4LN1A

Crystal structure of l-lactate dehydrogenase from bacillus cereus atcc 14579 complexed with calcium, nysgrc target 029452
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
321
structure length
317
Chain Sequence
ENLYFQSMKKGINRVVLVGTGAVGCSYAYCMINQAVAEEFVLVDVNEAKAEGEAMDLSHAVPFAPAPTRVWKGSYEDCKDADLVVITAGLPQTRLDLVEKNAKIFKQIVRSIMDSGFDGIFLIATNPVDILTYVTWKESGLPKERVIGSGTTLDSARFRYMLGEYFDIGPHNIHAYIIGEHGDTELPVWSHVSVGIQKLQTLLEKDNTYNQEDLDKIFINVRDAAYHIIERKGATYYGIGMSLLRVTKAILNDENSVLTVSAYLEGQYGQKDVYIGVPAVLNRGGVREILEVELSEDEELKFDHSVQVLKETMAPVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of L-lactate dehydrogenase from Bacillus cereus ATCC 14579 complexed with calcium, NYSGRC Target 029452
rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase 1
total genus 100
structure length 317
sequence length 321
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ln1A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ln1A02
5F3RA 1NX6A 1YB4A 4LGVA 3S2EA 5I8WA 2VUUA 2WDZA 3W4IA 3GVCA 2PA3A 3DHYA 3KHUA 4AJEA 3HDJA 5TSDA 1BXGB 1XU7A 2ZTLA 1I32A 2B83A 3VPFA 3LK7A 3H65A 4WNCA 1P31A 2RHCA 1ISFA 3GEGA 2FN7A 2FZEA 3PGXA 5DOVA 1KVRA 3VKVA 1JAYA 3D64A 4E4YA 4DMLA 3O9ZA 4EZBA 1HDCA 1PU2A 1TXGA 4XYEA 2D1YA 1HYGA 2Y0CA 4I9NA 4YB8A 4YJFA 4J7XA 1F06A 4FN4A 5KTKA 4TRNA 2NU6A 2IEDA 2B35A 1NASA 1X14A 3SJ7A 2X58A 1J0XO 1U7HA 3DMYA 5EERA 3JQ9A 2JCYA 1B8PA 4KUEA 4MVJD 1AXGA 1K6JA 2GASA 5T6BA 2I67A 3NDIA 1WNTA 3EUWA 5EL0A 3F47A 1NNUA 3TDKA 4KWIA 2X9NA 3O4RA 4MO2A 4BGVA 2GDZA 4K9DA 1VM6A 5GZ6A 3ANLA 3IJPA 3PWSA 4NR0A 1WVGA 4RPGA 4BMNA 1PJTA 2GGSA 4YJGB 1OOEA 1HLDA 5HS4A 3WTBA 4HP8A 3C24A 1R4NA 3A1NA 1SO8A 3ROMA 2HRBA 4FC6A 4WOJA 4BNYA 4DPKA 1P77A 4H16A 3ZHZA 4BOYA 1E3WB 3FBGA 5FEUA 4FFOA 3AUSA 1E5LA 3NTQA 1KVQA 2X5JO 4TRJA 5F5LA 2AEJA 4GI2A 2A35A 2CFCA 3EAGA 3GZNA 2AQ8A 1T1RA 1O95A 2HQ1A 2WYUA 4Q3CA 4PG6A 1OC4A 2GSDA 4RZHA 1LI4A 1P33A 4YQYA 3VPSA 2JFFA 2HMSA 2X6TA 1GZ6A 5THQA 4JJIA 4R3WA 3GMDA 1ADCA 1DRUA 2NVWA 1EUDA 5GZ3A 2ZTMA 3DC2A 3JV7A 2B4TO 3UN1A 3NT2A 2FSVA 4QEDA 5TC4A 3ZHXA 4AJNA 3VDRA 3IC5A 4GVXA 3QY9A 4IQ0A 1T2AA 1KBZA 4DA9A 3AM4A 1W73A 5TLSA 1KC1A 1DBVO 3GAZA 2XAAA 5DCUA 2YFQA 5JDIC 2Q3EA 3ROKA 1LRJA 1P1KA 3TPCA 4IDCA 3WG9A 3W8EA 2YFHA 2ET6A 2ZB3A 1WXDA 1TT7A 4HFRA 4WEQA 4Z9YA 4HBGA 4UEOA 1K5HA 4OMUA 5KCZA 1AHHA 2O3UA 4J16A 3FWNA 3PI7A 3WQQA 2JFGA 1E6UA 4XB1A 3JQAA 3DOCA 4BKRA 5ADHA 1S6YA 4A27A 5TGDA 4IJWA 3DTYA 2I3GA 4RL6A 3IUSA 4WUVA 4XIJA 4ZJUA 2Q45A 1NWCA 2EG9A 1QLJA 3QP9A 4WLUA 5JFOA 4NBVA 3GLQA 2SCUA 3ZHYA 1WLYA 4R41A 4OJNA 4KQXA 1U3WA 1OBFO 1YOVA 1GCOA 4FOSA 3GUYA 2IYOA 4R1NA 4K6FA 3UICA 1P0CA 4XIYA 3RJ5A 1YONA 4BO4A 4A0SA 1PJLA 3GC6A 5JYDA 2GO1A 5MDHA 1WDLA 3NKLA 5KKCA 1G1AA 3PLRA 1NVGA 2BLLA 1E3EA 2NQ8A 3RVDA 1PEDA 2YV1A 3WBBA 1T4BA 4ZQGA 3FN4A 1MX3A 1DFIA 1KVTA 3K9QO 3OJFA 1H2HA 1D3AA 4XYBA 4INAA 5DNAA 5DN9A 4U5QA 1LSSA 5L3ZA 2IZZA 4ZQBA 3I9OA 1XIVA 1M6WA 4I5GA 2B37A 4QFCA 1WZEA 2DBVO 5B4TA 3WXBA 4GPD1 4ROSA 3WFIA 3TL2A 2PZKA 1IZ9A 4GH5A 2HAEA 4R16A 2C5EA 1EFKA 4RVUA 5C7OO 1ZUD1 3RD5A 4AJ1A 1HXHA 2ZJ1A 4FFMA 1GTMA 4Z3DA 1M6HA 3LQFA 1AHIA 5J23A 5A3VA 3BMOB 4GQAA 1JW9B 1EVJA 2J3KA 4BNMA 1Q0LA 3PEFA 1NQOA 2BRUA 3WGOA 4U0KA 3IJRA 3U0BA 2O3JA 3BTSA 3F5QA 2ZB8A 1P1JA 3KYBA 1TB4A 3NAQA 1BWSA 3AU9A 2WMDA 2BFOA 4MJLA 4BNKA 1A5ZA 1ZJZA 2NTNA 1HYHA 1IPEA 4CLRB 3GFBA 2GR9A 1Z74A 4LMRA 4UVGA 3PZBA 4OXNA 3BYZA 2VT2A 1I5RA 3BA1A 3GN1A 3OSUA 1ULSA 3ZWBA 2NV6A 2RCYA 5K9ZA 1UZMA 4PG7A 3VC7A 2HMUA 2IDZA 1YGYA 4HXYA 1NFRA 3X2FA 4J0FA 4EUFA 4O59O 3AM5A 1VKNA 1NBOA 2P9GA 4R54A 4CLEA 2PFGA 3PHLA 3GRKA 1UDAA 4DPLA 3WGGA 3INRA 4IQGA 2XOXA 4LCEA 3SJUA 4XR9A 4AJOA 4B7CA 5CG2A 1C14A 1PJ3A 1I3KA 4WNIA 2DTDA 3FCOA 3Q6IA 4FW8A 2R2GA 3ORFA 1E1LA 2VTEA 3DBLB 1GEEA 3I9JA 4MVJM 5LDHA 4ZICA 1LEHA 1G0OA 1LUAA 1Y8QA 2P91A 2V65A 2CDAA 2HRZA 2EJVA 5T57A 4RJTA 3QVXA 3ZWPA 3T4XA 4IMPA 1DHTA 3UCXA 4GSKA 1WDKA 4ALKA 2CVOA 3V8BA 1E7MA 4DQVA 3GNSA 1KIFA 4JK3A 4CMGA 1QV7A 1RM5A 2B69A 1YL7A 5JLAA 3JYQA 2DKNA 1ENYA 3O8QB 5CDGA 2IODA 1RM3A 5G0UA 3GVHA 4ZQFA 2OP0A 2HMWA 1B26A 2VYND 2BFMA 3AY3A 5KWEA 4NFSA 1GUYA 1PWXA 5JY1A 5K6AA 3ZU5A 4BQRA 3MJCA 1YS4A 1PS9A 4DIFA 1IOLA 5L7YA 3C7AA 1DO8A 4CM8B 1FDUA 1SAYA 2UAGA 4AJPA 1HT0A 1UJMA 1MG0A 2VHXA 4RF3A 2W98A 2FRDA 3E82A 4S3MA 4Z9FA 1GPDG 1HWYA 1JWBB 1C0LA 2F00A 2UUOA 5BNIA 4CV3A 2QQ5A 3Q1LA 4BKPA 1CRWG 1T1SA 4AICA 4NH4A 1P9LA 2W2LA 3H3JA 3ADOA 1ZIDA 4F6CA 5JSFA 4QT0A 4CQLA 2YHIB 3JD2A 3SLGA 2O23A 4BKOA 3D4NA 2YHIA 1MB4A 3AFNA 4MVJA 5JO9A 3QWFA 1I33A 4Z0PA 3RUCA 1QLHA 3K5PA 4KQWA 4P22A 5U4QA 4UUMA 1QYXA 4BB5A 1IHYA 4DXHA 1R0SA 1Z6ZA 3DTTA 5BT9A 3RCBA 2AQIA 3WSVA 1F8GA 1S7CA 2CF6A 2Z1NA 4ESOA 2VUTA 2WD7A 2J6IA 3ETEA 2EKQA 2R00A 3ROPA 2P4QA 4A26A 3UF0A 2GN6A 1KETA 3O26A 4RPJA 3AY7A 3L77A 4J9VA 4OO3A 1X0VA 2Y1EA 1LSUA 2FR0A 3G1TA 3ZV5A 3VTFA 4O63O 3D4OA 3FSRA 3AJRA 3U4IA 4JJGA 4L73A 3ZDFA 4BV9A 1GAEO 1UXJA 2GZ3A 3GDOA 1NQAO 3JQEA 4BO8A 2A4KA 1FDWA 4QFDA 4E5NA 2EP5A 3KRTA 3TZKA 3QIVA 2Q2QA 2CMDA 3C1OA 3MJ4A 4PVDA 1E7YA 2XXJA 3LC2O 2Y99A 3STHA 4E5MA 1U1IA 3ZWNA 3QVOA 2JKVA 3GUCA 5B4VA 2PZJA 