDR A;  1XWK A;  3P90 A;  4MZB A;  1SK2 A;  3UVH A;  4DSS A;  3TRP A;  1A2M A;  3VUR A;  4PQI A;  2CVD A;  5LCZ A;  5J5N A;  1B48 A;  4CDO A;  1MDJ A;  1EGR A;  4ZXG A;  2V6K A;  2WFC A;  1X5D A;  1XIY A;  1PSQ A;  1GUK A;  2MZC A;  1Q4J A;  4RQX A;  4BVX A;  3MWH A;  1SD8 A;  3KH9 A;  4KUN A;  2PER A;  4RQR A;  2VL2 C;  13GS A;  4XS6 A;  1MDI A;  2B6M A;  2PVQ A;  1FAA A;  3DEX A;  3CMI A;  3HVV A;  5DAK B;  3QFB C;  4EVM A;  2OAD A;  4YQM A;  4QL9 A;  1M2B A;  2UZ8 A;  3KTB A;  3W6G A;  3HVS A;  4BWS A;  1A23 A;  4MF5 A;  2AJQ B;  1E2Y A;  3KGK A;  1OC9 A;  3GH9 A;  3HY2 A;  1XVW A;  1TU7 A;  1RW1 A;  3IAM 2;  2DC5 A;  1X9W B;  2ES7 A;  1ERW A;  3KP8 A;  4G19 A;  3CTG A;  5IIZ A;  5KN0 A;  2K8S A;  3C7M A;  3TJJ A;  4F0C A;  3FW2 A;  5CRW A;  1NHO A;  4WKW A;  1GSQ A;  1F6M C;  3PGT A;  1M9A A;  1AW9 A;  3EUR A;  4EDY A;  3H8Q A;  4IP1 A;  5CYY A;  2C0E A;  1GTA A;  2WJU A;  3GYK A;  2CX4 A;  2PVO C;  4MJB A;  3TJF A;  3VWU A;  3FR3 A;  2IJY A;  5G5F A;  3GX0 A;  3IPZ A;  2C0F A;  1TKD B;  3F3R A;  5KN2 A;  4BL7 A;  1J0F A;  5AIV A;  4AJ6 A;  4KSO A;  4CHS A;  2EIQ A;  3WGD A;  4DSR A;  3EMX A;  5ECP B;  4NWY A;  3KXO A;  4X43 A;  2CT6 A;  1WP0 A;  3TCO A;  1H4O A;  2FNO A;  1UC7 A;  1JLV A;  1G6W A;  1W4V A;  2GQM A;  3OR5 A;  1B9X C;  2HXK A;  1VF3 A;  4ECB A;  2R6K A;  4ULX A;  1U6T A;  1SKS B;  5IOW A;  5F05 A;  1PQN A;  3ZIJ A;  3W8J A;  1WPI A;  2JZS A;  3DYR A;  4X1U A;  2HE3 A;  5HR2 A;  2OE1 A;  4IEL A;  2OA7 A;  1NSW A;  5DDL A;  4ML6 A;  1THO A;  1G7E A;  4CW9 A;  2E7P A;  1ZL9 A;  5FT3 A;  4ZIL A;  2PMT A;  2KLX A;  4KCA A;  22GS A;  4I5Q A;  3A2X A;  2WGR A;  3TJK A;  4HZ2 A;  4O92 A;  1QXH A;  2PUK C;  4F2I A;  2R4V A;  1O6J A;  2VM2 A;  1GSU A;  2FUG 2;  3ZVJ D;  4PTS A;  1NM3 A;  2HLS A;  2M46 A;  5D73 A;  4V1A p;  4WET A;  1FG4 A;  4GRF A;  3QFA C;  2E2G A;  2VOC A;  2CVK A;  5H5Q A;  3HJP A;  4NXI A;  5HQP A;  1XWA A;  3CSJ A;  3CRU A;  2VCV A;  1U88 A;  2VIM A;  1WRY A;  4P3Y B;  1B4P A;  4DEJ A;  4KCE A;  3GUR A;  12GS A;  5IMV A;  1TRW A;  4V2M A;  3LYK A;  1GUM A;  1IYI A;  1GUH A;  2LST A;  1MEK A;  3P7X A;  2LRC A;  1GSY A;  3GRX A;  2B7J A;  2PPT A;  4PNG A;  5CAX A;  3PIN A;  3FRC A;  1WWJ A;  1B8X A;  3KIJ A;  1S3A A;  1OKD A;  2L5L A;  3DGQ A;  4ZL8 A;  2IFQ B;  3HDC A;  2DJ0 A;  3IAS 2;  2IL3 A;  1ZCP A;  2X99 A;  1PX6 A;  4N0V A;  1EEJ A;  6GSV A;  4IGJ A;  1DUG A;  4HQZ A;  3CRT A;  1N8J A;  3F0I A;  2V6O A;  2C4J A;  4XIH A;  2YOI A;  1VGL A;  1I5G A;  2HFD A;  3TDG A;  1HNA A;  2AHE A;  2GS3 A;  5COH A;  3IC4 A;  2DSA A;  6GSX A;  4N11 A;  4TOP A;  5G5E A;  1QGV A;  4E8H A;  2VLU A;  3HZ4 A;  4YAP A;  2I81 A;  3VWX A;  2MBT A;  1VRS D;  4JR4 A;  1AC1 A;  4KA0 A;  1BJX A;  3H1N A;  1HYU A;  2MMA A;  2P0G A;  3F9U A;  4JED A;  2R5G A;  4I6X A;  1K0O A;  1WOU A;  1SL2 B;  3UIW A;  1JFU A;  3PPU A;  3ZMK A;  4ZBA A;  3EVI A;  2VO4 A;  3ERF A;  2YZH A;  4KE3 A;  1XW5 A;  2TRX A;  4MPF A;  3LWA A;  1TU8 A;  4K9Z A;  4QQ7 A;  1U87 A;  1A2J A;  4MJC A;  5J9B A;  8GSS A;  4WBR D;  3LSZ A;  2DJ2 A;  2H01 A;  5BMU A;  5GAN D;  4IP6 A;  3W8S A;  3DML A;  4L5O A;  5B8B A;  5B6N A;  5G1L A;  1PL1 A;  2MMO A;  1Z6M A;  1WJK A;  4PUF C;  5CRE A;  5C04 A;  5ABR A;  5B7C A;  2EC4 A;  4NV2 A;  2V1M A;  3F3Q A;  2FGX A;  3QCP A;  1HD2 A;  5J3R A;  5DAL A;  3M9J A;  1M9B A;  4GCI A;  3BJ5 A;  5HR1 A;  4J56 E;  1ZYQ B;  2OBK A;  3UMA A;  5ECH B;  2VLV A;  2FA8 A;  1GNE A;  4QL7 A;  5AIX A;  2F51 A;  1VF1 A;  3KCM A;  5L71 A;  2GGT A;  5LD0 A;  4L0U A;  2GSS A;  3HD5 A;  2DJK A;  4AJ7 A;  2I1U A;  2IME A;  1FHE A;  2OE0 A;  4HEA 2;  2LJR A;  4WF4 A;  3D5J A;  2H66 A;  4OMV A;  2V32 A;  4NHW A;  3ZRE A;  2XPD A;  3J7Y k;  4GSN A;  3DVX A;  4GWR A;  5G1K A;  4MZC A;  10GS A;  3BCI A;  3P2A A;  1IYH A;  2CX3 A;  2A2S A;  1G0T A;  2YWO A;  3ERW A;  1FB0 A;  4G0K A;  1BYE A;  5FHI A;  1EWX A;  5ID2 B;  4XCS A;  2CA8 A;  3SBC A;  4N0Z A;  4IQA A;  2MMN A;  1KTE A;  1O73 A;  2FY6 A;  4KAE A;  3D0Z A;  3JCM L;  3C71 A;  1V98 A;  3LXZ A;  5JCG A;  2H72 A;  1Y25 A;  4KX4 A;  1E6B A;  2HRA A;  3G7J A;  2FA4 A;  1PA3 A;  2HYX A;  2HZE A;  20GS A;  2HSY A;  2RM5 A;  4OFN A;  4RI6 A;  4MA9 A;  4MLY A;  2R3X A;  3FR6 A;  2BTO T;  2AUV A;  3GTU A;  2I3Y A;  4GF0 A;  4KB3 A;  1XVQ A;  1A0R P;  1JZW A;  4TXO A;  3GH6 A;  1UA5 A;  2KP2 A;  3LFL A;  2EIR A;  3IRA A;  3ISO A;  3UBK A;  2I9H A;  1SYR A;  4GQC A;  5CP1 A;  3FZ4 A;  2H70 A;  1XXU A;  2KP1 A;  3GL5 A;  4FYB A;  1XW9 A;  5D93 A;  1F2E A;  5CRH A;  3VI7 A;  4IKH A;  1XOA A;  2FWG A;  1K3Y A;  2RUF A;  2ON7 A;  2JU5 A;  3IK9 A;  1GLQ A;  1K0M A;  3KH7 A;  1OE8 A;  7GSS A;  1GNW A;  1GTB A;  4IS0 A;  1T7P B;  4IBP A;  3ZL5 A;  4XS1 A;  1DE1 A;  4EUY A;  5E59 A;  5D9T A;  4ACS A;  1BAY A;  2K18 A;  2X8C A;  11GS A;  1ST9 A;  4IVF A;  1SJ6 A;  3F4R A;  1XOB A;  1AUC A;  3MNG A;  1V9W A;  4TR4 A;  4PQH A;  4K7N A;  2IMD A;  2K8V A;  2N5A A;  4OO5 A;  3ZLP A;  1B9Y C;  4ZBB A;  2H0G A;  4OCF A;  2DJ3 A;  5HFI A;  4GTU A;  2DML A;  3EU4 A;  1XBS A;  2KUC A;  4MMM A;  2RLI A;  2O87 A;  3I6A A;  4PX1 A;  4XS4 A;  16GS A;  1SKR B;  4LA1 A;  2NVL A;  1JHB A;  2LEG A;  3GSS A;  1TRV A;  3SWL A;  2YWI A;  2JZT A;  5HFK A;  3HZ8 A;  5E4W A;  1OC8 A;  4HU7 A;  1YF1 A;  4L5L A;  4H86 A;  2C3N A;  3M0F A;  2YAN A;  3IHQ A;  2GVP A;  3IC8 A;  3RDW A;  1SD9 A;  2C3Q A;  1TP9 A;  4JBB A;  3C1R A;  3EMP A;  3WT1 A;  4DSS B;  4MK3 A;  1BX9 A;  3QAV A;  1EP7 A;  1YEP A;  4I2U A;  5JCU A;  4K6X A;  2VCZ A;  2LNS A;  4WEY A;  