1OFGA 1FJHA 1UDBA 4KDFA 1GPJA 2BGMA 3E03A 4NDNE 3PJFA 4E2ZA 1NQ5A 1DJQA 4UULA 1DAOA 5KOIA 9LDTA 4RORA 3R6DA 4P38A 4HY3A 2IXAA 1WZIA 3S2IA 4FFRA 3RU9A 3FTPA 1UZLA 1ZMOA 1N1EA 4IXWA 3QVWA 3I4FA 3WS7A 1NQTA 3I4CA 2VCYA 3LC7O 4EJMA 5T5QA 4XDZA 1AUPA 4D3SA 2J3JA 4IXTA 2D4AA 3EK2A 3TFOA 4NK4A 3W4KA 3S8MA 3QQPA 4MIYA 5H83A 3VTZA 4ALNA 1UXKA 4OHUA 4ALMA 3DZKA 3GG2A 1R4NB 3ANNA 1EBFA 3OH8A 3AOEA 1GQQA 2P5YA 3AW9A 2H5LA 2QX7A 2TMGA 2V6BA 4IPTA 4AL4A 3GMSA 1YJQA 1BMDA 2VYNA 3P5SA 5G4LA 1SEPA 1I2BA 4DBVO 4TSKA 3ABIA 5G0SA 2GN9A 2I3AA 3DFUA 3LC1O 4J1NA 5A03A 1EUZA 2JHGA 3LYLA 1NR1A 4KMSA 4RV9A 3OEWA 4NIMA 1EEHA 1U3UA 2OFPA 4E12A 2FMUA 4ZHSA 4YAJA 5GZ1A 2BH9A 2PY6A 4TZTA 4N54A 3JQ8B 1LQTA 1UUFA 1ZZEA 4G65A 1ZFNA 2O4CA 2Q4BA 1P1FA 1HDYA 1VKOA 3PRJA 4ND1A 4NPCA 4W9NA 3E6AA 4Z0TA 1FK8A 1C0KA 2Z1MA 2HJRA 5COQA 1MLDA 4J4HA 4P4LA 3JQCA 4L0QA 1XELA 4CMBA 1B14A 1UP6A 2Y1FA 3GNQA 1E7SA 3A14A 3GVPA 3WLEA 5JYEA 2JD0A 1UP7A 3JQGB 1VSVA 2PK3A 3KBOA 5L45A 4EI2A 1AGNA 5U9CA 4IJKA 4YT4A 5AXAA 5FF9A 3IS3A 3GPDG 3RU7A 2Y0EA 4YVFA 4RCVA 3U9LA 1PQWA 2I76A 3D4PA 3LSYA 1CERA 3VAZA 1GD1O 2Y1GA 5B1YA 4KUGA 3I6IA 1QRRA 1CDOA 3L0DA 3L4BA 4QO8A 3MTJA 2FR1A 1W4ZA 3K92A 5L4SA 3HG7A 4FCCA 2ZCVA 4ID9A 3WFJA 4ZVVA 3SEFA 1R6DA 1ZJYA 4RQTA 4I8XA 1FXSA 4BNUA 3E5MA 1YBAA 2IEBA 3RWBA 3M1AA 1G0NA 2NNLD 3CUKA 2O3QA 2UYYA 3DEYX 3ENNA 2ZK7A 4XQ9A 4YBZA 1FMCA 3KEQA 1LJ8A 2IZ0A 3K8ZA 4A73A 4AFNA 4F3YA 1U4SA 2O7QA 3I52A 3OIFA 4N5LA 3BHJA 4OXKA 2LDXA 4WECA 5BNTA 4M49A 2VYVA 3HN7A 4OIMA 3WSWA 2PKQP 2HSDA 1GQYA 3ASVA 4CM8A 5CDSA 5AXBA 1ZXBA 2OHXA 2VT3A 5JAQA 3TWOA 1BHSA 4O1MA 1DPGA 2EGHA 2P5UA 1WW8A 3DL2A 2VUSA 2EJWA 1H5QA 4YJHB 1J49A 4U6QA 1BVRA 1P1HA 2QRLA 3CEAA 4BO3A 3OBBA 5EESA 1Z45A 3WJ7A 2Q99A 3RFVA 4AJHA 3VZQA 5KJ6A 5IAAA 1LDYA 4PIVA 2VOJA 3ULKA 2YZ7A 1B2LA 2BFAA 3WOHA 2TMDA 1DC4A 4AG3A 2WYWA 3W8FA 3ZNNA 1GR0A 4CR8A 3FNGA 3FR8A 5IF3A 5ITWA 3M2TA 5IG2A 3FF4A 5K6AC 4AJKA 2ZYDA 3GK3A 1E7RA 4LCJA 4M54A 3QVSA 4GBJA 4KTVE 4GLOA 2YYYA 2NU9A 3JQBC 1HL3A 1GYQA 3ZWYA 7ADHA 1JKJA 1HDOA 2ILTA 4CMAA 5CDYA 2AHRA 2GUGA 3HDYA 3MOGA 3P2YA 3WGHA 3GAFA 1E3JA 4OH1A 2NTJA 3CSDA 3RASA 1Z82A 4W82A 1BTOA 2B5VA 3HSKA 4CMIB 1T2FA 2YHUA 3JQGA 4NBRA 4NU5A 3KV3O 1ZXLA 4PLFA 3JQAD 5LC1A 2HKIA 4NFHA 1QV6A 1PL6A 3ZWXA 2EHDA 2YV2A 1FDSA 1JTVA 3IMFA 1PGJA 3IQDB 4AVYA 2WM3A 2QZ9A 2ZB4A 3GGPA 1Q7GA 1VRWA 2BGKA 1X15A 3JTMA 4ZRMA 4IM7A 5JDIA 2C07A 1O5IA 4CM7A 1H6CA 1E3LA 5A06A 4CLRA 4KTTE 5JAZA 4XKJA 1NPYA 4MIEA 7MDHA 4CMHA 4PZEA 4ZGWA 3PHGA 4G5HA 3VDQA 5ENVA 4YWJA 3ONEA 4CV0A 3WNQA 3GVIA 1M66A 4E21A 3JYNA 2FPGA 3E18A 4CLXA 5IXYA 3DZHA 3ASUA 3AOGA 4XDYA 9LDBA 4LN1A 5MGBA 4CUZA 2YQ4A 4KDEA 2GZ1A 2PGJA 4CQMA 1C1DB 5L40A 4RVDA 3WJAA 1PJCA 1PQUA 1VPDA 2HK8A 2I66A 4JBHA 5JCJD 2X0JA 3FR7A 4DBZA 4QXMA 1V3VA 1LC0A 4RLSA 1XGKA 4NU6A 1F12A 2B36A 2IE0A 3ADPA 4E5YA 2PWZA 4MP3A 1DLIA 1W6UA 3EHEA 4P4NA 2VHYA 2PZLA 3RROA 3D5TA 1ML3A 1VSUA 1Y8RA 1JVSA 4XB2A 4I5DA 2X1HA 3E9MA 3JD4A 5DZSA 3WDSA 1ZSVA 4U7WA 5CEEA 3KSUA 3DB2A 2NVUB 5IN4A 1MUUA 3RC1A 1PJQA 4A5OA 1HSZA 3UCFA 4ND5A 2FY8A 4QTZA 4BVAA 1GUZA 4PVCA 1LRKA 4HX5A 4WCFB 3MJSA 5A9SB 1PIWA 1BGVA 1NXQA 1WDMA 2RIRA 2ZIZA 3P19A 4W7HA 1H9BA 3ICCA 1VE9A 1I3NA 4Q3AA 2PKRA 3DAFA 2RH8A 1LLQA 4PRLA 3U4CA 5AOVA 1VC2A 2VOEA 3UGKA 3WYBA 4E13A 3WQSB 1LDNA 2YY7A 2AE1A 1F0YA 2NLOA 3H4VA 3OQ6A 1JLLA 1G6KA 3CZMA 2ZTVA 4NBTA 4GMFA 5U1PA 3S1LA 2VWGA 1ISIA 3MJEA 4RVHA 2BHLA 3NJ8A 2JD2A 5JC1A 5JAMA 5AQ1A 4Q3DA 4NJMA 5DBIA 4IS2A 4IINA 4EDFA 3SX2A 4DLBA 1P45A 1Y1PA 2V6MA 3CMCO 2I6TA 1H2BA 1HDXA 3BAZA 3KO8A 4XRGA 4WGGA 2X86A 3PTZA 5AVOA 5G4KB 2X0IA 3V2UA 5JW6A 2AQHA 3BMOA 1KEUA 4JCOA 4JROA 3C85A 4GLLA 3W6ZA 4AJ2A 3L6EA 4IJVA 5TT1A 1T24A 4Q9NA 4IDGA 2UVDA 3DBLA 3OJLA 3U4DA 1NFQA 1ZH8A 3FPLA 2W4QA 4G81A 4XRRA 3GDGA 4Q3NA 4YXFA 3W6UA 3PYMA 5DBFA 4OL9A 1VJ1A 4MVJF 1ZNQO 4FGWA 4JN6B 4TRMA 3EVNA 2HCTA 3NTRA 1CETA 4PLGA 4KP7A 1ZBQA 4WLOA 1H6AA 4J90A 3Q0EA 1Y81A 4DYDA 4JBIA 1D1TA 3SLKA 1YBMA 3ZW8A 2Z5LA 3H9GA 1Q2XA 3DZGA 2QHXA 4MKZA 3WLFA 1EK6A 1RWBA 3C1TA 3NJ4A 4GL4A 2PLAA 4WASA 1LLUA 4R1UA 2QRKA 2OZPA 5ES3A 3IP3A 5I7SA 4Y6SA 1DIAA 3E9QA 2VWHA 1X13A 3JCZA 1MGOA 4CV2A 4LSMA 5CG1A 2O4UX 4Q3EA 4J4TA 2CDBA 3DBRA 2OO5A 4YT8A 1GFSA 1MC5A 4L76A 4GX1A 4IJUA 5KNLA 1HF3A 3T7EA 4J43A 3KOUA 1DC6A 4JJFA 2PH5A 3WNVA 2NVBA 4B3HA 5HM8A 5L9AA 3GQVA 2YDXA 3LT0A 3JQBA 2AG8A 1E92A 4YAEA 3A4VA 3TZHA 4B4WA 3HFGA 1U9JA 3S2GA 5IDXA 5JDCA 1KC3A 4QUKA 1WMBA 3WGIA 2Q2VA 3LZ6A 1M2WA 4DLLA 1BW9A 5BSEA 4DTIA 4PLVA 4MOWA 5A5EA 3PYXA 1K6XA 4DLAA 3ONDA 4CL3A 3H5AA 1HDGO 5T8KC 2HUNA 4E33A 2NTVA 4J1SA 3DOOA 2O2SA 4YA6A 4BO0A 1U3VA 3WQRA 4C7JA 3HDQA 1DAPA 3H6KA 1Z75A 1L7EA 4E2WA 4WLEA 1HE3A 5T8KA 3EW7A 4YYZA 2FSSA 5H81A 4IZHA 4R3NA 1UXHA 5HRUA 2JCXA 4L4SA 1NPDA 3MJVA 1PS0A 2ZTUA 1CQJA 1PJSA 1KEVA 2NVUA 1O94A 4S1VA 5EPOA 5A9TA 1HTBA 4M55A 4LRSB 5IZCC 3IL2A 5DCWA 4Z6KA 4YCAA 4XYMA 4IDBA 6ADHA 2VHVA 2YQ5A 3H2SA 3EMKA 4U6SA 1PSDA 4Y9DA 4IGEA 8ADHA 5IFLA 3OIGA 1EQUA 1BXZA 5DOZA 4D79A 1JWAB 1KYQA 3RBXA 2GNAA 4MVJE 1GYPA 4CM9D 5JY6A 1HDRA 4NJMB 3F4BA 1VL8A 4J4BA 4BHTA 1ONPA 1E1KA 1FDTA 3L6DA 5G0WA 3H9JA 1LDGA 4BNWA 4PLYA 1XKQA 1ZK4A 1YL5A 3AUAA 3OHSX 4LRTB 2HMVA 2EKPA 3F1KA 5TJ9A 4BIIA 3UAGA 5IZCA 4OQYA 4J6FA 3KUXA 4P4GA 3ENKA 4B7XA 3GF4A 3WWZA 1I36A 2P9EA 1TT5B 4PLWA 1A4UA 1VI2A 3PWKA 3E9NA 4UUOA 2P9CA 3D1LA 3T4EA 1B0AA 3N58A 1A71A 2VHZA 3GOHA 4FD3A 4XJSA 2PGLA 1C1DA 1MV8A 4EGFA 3LF2A 4EJ0A 3SC6A 5FI5A 3OQ1A 1R16A 4GX0A 3ZNOA 1ZCJA 4D0RA 5CEFA 3Q9UA 1LX6A 3FNEA 3RAJA 3NRCA 2OBYA 1BSVA 1YQXA 3OJOA 2NU8A 3WGTA 4AJIA 3AI2A 4I08A 3RUDA 2C7GA 4K28A 4XGNA 5EIOA 1NVMB 3HNPA 2GN4A 3QWIA 5JBIA 3TSCA 3NDRA 3CH6A 2VNAA 4M1QA 1I24A 4B4OA 1N92A 2X5KO 5IJZA 2RBEA 1LDEA 4YR9A 2DTEA 3BTUA 3M6IA 1U4OA 3EY4A 1N2SA 1SB9A 5CEJA 1GV0A 3PGJA 1SPXA 5DT9A 1QXSA 5BSHA 2W2KA 4BNHA 2H6EA 4CM1A 3B6ZA 3OICA 4O0LA 3CKYA 4UAGA 3KYCB 3UCEA 3E8XA 1D4FA 1P44A 3G49A 2ZYGA 3HJAA 4D45A 3BIOA 3ROQA 1LNQA 4W6ZA 1KVSA 4TQGA 1UAGA 3I1JA 3HQ4O 4Z3KA 2ZJ0A 3E48A 3ON5A 3IAHA 3PJDA 2NQTA 2DPGA 4RVSA 3EZLA 4BO9A 1DJNA 3L9WA 1DDOA 1LBEA 3AU8A 4A03A 3AK4A 3EVTA 3KTDA 3OJEA 4NJOA 4BMVA 1T4DA 1V9LA 2D8AA 5COAA 1YXMA 4EYEA 1HEUA 2G17A 4RVFA 4BB6A 4D46A 2FR8A 2H9IA 1I30A 5F1PA 4NMHA 1PS8A 3PDUA 2X5OA 3JQ7A 4CPDA 1I01A 2C29D 4O5OA 3WGZA 1R37A 4DQXA 4TVOA 3LF1A 1YBVA 2VQ3A 3C3XA 1EBUA 1X0XA 2E48A 4YDRA 1HETA 3DHEA 2IZ1A 5HS6A 1GYRA 5H82A 5THKA 5L4NA 1Q1NA 3Q2IA 4IDDA 3L9XA 2PR2A 5TF4A 1IYZA 1E5QA 4MP8A 3ZW9A 1WAMA 3AWDA 1J4AA 1I2ZA 1PJ4A 4YJFB 4BNVA 1RKXA 1EVYA 1RJWA 2PZMA 1HKUA 2Q4EA 5TNXA 4FGSA 3QLJA 4ND2A 4QSMA 1PZHA 4YT2A 2X23A 4GKBA 3D3WB 4PG5A 2Y05A 4LVUA 1DB3A 1U2GA 4RQUA 4XX0A 2D59A 3IKVA 4PLCA 3DQPA 3L4SO 1R0KA 4D3FA 1M67A 2HMTA 3OIDA 1VLLA 1ONOA 3MWDB 1EQ2A 3O03A 3K2BA 4E6PA 2AE2A 2J5QA 1RM4A 3DZIA 3WR5A 2HDHA 3WYCA 3RUIA 3U49A 4PLTA 3F46A 3HB5X 2V6GA 1LTHR 3DMTA 4CR6A 4BGUA 2G1UA 3D3EA 1SOVA 2GYYA 2PNFA 5ER9A 1GCUA 1H9AA 1E77A 3IIEA 4E32A 5ICMA 2Y1CA 5A3JA 4I1IA 1ULUA 4JXKA 2OP1A 1YDEA 1SOWA 1ENOA 3QW2A 1ZK2A 1HDZA 2CUKA 2J3IA 2YW9A 2W8ZA 1V3TA 2NU7A 1YJ8A 2A9FA 1YO6A 3VZRA 3I9NA 3UXYA 2AA3A 1L1FA 4W7IA 5KJEA 3VKUA 4E2XA 4RF2A 3BZUA 4GWGA 4J1QA 4HADA 3PZRA 3JYOA 1ISMA 4GKVA 5L53A 5A02A 4BNZA 1XEAA 2OGUA 5ILGA 4CMKA 1LLCA 1QYDA 3UOGA 3DXFA 3HB4X 5JMWA 4R5HA 4BNNA 1I0ZA 2FWMX 5EINA 5TQVA 2IXBA 3VPXA 1U8XX 1H6BA 1B3BA 3PHJA 4TRRA 5T67A 4G2NA 3I23A 4OKNA 2Q1UA 3FBTA 4WPGA 4BNJA 4II3A 4Q39A 3CXRA 4J0EA 4NNJA 3DMTC 2VN8A 3T7CA 5BR7A 5CFZA 4CLDA 3GZ4A 1RPNA 4BO5A 4XYGA 3LT2A 1PR3A 1KVUA 3C7DB 4RPHA 1WP4A 2E6UX 3ZWCA 3BXXA 1E6WA 1D7OA 3NGLA 2E4AA 1PZEA 4D43A 3QV1A 1Y8QB 4OGWA 3SXPA 4GGOA 3GPIA 3V1UA 3H5RA 4XYLA 2HU2A 3K73O 4XZ3A 3NX4A 3DWFA 5GY7A 2PD6A 4GMGA 1PZGA 4HUJA 4XWYA 3PK0A 1OC2A 3TF5A 1O0SA 3VVCA 1KY5A 1Z73A 4NHEA 2CZCA 1PGNA 4LSWA 2RAFA 1O9BA 1ZEJA 3GHYA 1UAYA 3VZSA 2CF5A 2V6FA 2O3TA 2DT5A 3GR6A 1PX0A 3NTOA 4IMRA 1IB6A 2HLPA 1T2CA 3CPSA 3ICPA 1EE9A 1OMOA 5B12A 5I9LA 3G0OA 2V7PA 4YTEA 2XXBA 5TRTA 2I5PO 1F14A 1P1IA 1EFLA 1XR3A 2D5AA 1WWKA 2VRCA 3LVFO 4PZDA 4B4VA 2A92A 4C7KA 1EDZA 4R01A 4I5EA 1TEHA 1GZ3A 1DC3A 1PQPA 4WCDA 2Z95A 4CLHA 1I2CA 3ZU3A 3FHLA 1R0LA 1ZVMA 3Q9NA 2CVZA 3G79A 4K6CA 1QP8A 4J3FA 4B3JA 1A7AA 2BI7A 2O3RA 3RC9A 3KYDA 2VWPA 5I7FA 3GEMA 1JKFA 5AXCA 1M75A 1E7QA 1LXCA 3VHRA 1V0JA 1XCBA 3PXXA 4KUHA 3RSHA 5TT0A 4BNLA 4B8ZA 5FWNA 1YL6A 2DUWA 3TRIA 4RO0A 1MXFA 4UVIA 1NM5A 4YJHA 3IUPA 1I3LA 1C1XB 1QORA 4EBFA 1RYDA 4AJLA 4BGIA 4CM9A 1YRLA 5K0ZA 1A4IA 1ADFA 5CPFA 1E7WA 1HZZA 4ALIA 3O8QA 3I6QA 3OEYA 4MP6A 4NBWA 3ANMA 2AXQA 3H9EO 5L51A 4YJGA 1IUKA 1W0CA 3PP8A 3IOYA 3VPGA 1NPTO 4CV1A 1HE2A 1R66A 3TJRA 3ZGYA 5A05A 4BGEA 4YPOA 2OMEA 4O6VA 2DFVA 3JQ7B 3JQ8A 3KB6A 4UREA 5JCJA 1M76A 3HADA 5F5NA 2VRCD 1GV1A 2RH4A 3P2OA 3AUUA 4ZA2A 2E49A 1PR9A 3D0OA 4J91A 3AY6A 2C59A 4A7PA 1BXKA 1YDWA 4URFA 1DHRA 4LK3A 4CLOB 1KEWA 3E5RA 2EP7A 3ZV4A 3KETA 1YWGO 3IKTA 3PHIA 1PTJA 2Y67A 2XF8A 1LQUA 1GY8A 3GNTA 3OMLA 4CODB 1PWZA 1GEGA 4BKQA 4MDHA 2BFPA 2Y1OA 4BNXA 4F45A 4XQEA 3WICA 1ZO8A 3MEQA 4N7RA 3JD3A 2DLDA 4J1TA 4RDHA 4D42A 3V1YA 1E0DA 4WJZA 3D5QA 1A9ZA 3RQSA 2PH3A 3KZVA 4E31A 1IULA 3H2ZA 4H15A 3PHHA 1HZJA 3UHAA 3RFXA 4IIUA 1DOHA 3MCVA 4B79A 2VTDA 5EQFA 2G5CA 5F1OA 5DDIP 4LISA 2O3SA 3EZYA 1SBYA 5A04A 4H3VA 4B3IA 1YE3A 2WEKA 2NACA 3W4JA 1IHXA 3I5MA 4NQZA 1BDBA 3ZH2A 4Q3BA 5HBRA 5ITVA 2JFHA 4DC1A 4ZD6A 5KVVA 3AOEC 4BO2A 3GEDA 4BUCA 2CNBA 2NUAA 4HNGA 2EEZA 5KVSA 2X9GA 2G82A 4UVHA 4R68A 1DIGA 3PFFA 5C37A 4D7AA 3I83A 4ONEA 3R1IA 4Y98A 3B1KA 3L6OO 2WYVA 3KXDA 2H1SA 1E3WA 5DP1A 1DIBA 4QX6A 1F8FA 5EMHA 4E30A 3QSGA 1JDJA 4ITUA 4JBGA 4OSOA 4YEDA 1I3MA 3DZBA 1W8DA 1UXGA 1DSSG 3B20A 3F1LA 4CR7A 2W90A 3S55A 5JNLA 5L7TA 5KVCA 3C7CB 3UH1A 2FP4A 4DUPA 2B0JA 4WLFA 2Q1SA 3GY0A 3INGA 4R9SA 1CWUA 4B8WA 3C8MA 4OOFA 3LDHA 1PJBA 3RBZA 3VVBA 2NWQA 3PQDA 1DEHA 2QIOA 2ZQYA 1YB1A 3PJEA 3OFSA 4AJ4A 4CQLB 2HK9A 1R12A 1YB5A 2E37A 1H94A 4RPKA 2C7VA 4L4XA 5GMOA 1NTOA 4IY1A 3ZWAA 3ZU2A 2UV8A 4H7PA 2WSBA 1QKIA 1ARZA 4GX5A 5HA5A 2DBRA 3FNHA 4BNGA 1PGOA 2AW5A 1LC3A 3A06A 2WD7B 4MINA 3X2EA 3DFZA 1IPFA 1HYEA 4AJJA 3PIIA 2C2XA 4LVCA 5HTOA 4NBUA 4Y8VA 4YRAA 1ZK3A 4DL9A 3W8DA 4P8RA 3JQDA 2BI8A 2DPHA 2Y1DA 5DBGA 1V8BA 2WE8A 4LW8A 3VOSA 3U5TA 4MVJI 4OKIA 4FSHA 4XGKA 