3UAP A;  5GAP D;  3I9V 2;  4LL4 B;  1XWB A;  2VAF A;  3IBH A;  1SU9 A;  3M9K A;  2L59 A;  5IPH A;  1JZR A;  2HQT A;  4ECI A;  1YEX A;  4EE0 A;  4BPY A;  4I8B A;  4BVX B;  2LUS A;  3RHC A;  5F07 A;  4J57 E;  5GST A;  5ELA A;  2YJ7 A;  4LL1 B;  2BJX A;  3UJ1 A;  2MBS A;  3LEF A;  2O8V B;  1SL1 B;  1MTC A;  3DD3 A;  2HT9 A;  2YNX A;  1LU4 A;  1JZD A;  2NBS A;  2M80 A;  1XW6 A;  4TR1 A;  2GZP A;  1ZGN A;  4KDY A;  1OC9 B;  4F03 A;  5DCG A;  2NTO A;  3GKM A;  2H71 A;  3TKS A;  3EWL A;  1QQ2 A;  2WB9 A;  4ZB8 A;  4MP4 A;  1PL2 A;  3F4T A;  4TKY A;  1MD4 A;  3UEM A;  2E2M A;  4G2E A;  4L8E A;  4MJA A;  14GS A;  5KN3 A;  2PN8 A;  2DIY A;  1EP8 A;  5DJL A;  4I97 A;  1XPV A;  3TGZ A;  4ZIJ A;  3KMO A;  1PKW A;  4MAB A;  3F6F A;  1KBN A;  3E0U A;  1QFN A;  3IXR A;  3ZML A;  1TOF A;  5EVO A;  5HR3 A;  5EL8 A;  4BL7 B;  3M3M A;  2ON5 A;  1GSD A;  2VM1 A;  1HQO A;  1ZOF A;  3Q74 A;  4OFT A;  4MDC A;  4OD7 A;  2C3T A;  1Z3E A;  3RPP A;  1DSB A;  2I4A A;  4PNF A;  3A3T A;  3HYP A;  4XRD A;  5IO0 A;  4BWQ A;  1PMT A;  3J7Y b;  5CNW A;  3KEB A;  5DBQ A;  3I43 A;  2QSI A;  3HKR A;  1GSE A;  5G31 A;  3NZN A;  3VPQ A;  4HZ4 A;  1G6Y A;  6GSY A;  5D9W A;  1YZX A;  2VCX A;  5ECM B;  4FYU A;  1TK5 B;  1TXX A;  1X0R A;  4PUR A;  1TW9 A;  1Z7P A;  4G0L A;  1PX7 A;  4LMW A;  3TOU A;  3GHA A;  3VWW A;  1H75 A;  3ERG A;  2H6Z A;  3TJG A;  3E9J B;  2J23 A;  1AQX A;  3L9V A;  4PGT A;  2YWM A;  4ILF A;  5INY A;  1SKW B;  3GKX A;  4HJM A;  2YN1 A;  3O6T A;  1OE7 A;  1OC3 A;  2MYG A;  4KW6 A;  17GS A;  3FZ9 A;  4ISD A;  5AGY A;  3MDK A;  2R2J A;  3PR8 A;  6GSS A;  3QR6 A;  2ALB A;  4LMV A;  5J9C A;  2H1D A;  2N5B A;  1ERU A;  2JSY A;  3FK8 A;  3A2W A;  3KM6 A;  1T4Y A;  1QMV A;  1NW2 A;  5ECL B;  4HUA A;  3FHK A;  4EKZ A;  5B8A A;  4TN8 A;  1R5A A;  2B5X A;  3RBT A;  4PXO A;  1PRX A;  1RQM A;  5H5R A;  1AXD A;  2GZY A;  3TUE A;  4Q5R A;  2JL4 A;  1YKA A;  3QD9 A;  1X9M B;  1DE2 A;  2FWH A;  5IO2 A;  3TKS E;  5JWQ B;  5IMA A;  4D73 A;  2LRT A;  2GT5 A;  3DKS A;  2F3M A;  2VL3 A;  3VPT A;  1AIU A;  2X64 A;  1S3D A;  3TKP A;  3GIX A;  4EF0 A;  2YV7 A;  5FWG A;  2VCQ A;  1YKC A;  3QMX A;  4J2F A;  3CBU A;  2CZ3 A;  3FZA A;  4MJE A;  2XBQ A;  4OWY A;  5A4U A;  2H1A A;  3EIN A;  2GQK A;  19GS A;  2H30 A;  2AAW A;  2L4C A;  18GS A;  4G0I A;  4HDE A;  4JE1 A;  1A2L A;  3LJR A;  1FW1 A;  2HSM A;  4WR5 A;  3D4T A;  4POM A;  4ECC A;  1BED A;  1TK8 B;  3UVT A;  4KH7 A;  5JWO B;  4Q5Q A;  3QAW A;  1TTZ A;  1DBY A;  3Q6O A;  4IJI A;  4MF6 A;  1Z6N A;  3LXT A;  1O7U A;  3D21 A;  3GUS A;  2B1L A;  3GKN A;  3ZVJ A;  2LV3 A;  3APS A;  4E8E A;  2JAD A;  3GV1 A;  2HRN A;  1URM A;  1OAZ A;  1M2A A;  2B3S A;  3GMF A;  3ME8 A;  2XC2 A;  5GZZ B;  1F9M A;  2LKU A;  3HXS A;  5D96 A;  1OYJ A;  3EU3 A;  2L6D A;  4JZQ A;  2CAI A;  4OCE A;  3F6D A;  3KJY A;  2HSN B;  2DIZ A;  2CV4 A;  1A8Y A;  5DAL B;  1ABA A;  3VI5 A;  3F4S A;  2AYT A;  1GSS A;  1YDK A;  5ECQ B;  1T4Z A;  4G9H A;  5D8I A;  3BOA A;  1V57 A;  3CYN A;  1T00 A;  2YV9 A;  2H75 A;  1UVZ A;  4YQU A;  5IMZ A;  1V58 A;  1GUL A;  2PBJ A;  2HZF A;  1K0D A;  1SJZ A;  1MDK A;  1BG5 A;  3LQ7 A;  5J41 A;  3DVW A;  1EGO A;  2XHF A;  1K3L A;  1AAZ A;  2DMM A;  2WS2 A;  4BVY A;  3V1W A;  2NPB A;  1O85 A;  4IQ1 A;  4MPG A;  4KND A;  1O8W A;  5IMD A;  1GRX A;  5ENU A;  1QK8 A;  5IMF A;  3QOU A;  3ZRD A;  1R7H A;  1CQH A;  2HRK A;  2QGV A;  3CSH A;  2K6V A;  2REM A;  3IA1 A;  1FOV A;  3RHB A;  2GT6 A;  4HQS A;  5J4U A;  5AN1 A;  4AF2 A;  3TB2 A;  3IE3 A;  4JRR A;  2LRN A;  2IIY A;  1GTI A;  2G2Q A;  3PH9 A;  4IN0 A;  2WRT A;  2GSR A;  1GH2 A;  2QKE A;  4EO3 A;  5IMC A;  4FIW A;  4O7H A;  3KTL A;  2VD1 A;  1M99 A;  4MF7 A;  3M8N A;  1JLW A;  1C72 A;  6GST A;  5DQY A;  5KN1 A;  1O8X A;  2HZE B;  2TIR A;  5A5K A;  2VD0 A;  5JWR B;  1OVN A;  3Q19 A;  1THX A;  2FCH A;  3L9S A;  2IWT A;  3FYG A;  4ZB6 A;  3GTU B;  1GTU A;  2LQQ A;  4TXO B;  4ZB9 A;  5IOX A;  2B5E A;  1MD3 A;  2P5R A;  3AY8 A;  3L78 A;  3NOF A;  5F06 A;  2Z9S A;  4NMU A;  2GSQ A;  5D9X A;  3BD2 A;  2PGT A;  4EXJ A;  4AJ8 A;  1FVJ A;  3IV4 A;  5DAK A;  2H76 A;  4NV5 A;  2TRC P;  1G7O A;  2K9F A;  1K3O A;  3WD6 A;  5C00 A;  4V2N A;  5GSS A;  1WMJ A;  2ZUP A;  4F9Z A;  3MSZ A;  5AIS A;  3GA4 A;  2CQ9 A;  4HU9 A;  3D22 A;  2L6C A;  1V2A A;  4HI7 A;  5DVB A;  1M7T A;  4JR6 A;  3ZFB A;  2G0F A;  5H5S A;  5JCW A;  3DWV A;  3ED3 A;  4NPB A;  4WBJ A;  4NAX A;  3BBY A;  1EZK A;  2VL2 A;  2IMF A;  1EEM A;  4JU5 A;  1EV9 A;  1HNB A;  2XPE A;  3IOS A;  4WF5 A;  3VK9 A;  2VCT A;  4NHZ A;  2GZZ A;  3D4M A;  5IM9 A;  3O76 A;  2GTU A;  2IMK A;  3H79 A;  2V2G A;  5ECN B;  3ZTL A;  4TR3 A;  3N5O A;  2HRF A;  3QAG A;  5G2Z A;  1KNG A;  2LJK A;  2H6Y A;  2MMZ A;  5CRG A;  3O3T A;  2OKA A;  5EY6 A;  4OFM A;  2O7K A;  2H6X A;  1FVK A;  3GL3 A;  1AQV A;  2LJA A;  2ZCT A;  1SJI A;  1TK0 B;  1BQ7 A;  1YY7 A;  1F3A A;  2CAQ A;  1UN2 A;  2EIO A;  2LNT A;  3QDN A;  3TKR A;  4XS4 B;  1M0U A;  3DIE A;  3ZIT A;  2OBI A;  2PU9 C;  2D2Z A;  2H0H A;  2JZR A;  3GKK A;  3QPM A;  4FO5 A;  2X8H A;  3A2V A;  1U3A A;  4ZL7 A;  4O5R A;  4K8M A;  4KDU A;  3C73 A;  5A4V A;  2H8L A;  5CRD A;  1TI3 A;  4GSS A;  2B7K A;  2P5Q A;  5EPF A;  4KF9 A;  2FHE A;  1T8E B;  3HVX A;  1TDI A;  4K7O A;  2L57 A;  1R26 A;  3TKS C;  4IW9 A;  4DSQ A;  4XHM A;  1WE0 A;  4XRA A;  1KEB A;  1K0B A;  2JSZ A;  3FR9 A;  5ELG A;  4N30 A;  4MZW A;  3NIV A;  5ECK B;  2KOK A;  4TRX A;  4ZBD A;  2FD3 A;  4EL1 A;  1K0N A;  2C8U A;  2DJJ A;  4Q5N A;  2KHP A;  2FWE A;  3C8E A;  2O89 A;  