1DFHA 4CMCA 3UFXA 4BL5A 4XA8A 3JD1A 4E2YA 1X1EA 1CYDA 4XJTA 3WMWA 3JQFC 3G1UA 2C5AA 3GGOA 5I9MA 3KSZO 1R4MB 1ENZA 1KY4A 5LDGA 2BD0A 3HE3A 1R4MA 1PL7A 1CQIA 4II2A 1TVEA 3WGYA 1TLTA 1ZMTA 4JNKA 4JP2A 3JQFA 1QMGA 1U5AA 1Y5MA 4MPDA 5JS6A 2EWMA 3I9LA 1KOLA 4YRBA 4GVLA 5I7VA 2A94A 2AEFA 2DFDA 1ENPA 2GZ2A 2X9VA 1H93A 1YH3A 4HFMA 3SBOA 5IDQA 4FBGA 4XCVA 2B5WA 3DONA 4I9UA 4OSPA 1QR6A 1DIRA 1LU9A 1PGQA 4BO1A 5ER6A 3PQFA 3UUWA 5A9RA 4EJ6A 1T25A 3M2PA 3L07A 1HSOA 2W2KB 2C82A 4J2HA 4CUKA 3SVTA 1DRVA 1QG6A 1XA0A 1GL3A 4PN3A 4EW6A 5F1KA 5G2OA 4M89A 2IYPA 4TROA 4L8VA 3NT5A 3GG9A 1J5PA 5CP8A 4A2CA 2Q1WA 2GF2A 4HWKA 4C4OA 2GCGA 2VZ8A 1HE4A 1ZSNA 3WBFA 3RBVA 4CJXA 3HUDA 1X1TA 4BQPA 3R3JA 4DQUA 5DF1A 3N74A 5C7LO 4PZCA 5JCXA 1XG5A 4R9RA 1X7HA 3GZNB 2X7HA 1LDBA 4MVJH 1YQDA 3DAPA 4TKLA 1GU7A 3ZWVA 3FWZA 3FD8A 5C5IA 3WB9A 1B8VA 3TOXA 5IDWA 5CDUA 4FJ1A 1U8FO 1AXEA 5T64A 4XEHA 4BMSA 3KVOA 5TS3A 2GRAA 2FZWA 2G76A 3QE3A 5IXSA 3PPIA 4K1LA 2PD4A 3CZRA 4FPXA 4BKUA 1QYVA 5EJ2A 4BNFA 2Q2WA 4PGFA 1WPQA 2DBZA 4D0SA 5A9SA 4PCVA 1QSGA 1B15A 1B3RA 1UDCA 1JVBA 4R51A 3P7MA 3PFWO 3KYCA 2POQX 1V35A 4CMIA 1CF2O 1PL8A 1Y6JA 4CM4B 1XSEA 4ILKA 3ZU4A 2JJYA 3QRWA 1GADO 2EV9A 3WYEA 3BMQA 4I9HA 3QWHA 5BSFA 1SC6A 4I5FA 3D3WA 5I7EA 1N7GA 2DVMA 2Q1TA 2CVQA 1JU9A 2PKQO 1NAHA 4Z0HO 1ZKMA 4PRKA 3E1KA 2P2SA 5EQDA 1NHWA 3PLNA 3BHIA 3QWAA 3EDMA 5FFFA 2QZZA 4ZQEA 3ZI0A 4FS3A 3DZFA 2VYVD 4EEXA 5B37A 1ZW1A 1K3TA 1GZ4A 3LU1A 4N5MA 1B16A 4WK6A 1XHLA 4IIVA 4M8SA 5I8ZA 3A9WA 5I9NA 2FPIA 3G3EA 2GERA 1OI7A 3BMNA 4K26A 1BXGA 1JAXA 4NFYA 2G0TA 5DP2A 3UKOA 5KJCA 2EIHA 1RYEA 4NZ9A 4D3DA 1P3DA 5KIAA 3AI3A 4L74A 1H6DA 4LMPA 2PV7A 3INTA 3GDFA 2J5KA 3FNFA 1E3SA 5KJFA 1EK5A 3TZCA 3V2HA 5A4DA 2YDYA 2C2YA 3QVTA 4R1SA 2AG5A 3BTVA 3KYDB 4BV8A 2Y68A 2BMAA 3I3OA 3SC4A 3S2FA 1D8AA 3DZJA 2Q50A 4N18A 4XQCA 1GDHA 4PG8A 2X8LA 3ZNPA 1BVUA 4D41A 4Y67A 1ZK0A 3VH4A 2PTGA 4B7UA 2Q49A 4WLVA 5JE8A 5A1TA 4PLZA 2QRJA 3OECA 1E1MA 4OYRA 1XLTA 4XR4A 3GRPA 1A9YA 2GLXA 4F46A 1MG5A 3K6JA 3GHHA 3K30A 3UVEA 1U7TA 3RKUA 4UEJA 2QG4A 3OP4A 3OQBA 1XYGA 3NGXA 3TL3A 4FDAA 4XGIA 4CQMD 4U8GA 2HK7A 4J49A 1XU9A 1SEVA 2D2IA 2DTXA 4Y6RA 2ZQZA 3OF2A 3DAGA 1ZK1A 3WGQA 4EUHA 3ZZNA 1UP4A 1LDMA 3ETDA 3RC2A 3DR3A 1Y5RA 5DCYA 3VH3A 2VZ9A 3AUTA 3WWYA 4A10A 2QYSA 2PGDA 4DVJA 3K96A 4RF4A 2BELA 1T2EA 3ZHBA 4GAEA 1F17A 3RI3A 1FDVA 6LDHA 2ZYAA 1CJCA 3HN2A 5L95A 2OXIA 4YAIA 2C20A 4YRDA 1Q0QA 1IE3A 4J7UA 1VJTA 2I99A 4TVBA 2EKLA 3KM0A 4R69A 4DGSA 4R1TA 4IDFA 1XQ6A 3DBRB 4MVJP 4DRYA 2C0CA 4L9RA 3V2GA 4EEZA 2J3HA 4FC7A 4M86A 4YACA 1X7GA 1NFFA 1ADBA 3ZWOA 1NR7A 1LRLA 2QW8A 3RJ9A 2VWQA 3B1FA 4RGBA 1N7HA 2JAHA 3RKRA 5IZ4A 1IY8A 4WEOA 2DU8A 1V6AA 2WJPA 3ONFA 5IDYA 5IN5A 1JN0A 4BS9A 4ND3A 3BMNB 3L4BC 1O8CA 3LT1A 1HLPA 3CIFA 5B4UA 3HWRA 1LSJA 2Y66A 4E0BA 5G0TA 2JL1A 3F9IA 5C3MA 3DO5A 1X7DA 1QYWA 3HDHA 1B7GO 2NSDA 1T2DA 1UR5A 1VJ0A 3LLSA 4HKTA 4CM5A 3GT0A 2AMFA 2C54A 5KJ1A 1ZEMA 1SNYA 2P4HX 3GGGA 4R5MA 5EN4A 4GGPA 5JPIA 3K2EA 3RIHA 1K2WA 2D3TA 4TKMA 2WWRA 1SZJG 3H7AA 3FPCA 3TFQA 4WOKA 4RVGA 2VZ0A 1BW9B 1XQ1A 8LDHA 3ITDA 4N5NA 3NUGA 1B8UA 3JQ9C 4RF5A 1KEPA 3F5SA 1EZ4A 3QWBA 4QQRA 1ISHA 2R6JA 5AYVA 1EVZA 3PYLA 3V5NA 5CDTA 1P1RA 1UXIA 1AN9A 3RUEA 1UZNA 3A28A 1RM0A 3H9UA 3TNLA 4BO7A 3RUAA 4CM3A 2QYTA 4HNHA 1JA9A 4NI5A 4UVEA 1DIHA 1C0PA 2DM6A 4MKRA 3FI9A 4ZU3A 4W4TA 1QYCA 3VPHA 4DPMA 1NHGA 4F6LA 4FR5A 2FPPA 4E5PA 4IDAA 3JD0A 4FFNA 3V1TC 4XD2A 1Z7EA 3BMCA 4TWRA 4DIBA 1VL0A 1C1XA 1ORRA 2DAPA 4FJ2A 1ONNA 2DBQA 2O2YA 3DHNA 3EYWA 2X0RA 4J7CA 1U3TA 3NEPX 3U3XA 3BTOA 3R3SA 4CUJA 3IDSA 1Q7CA 1DFGA 3MOIA 4Z9XA 4UVDA 3GA0A 4CMEC 5ENDA 3TOZA 2W2LD 3VZPA 1HRDA 2E82A 3JYPA 1VL6A 2X4GA 3PJGA 3WTCA 5F21A 1ISJA 1TT5A 3FTNA 3VH2A 2YJZA 2J8ZA 4IGFA 3OA2A 2FHSA 4RDIA 4M87A 5TX7A 4QO7A 1R15A 1Y7TA 2X0NA 3D7LA 4IZIA 4DMMA 3K31A 3HZZA 3ZWWA 3DBVO 2WE7A 3RC7A 1SMKA 1T26A 4CQMB 3WMXA 1O6ZA 2OORA 2WTBA 1L7DA 4YAGA 2NM0A 5JO0A 1PGPA 2OUIA 3IP1A 4JX8A 5KKAA 3TZQA 2VNSA 4RPLA 1I10A 2EXXA 3DBHB 4OOEA 2GPTA 2HJSA 3LLVA 3U4HA 3EC7A 5L7WA 3TN7A 5CHEA 3NT4A 2JHFA 4PFJA 3H8VA 2O7SA 3DDNA 3KLMX 5JC8A 3CTMA 5BSGA 3NV9A 4RLHA 1MC4A 4CMEA 3GVXA 1JKIA 5FYDA 5JXWA 4ZN6A 1OZAA 1EE2A 2CSUA 1LLDA 4IUYA 2PD3A 4GSLA 2YV3A 1YVEI 3MJTA 3AFMA 1DRWA 1UH5A 4W99A 3UW3A 4WE3A 2JD1A 4QECA 1Y9EA 4E5KA 3JYLA 4ZQHA 3AI1A 4OQZA 2WD8A 4B4UA 2OBNA 2ZB7A 3ZV6A 3H3FA 2EW8A 5JMPA 3LT4A 4X54A 5TIIA 5FI3A 2CY0A 1ZSYA 3KLPX 3PQEA 3ZCXA 1A27A 4TZKA 5AXDA 2CDCA 1A7KA 2D0IA 2Q46A 3ST7A 1Y8RB 1U5CA 2BKAA 1C3VA 4L75A 4GX2A 5DULA 3R0IA 2NADA 3ZWMA 2LDBA 5BQFA 4J9UE 3B1JA 3N7UA 4KOAA 4ZRNA 1U28A 2JAPA 1NYTA 4YQZA 5CPBA 1P74A 1CIVA 3CINA 5G0VA 4EITA 4FJ0A 4UUPA 4PLHA 5G4KA 2R00C 5BNFA 3U09A 4YJDA 2GD1O 1AE1A 2O48X 3H5NA 3MTGA 2OL4A 5COBA 1LA2A 3QA9A 2D5CA 4NK5A 5A5FA 1NP3A 4UUNA 4W9NC 4U0JA 1E6EA 3WX0A 4ALJA 2DUUA 3HHPA 4DYVA 1NVTA 2B4RO 3F6YA 4KZPA 3OM9A 1N9GA 4ND4A 4BO6A 3MZ0A 1ID1A 2H63A 1EVIA 4MIOA 2DQ4A 1BRMA 1YKFA 3ITKA 1FF9A 3Q3CA 1Q0HA 1E1NA 4D44A 1K6IA 3F4LA 1EMDA 1EUCA 2J5RA 2Y93A 2FOIA 3GN2A 5ILOA 4L4RA 1C0IA 3BMQB 1D1SA 3M1LA 4HFJA 4WKGA 2AQKA 1MFPA 1N8KA 1Z7BA 2B4QA 3RUHA 