2DJ1 A;  4MH3 A;  2H1G A;  5F8B A;  4DVC A;  2LS5 A;  4POK A;  3IDV A;  4TR1 B;  3VLN A;  4HOJ A;  1EV4 A;  1Z5Y E;  1S3C A;  1VF4 A;  4KDX A;  3HCZ A;  4V2L A;  1A8L A;  1YF0 A;  3A5W A;  2A4V A;  1EOH A;  3F8U A;  1PGT A;  5F0G A;  2HI7 A;  2IFQ A;  1QUW A;  1I9D A;  4G10 A;  3GN3 A;  2C80 A;  3C1S A;  2IMI A;  1GSF A;  3N9J A;  1SEN A;  1Y6E A;  1ZMA A;  2C0G A;  1XZO A;  3GFK A;  4YAV A;  4AGS A;  4TXV A;  1R5P A;  3EC3 A;  1TRS A;  1T3B A;  4K7I A;  3UOM A;  4PUA A;  2B5Y A;  4USS A;  3FZ5 A;  2M72 A;  4L0W A;  2YCD A;  1GLP A;  5ECO B;  1V40 A;  3HJO A;  4I2T A;  4ML1 A;  3L9U A;  1PN9 A;  1A0F A;  4K0N A;  3KD0 A;  1F37 A;  5IPG A;  4POB A;  1AQW A;  3FKF A;  1OKT A;  1WIK A;  3GX8 A;  3VFI A;  1SK0 A;  1XCC A;  1SL0 B;  5DCH A;  4GQF A;  3ZFL A;  1SK1 A;  1USB A;  4ID0 A;  1K0C A;  2HSH A;  3BCK A;  3G9B A;  2J9H A;  3MAK A;  4KGI A;  3G7Y A;  4MH2 A;  3HJM A;  3ZZX A;  4HJ2 A;  1ERT A;  2R37 A;  4BA7 A;  2VCW A;  5ECS A;  2C0D A;  4IJ3 A;  1LJR A;  1GP1 A;  4TR0 A;  4OO4 A;  2WDU A;  2P31 A;  1LBK A;  1VF2 A;  4F82 A;  2WZ9 A;  1PD2 1;  1TRU A;  2A2R A;  4X0X A;  3CSI A;  4XTS A;  2E0Q A;  1X9S B;  5HR0 A;  3M1G A;  3U5R E;  2B1K A;  3APQ A;  1EOG A;  4Z7X A;  1X5E A;  4GST A;  2GLR A;  1Z9H A;  3K8N A;  5G30 A;  2PWJ A;  3FEU A;  2CVB A;  2FLS A;  3VWV A;  4GXZ A;  4POL A;  3I69 A;  6GSU A;  4O32 A;  1XWG A;  2FWF A;  1K0A A;  2GST A;  2YWN A;  3US3 A;  2OAC A;  2H0I A;  1TJD A;  3L0H A;  4ZL9 A;  3RAZ A;  2H1B A;  1JZO A;  1GWC A;  4K1F A;  2YZU A;  3ZYW A;  3U6V A;  5A4W A;  3DRN A;  1SYX A;  1ON4 A;  4D73 B;  2JAC A;  2RII A;  3GNJ A;  4FQU A;  1ILO A;  1Q98 A;  4HS1 A;  2DBC A;  4K2D A;  3LOR A;  2F8A A;  2LTK A;  5ID2 A;  2VLT A;  3E3E A;  4KSM A;  2CZ2 A;  4PQ1 A;  3CTF A;  2F9S A;  9GSS A;  3LG6 A;  4YH2 A;  1XWC A;  2OJL A;  2C1Y A;  1U3I A;  3F63 A;  3WT2 A;  4IHU A;  1FO5 A;  2HSM B;  5IQY A;  1YJ6 A;  3FY7 A;  1CQG A;  5ECR B;  4Q5F A;  2RM6 A;  3P8W A;  4N10 A;  5DJM A;  2HNL A;  3WYW A;  2VL9 A;  3R3E A;  2N5F A;  3EYT A;  1PKZ A;  1ZZY A;  3TRX A;  2AV4 A;  3H93 A;  1O81 A;  4EDZ A;  2RUE A;  4WR4 A;  3TKQ A;  3IR4 A;  3TJB A;  3APO A;  3R2Q A;  3LGC A;  1ZYE A;  4TW5 A;  3WGX A;  1J08 A;  1ERV A;  1W89 A;  4V1A g;  4TVE A;  2XBI A;  3UAR A;  3L4N A;  5LNK e;  2DLX A;  3ME7 A;  1R4W A;  3KP9 A;  4ECJ A;  5CO3 A;  2AB6 A;  3HHV A;  4FH8 A;  4WXT A;  3RPN A;  2YP6 A;  2GQL A;  1YQ1 A;  1XFL A;  2X8G A;  3D6I A;  3LYP A;  2WCI A;  1A24 A;  1B4Q A;  1NHY A;  2H73 A;  1FB6 A;  3UBL A;  2IPA A;  3HA9 A;  2VUP A;  2V41 A;  2L4Q A;  3IK7 A;  4GLT A;  3UL3 A;  3KMN A;  2NDO A;  1HNC A;  1Z7R A;  3WGE A; 
#chains in the Genus database with same CATH topology
 2YJH A;  4FYC A;  1F3B A;  5HFG A;  3Q18 A;  4F0B A;  1M3J A;  2IN3 A;  3KZQ A;  2L5O A;  3CXG A;  2F8F A;  3ZIV A;  4RUV A;  5D9V A;  4K0G A;  4BVY B;  2OE3 A;  2H19 A;  2YPM A;  1T1V A;  3H4K A;  1TI1 A;  2QC7 A;  4EC0 A;  1N2A A;  2O85 A;  3DXB A;  2HRK B;  5B6M A;  4YQV A;  1M2D A;  1ACV A;  1X5C A;  2H74 A;  5ECI B;  1ML6 A;  4MCU A;  3TRQ A;  1GL8 A;  1RK4 A;  3TOT A;  5KEJ A;  3G7I A;  6GSW A;  5DQS A;  1J9B A;  4RI7 A;  4LLR A;  3EE2 A;  2BMX A;  2ZNM A;  2WUL A;  2LQO A;  3S9F A;  3GST A;  2GDR A;  4QMK A;  1XWK A;  3P90 A;  4MZB A;  1SK2 A;  3UVH A;  4DSS A;  3TRP A;  1A2M A;  3VUR A;  4PQI A;  2CVD A;  5LCZ A;  5J5N A;  1B48 A;  4CDO A;  1MDJ A;  1EGR A;  4ZXG A;  2V6K A;  2WFC A;  2H1L A;  1X5D A;  1XIY A;  1PSQ A;  1GUK A;  2MZC A;  1Q4J A;  4RQX A;  4BVX A;  3MWH A;  1SD8 A;  3KH9 A;  4KUN A;  2PER A;  4RQR A;  2VL2 C;  13GS A;  4XS6 A;  1MDI A;  2B6M A;  2EFH A;  2PVQ A;  1FAA A;  3DEX A;  3CMI A;  3HVV A;  5DAK B;  2R0P A;  3QFB C;  4EVM A;  2OAD A;  4YQM A;  4QL9 A;  1M2B A;  2UZ8 A;  3KTB A;  3W6G A;  3HVS A;  4BWS A;  1A23 A;  4MF5 A;  2AJQ B;  1E2Y A;  3KGK A;  1OC9 A;  3GH9 A;  3HY2 A;  1I1I P;  1XVW A;  1TU7 A;  4X4J A;  1RW1 A;  3IAM 2;  2DC5 A;  1X9W B;  2ES7 A;  1ERW A;  3KP8 A;  4G19 A;  3CTG A;  5IIZ A;  5KN0 A;  1YVL A;  2K8S A;  3C7M A;  3TJJ A;  4F0C A;  3FW2 A;  5CRW A;  1NHO A;  4Z2U A;  4WKW A;  1PFO A;  4BIK A;  1GSQ A;  1F6M C;  3PGT A;  1M9A A;  1AW9 A;  3EUR A;  4A5P A;  1XG8 A;  4EDY A;  3H8Q A;  4IP1 A;  5CYY A;  2C0E A;  1GTA A;  2WJU A;  3GYK A;  1Y1U A;  2CX4 A;  2PVO C;  4MJB A;  3TJF A;  3VWU A;  3FR3 A;  2IJY A;  5G5F A;  3GX0 A;  3IPZ A;  2C0F A;  1TKD B;  3F3R A;  5KN2 A;  4BL7 A;  3LW9 A;  1J0F A;  5AIV A;  4AJ6 A;  4KSO A;  4CHS A;  2QA1 A;  2EIQ A;  3WGD A;  5A1N A;  4DSR A;  3EMX A;  5ECP B;  4NWY A;  3KXO A;  4X43 A;  2CT6 A;  1WP0 A;  3TCO A;  1H4O A;  2FNO A;  1UC7 A;  1JLV A;  1G6W A;  1W4V A;  2GQM A;  3OR5 A;  1B9X C;  2HXK A;  1VF3 A;  4ECB A;  2R6K A;  4ULX A;  1U6T A;  1SKS B;  5IOW A;  3CHX C;  5F05 A;  1PQN A;  3ZIJ A;  3W8J A;  1WPI A;  2JZS A;  3DYR A;  4N3Z A;  2HE3 A;  4X1U A;  5HR2 A;  4K5R A;  2OE1 A;  4IEL A;  2OA7 A;  1NSW A;  5DDL A;  4ML6 A;  1THO A;  4AI6 A;  1G7E A;  4CW9 A;  2E7P A;  1ZL9 A;  5FT3 A;  4ZIL A;  2PMT A;  2KLX A;  4KCA A;  22GS A;  4I5Q A;  3A2X A;  2WGR A;  3TJK A;  4HZ2 A;  4O92 A;  1QXH A;  2PUK C;  4F2I A;  2R4V A;  1O6J A;  2VM2 A;  1GSU A;  5KOW A;  2FUG 2;  3ZVJ D;  4PTS A;  4AKH A;  1NM3 A;  2HLS A;  2M46 A;  5D73 A;  4V1A p;  4WET A;  1FG4 A;  4GRF A;  3QFA C;  2E2G A;  2VOC A;  2CVK A;  5H5Q A;  3HJP A;  4NXI A;  5HQP A;  1XWA A;  3CSJ A;  3CRU A;  2VCV A;  1U88 A;  2VIM A;  1WRY A;  4P3Y B;  1B4P A;  4DEJ A;  4KCE A;  3GUR A;  12GS A;  5IMV A;  1TRW A;  4V2M A;  3LYK A;  1GUM A;  1IYI A;  4MNN A;  1GUH A;  2LST A;  1MEK A;  3P7X A;  2LRC A;  1GSY A;  3GRX A;  2B7J A;  2PPT A;  4PNG A;  5CAX A;  3PIN A;  3FRC A;  1WWJ A;  1B8X A;  3KIJ A;  1S3A A;  1OKD A;  2L5L A;  3DGQ A;  4ZL8 A;  2IFQ B;  3HDC A;  2DJ0 A;  3IAS 2;  2IL3 A;  1ZCP A;  4O5U A;  2X99 A;  1PX6 A;  4N0V A;  1EEJ A;  6GSV A;  4IGJ A;  1DUG A;  4HQZ A;  3CRT A;  1N8J A;  3F0I A;  2V6O A;  2C4J A;  5A34 B;  1SVL A;  4XIH A;  2YOI A;  1VGL A;  1I5G A;  2HFD A;  3TDG A;  1HNA A;  2AHE A;  2GS3 A;  5COH A;  3IC4 A;  2DSA A;  6GSX A;  4N11 A;  4TOP A;  5G5E A;  1QGV A;  4E8H A;  2VLU A;  2VKZ G;  3HZ4 A;  4YAP A;  2I81 A;  3VWX A;  2MBT A;  1VRS D;  4JR4 A;  1AC1 A;  4KA0 A;  1BJX A;  3H1N A;  2X4A A;  1HYU A;  2MMA A;  2P0G A;  2QA2 A;  3F9U A;  4JED A;  2R5G A;  4I6X A;  1K0O A;  1WOU A;  1SL2 B;  3UIW A;  1JFU A;  3PPU A;  3ZMK A;  4ZBA A;  3EVI A;  2VO4 A;  3ERF A;  2YZH A;  4KE3 A;  1XW5 A;  2TRX A;  4ICY A;  4MPF A;  3LWA A;  1TU8 A;  4K9Z A;  4QQ7 A;  1U87 A;  1A2J A;  4MJC A;  5J9B A;  8GSS A;  4WBR D;  3LSZ A;  2DJ2 A;  2H01 A;  5BMU A;  5GAN D;  4IP6 A;  3W8S A;  3DML A;  4L5O A;  5B8B A;  5B6N A;  5G1L A;  1PL1 A;  2MMO A;  2HSN A;  1Z6M A;  1WJK A;  4PUF C;  5KOX A;  5CRE A;  5C04 A;  5ABR A;  5B7C A;  2EC4 A;  4NV2 A;  2V1M A;  3F3Q A;  2FGX A;  3QCP A;  1HD2 A;  5J3R A;  5DAL A;  3M9J A;  1M9B A;  4GCI A;  3BJ5 A;  5HR1 A;  4J56 E;  2WW2 A;  1N25 A;  1ZYQ B;  2OBK A;  3UMA A;  5ECH B;  2VLV A;  2FA8 A;  1GNE A;  4QL7 A;  5AIX A;  2F51 A;  1VF1 A;  2X49 A;  3KCM A;  5L71 A;  2GGT A;  5LD0 A;  4L0U A;  2GSS A;  3HD5 A;  2DJK A;  4AJ7 A;  2I1U A;  2IME A;  1FHE A;  2OE0 A;  4HEA 2;  2LJR A;  4WF4 A;  3D5J A;  4HSC X;  2H66 A;  4OMV A;  2V32 A;  4NHW A;  3ZRE A;  2XPD A;  3J7Y k;  4GSN A;  3DVX A;  4GWR A;  5G1K A;  4MZC A;  10GS A;  3BCI A;  3P2A A;  1IYH A;  4PI0 C;  2CX3 A;  2A2S A;  1G0T A;  3ERW A;  2YWO A;  1FB0 A;  4G0K A;  1BYE A;  5FHI A;  1EWX A;  5ID2 B;  4XCS A;  2CA8 A;  3SBC A;  2WZS A;  4N0Z A;  1ZYN A;  4IQA A;  2MMN A;  1SVM A;  1KTE A;  1O73 A;  2FY6 A;  4KAE A;  2R0C A;  3D0Z A;  3JCM L;  3C71 A;  1V98 A;  3LXZ A;  5JCG A;  2H72 A;  1Y25 A;  4KX4 A;  1E6B A;  2HRA A;  3G7J A;  2FA4 A;  1PA3 A;  2HYX A;  2HZE A;  20GS A;  2HSY A;  2RM5 A;  4OFN A;  4RI6 A;  4MA9 A;  4MLY A;  2R3X A;  1M3I A;  3FR6 A;  2BTO T;  2AUV A;  3GTU A;  2I3Y A;  4GF0 A;  4KB3 A;  1XVQ A;  1A0R P;  1JZW A;  4TXO A;  3GH6 A;  1UA5 A;  2KP2 A;  3LFL A;  2EIR A;  3IRA A;  3ISO A;  3UBK A;  2I9H A;  1SYR A;  4GQC A;  5CP1 A;  3FZ4 A;  2H70 A;  1XXU A;  2KP1 A;  3GL5 A;  4FYB A;  1XW9 A;  1PN0 A;  5D93 A;  1F2E A;  5CRH A;  3VI7 A;  4IKH A;  1XOA A;  2FWG A;  1K3Y A;  2RUF A;  2ON7 A;  2JU5 A;  3IK9 A;  1GLQ A;  1K0M A;  3KH7 A;  1OE8 A;  7GSS A;  1GNW A;  1GTB A;  4IS0 A;  4PHZ C;  1T7P B;  4IBP A;  3ZL5 A;  4XS1 A;  1DE1 A;  4EUY A;  5E59 A;  5D9T A;  4ACS A;  2WW0 A;  1BAY A;  2K18 A;  2X8C A;  11GS A;  1ST9 A;  2WW3 A;  4IVF A;  1SJ6 A;  3F4R A;  1XOB A;  1AUC A;  3MNG A;  1V9W A;  2A4H A;  4TR4 A;  4PQH A;  4K7N A;  2IMD A;  2K8V A;  2N5A A;  4OO5 A;  3ZLP A;  1B9Y C;  4ZBB A;  2H0G A;  4OCF A;  2DJ3 A;  5HFI A;  4GTU A;  3EU4 A;  2DML A;  1XBS A;  2KUC A;  4MMM A;  2RLI A;  2O87 A;  3I6A A;  4PX1 A;  4XS4 A;  16GS A;  1SKR B;  4LA1 A;  2NVL A;  1JHB A;  2LEG A;  3GSS A;  2UV8 G;  1TRV A;  3SWL A;  2YWI A;  2JZT A;  5HFK A;  3HZ8 A;  5E4W A;  1OC8 A;  4HU7 A;  1YF1 A;  4L5L A;  4H86 A;  2C3N A;  3M0F A;  2YAN A;  3IHQ A;  2GVP A;  3IC8 A;  3RDW A;  1SD9 A;  2C3Q A;  1TP9 A;  4JBB A;  3C1R A;  3EMP A;  3WT1 A;  4DSS B;  4MK3 A;  1BX9 A;  3QAV A;  1EP7 A;  1YEP A;  4I2U A;  5JCU A;  4K6X A;  2VCZ A;  2LNS A;  4WEY A;  3UAP A;  5GAP D;  5BRT A;  3I9V 2;  4LL4 B;  1XWB A;  2VAF A;  3IBH A;  1SU9 A;  3M9K A;  2L59 A;  5IPH A;  1JZR A;  4AKX B;  2HQT A;  4ECI A;  1YEX A;  4EE0 A;  4BPY A;  4I8B A;  4BVX B;  2LUS A;  3RHC A;  5F07 A;  4J57 E;  3HMJ G;  5GST A;  5ELA A;  2YJ7 A;  4LL1 B;  2BJX A;  3UJ1 A;  2MBS A;  3LEF A;  2O8V B;  4YKF A;  1SL1 B;  1MTC A;  3DD3 A;  2HT9 A;  2YNX A;  1LU4 A;  1JZD A;  2NBS A;  2M80 A;  1XW6 A;  4TR1 A;  2GZP A;  1ZGN A;  4KDY A;  1OC9 B;  4F03 A;  5DCG A;  2NTO A;  3GKM A;  2H71 A;  3TKS A;  4Z2R A;  3EWL A;  1QQ2 A;  2WB9 A;  4ZB8 A;  4MP4 A;  1PL2 A;  3F4T A;  4TKY A;  1MD4 A;  3UEM A;  2E2M A;  4G2E A;  4L8E A;  4MJA A;  14GS A;  5KN3 A;  2PN8 A;  2DIY A;  1EP8 A;  5DJL A;  4I97 A;  1XPV A;  3TGZ A;  4ZIJ A;  3KMO A;  4K5S A;  5A5H A;  1PKW A;  4MAB A;  3F6F A;  1KBN A;  3E0U A;  1QFN A;  3IXR A;  3ZML A;  1TOF A;  5EVO A;  5HR3 A;  5EL8 A;  4BL7 B;  5J40 A;  3M3M A;  2ON5 A;  1GSD A;  2VM1 A;  1HQO A;  5A1N B;  1ZOF A;  3Q74 A;  4OFT A;  4MDC A;  4OD7 A;  2C3T A;  1Z3E A;  3RPP A;  1DSB A;  2I4A A;  4PNF A;  3A3T A;  3HYP A;  4XRD A;  5IO0 A;  4BWQ A;  1PMT A;  3J7Y b;  5CNW A;  3KEB A;  5DBQ A;  3I43 A;  2QSI A;  3HKR A;  1GSE A;  5G31 A;  3NZN A;  3VPQ A;  4HZ4 A;  1G6Y A;  2EFC A;  1FOH A;  6GSY A;  5D9W A;  1YZX A;  2VCX A;  5ECM B;  4FYU A;  1TK5 B;  1TXX A;  1X0R A;  4PUR A;  1TW9 A;  1Z7P A;  4G0L A;  1PX7 A;  4LMW A;  3TOU A;  3GHA A;  3VWW A;  1H75 A;  3ERG A;  2H6Z A;  3TJG A;  3E9J B;  2J23 A;  1AQX A;  3L9V A;  4PGT A;  2YWM A;  4ILF A;  5INY A;  1SKW B;  3GKX A;  4HJM A;  2YN1 A;  3O6T A;  1OE7 A;  1OC3 A;  2MYG A;  4KW6 A;  17GS A;  3FZ9 A;  4ISD A;  5AGY A;  3MDK A;  2R2J A;  3PR8 A;  6GSS A;  3QR6 A;  2ALB A;  4LMV A;  5J9C A;  2H1D A;  2N5B A;  1ERU A;  2JSY A;  3FK8 A;  3A2W A;  3KM6 A;  1T4Y A;  1QMV A;  1NW2 A;  5ECL B;  4HUA