1SCUA 1MXHA 2EF1A 1OAAA 2P68A 5JDCC 5CAEA 4MVJG 3KEOA 4IQ8A 4BNTA 2GN8A 4KWHA 4EUEA 4YAKA 2BF7A 1BDMA 4GWKA 3ZN2A 2DC1A 1DLJA 4WCFC 1E3IA 1N5DA 1XDWA 1A72A 4DWVA 1H0KA 4IDEA 4OM8A 4FIZA 1K0UA 3G17A 5HWSA 1NWHA 4FFPA 4ALLA 1ISGA 1GUFA 1I8TA 1Q7BA 1WMAA 1YOVB 3C1AA 4JP3A 4CM6A 5ICSA 2I65A 4JLWA 2JCVA 4DIOA 4HFNA 3FRJA 1IL0A 2RHRA 3CMMA 3WIDA 4DREA 1KS9A 3QJ5A 2I9PA 2O50A 4J2OA 3I9KA 4HV4A 2Y0DA 3PWZA 4WLNA 5JAIA 2CD9A 4Y6PA 3GFGA 2IRWA 3ZV3A 3O38A 3NYWA 4PLPA 2ZCUA 4NG5A 1SB8A 3TZ6A 1P0FA 2VRBA 3PVZA 1XWFA 3EGOA 1YQGA 4FB5A 4OXYA 4DC0A 1LSOA 1BG6A 2OOSA 2UDPA 1KERA 2X22A 3B70A 3JSAA 4FQ8A 3F3SA 3MWEB 3JQ6A 1N1GA 2AEMA 3RUFA 4TMFA 4WCFA 1DC5A 1JQBA 1PJ2A 2HO5A 3PDJA 3VH1A 1ADGA 4PG4A 2EGGA 4CL8A 3Q11A 1NAIA 1K89A 1TA4A 4FFLA 1N9GB 3PIDA 1Y9AA 4MKXA 3U62A 2YUTA 3KSDO 3W1VA 4CMJA 3DOJA 3NDJA 5L4LA 1J6UA 1HE5A 4BNIA 2ZKLA 1U2DA 2EERA 2VHWA 3COSA 4JGBA 4XQGA 4CM4A 1MFZA 3AM3A 3ETGA 4R4JA 3CE6A 4YT5A 2UUPA 3BMCB 3OA0A 1MA0A 3QHAA 3GH3A 4IBOA 4RZIA 3WIEA 1MP0A 3H9QA 1CEQA 1TI7A 3I9MA 3OETA 3TQHA 5C7IO 2BGLA 5TJHA 1EDOA 3JQAB 1IZ0A 3Q2KA 4E3ZA 1DXYA 4FOOA 3HFSA 2ZATA 3RFTA 5KVQA 4JQCA 3OJ0A 4JIGA 5LCXA 4IS3A 1GQ2A 2F1KA 4OAQA 3ZNQA 3BHMA 2EW2A 4CLOA 2XPCA 1PZFA 1V3UA 1O89A 3DBHA 4UEKA
chains in the Genus database with same CATH superfamily
1X7XA 1SG6A 4LGVA 3AF6A 4EHFA 1Z2CA 2VUUA 4P32A 4AP9A 3GQBA 2WDZA 5J1TB 2PA3A 4FLEA 1U0RA 4RMHA 4BBJA 3VPBA 5IVDA 4EGAA 2WJYA 4ESVA 5TSDA 1BXGB 1FSSA 4IEFB 2BYTA 1WPGA 2ZTLA 3BAFA 5JFGA 1YQQA 3THOA 4UXHA 1XEXA 2R8BA 4EENA 4WNCA 3L7BA 4G1VA 1ISFA 5DOVA 2FMXA 3PGXA 1QP0A 5CVVA 1ODJA 4QNMA 5BWMA 4P81A 4Q7JB 3UJ7A 2E4YA 1N2EA 3KQUA 2X14A 2WF6A 1O8BA 2UVQA 1PU2A 3QBDA 1J33A 1GQRA 2P78A 3I45A 3MINB 1HYGA 1UAAA 3OOSA 4YB8A 3M1IA 1FBNA 1DQPA 3LHIA 3PFHA 2EYQA 4AY5A 1XKXA 1V43A 2PSJA 4ZYYA 2ENWA 2Z3ZA 3ENWA 1NASA 2QRVA 4WV3A 3RSFA 5EERA 3JQ9A 4M37A 5LZ7A 1L8XA 3DJFA 2B3DA 3WB0A 3EF3A 1YUNA 1AXGA 3B1YA 4AS2A 1A3CA 1B8OA 2VDWB 4C05A 1WNTA 4D80A 4QDXA 1UOEA 2Q1YA 3F47A 1NNUA 3TDKA 4KWIA 5ALVA 2CHGA 2IUUA 1G9TA 1CCWA 3FCYA 5KYWB 4MO2A 3KSRA 2GDZA 3MD9A 3HKDB 2QD4A 1TEZA 4BU0A 4K9DA 1Q50A 4QBIA 4E5UA 4N8DA 4RMNA 2QAJA 4JOCA 3QPVA 3TDMA 1YVPA 4NR0A 3MJRA 2YFKA 1ZIYA 4PTLA 2GNPA 3IMKA 4JLUA 1RPAA 1R0CA 4NULA 4X92A 1DRJA 4F6RB 5JIBA 4OQEA 3UB3A 4HP8A 3C24A 3STUA 2ZXEA 4TKVB 4HNSA 4DPKA 3KXKA 1T1JA 3RRMA 4B3GA 3BFXA 3A1FA 2Q9BA 4MKGA 4BOYA 1Q95A 4S0XA 2AGVA 2PXHA 3P2EA 2IHKA 4PGGA 2XSZA 3FZGA 2ZBQA 1DQYA 4L3OA 4MQ5A 2A35A 4XXHA 5AKHA 4B73A 1EP2B 3P96A 3V3TA 3SP1A 1SCKA 1MQAA 2WYUA 5HJ5A 1KH3A 5DJ5A 4D0GA 4UMDA 4PG6A 1UPFA 2GSDA 1C4XA 3TO5A 1S89A 4F2GA 3RS3A 2X6TA 4V02A 5CDFE 2QWXA 2HJ9A 4O2LA 3KB2A 4KAFA 4UQLA 1KSHA 2ZTMA 2GFQA 2J1LA 3KKKA 1JEAA 4ZO8A 1SBNE 5AFSA 5BN1A 2GBFA 5AK3A 4HB2A 3LBAA 4S04A 5E9JA 2FSVA 5TC4A 2BEWB 4AJNA 4K8RB 3IC5A 1NKSA 3QY9A 1PV4A 1KMNA 5AM0A 1DBVO 3GAZA 4Q1VA 1LTKA 3HCFA 4U5XA 3O1LA 2YFQA 3R8FA 3OF3A 2XE6A 1RRKA 4QPJC 3RVJA 5JDIC 2Q3EA 1OF1A 1SZPA 1RT9A 3ROKA 2DPYA 1K06A 3V4RA 1P1KA 1JH9A 1E9EA 5EHNA 1Q0ZA 3DHWC 5ECYA 1XZKA 5HNKA 1ORWA 2PT6A 5EXTA 3AV3A 1E96A 2F6RA 1TT7A 1QBKC 3UXEA 3QLVA 4Z9YA 2HX1A 1QS0B 3E4CA 2VA9A 3HBFA 4KEAA 1OU0A 3L92A 1IG3A 4ECEA 3I2IA 2FEOA 4OMUA 1ODSA 3D8RA 4TN1A 2O3UA 5IUNC 3F3MA 4J16A 3FWNA 1IOVA 3CZPA 1SCJA 3CWQA 5ENZA 5H59A 1PAUA 2F4NA 2PWAA 1M7BA 1Z4JA 1QH1B 1U9CA 5ADHA 2JIZD 4ZI2A 5TGDA 3AZOA 2AH5A 4LDJA 1J99A 4ETMA 3U26A 3HU1A 5IYZB 1I1HA 3G13A 1ISRA 3IB6A 2B5OA 5FOSA 4ENRA 4WLUA 1L5YA 4BEBA 1HMYA 4FDVA 2G7MC 2Q6OA 4Y2XA 3NAZA 5DBHX 2IHNA 3L1HA 5DT2A 3ZHYA 1WLYA 4LJ4A 3SDBA 3CVXA 1XLVA 1U3WA 3KLNA 1OBFO 1PFYA 5AHKA 3CONA 1KI8A 1YOVA 4C4AA 1NW7A 2PUFA 3GUYA 4Q9LA 2IYOA 1KL7A 1XVVA 2HO4A 3FPHA 2ISQA 4K6FA 4RY9A 4D4HA 4K0KB 3NZEA 2PRIA 4BDTA 1BAPA 2XUDA 1U31A 3SMVA 2ZJZA 3OQVA 5G1OA 4OI2A 1MD9A 3G9XA 3WK4A 4EPRA 1WDLA 3H1EA 2YWGA 1UJ4A 1TVKA 5TS2A 3FF1A 5LP6C 1T0PA 2QVCA 4I9FA 4OQPA 3WBBA 2DKOA 1T1EA 1QCDA 2QMHA 1OLUA 5KTYA 1JNYA 3VYTB 2B7BA 5BWCA 3K9QO 1L9KA 4WDQA 1S2LA 1IUPA 1H2HA 1D3AA 4XYBA 4INAA 5DNAA 4CN9A 1SA0B 5GPBA 4NZOA 4U5QA 5L3ZA 1L4KA 4DNPA 2Q5QA 2JANA 1GKIA 2DEUA 5U4XA 2QN7A 1P5ZB 2Q7DA 3WLKX 4NCXA 3BWCA 3U81A 4N41A 5K03A 3CUSA 4UAVA 3DUWA 3TLEA 2VDQB 4QOJA 2ZYTX 1F9AA 4JLJA 4BQFA 5HUHA 2AKEA 1E4EB 1TYCA 1UQRA 1XJ5A 1Y6QA 1TO2E 5SZKB 3KZNA 3TL2A 1IZ9A 3DVQX 3BGIA 5DEIA 4GH5A 1M1YA 1TUGA 1TUIA 2HAEA 3AB3A 1CLEA 4HMPA 3BRCA 4YASA 5C7OO 4E5VA 2RJOA 2WFZA 2ZWAA 4DNQA 3RD5A 3ZCRA 4AAYA 1SKUA 3MB8A 2IKSA 2ZJ1A 3LKZA 1D5WA 1E2HA 3CN7A 4US0R 1AHIA 3ICVA 5A3VA 3BMOB 2PO7A 1WETA 5KO2A 2J3KA 1EVJA 3ORSA 5JV5A 1AV7A 2P7HA 1B0UA 4YGYA 4BE9A 2C1ZA 4F4HA 2FW0A 4U0KA 1UZAA 1COWD 2JC3A 1VQ1A 3NTLA 3H1TA 4GXRA 2CCJA 1M2JA 4OA8A 3U0BA 3F5QA 4G4JA 2QF7A 2A1UA 1P1JA 1JR2A 2DYKA 1TB4A 3AB7A 1QK5A 3KYBA 4KIJA 2WMDA 1NMZA 4O1HA 2XE7A 4U63A 4HLDA 5CFPA 2JJMA 4G25A 4K6KA 4CLRB 2W58A 4JEMA 4CEHB 2WFLB 2IPNA 4LMRA 1Y33E 2Y0PA 3BYZA 3TAXA 1TKBA 3EG9B 5CLGA 1II9A 1C1HA 4B4DA 4N6OA 1ZOIA 2EFGA 3JWIA 3BA1A 1RAGA 4R9UC 4MDEA 2O2JA 5KQLA 4KPUB 4E4RA 1F7VA 2NV6A 2RCYA 2I7TA 1UZMA 4IHJB 1PWYE 3NI2A 3VU3A 4HQ6A 2HMUA 3SIRA 3V4VB 2EJBA 2WIFA 4EHKA 1CUVA 2FI1A 3VYUB 3PHCA 5LOVF 3IODA 3X2FA 5JI2E 4O4LB 4YMLA 4S24A 5J4HA 3HCBA 3ZHTA 1E9VA 3AM5A 2VC2B 2HEGA 4NU8X 3FSEA 1KXJA 1M6YA 2P9GA 1JSZA 1MNAA 4R54A 3AR4A 1J0DA 4C7VA 4QLBA 1UDAA 5HCIA 1AZLA 1P4SA 4KSYA 3E05A 2XOXA 3VMMA 1CZUA 1QAMA 3IHLA 2IGBA 2PU5A 1BRTA 2R84A 4MUKA 2DTDA 4WNIA 2M98A 5DNWA 3RSOA 1AJEA 4FW8A 2R2GA 2E87A 4BLPA 2XEDA 3HC7A 4B5KA 1W9MA 2XZTA 2YZGA 4KZKA 4MVJM 4O0MA 3SIPA 5LDHA 1O7JA 1P7YA 1LEHA 2ZDGA 4LZOA 4M0CA 3BD6A 4Q15A 3AFOA 4EHIA 2AUNA 3H1FA 5IVPA 2Q4RA 4IMPA 3ZWQA 4MHTA 1DHTA 3UCXA 1VBKA 1WDKA 4LXXA 2ZP1A 3V8BA 4ALKA 4YP0A 4DQVA 4F8EA 1D4OA 1JHUA 1KIFA 2VO1A 3FG9A 3R44A 4I81A 1LWOA 1QV7A 4JK3A 1ZN9A 5WRFA 3Q1KA 3ONVA 5KOYA 4CQNA 1CR0A 3EZ7A 5JLAA 2RMKA 4AO8A 2FPKA 2RHHA 1GLGA 2QV7A 2GHIA 3VTKA 1DCFA 1P61B 5B36A 1G8SA 4YONB 4MO9A 5AJVB 5G0UA 3NATA 2FG5A 3GVHA 5JCZA 1VTKA 2OP0A 4MPJA 2EFHB 2WU0A 4BWFB 4KJZA 2BFMA 2YIDA 4LHVA 1CRPA 2YHAA 4EI9A 4M9SA 5JY1A 4PYRA 2QPLA 4LMAA 1JU3A 1CDDA 2B8NA 3MJCA 2Q3FA 4YY3B 3CZCA 1EFUA 1IOLA 5L7YA 3O8BA 3AL3A 5AI0A 1PVOA 2QJOA 1UBUS 4FZ5A 1SAYA 1KYXA 1QIHA 3H2HA 3EJWA 1F5SA 1KHTA 1NF9A 1RBYA 2PUHA 3NVAA 2BGNA 3N8DA 5FA8A 2BHNA 3M6XA 2FRDA 4PYLA 1MOZA 5ADUS 3E82A 1KK3A 1E4EA 1Z17A 4KXXA 4RK7A 4ATNA 4CV3A 2ZSKA 4BLTA 4HB3A 4JL8A 1GPBA 1OZGA 1T1SA 3FOFC 1P9LA 2W2LA 1CJUC 2V58A 4FE4A 4QAJA 4TMWA 1YQWA 4FXPA 2I91A 1N78A 2G1KA 4PYKA 4QT0A 1U2PA 2YHIB 4KQHA 4BU1A 2O23A 4BKOA 4NYIR 1Z29A 3D4NA 3PL1A 1JXOA 1ZUNB 2PHZA 5J3JA 5I7WA 5JO9A 2WV7A 1ULZA 2WR8A 3A0RB 3OTOB 1PF7E 1XZJA 5EZ5A 4Z0PA 3RUCA 2EOAA 5E8JA 4KQWA 1TMKA 1WDTA 4P22A 4UUMA 2WMYA 3F6PA 5ERYA 5GJVC 4BB5A 3W5DA 4F72A 3T5DA 1KI2A 4G67A 1J0EA 2AQIA 3HY4A 1IPHA 2Q3JA 3WSVA 3INNA 4RHEA 3LY8A 5KHAA 4ML3A 3SC2A 2DR2A 1NOJA 2D7CA 3LUPA 1I4OA 1V2GA 2F1OA 3EYAA 3M0EA 4OEHA 4E14A 1TK2A 3AY7A 3L77A 3NIDB 1FNCA 1U2RA 1X0VA 4EY4A 2QR2A 2RH5A 5CITA 3ZV5A 1P2VA 2ZIXB 2EF0A 1LJUA 1Y1RA 1R4AA 3B85A 1GQSA 3DDHA 3L05A 3RVOA 1XHEA 1C29B 2A1TS 3AJRA 4KX3A 4FK8A 4JJGA 3ZDFA 4BV9A 1J8MF 1GAEO 1QE5A 3GDOA 2H1HA 4JVNA 4BO8A 5H4GA 5EJ6A 3EGDB 2ONYA 3P0RA 4E5NA 1L5SA 1OKKD 2FCRA 4FI3F 1MHPA 3KRTA 1U90A 2Q2QA 1F2TB 4JLAA 4PVDA 1E7YA 2XW6A 1T4GA 4NZNA 1C9KA 5D3QA 1M7HA 3L7YA 4QA9A 4UEQA 2V7EA 5EUCA 4UFNA 4HWOA 1KK0A 4E5MA 3NFRA 2GWHA 1FTWA 1GL6A 2AX3A 3EXFA 3QVOA 4HWPA 2OB1A 3JAKB 5A4AA 1E9SA 1OFGA 1AZSC 1WG8A 1OWMA 1BZYA 3DVAB 2DULA 2REQB 3E03A 3KOWA 4NEHB 1JQDA 4EY3A 3NEYA 1JIJA 4DUYB 4RK4A 4UULA 4OX9B 1VE3A 4H59A 1Y9DA 2IYFA 3DP9A 4RORA 2QU8A 4P38A 1VMDA 2G83A 1WZIA 4B7ZA 1J20A 3AM1A 1N4DA 5HIMA 2P6RA 4IILA 2C1XA 1N1EA 1M34A 2PGNA 3HL4A 3T1QA 3GLGB 3THRA 3UK0A 1QTQA 4QNRA 3GJ6A 4K3UA 1DE0A 1XRLA 4MQ4A 5ILQA 5KAMA 3H83A 3O4FA 3OFKA 3T3MB 4XDZA 1YIAA 1XAHA 3S7TA 8GPBA 2CL5A 1AUPA 1NVVR 4IXTA 3WRYA 2D4AA 5D7NA 3NCTA 4GLBA 2R3SA 4GF5A 4QBKA 4MIYA 2YJGA 5H83A 4ZAVA 3KELA 3QLUC 4JXZA 1GPKA 5ISMA 3P9NA 1KJNA 1M1YE 2QTNA 4KIWA 1XTZA 1OFIA 1SBTA 1SUWA 3HABA 3AW9A 3ZZMA 2H5LA 1HNZB 1EM6A 1W8IA 1T34A 2TMGA 2ZVDA 2XB8A 3PT9A 4UNQA 1PZMA 2FQWA 4IPTA 2K2QB 1QQTA 3Q3VA 4G5QA 5CIQA 4AL4A 4F9GA 1ACMA 3QJYA 1BMDA 3CSSA 2JK0A 3W9UA 4MWBA 1I2BA 3OVMA 4KWCA 4DBVO 1ZR4A 3ABIA 1JTEA 2I3AA 3IELA 3FKSD 3HLTA 3VHXA 1WB9A 5A03A 3ZHRA 1L4YA 2AC7A 2D0OB 4RV9A 5B6IA 4NIMA 1U3UA 4E12A 1WZCA 5FOTA 4U1RA 2P4UA 4ZHSA 3NQ41 2B34A 4N54A 1EVKA 4Y2UA 3FMOB 3L46A 3VC1A 2DXIA 9MHTA 1LQTA 3VR2A 1UUFA 2O8CB 4HDSA 1ZFNA 3A25A 3NHKA 2I4LA 3M4NA 4W9NA 4Y0NA 1DAIA 1P7WA 1FK8A 3E6AA 1GVNB 4K9QA 4LBYA 4QYTA 4Z0TA 3O8NA 4J0CA 4BFWA 1C7JA 2OHVA 2YJTD 1IM5A 2Z1MA 4FP9A 2JFPA 2QUZA 1MLDA 3T1YB 1QC5A 1GSIA 2BFEB 2VHQA 3G7UA 3H8JA 1GT6A 4J4HA 1K9VF 4Q9HA 4X90A 4ADSG 2E7ZA 3JQCA 3FTEA 3B3AA 4HQNA 2EZ9A 4DIMA 2Y1FA 3CC8A 3GRYA 2FWRA 4X6YA 3KQPA 2C94A 4ZHQF 3E7WA 1FS6A 1U0GA 1YNSA 2Q3CA 1OD6A 2JD0A 5CLIA 1QVZA 1HFWA 2YNMC 1RI3A 2ZSHA 3OO1A 3KBOA 2PL1A 5AMXA 4YXWD 3HP1A 1BH6A 2MYNA 2M2IA 4G9EA 4PY2A 5BN5B 4IJKA 1C2YA 5ALTA 5U9CA 2RG7A 1KK2A 1X1RA 4BAZA 5AXAA 5JZOA 4N47A 2AI1A 2BFNA 4H6VA 4AWAA 2Z8YA 4L8LA 4UW9A 2JGKA 5BORA 2OCAA 2RGNA 3RU7A 4XX0B 3U3JA 2C2BA 2P9FA 4A16A 5HIKA 4EA7A 3Q8KA 1EFRA 2WAXA 4Y2HA 4X64B 2SHKA 3D4PA 5EZ6B 3LSYA 4ZKDA 4HNAB 2A4MA 4L0DA 5IFKA 2Z0MA 2R4QA 1HDIA 1T4CA 4BZZA 2JBAA 3O2QB 5A3QA 2IE8A 3MWKA 5E8RA 2VBFA 4PQFA 1BJRE 3E70C 1JEQB 1II8A 3JQRA 1RQXA 4JU9A 3HG7A 1PNTA 3CFYA 3JARA 1TGVA 4JIMA 3WFJA 4ZVVA 1R6DA 4RQTA 3RRYA 4ZARA 4I8XA 2A0YA 1FXSA 1KJQA 2P4EA 1M8FA 3UMSA 3E5MA 1K6MA 4HN2A 2EYUA 1DBRA 1IVNA 2DPLA 3CLTC 3RWBA 3SZGA 1NVBA 1P81A 4EB6A 1G0NA 1XALA 1LBQA 4NH0A 3KQKA 3ENNA 4X5OA 3A05A 3MTAA 3RE1A 1GTG1 2ZK7A 1PG5A 2VG8A 1FMCA 4FMPA 4MW1A 1M1NA 3R3WA 1ZOPA 3ZBUA 2UKDA 2H5JA 3K8ZA 1EB9A 3MJDA 4AFNA 1ODLA 4XVRA 1QHEA 3OIFA 2OO5C 3O1JC 4LJ5A 4WECA 5IW8A 2BKLA 3O75A 4M49A 3HN7A 4IX1A 4O4JA 4OIMA 4JV5B 3HPQA 2QTHA 3R77A 3UMVA 1MC1A 3WSWA 1U0BB 3SE0A 2HSDA 3EBPA 5LB4A 2SKCA 1GQYA 3ASVA 1I4DD 3OZXA 1DC7A 4P5EA 4PHGA 4O2BF 1IU9A 2VT3A 4LE0A 1ATIA 1YA4A 3RSLA 5IHPA 2FKNA 4O1MA 3OIUA 2P5UA 4MHOA 4CEIB 3TTTA 1WW8A 1UMCA 4HB0A 4JUFA 3CF6R 1JDBB 4O8CA 4X20B 3OPVA 4A8TA 4U6QA 4UPDA 2QRLA 2J9YB 2YICA 