A;  3FHK A;  4AKI A;  4EKZ A;  5B8A A;  4TN8 A;  1R5A A;  2B5X A;  3RBT A;  4PXO A;  1PRX A;  1RQM A;  5H5R A;  4E68 A;  1AXD A;  2GZY A;  3TUE A;  4Q5R A;  2JL4 A;  1YKA A;  3QD9 A;  1X9M B;  1DE2 A;  3MYD A;  2FWH A;  5IO2 A;  3TKS E;  5JWQ B;  5IMA A;  4D73 A;  2LRT A;  2GT5 A;  3DKS A;  2F3M A;  2VL3 A;  3VPT A;  1AIU A;  2X64 A;  1S3D A;  3TKP A;  3GIX A;  4EF0 A;  2YV7 A;  5FWG A;  2VCQ A;  1YKC A;  3FMW A;  3QMX A;  4J2F A;  3CBU A;  2CZ3 A;  3FZA A;  4MJE A;  2XBQ A;  1S4B P;  4OWY A;  5A4U A;  3HVN A;  2H1A A;  3EIN A;  2GQK A;  19GS A;  2H30 A;  2AAW A;  2L4C A;  18GS A;  4G0I A;  4HDE A;  4JE1 A;  1A2L A;  3LJR A;  1FW1 A;  2HSM A;  4WR5 A;  3D4T A;  4POM A;  4ECC A;  1BED A;  1TK8 B;  3UVT A;  4KH7 A;  5JWO B;  4Q5Q A;  3QAW A;  1TTZ A;  1DBY A;  3Q6O A;  4IJI A;  4MF6 A;  1Z6N A;  3LXT A;  1O7U A;  3D21 A;  3GUS A;  3MIX A;  2B1L A;  3GKN A;  2WVX A;  3ZVJ A;  2LV3 A;  3APS A;  4E8E A;  2JAD A;  3GV1 A;  2HRN A;  1URM A;  5BMU B;  1OAZ A;  1M2A A;  2B3S A;  3GMF A;  3ME8 A;  2XC2 A;  5GZZ B;  1F9M A;  2LKU A;  3HXS A;  5D96 A;  1OYJ A;  3EU3 A;  2L6D A;  4JZQ A;  2CAI A;  4OCE A;  3F6D A;  3KJY A;  2HSN B;  2DIZ A;  2CV4 A;  1A8Y A;  5DAL B;  1ABA A;  3VI5 A;  3F4S A;  2AYT A;  1GSS A;  1YDK A;  5ECQ B;  1T4Z A;  4G9H A;  5D8I A;  3CWG A;  3BOA A;  1V57 A;  3CYN A;  1T00 A;  2YV9 A;  2H75 A;  1UVZ A;  4YQU A;  5IMZ A;  1V58 A;  1GUL A;  2PBJ A;  2DKH A;  2HZF A;  1K0D A;  1SJZ A;  1MDK A;  4EIQ A;  1BG5 A;  3LQ7 A;  5J41 A;  3DVW A;  1EGO A;  4K2X A;  2XHF A;  1K3L A;  1AAZ A;  2DMM A;  2WS2 A;  4BVY A;  3V1W A;  2NPB A;  1O85 A;  4IQ1 A;  4MPG A;  4KND A;  1O8W A;  5IMD A;  1GRX A;  5ENU A;  1QK8 A;  5IMF A;  3QOU A;  3ZRD A;  1R7H A;  1CQH A;  2HRK A;  2QGV A;  3CSH A;  2K6V A;  2REM A;  3IA1 A;  1FOV A;  3RHB A;  2GT6 A;  4HQS A;  5J4U A;  5AN1 A;  4AF2 A;  3TB2 A;  3IE3 A;  4JRR A;  2LRN A;  2IIY A;  1GTI A;  2G2Q A;  3PH9 A;  4IN0 A;  2WRT A;  2GSR A;  1GH2 A;  2QKE A;  4EO3 A;  5IMC A;  4FIW A;  3RFR C;  4O7H A;  1SVO A;  3KTL A;  2VD1 A;  1M99 A;  4MF7 A;  3M8N A;  1JLW A;  1C72 A;  6GST A;  5DQY A;  5KN1 A;  1O8X A;  2HZE B;  2TIR A;  5A5K A;  2VD0 A;  5JWR B;  1OVN A;  3Q19 A;  1THX A;  2FCH A;  3L9S A;  2IWT A;  3FYG A;  4ZB6 A;  2WVZ A;  3GTU B;  1GTU A;  2LQQ A;  4TXO B;  4ZB9 A;  5IOX A;  2B5E A;  1MD3 A;  2P5R A;  3AY8 A;  3L78 A;  3NOF A;  5F06 A;  2Z9S A;  4NMU A;  2GSQ A;  5D9X A;  3BD2 A;  2PGT A;  4EXJ A;  4AJ8 A;  1FVJ A;  3IV4 A;  2O36 A;  5DAK A;  2H76 A;  4NV5 A;  2TRC P;  1G7O A;  4EIP A;  2K9F A;  1K3O A;  3WD6 A;  5C00 A;  4V2N A;  5GSS A;  1WMJ A;  2ZUP A;  4PI2 C;  3MSZ A;  4F9Z A;  5AIS A;  3GA4 A;  2CQ9 A;  5J47 A;  4FXY P;  4HU9 A;  3D22 A;  2L6C A;  1V2A A;  4HI7 A;  1BG1 A;  5DVB A;  1M7T A;  4JR6 A;  3ZFB A;  2G0F A;  5H5S A;  5JCW A;  3DWV A;  3ED3 A;  4NPB A;  4WBJ A;  4NAX A;  3BBY A;  1EZK A;  2VL2 A;  3CQF A;  2IMF A;  1EEM A;  4JU5 A;  1EV9 A;  1HNB A;  3IOS A;  2XPE A;  4WF5 A;  3VK9 A;  2VCT A;  4NHZ A;  2GZZ A;  3D4M A;  5IM9 A;  3O76 A;  2GTU A;  2IMK A;  3H79 A;  5J4V A;  2V2G A;  5ECN B;  3ZTL A;  4TR3 A;  3N5O A;  2HRF A;  3QAG A;  5G2Z A;  1BF5 A;  1KNG A;  2LJK A;  2H6Y A;  2MMZ A;  5CRG A;  3O3T A;  2OKA A;  5EY6 A;  4OFM A;  2O7K A;  4YKG A;  2H6X A;  1FVK A;  3GL3 A;  1AQV A;  2LJA A;  2ZCT A;  1SJI A;  1TK0 B;  1BQ7 A;  1YY7 A;  1F3A A;  2O5V A;  2CAQ A;  1UN2 A;  2EIO A;  2LNT A;  3QDN A;  3TKR A;  4XS4 B;  1M0U A;  3DIE A;  3ZIT A;  2OBI A;  2PU9 C;  2D2Z A;  2H0H A;  3RGB C;  2JZR A;  3GKK A;  3QPM A;  4FO5 A;  2X8H A;  3A2V A;  1U3A A;  4ZL7 A;  4O5R A;  4K8M A;  4KDU A;  3C73 A;  5A4V A;  2H8L A;  5CRD A;  1TI3 A;  4GSS A;  2EFE A;  2B7K A;  3IHG A;  2P5Q A;  5EPF A;  4KF9 A;  2FHE A;  1T8E B;  3HVX A;  2OT3 A;  1TDI A;  4K7O A;  2L57 A;  1R26 A;  3TKS C;  4IW9 A;  4DSQ A;  4XHM A;  1WE0 A;  4XRA A;  1KEB A;  1K0B A;  2JSZ A;  3FR9 A;  5ELG A;  4N30 A;  3A5I A;  4MZW A;  3NIV A;  5ECK B;  2KOK A;  4TRX A;  4ZBD A;  2FD3 A;  4EL1 A;  1K0N A;  4AKG A;  2C8U A;  2DJJ A;  4Q5N A;  2KHP A;  2FWE A;  3C8E A;  2O89 A;  2DJ1 A;  4MH3 A;  2H1G A;  5F8B A;  4DVC A;  2LS5 A;  4POK A;  3IDV A;  4TR1 B;  3VLN A;  4HOJ A;  1EV4 A;  1Z5Y E;  1S3C A;  1VF4 A;  4KDX A;  2O3E A;  3HCZ A;  4V2L A;  1A8L A;  2EFD A;  1YF0 A;  3A5W A;  2A4V A;  1EOH A;  1ZYP A;  3F8U A;  1PGT A;  5F0G A;  2HI7 A;  1S3R A;  2IFQ A;  4GDF A;  1QUW A;  1I9D A;  4CY6 A;  4G10 A;  3GN3 A;  2C80 A;  3C1S A;  2IMI A;  5A5H B;  1GSF A;  3N9J A;  1SEN A;  1Y6E A;  1ZMA A;  2C0G A;  1XZO A;  3GFK A;  4YAV A;  4AGS A;  4TXV A;  1TXU A;  1R5P A;  3EC3 A;  1TRS A;  1T3B A;  5A34 A;  4K7I A;  4CY8 A;  3UOM A;  4PUA A;  2B5Y A;  4USS A;  3FZ5 A;  2M72 A;  4L0W A;  2YCD A;  1GLP A;  5ECO B;  1V40 A;  3HJO A;  4I2T A;  4ML1 A;  3L9U A;  1PN9 A;  1A0F A;  4K0N A;  2A2P A;  1F37 A;  3KD0 A;  5IPG A;  4POB A;  1AQW A;  3FKF A;  1OKT A;  1WIK A;  3GX8 A;  3VFI A;  1SK0 A;  1XCC A;  1SL0 B;  5DCH A;  4GQF A;  3ZFL A;  1SK1 A;  1USB A;  4ID0 A;  1K0C A;  2HSH A;  3BCK A;  3G9B A;  2J9H A;  3MAK A;  4KGI A;  3G7Y A;  4MH2 A;  3HJM A;  3ZZX A;  4HJ2 A;  2WW1 A;  1ERT A;  2R37 A;  4BA7 A;  2VCW A;  5ECS A;  2C0D A;  2WVY A;  4IJ3 A;  1LJR A;  1GP1 A;  4TR0 A;  4OO4 A;  2WDU A;  2P31 A;  1LBK A;  1VF2 A;  4F82 A;  2WZ9 A;  1PD2 1;  1YEW C;  1TRU A;  2A2R A;  4X0X A;  3CSI A;  4XTS A;  2E0Q A;  1X9S B;  4G01 A;  3M1G A;  5HR0 A;  3U5R E;  2B1K A;  3APQ A;  1EOG A;  4Z7X A;  1X5E A;  4GST A;  2GLR A;  1Z9H A;  3K8N A;  5G30 A;  2PWJ A;  3FEU A;  2CVB A;  2FLS A;  3VWV A;  4GXZ A;  4POL A;  3I69 A;  6GSU A;  4O32 A;  1XWG A;  2FWF A;  1K0A A;  2GST A;  2YWN A;  3US3 A;  2OAC A;  2H0I A;  1TJD A;  3L0H A;  4ZL9 A;  3RAZ A;  2H1B A;  1JZO A;  1GWC A;  4K1F A;  2YZU A;  3ZYW A;  3U6V A;  5A4W A;  2DKI A;  3DRN A;  1SYX A;  1ON4 A;  4D73 B;  2JAC A;  2RII A;  3GNJ A;  4FQU A;  2R0G A;  1ILO A;  4W66 A;  1Q98 A;  4HS1 A;  2DBC A;  4K2D A;  3LOR A;  2F8A A;  2LTK A;  5ID2 A;  2VLT A;  3E3E A;  4KSM A;  2CZ2 A;  4PQ1 A;  3CTF A;  2F9S A;  9GSS A;  3LG6 A;  4YH2 A;  1XWC A;  2OJL A;  2C1Y A;  1U3I A;  3F63 A;  3WT2 A;  4IHU A;  1FO5 A;  2HSM B;  5IQY A;  5J4Y A;  1YJ6 A;  3FY7 A;  1CQG A;  5ECR B;  4Q5F A;  2RM6 A;  3P8W A;  4N10 A;  5DJM A;  2HNL A;  3WYW A;  2VL9 A;  3R3E A;  2N5F A;  3EYT A;  1PKZ A;  4Z2T A;  1ZZY A;  3TRX A;  2AV4 A;  3H93 A;  1O81 A;  4EDZ A;  2RUE A;  4WR4 A;  3TKQ A;  3IR4 A;  3TJB A;  2WVX B;  3APO A;  3R2Q A;  3LGC A;  1ZYE A;  4TW5 A;  3WGX A;  1J08 A;  1ERV A;  4O5Q A;  1W89 A;  4V1A g;  4TVE A;  2XBI A;  3UAR A;  3L4N A;  5LNK e;  2DLX A;  3ME7 A;  1R4W A;  3KP9 A;  4ECJ A;  5CO3 A;  2AB6 A;  3HHV A;  4FH8 A;  4WXT A;  3RPN A;  4ZB7 A;  2YP6 A;  2GQL A;  1YQ1 A;  1XFL A;  2X8G A;  3D6I A;  3LYP A;  2WCI A;  1A24 A;  1B4Q A;  1NHY A;  2H73 A;  1FB6 A;  3UBL A;  2IPA A;  3HA9 A;  2VUP A;  2V41 A;  2L4Q A;  3IK7 A;  3TU3 B;  4GLT A;  3UL3 A;  3EPT A;  3KMN A;  2NDO A;  1HNC A;  1Z7R A;  3WGE A; 
#chains in the Genus database with same CATH homology
 2YJH A;  4FYC A;  1F3B A;  5HFG A;  3Q18 A;  4F0B A;  2IN3 A;  3KZQ A;  2L5O A;  3CXG A;  2F8F A;  3ZIV A;  4RUV A;  5D9V A;  4K0G A;  4BVY B;  2OE3 A;  2H19 A;  2YPM A;  1T1V A;  3H4K A;  1TI1 A;  2QC7 A;  4EC0 A;  1N2A A;  2O85 A;  3DXB A;  2HRK B;  5B6M A;  4YQV A;  1M2D A;  1ACV A;  1X5C A;  2H74 A;  5ECI B;  1ML6 A;  4MCU A;  3TRQ A;  1GL8 A;  1RK4 A;  3TOT A;  5KEJ A;  3G7I A;  6GSW A;  5DQS A;  1J9B A;  4RI7 A;  4LLR A;  3EE2 A;  2BMX A;  2ZNM A;  2WUL A;  2LQO A;  3S9F A;  3GST A;  2GDR A;  4QMK A;  1XWK A;  3P90 A;  4MZB A;  1SK2 A;  3UVH A;  4DSS A;  3TRP A;  1A2M A;  3VUR A;  4PQI A;  2CVD A;  5LCZ A;  5J5N A;  1B48 A;  4CDO A;  1MDJ A;  1EGR A;  4ZXG A;  2V6K A;  2WFC A;  2H1L A;  1X5D A;  1XIY A;  1PSQ A;  1GUK A;  2MZC A;  1Q4J A;  4RQX A;  4BVX A;  3MWH A;  1SD8 A;  3KH9 A;  4KUN A;  2PER A;  4RQR A;  2VL2 C;  13GS A;  4XS6 A;  1MDI A;  2B6M A;  2EFH A;  2PVQ A;  1FAA A;  3DEX A;  3CMI A;  3HVV A;  5DAK B;  2R0P A;  3QFB C;  4EVM A;  2OAD A;  4YQM A;  4QL9 A;  1M2B A;  2UZ8 A;  3KTB A;  3W6G A;  3HVS A;  4BWS A;  1A23 A;  4MF5 A;  2AJQ B;  1E2Y A;  3KGK A;  1OC9 A;  3GH9 A;  3HY2 A;  1XVW A;  1TU7 A;  4X4J A;  1RW1 A;  3IAM 2;  2DC5 A;  1X9W B;  2ES7 A;  1ERW A;  3KP8 A;  4G19 A;  3CTG A;  5IIZ A;  5KN0 A;  1YVL A;  2K8S A;  3C7M A;  3TJJ A;  4F0C A;  3FW2 A;  5CRW A;  1NHO A;  4Z2U A;  4WKW A;  1GSQ A;  1F6M C;  3PGT A;  1M9A A;  1AW9 A;  3EUR A;  4A5P A;  4EDY A;  3H8Q A;  4IP1 A;  5CYY A;  2C0E A;  1GTA A;  2WJU A;  3GYK A;  1Y1U A;  2CX4 A;  2PVO C;  4MJB A;  3TJF A;  3VWU A;  3FR3 A;  2IJY A;  5G5F A;  3GX0 A;  3IPZ A;  2C0F A;  1TKD B;  3F3R A;  5KN2 A;  4BL7 A;  3LW9 A;  1J0F A;  5AIV A;  4AJ6 A;  4KSO A;  4CHS A;  2QA1 A;  2EIQ A;  3WGD A;  5A1N A;  4DSR A;  3EMX A;  5ECP B;  4NWY A;  3KXO A;  4X43 A;  2CT6 A;  1WP0 A;  3TCO A;  1H4O A;  2FNO A;  1UC7 A;  1JLV A;  1G6W A;  1W4V A;  2GQM A;  3OR5 A;  1B9X C;  2HXK A;  1VF3 A;  4ECB A;  2R6K A;  4ULX A;  1U6T A;  1SKS B;  5IOW A;  5F05 A;  1PQN A;  3ZIJ A;  3W8J A;  1WPI A;  2JZS A;  3DYR A;  4N3Z A;  2HE3 A;  4X1U A;  5HR2 A;  4K5R A;  2OE1 A;  4IEL A;  2OA7 A;  1NSW A;  5DDL A;  4ML6 A;  1THO A;  4AI6 A;  1G7E A;  4CW9 A;  2E7P A;  1ZL9 A;  5FT3 A;  4ZIL A;  2PMT A;  2KLX A;  4KCA A;  22GS A;  4I5Q A;  3A2X A;  2WGR A;  3TJK A;  4HZ2 A;  4O92 A;  1QXH A;  2PUK C;  4F2I A;  2R4V A;  1O6J A;  2VM2 A;  1GSU A;  5KOW A;  2FUG 2;  3ZVJ D;  4PTS A;  4AKH A;  1NM3 A;  2HLS A;  2M46 A;  5D73 A;  4V1A p;  4WET A;  1FG4 A;  4GRF A;  3QFA C;  2E2G A;  2VOC A;  2CVK A;  5H5Q A;  3HJP A;  4NXI A;  5HQP A;  1XWA A;  3CSJ A;  3CRU A;  2VCV A;  1U88 A;  2VIM A;  1WRY A;  4P3Y B;  1B4P A;  4DEJ A;  4KCE A;  3GUR A;  12GS A;  5IMV A;  1TRW A;  4V2M A;  3LYK A;  1GUM A;  1IYI A;  4MNN A;  1GUH A;  2LST A;  1MEK A;  3P7X A;  2LRC A;  1GSY A;  3GRX A;  2B7J A;  2PPT A;  4PNG A;  5CAX A;  3PIN A;  3FRC A;  1WWJ A;  1B8X A;  3KIJ A;  1S3A A;  1OKD A;  2L5L A;  3DGQ A;  4ZL8 A;  2IFQ B;  3HDC A;  2DJ0 A;  3IAS 2;  2IL3 A;  1ZCP A;  4O5U A;  2X99 A;  1PX6 A;  4N0V A;  1EEJ A;  6GSV A;  4IGJ A;  1DUG A;  4HQZ A;  3CRT A;  1N8J A;  3F0I A;  2V6O A;  2C4J A;  5A34 B;  1SVL A;  4XIH A;  2YOI A;  1VGL A;  1I5G A;  2HFD A;  3TDG A;  1HNA A;  2AHE A;  2GS3 A;  5COH A;  3IC4 A;  2DSA A;  6GSX A;  4N11 A;  4TOP A;  5G5E A;  1QGV A;  4E8H A;  2VLU A;  2VKZ G;  3HZ4 A;  4YAP A;  2I81 A;  3VWX A;  2MBT A;  1VRS D;  4JR4 A;  1AC1 A;  4KA0 A;  1BJX A;  3H1N A;  2X4A A;  1HYU A;  2MMA A;  2P0G A;  2QA2 A;  3F9U A;  4JED A;  2R5G A;  4I6X A;  1K0O A;  1WOU A;  1SL2 B;  3UIW A;  1JFU A;  3PPU A;  3ZMK A;  4ZBA A;  3EVI A;  2VO4 A;  3ERF A;  2YZH A;  4KE3 A;  1XW5 A;  2TRX A;  4ICY A;  4MPF A;  3LWA A;  1TU8 A;  4K9Z A;  4QQ7 A;  1U87 A;  1A2J A;  4MJC A;  5J9B A;  8GSS A;  4WBR D;  3LSZ A;  2DJ2 A;  2H01 A;  5BMU A;  5GAN D;  4IP6 A;  3W8S A;  3DML A;  4L5O A;  5B8B A;  5B6N A;  5G1L A;  1PL1 A;  2MMO A;  2HSN A;  1Z6M A;  1WJK A;  4PUF C;  5KOX A;  5CRE A;  5C04 A;  5ABR A;  5B7C A;  2EC4 A;  4NV2 A;  