3EE6A 4XE5A 4ZAYA 3BC1A 4EK9A 4DGQA 3WJ7A 2Q99A 4RV5A 2O8BA 3RFVA 5KJ6A 4X6UA 3TR5A 2HADA 2J6HA 2GM4A 2I3BA 1JB1A 2YZ7A 2E4ZA 4MARA 2TMDA 4AZ0B 5ITWA 3JAMA 1GR0A 1QH0A 3DGEC 3FR8A 2WUDA 2OLKA 3M2TA 3UK6A 5K6AC 1E4YA 3MYYA 3VR5H 3EJ6A 2REOA 1ZYUA 4P35A 5JJBA 2ZS9A 1JQ3A 4LCJA 4KTVE 2VP9A 2IYLD 4W6QA 4WINA 1Q44A 2HOQA 2HXGA 1QO0A 2YYYA 5JSHA 1N33B 1PEYA 3WK6A 2JGRA 1TVMA 1YCDA 3EXHC 3ZWYA 4BFTA 1G20A 1JKJA 1HDOA 2J0UA 4OFBA 3WV5A 4NWIA 2Y2UA 3PKIA 1UDRA 3H9CA 3U4MA 4KLAA 2QMYA 3MOGA 1NBAA 1W0KD 3WGHA 3NYIA 1SWVA 1VHWA 4Q1BA 3GUHA 4DWJA 3CGGA 2PUJA 2NTJA 3WP1B 1RBMA 3CSDA 1DBQA 4A2PA 1TW2A 4BB9A 4L22A 4Q4CA 2HHAA 4W82A 1RXVA 3PQCA 1L6RA 4XVUA 3ND6A 3P27A 3WO0A 4PSUA 4FYYA 5LYJB 3JQAD 3ADDA 4ZYWA 4NFHA 2V03A 1QV6A 1SQ6A 4GP9A 1M8GA 1Q14A 1NM5C 1F48A 4BMYA 1EHIA 1M34E 1VKHA 3FTCA 1LS1A 1JTVA 4FZ3A 2YRXA 3VSBA 1QUFA 1PGJA 2Q4TA 5BN3B 3BBPA 3CF2A 4HAYA 3PEEA 2BGKA 4ZRMA 3WE7A 4R40A 5BXYA 1Q1AA 1NOKA 4GLFA 1UK7A 4CW7A 4D74A 3N6VA 1N2ZA 1U7PA 4ER3A 3QPBA 3TGPA 3DTVD 4MRMB 2ECQA 3T5MA 4N76A 1L5NA 4BN0A 4NZPA 4RXTA 1KJYA 1ZHHA 3VDQA 1B1AA 1PSZA 5ENVA 4YWJA 3ETLA 3I58A 1V5EA 1W4LA 4IRMA 4URWR 4LRWA 3TLXA 1T6XA 1UFOA 2GMWA 5JVDA 1SCDA 1W85B 2C3PA 3K53A 4G5YA 1Z22A 1QF7A 5IXYA 3FFBA 3DZHA 1FDIA 3QJGA 5EIAA 4KE9A 4XDYA 1A2KC 1GPAA 1UBLS 3F7TA 3GP3A 3D7SA 5MGBA 1BYIA 1TD1A 3R3HA 3NETA 5FAKA 4A2WA 2CBZA 1FP6A 2W6JD 2QY9A 3LQYA 4OB7A 1C1DB 3F6CA 2H85A 3NHSA 4RVDA 3WJAA 1MIOB 3IHTA 3FA2A 4M22A 3HCAA 3OURA 1UT5A 1RC0A 1V3VA 1WU8A 2HR1A 4RLSA 4LSGA 3R3XA 3RYHB 2VEDA 2B36A 4KQFA 3K1JA 2JJ1A 4UM5A 1I7QB 2EHJA 3ADPA 2TMYA 2PWZA 5LR6A 1DLIA 3OD5A 4NVRA 4O4IA 5E1DA 3RTGA 5LXTB 2VHYA 1E6CA 1ZUWA 5LOVA 2PZLA 1JFTA 4RHXA 3BERA 1K7CA 1DUSA 4NCKA 5LDDC 3CO0S 5DZSA 1ZD3A 1KJZA 2NUTB 1W4RA 1OFUA 3KSUA 3QUAA 4DV0B 2PGXA 1V8DA 2CXUA 2JHCA 1NRWA 4J16C 1CJTC 2H2FA 2VDRB 1U9IC 1R5BA 2WZBA 3EDRA 4MI9A 2ZIUB 2FY8A 3E2MA 3R3UA 2BOVA 4M9QA 1NBMA 5ULLA 6YASA 3DYBA 3FIJA 1G66A 2CWWA 3R74A 2X7XA 4FFBA 3K20A 4K9NA 3ACBA 2WYOA 2BMFA 3ORQA 3P19A 5LP6A 1UKYA 1H9BA 1SXJA 1VE9A 2H4WA 3JYHA 3FUWA 4J3JA 4Q3AA 3CEMA 1DWUA 3DAFA 3H2GA 2I6SA 2RFLA 3V9AA 1XRPA 4EW1A 1G8KA 3U4CA 3E7PA 3NFYA 4PAGA 5AOVA 1VC2A 3WYBA 3UGKA 2DQKA 1LDNA 2YY7A 3PQ3A 2G4CA 1F0YA 2WWHA 3OQ6A 4Q4AB 4WN9B 4X71A 5C0OE 2ZTVA 1XPJA 5U1PA 5KU1A 3BILA 2VWGA 3B82A 1KOGA 3MJEA 5E6UA 2BHLA 1LQ2A 3QMMA 2R11A 4RTRA 1UWLA 3DZCA 5CIYA 4Q7MB 1GHTA 1NDQA 2W2PA 3M70A 4IINA 4JUIA 1ICIA 2VF4X 1T2VA 2I29A 4IDQA 1M72A 4Z8YA 5KHLB 3N0WA 2V6MA 4DLSA 3QEMB 1K08A 2AXEA 3KX2A 3H5TA 3RTEA 1PW7A 2ZJFA 2B94A 3AVXA 5J5VA 3NM6B 5BYJA 2Y1XA 3IE2A 3NBAA 3RAFC 5CLJA 3L4KA 2HA6A 4LNUB 2C0PA 2GILA 5BMOA 1RWKA 3TVYA 4CF7A 3K0FB 2EL7A 4IJVA 5TT1A 1Z68A 4LHEA 1QFXA 2WNHA 3K8YA 4LJ6A 5I4IA 4Q9NA 1TIBA 4UDXX 1UM9A 2UVDA 5F7XA 2VYQA 2PS1A 5FI1B 2KMLA 3H3XA 4MQFA 1NFQA 4L7VA 5TV2A 2V3CC 1PT7A 1ZH8A 3TZEA 3AGQA 1NJSA 3BQMB 3W6UA 3NS7A 4FNGA 1QFMA 1TRHA 2Q41A 4G07A 3BXPA 4X1IA 1NVAA 2YZNA 1X7ZA 2ZR8A 2VRNA 3CS3A 3NBYC 4UBIA 1CETA 1E62A 1HBJA 5FPSA 5EHZA 4PLGA 2OGSA 1ZBQA 4YQEA 4C6SA 5I6DA 4WLOA 1H6AA 3MT9A 1MT3A 4J90A 2ISSD 3X1JA 3IP9A 4K9KA 1U4NA 2PYDA 4JBIA 5LWHA 3SLKA 4D4JA 4HPXB 4JB2A 3H9GA 4MR7B 1WMFA 1EK6A 1RWBA 3E22A 3NJ4A 4B6FA 5LIRA 4LHZA 2RD2A 3JCZA 5ESXA 4HYTA 2FMHA 4E6EA 3OCJA 2PAAA 2PZEA 1FTNA 3QX8A 4TTRA 4B0PA 4Q3EA 1QG0A 1MC5A 4L76A 2ONCA 4IJUA 3NBQA 1HF3A 5CM9C 5FOWA 3A11A 3KOUA 1VCIA 4LZAA 5AOAA 3L8ZA 3T7EA 1G98A 2CBGA 1B76A 2XWSA 5L9AA 5FL7D 1Q15A 1CEYA 2H1CA 2PMFA 3JQBA 5D00A 2BTEA 4EHHA 2LW7A 4HRYA 4KVAA 1QIKA 1PKEA 3VR4H 3H2KA 3DFIA 1U9JA 3MTDA 3S2GA 2JASA 3C7KA 4QUKA 1B6SA 4B5LA 4FQ7A 1XPRA 3W5VA 3IR6A 4R0VA 4XW2A 1A50B 1K5GA 3CX7A 3LZ6A 4L27A 5ALFA 4BLOA 1YJXA 1ONSA 1TJ3A 1YI0A 4MWZA 1D8TA 4QUJA 4DLAA 1E59A 3ONDA 5JASA 1YZVA 4ZVLA 4EHDA 1OV4A 2YZKA 2DERA 2BBOA 2Q3HA 4DCUA 2I4IA 3R76A 5HKAA 5JFTA 5JYCA 1R74A 1VPEA 1L7PA 4ZYLA 2GKOA 1DTWB 1XMIA 4BO0A 3JZFA 1II0A 3ZTTA 3UBMA 4IF4A 1NU6A 1HE3A 3EGIA 2P75A 4QXOA 2C00A 3S1AA 3TIVA 3TSWA 2XZDA 2DECA 4G0VA 1G20E 1UEJA 4IZHA 4R3NA 1WB6A 2C84A 5GVSA 3QXGA 5A5GA 2DSTA 2JCXA 4L4SA 4NDZA 1ECBA 1TLFA 2K4MA 1V25A 2AOUB 1PJSA 1KEVA 2F67A 2ZR0A 3K0BA 2F2TA 2ZUWA 3GMIA 1OV6A 2QRUA 3LUGA 4BQQA 1TKRA 1U1CA 4QU5A 3T38A 3HJNA 1ZLXA 1MJNA 1R9JA 2QW0X 1YFLA 1IJEA 4YCAA 2HU8A 3ZJUA 3EPKA 4JOBA 4MV7A 4KQEA 4F9FA 3OOYA 3L0IB 3I6YA 3W6OA 2OSBA 4OX9Y 1AD2A 1HDEA 3IHWA 4Y9DA 4G1MB 3GAMA 3TRKA 1LZLA 2OR3A 3GJ3A 4MPRA 1EQUA 2DFNA 4HAVA 5H5JA 4F97A 4OI0A 3UQZA 3NEJA 4YP7A 2ZJYA 4PSAA 4ZDJA 2P3OA 4DA0A 4AG5A 2PX0A 4IHJA 3ESXA 3N2LA 4IWYA 4OLHA 3OFNA 3KJGA 3RBXA 4KR9A 2ZYVX 4D02A 2UZAA 3DG9A 1JYSA 2I2WA 3EF1A 1EG2A 1H0SA 5C9ZA 2F8SA 1CZHA 3H42B 4CG1A 1Z38A 5JY6A 2QTTA 2QUIA 1B8NA 2VDLB 3PNMA 5D85A 3TNJA 5I5EA 1RXSA 3I64A 1E1KA 3OTIA 1FDOA 4KBGA 4OXXA 2VK1A 5G0WA 2AJ8A 3FIUA 3G8DA 4RACA 1OBOA 5D87A 2OPBA 3SBXA 4MULA 2QN2A 4MS4B 2C9CA 2Q62A 3BK7A 4JASB 3QKUA 5GQSA 3ER9A 3HR8A 5TJ9A 2J59A 3GFFA 2BN4A 3GJ4A 1QO9A 4F1JA 3WWZA 1I36A 2O5VA 1FVXA 1JIIA 3BRSA 3OZAA 3MGBA 3L6CA 4FBMA 2E1RA 4FKMA 4FYKA 1R6BX 3CNOA 2P9CA 3D1LA 3E9NA 3ELYA 4G0YA 4H35A 4G63A 4UUOA 2H2WA 