2V1M A;  3F3Q A;  2FGX A;  3QCP A;  1HD2 A;  5J3R A;  5DAL A;  3M9J A;  1M9B A;  4GCI A;  3BJ5 A;  5HR1 A;  4J56 E;  1N25 A;  1ZYQ B;  2OBK A;  3UMA A;  5ECH B;  2VLV A;  2FA8 A;  1GNE A;  4QL7 A;  5AIX A;  2F51 A;  1VF1 A;  2X49 A;  3KCM A;  5L71 A;  2GGT A;  5LD0 A;  4L0U A;  2GSS A;  3HD5 A;  2DJK A;  4AJ7 A;  2I1U A;  2IME A;  1FHE A;  2OE0 A;  4HEA 2;  2LJR A;  4WF4 A;  3D5J A;  2H66 A;  4OMV A;  2V32 A;  4NHW A;  3ZRE A;  2XPD A;  3J7Y k;  4GSN A;  3DVX A;  4GWR A;  5G1K A;  4MZC A;  10GS A;  3BCI A;  3P2A A;  1IYH A;  2CX3 A;  2A2S A;  1G0T A;  3ERW A;  2YWO A;  1FB0 A;  4G0K A;  1BYE A;  5FHI A;  1EWX A;  5ID2 B;  4XCS A;  2CA8 A;  3SBC A;  4N0Z A;  1ZYN A;  4IQA A;  2MMN A;  1SVM A;  1KTE A;  1O73 A;  2FY6 A;  4KAE A;  2R0C A;  3D0Z A;  3JCM L;  3C71 A;  1V98 A;  3LXZ A;  5JCG A;  2H72 A;  1Y25 A;  4KX4 A;  1E6B A;  2HRA A;  3G7J A;  2FA4 A;  1PA3 A;  2HYX A;  2HZE A;  20GS A;  2HSY A;  2RM5 A;  4OFN A;  4RI6 A;  4MA9 A;  4MLY A;  2R3X A;  3FR6 A;  2BTO T;  2AUV A;  3GTU A;  2I3Y A;  4GF0 A;  4KB3 A;  1XVQ A;  1A0R P;  1JZW A;  4TXO A;  3GH6 A;  1UA5 A;  2KP2 A;  3LFL A;  2EIR A;  3IRA A;  3ISO A;  3UBK A;  2I9H A;  1SYR A;  4GQC A;  5CP1 A;  3FZ4 A;  2H70 A;  1XXU A;  2KP1 A;  3GL5 A;  4FYB A;  1XW9 A;  1PN0 A;  5D93 A;  1F2E A;  5CRH A;  3VI7 A;  4IKH A;  1XOA A;  2FWG A;  1K3Y A;  2RUF A;  2ON7 A;  2JU5 A;  3IK9 A;  1GLQ A;  1K0M A;  3KH7 A;  1OE8 A;  7GSS A;  1GNW A;  1GTB A;  4IS0 A;  1T7P B;  4IBP A;  3ZL5 A;  4XS1 A;  1DE1 A;  4EUY A;  5E59 A;  5D9T A;  4ACS A;  1BAY A;  2K18 A;  2X8C A;  11GS A;  1ST9 A;  4IVF A;  1SJ6 A;  3F4R A;  1XOB A;  1AUC A;  3MNG A;  1V9W A;  2A4H A;  4TR4 A;  4PQH A;  4K7N A;  2IMD A;  2K8V A;  2N5A A;  4OO5 A;  3ZLP A;  1B9Y C;  4ZBB A;  2H0G A;  4OCF A;  2DJ3 A;  5HFI A;  4GTU A;  2DML A;  3EU4 A;  1XBS A;  2KUC A;  4MMM A;  2RLI A;  2O87 A;  3I6A A;  4PX1 A;  4XS4 A;  16GS A;  1SKR B;  4LA1 A;  2NVL A;  1JHB A;  2LEG A;  3GSS A;  2UV8 G;  1TRV A;  3SWL A;  2YWI A;  2JZT A;  5HFK A;  3HZ8 A;  5E4W A;  1OC8 A;  4HU7 A;  1YF1 A;  4L5L A;  4H86 A;  2C3N A;  3M0F A;  2YAN A;  3IHQ A;  2GVP A;  3IC8 A;  3RDW A;  1SD9 A;  2C3Q A;  1TP9 A;  4JBB A;  3C1R A;  3EMP A;  3WT1 A;  4DSS B;  4MK3 A;  1BX9 A;  3QAV A;  1EP7 A;  1YEP A;  4I2U A;  5JCU A;  4K6X A;  2VCZ A;  2LNS A;  4WEY A;  3UAP A;  5GAP D;  5BRT A;  3I9V 2;  4LL4 B;  1XWB A;  2VAF A;  3IBH A;  1SU9 A;  3M9K A;  2L59 A;  5IPH A;  1JZR A;  4AKX B;  2HQT A;  4ECI A;  1YEX A;  4EE0 A;  4BPY A;  4I8B A;  4BVX B;  2LUS A;  3RHC A;  5F07 A;  4J57 E;  3HMJ G;  5GST A;  5ELA A;  2YJ7 A;  4LL1 B;  2BJX A;  3UJ1 A;  2MBS A;  3LEF A;  2O8V B;  4YKF A;  1SL1 B;  1MTC A;  3DD3 A;  2HT9 A;  2YNX A;  1LU4 A;  1JZD A;  2NBS A;  2M80 A;  1XW6 A;  4TR1 A;  2GZP A;  1ZGN A;  4KDY A;  1OC9 B;  4F03 A;  5DCG A;  2NTO A;  3GKM A;  2H71 A;  3TKS A;  4Z2R A;  3EWL A;  1QQ2 A;  2WB9 A;  4ZB8 A;  4MP4 A;  1PL2 A;  3F4T A;  4TKY A;  1MD4 A;  3UEM A;  2E2M A;  4G2E A;  4L8E A;  4MJA A;  14GS A;  5KN3 A;  2PN8 A;  2DIY A;  1EP8 A;  5DJL A;  4I97 A;  1XPV A;  3TGZ A;  4ZIJ A;  3KMO A;  4K5S A;  5A5H A;  1PKW A;  4MAB A;  3F6F A;  1KBN A;  3E0U A;  1QFN A;  3IXR A;  3ZML A;  1TOF A;  5EVO A;  5HR3 A;  5EL8 A;  4BL7 B;  5J40 A;  3M3M A;  2ON5 A;  1GSD A;  2VM1 A;  1HQO A;  5A1N B;  1ZOF A;  3Q74 A;  4OFT A;  4MDC A;  4OD7 A;  2C3T A;  1Z3E A;  3RPP A;  1DSB A;  2I4A A;  4PNF A;  3A3T A;  3HYP A;  4XRD A;  5IO0 A;  4BWQ A;  1PMT A;  3J7Y b;  5CNW A;  3KEB A;  5DBQ A;  3I43 A;  2QSI A;  3HKR A;  1GSE A;  5G31 A;  3NZN A;  3VPQ A;  4HZ4 A;  1G6Y A;  2EFC A;  1FOH A;  6GSY A;  5D9W A;  1YZX A;  2VCX A;  5ECM B;  4FYU A;  1TK5 B;  1TXX A;  1X0R A;  4PUR A;  1TW9 A;  1Z7P A;  4G0L A;  1PX7 A;  4LMW A;  3TOU A;  3GHA A;  3VWW A;  1H75 A;  3ERG A;  2H6Z A;  3TJG A;  3E9J B;  2J23 A;  1AQX A;  3L9V A;  4PGT A;  2YWM A;  4ILF A;  5INY A;  1SKW B;  3GKX A;  4HJM A;  2YN1 A;  3O6T A;  1OE7 A;  1OC3 A;  2MYG A;  4KW6 A;  17GS A;  3FZ9 A;  4ISD A;  5AGY A;  3MDK A;  2R2J A;  3PR8 A;  6GSS A;  3QR6 A;  2ALB A;  4LMV A;  5J9C A;  2H1D A;  2N5B A;  1ERU A;  2JSY A;  3FK8 A;  3A2W A;  3KM6 A;  1T4Y A;  1QMV A;  1NW2 A;  5ECL B;  4HUA A;  3FHK A;  4AKI A;  4EKZ A;  5B8A A;  4TN8 A;  1R5A A;  2B5X A;  3RBT A;  4PXO A;  1PRX A;  1RQM A;  5H5R A;  4E68 A;  1AXD A;  2GZY A;  3TUE A;  4Q5R A;  2JL4 A;  1YKA A;  3QD9 A;  1X9M B;  1DE2 A;  3MYD A;  2FWH A;  5IO2 A;  3TKS E;  5JWQ B;  5IMA A;  4D73 A;  2LRT A;  2GT5 A;  3DKS A;  2F3M A;  2VL3 A;  3VPT A;  1AIU A;  2X64 A;  1S3D A;  3TKP A;  3GIX A;  4EF0 A;  2YV7 A;  5FWG A;  2VCQ A;  1YKC A;  3FMW A;  3QMX A;  4J2F A;  3CBU A;  2CZ3 A;  3FZA A;  4MJE A;  2XBQ A;  4OWY A;  5A4U A;  2H1A A;  3EIN A;  2GQK A;  19GS A;  2H30 A;  2AAW A;  2L4C A;  18GS A;  4G0I A;  4HDE A;  4JE1 A;  1A2L A;  3LJR A;  1FW1 A;  2HSM A;  4WR5 A;  3D4T A;  4POM A;  4ECC A;  1BED A;  1TK8 B;  3UVT A;  4KH7 A;  5JWO B;  4Q5Q A;  3QAW A;  1TTZ A;  1DBY A;  3Q6O A;  4IJI A;  4MF6 A;  1Z6N A;  3LXT A;  1O7U A;  3D21 A;  3GUS A;  3MIX A;  2B1L A;  3GKN A;  3ZVJ A;  2LV3 A;  3APS A;  4E8E A;  2JAD A;  3GV1 A;  2HRN A;  1URM A;  5BMU B;  1OAZ A;  1M2A A;  2B3S A;  3GMF A;  3ME8 A;  2XC2 A;  5GZZ B;  1F9M A;  2LKU A;  3HXS A;  5D96 A;  1OYJ A;  3EU3 A;  2L6D A;  4JZQ A;  2CAI A;  4OCE A;  3F6D A;  3KJY A;  2HSN B;  2DIZ A;  2CV4 A;  1A8Y A;  5DAL B;  1ABA A;  3VI5 A;  3F4S A;  2AYT A;  1GSS A;  1YDK A;  5ECQ B;  1T4Z A;  4G9H A;  5D8I A;  3CWG A;  3BOA A;  1V57 A;  3CYN A;  1T00 A;  2YV9 A;  2H75 A;  1UVZ A;  4YQU A;  5IMZ A;  1V58 A;  1GUL A;  2PBJ A;  2DKH A;  2HZF A;  1K0D A;  1SJZ A;  1MDK A;  4EIQ A;  1BG5 A;  3LQ7 A;  5J41 A;  3DVW A;  1EGO A;  4K2X A;  2XHF A;  1K3L A;  1AAZ A;  2DMM A;  2WS2 A;  4BVY A;  3V1W A;  2NPB A;  1O85 A;  4IQ1 A;  4MPG A;  4KND A;  1O8W A;  5IMD A;  1GRX A;  5ENU A;  1QK8 A;  5IMF A;  3QOU A;  3ZRD A;  1R7H A;  1CQH A;  2HRK A;  2QGV A;  3CSH A;  2K6V A;  2REM A;  3IA1 A;  1FOV A;  3RHB A;  2GT6 A;  4HQS A;  5J4U A;  5AN1 A;  4AF2 A;  3TB2 A;  3IE3 A;  4JRR A;  2LRN A;  2IIY A;  1GTI A;  2G2Q A;  3PH9 A;  4IN0 A;  2WRT A;  2GSR A;  1GH2 A;  2QKE A;  4EO3 A;  5IMC A;  4FIW A;  4O7H A;  1SVO A;  3KTL A;  2VD1 A;  1M99 A;  4MF7 A;  3M8N A;  1JLW A;  1C72 A;  6GST A;  5DQY A;  5KN1 A;  1O8X A;  2HZE B;  2TIR A;  5A5K A;  2VD0 A;  5JWR B;  1OVN A;  3Q19 A;  1THX A;  2FCH A;  3L9S A;  2IWT A;  3FYG A;  4ZB6 A;  3GTU B;  1GTU A;  2LQQ A;  4TXO B;  4ZB9 A;  5IOX A;  2B5E A;  1MD3 A;  2P5R A;  3AY8 A;  3L78 A;  3NOF A;  5F06 A;  2Z9S A;  4NMU A;  2GSQ A;  5D9X A;  3BD2 A;  2PGT A;  4EXJ A;  4AJ8 A;  1FVJ A;  3IV4 A;  5DAK A;  2H76 A;  4NV5 A;  2TRC P;  1G7O A;  4EIP A;  2K9F A;  1K3O A;  3WD6 A;  5C00 A;  4V2N A;  5GSS A;  1WMJ A;  2ZUP A;  4F9Z A;  3MSZ A;  5AIS A;  3GA4 A;  2CQ9 A;  5J47 A;  4HU9 A;  3D22 A;  2L6C A;  1V2A A;  4HI7 A;  1BG1 A;  5DVB A;  1M7T A;  4JR6 A;  3ZFB A;  2G0F A;  5H5S A;  5JCW A;  3DWV A;  3ED3 A;  4NPB A;  4WBJ A;  4NAX A;  3BBY A;  1EZK A;  2VL2 A;  2IMF A;  1EEM A;  4JU5 A;  1EV9 A;  1HNB A;  3IOS A;  2XPE A;  4WF5 A;  3VK9 A;  2VCT A;  4NHZ A;  2GZZ A;  3D4M A;  5IM9 A;  3O76 A;  2GTU A;  2IMK A;  3H79 A;  5J4V A;  2V2G A;  5ECN B;  3ZTL A;  4TR3 A;  3N5O A;  2HRF A;  3QAG A;  5G2Z A;  1BF5 A;  1KNG A;  2LJK A;  2H6Y A;  2MMZ A;  5CRG A;  3O3T A;  2OKA A;  5EY6 A;  4OFM A;  2O7K A;  4YKG A;  2H6X A;  1FVK A;  3GL3 A;  1AQV A;  2LJA A;  2ZCT A;  1SJI A;  1TK0 B;  1BQ7 A;  1YY7 A;  1F3A A;  2O5V A;  2CAQ A;  1UN2 A;  2EIO A;  2LNT A;  3QDN A;  3TKR A;  4XS4 B;  1M0U A;  3DIE A;  3ZIT A;  2OBI A;  2PU9 C;  2D2Z A;  2H0H A;  2JZR A;  3GKK A;  3QPM A;  4FO5 A;  2X8H A;  3A2V A;  1U3A A;  4ZL7 A;  4O5R A;  4K8M A;  4KDU A;  3C73 A;  5A4V A;  2H8L A;  5CRD A;  1TI3 A;  4GSS A;  2EFE A;  2B7K A;  3IHG A;  2P5Q A;  5EPF A;  4KF9 A;  2FHE A;  1T8E B;  3HVX A;  2OT3 A;  1TDI A;  4K7O A;  2L57 A;  1R26 A;  3TKS C;  4IW9 A;  4DSQ A;  4XHM A;  1WE0 A;  4XRA A;  1KEB A;  1K0B A;  2JSZ A;  3FR9 A;  5ELG A;  4N30 A;  3A5I A;  4MZW A;  3NIV A;  5ECK B;  2KOK A;  4TRX A;  4ZBD A;  2FD3 A;  4EL1 A;  1K0N A;  4AKG A;  2C8U A;  2DJJ A;  4Q5N A;  2KHP A;  2FWE A;  3C8E A;  2O89 A;  2DJ1 A;  4MH3 A;  2H1G A;  5F8B A;  4DVC A;  2LS5 A;  4POK A;  3IDV A;  4TR1 B;  3VLN A;  4HOJ A;  1EV4 A;  1Z5Y E;  1S3C A;  1VF4 A;  4KDX A;  3HCZ A;  4V2L A;  1A8L A;  2EFD A;  1YF0 A;  3A5W A;  2A4V A;  1EOH A;  1ZYP A;  3F8U A;  1PGT A;  5F0G A;  2HI7 A;  2IFQ A;  4GDF A;  1QUW A;  1I9D A;  4CY6 A;  4G10 A;  3GN3 A;  2C80 A;  3C1S A;  2IMI A;  5A5H B;  1GSF A;  3N9J A;  1SEN A;  1Y6E A;  1ZMA A;  2C0G A;  1XZO A;  3GFK A;  4YAV A;  4AGS A;  4TXV A;  1TXU A;  1R5P A;  3EC3 A;  1TRS A;  1T3B A;  5A34 A;  4K7I A;  4CY8 A;  3UOM A;  4PUA A;  2B5Y A;  4USS A;  3FZ5 A;  2M72 A;  4L0W A;  2YCD A;  1GLP A;  5ECO B;  1V40 A;  3HJO A;  4I2T A;  4ML1 A;  3L9U A;  1PN9 A;  1A0F A;  4K0N A;  2A2P A;  1F37 A;  3KD0 A;  5IPG A;  4POB A;  1AQW A;  3FKF A;  1OKT A;  1WIK A;  3GX8 A;  3VFI A;  1SK0 A;  1XCC A;  1SL0 B;  5DCH A;  4GQF A;  3ZFL A;  1SK1 A;  1USB A;  4ID0 A;  1K0C A;  2HSH A;  3BCK A;  3G9B A;  2J9H A;  3MAK A;  4KGI A;  3G7Y A;  4MH2 A;  3HJM A;  3ZZX A;  4HJ2 A;  1ERT A;  2R37 A;  4BA7 A;  2VCW A;  5ECS A;  2C0D A;  4IJ3 A;  1LJR A;  1GP1 A;  4TR0 A;  4OO4 A;  2WDU A;  2P31 A;  1LBK A;  1VF2 A;  4F82 A;  2WZ9 A;  1PD2 1;  1TRU A;  2A2R A;  4X0X A;  3CSI A;  4XTS A;  2E0Q A;  1X9S B;  4G01 A;  3M1G A;  5HR0 A;  3U5R E;  2B1K A;  3APQ A;  1EOG A;  4Z7X A;  1X5E A;  4GST A;  2GLR A;  1Z9H A;  3K8N A;  5G30 A;  2PWJ A;  3FEU A;  2CVB A;  2FLS A;  3VWV A;  4GXZ A;  4POL A;  3I69 A;  6GSU A;  4O32 A;  1XWG A;  2FWF A;  1K0A A;  2GST A;  2YWN A;  3US3 A;  2OAC A;  2H0I A;  1TJD A;  3L0H A;  4ZL9 A;  3RAZ A;  2H1B A;  1JZO A;  1GWC A;  4K1F A;  2YZU A;  3ZYW A;  3U6V A;  5A4W A;  2DKI A;  3DRN A;  1SYX A;  1ON4 A;  4D73 B;  2JAC A;  2RII A;  3GNJ A;  4FQU A;  2R0G A;  1ILO A;  4W66 A;  1Q98 A;  4HS1 A;  2DBC A;  4K2D A;  3LOR A;  2F8A A;  2LTK A;  5ID2 A;  2VLT A;  3E3E A;  4KSM A;  2CZ2 A;  4PQ1 A;  3CTF A;  2F9S A;  9GSS A;  3LG6 A;  4YH2 A;  1XWC A;  2OJL A;  2C1Y A;  1U3I A;  3F63 A;  3WT2 A;  4IHU A;  1FO5 A;  2HSM B;  5IQY A;  5J4Y A;  1YJ6 A;  3FY7 A;  1CQG A;  5ECR B;  4Q5F A;  2RM6 A;  3P8W A;  4N10 A;  5DJM A;  2HNL A;  3WYW A;  2VL9 A;  3R3E A;  2N5F A;  3EYT A;  1PKZ A;  4Z2T A;  1ZZY A;  3TRX A;  2AV4 A;  3H93 A;  1O81 A;  4EDZ A;  2RUE A;  4WR4 A;  3TKQ A;  3IR4 A;  3TJB A;  3APO A;  3R2Q A;  3LGC A;  1ZYE A;  4TW5 A;  3WGX A;  1J08 A;  1ERV A;  4O5Q A;  1W89 A;  4V1A g;  4TVE A;  2XBI A;  3UAR A;  3L4N A;  5LNK e;  2DLX A;  3ME7 A;  1R4W A;  3KP9 A;  4ECJ A;  5CO3 A;  2AB6 A;  3HHV A;  4FH8 A;  4WXT A;  3RPN A;  4ZB7 A;  2YP6 A;  2GQL A;  1YQ1 A;  1XFL A;  2X8G A;  3D6I A;  3LYP A;  2WCI A;  1A24 A;  1B4Q A;  1NHY A;  2H73 A;  1FB6 A;  3UBL A;  2IPA A;  3HA9 A;  2VUP A;  2V41 A;  2L4Q A;  3IK7 A;  3TU3 B;  4GLT A;  3UL3 A;  3EPT A;  3KMN A;  2NDO A;  1HNC A;  1Z7R A;  3WGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...