4G8DA 4BLQA 5MGNA 3PC4A 1VKJA 2IHZA 1DCMA 4KH0A 4M21A 5FI5A 4G56A 3A26A 2PSSA 3CUUA 3ZNOA 3ZE6A 3ICQB 1EG7A 1NTRA 4GWLA 3NALA 5CEFA 1B00A 4YS6A 3FNEA 2VPPA 2BBSA 3JWPA 1IN5A 1IFXA 1MO6A 1IG0A 1QHGA 3NRCA 1AQIA 1VA5A 2Z2JA 2NU8A 4AJIA 2HSEA 4YJKA 3RUDA 2ZM6B 2C7GA 2GOYA 5EZYA 1NVMB 2RONA 4B71A 2QIPA 2BJWA 1Z7WA 3QWIA 4HDQB 4A8HA 4BE4A 5JBIA 3I5YA 1ECPA 2CZGA 1K75A 1DV1A 3MWEA 3UMGA 4B4OA 1MVLA 3REQA 2WSSA 1N92A 5ETJA 3LUDA 3KQNA 1BHQ1 4IUCS 5J1SB 5HGJA 2X4LA 1YS1X 1FFYA 1XVUA 2W0SA 4IKEA 3NH6A 2AN4A 4MYSA 2WK1A 1EFHA 3A6FA 3MA0A 4MHSA 1N2SA 3OO0A 2AK3A 2B61A 5A4MS 3C8HA 2G36A 4B76A 5CEJA 5TEVA 1B6TA 2XVXA 3F8SA 3A2KA 1T4MA 4OGFA 3BXOA 3MQFA 1R6UA 1UWKA 1MTOA 4US2R 3DT9A 3NHLA 1N0VC 3OICA 4O0LA 4UBJA 1SXGA 4GVPA 1G5QA 4E1AA 2XB6A 1XTUA 2ZDHA 3FHCB 3LOQA 1WBDA 2V1UA 3OZTA 1LJLA 3ZDZB 2H9YA 2Y2VA 4E94A 4YAWA 2ZRLA 3ZY2A 4EGSA 1Z2AA 3Q15C 2ABWA 2PV0A 1RFGE 4AUKA 4REMA 2VUIB 2XUJA 2NPIA 1OYYA 2AZTA 2G8LA 5HE9A 2QMEA 3I1JA 3PC3A 1CT9A 1J8VA 1DKNA 4QU8A 1H1LB 3DLHA 1ZRHA 2GN2A 2HLDA 3COZA 3CZQA 5LWQA 5GP1A 3AU8A 4UCFA 5BQPA 1NZJA 2QSYA 3AK4A 3MWFA 1RYMA 2DR3A 4GM1A 1TC1A 1T4DA 3CIOA 4X8HA 4C6TB 2G17A 2BFDB 3CZ5A 2A67A 3ZXXA 2C9OA 4HEJA 1D9ZA 4P4UA 1S8OA 2ZWMA 3HSYA 3M33A 2RARA 3H99A 3C4VA 1DOZA 2ANBA 3CNEA 3ED5A 2O2ZA 2ZT8A 3OZBA 1XZBA 4G6ZA 5T3UA 3R7WA 3S2SA 1GFIA 3C3XA 1X0XA 2NVOA 4RTPA 5F78A 3H04A 4LTMA 4PX5A 5PGMA 3W5AA 4L5CA 4CKYA 5THKA 1EIWA 2CK3A 1UK8A 3S8EA 3ETJA 3REGA 1NW3A 2PR2A 3FNIA 2OGWA 3F9CA 1XLTC 1E5QA 5IYZF 4IJ5A 3RNOA 4CU5A 2QG6A 4BE7B 2VSFA 4YJFB 2NO4A 5L6LB 3USZA 1V16B 4FOTA 4TXMA 1CUCA 2YVAA 4EQ6A 3G5UA 2WMOB 3NPAA 1CQIB 3OPNA 1HKUA 2Q4EA 1J21A 1ZH0A 4PPGA 5H1YA 5C7YA 1I4WA 4BP1A 1Z5WA 5AVXA 1C4OA 2X23A 4ZVUA 1Z9BA 1DT3A 2J45A 3D3WB 3EODA 5HCNA 3WAGA 1KP2A 4LYFA 4OLAA 1I2DA 1QPBA 3VPAA 2D59A 3BJZA 5CK4A 1NC1A 1E1CB 2WB4A 3LDUA 1A9PA 1R0KA 3GZJA 1F8XA 4GKKB 4JYPA 4PICA 3T5PA 3HS3A 5EJIA 3VOTA 5AKIA 1EQ2A 1A4RA 2F8MA 4XWTA 4Z8XA 5B3LA 3K2BA 3O3MB 4ZU1X 1CSEE 1E3TA 1JR3E 1VJGA 1JSLA 2YJ3A 5I5GA 2W5UA 1RYBA 3TMYA 4GR9A 2WKQA 4P1ZA 1ZGAA 4MICA 3D6JA 2CLHB 3RUIA 5IH3A 1BXRB 2DWOA 4IDHA 5J2UB 1G21B 2R87A 4DEVA 2QSZA 4PLTA 1JHZA 1I1OA 4BZXA 4ZEVA 2A84A 3F46A 1MJGM 5F64A 3D3JA 2AN9A 3AQ4A 1P80A 5FB3A 2H7XA 2G1UA 1N5RA 4Y7DA 5ER9A 1GNSA 1GCUA 1H9AA 2CK3D 1R6XA 1RZUA 2V5UA 5A3JA 2QKYA 3CW9A 3LYUA 4OFXA 4I1IA 5C8VA 2XODA 3MHPA 1W93A 2PL5A 1ENOA 3AY0A 1SBHA 1XYVA 1V4NA 3FB4A 3MGGA 2IP2A 3DUFA 4LQLA 4CNQA 4RTQA 4RZ3A 2ZDQA 1ND6A 1ECLA 1DG3A 1W29A 1YO6A 1OYOA 1SVLA 3AR8A 2IIQA 1E79A 3EZGA 3I9NA 1YFJA 1L1FA 4BFCA 1H66A 3KJHA 4E2XA 1N36B 3BZUA 3G6WA 3IJEB 4GWGA 3RWOA 5F98A 4U2BA 3JYOA 4GKVA 3UUGA 4V0KA 2O20A 1A2QA 2WJAA 4BNZA 4F11A 1Y3HA 3DV0A 1GZDA 1L4FA 1LLCA 1QYDA 1B42A 2COKA 3DXFA 3IQEA 4MLZA 2JIRA 4EY7A 4TUYF 3A1UA 4DIEA 5TQVA 1EQAA 2Z2XA 1RWNA 2RAVA 3LLMA 4M0EA 2NSYA 1Q1GA 1QC5B 2QGZA 3TG8A 5T67A 2WJZB 3CO5A 4G2NA 4E7OA 2NG1A 1BEZA 2ZRCA 3SKYA 3DPIA 5DNUA 1F1BA 3DDWA 3FBTA 4RM2A 4TMYA 4DJFC 4PHFA 4XLLA 1KSJA 5TE9A 3RH0A 3CXRA 5NLLA 2FPXA 3AIKA 1O77A 4A0QA 2JH3A 3MMPA 4QU9A 4CLDA 4M1WA 1GGKA 3GZ4A 1QZUA 4XYGA 3NDPA 5LQMA 2JPDA 3C6KA 1KVUA 3IMCA 4ITVA 1WP4A 4RPHA 3BXXA 1J7KA 1P62B 3WNCA 5HZKA 3LGSA 2SKEA 2JI7A 4MS1B 1THMA 5IAJA 2PUTA 1Y7HA 1CC1S 4OGWA 3SXPA 3ZC3A 3ZR4B 3CJTA 4LOAA 4DT1B 2VPZA 4UQOA 1TE2A 4XYLA 3IQFA 1Z16A 3LWZA 1Z2PX 1S8FA 2IZ7A 5ITZA 3TF5A 4K9OA 4HNVA 1IHDA 4RK5A 3VVCA 2YH2A 3VSAA 2QEQA 3SF0A 5KYYB 2OD7A 1XFAA 4UE3S 4IYRA 1Q20A 1AKMA 4Q9KA 1O9BA 2DWUA 1T2NA 1X7XB 2OTCA 1Q3HA 2CF5A 4OMFG 4FSXA 3RFFA 2O3TA 1RJGA 2JJQA 5C52B 3RV4A 1YMQA 3GR6A 4P08A 3AF1A 3TB4A 2HLPA 4I3GA 3O4JA 4LXGA 3D59A 3V42A 3KKMA 2D54A 2V7PA 3HKBA 2WZCA 3LPDA 1OY1A 5TRTA 4C4ZA 1N2GA 2I5PO 4X0EA 5F76A 2D5AA 2VRCA 2YNMD 4I3FA 4C7KA 4PCAA 1EDZA 4HL6A 2M1XA 4I5EA 4Z4CA 2B99A 4WCDA 3F5FA 4GUDA 1I2CA 4FGLA 2OMKA 3B89A 5TEWA 1LK7A 2YXBA 4JC4A 1ZVMA 4EL0A 3QNMA 1O6FA 1N2CA 4HZIA 1JWLA 3CLHA 3G79A 1TJNA 4K6CA 3ZS8A 5HGXA 2IDMA 3WL6A 3T0GA 1J56A 1A7AA 2APJA 2BI7A 2WF7A 1QF6A 2VWPA 4JA0A 1XL1A 2FEMA 3A31A 3KVRA 3VU9B 3V4OA 1CVLA 1RLUA 5GOTA 3BIXA 1WR8A 3ME5A 4KUHA 2QM3A 3HJBA 1AO3A 4Q1CA 4QQFA 4GZ6A 4WH0A 3FMGA 4WOBA 3GRZA 4B8ZA 4O08A 3FOWA 2QN1A 3JY6A 4RO0A 4QTYA 2XJ9A 4ZZ2A 5ANRB 1YJBA 1PL0A 2C2ZA 3RW9A 1QORA 2D1TA 3EEIA 3OHPA 1TYDE 3FUCA 4MTLA 1E7WA 1JH8A 4HEA6 2FSVC 2HWUA 4RSRA 3I6QA 3FPKA 3TNDA 4EO9A 1E5DA 3FPGA 4LBWA 2V4UA 3O4VA 4D81A 1W0CA 2ATEA 1CR1A 4KNVA 2JJ1D 2O8FB 4GPAA 3TJRA 3ZGYA 4WNAB 1JG4A 3O9MA 4WY5A 4BGEA 4R2XA 4WHMA 2WU4A 3OWXA 4YPOA 1GRQA 1AGRA 4HX9A 2YMPA 4M36A 4N65A 1JHQA 4UREA 3QUSA 4J2TA 5B58C 3FNRA 2E55A 2RH4A 4ZA2A 2VP3A 2E49A 2VFAA 2VHTA 5KYUA 1YTUA 3X1KA 4J91A 3TM5A 4MVYA 1BXKA 4DDKA 1AKWA 4FMCF 3OE7D 3DNPA 5DHPA 2EP7A 2O6LA 3Q7SA 2HIMA 2J3MA 4X41A 1WCYA 2BV3A 1GRCA 1YDGA 3NKVA 4K9SA 2QP9X 2XF8A 3EPPA 4WOCA 2ZSFA 4XUGB 2P2YA 4HAUA 3GNTA 3MUNA 1IN4A 1JJIA 4AWXA 4R98A 1PWZA 1BQ4A 5B30A 1YBFA 1WKVA 4MDHA 1IBKB 1E9AA 1Q19A 4N39A 4BNXA 5BQOA 2ZRKA 4XQEA 1IBLB 3ZPXA 3TE6A 3IDAA 5EFZA 3EC2A 1OREA 1QB8A 3STVA 3ILSA 5LP1A 1JECA 1GT91 2DLDA 2UZIR 3O7WA 4JYAB 3K6RA 3D5QA 1A9ZA 3HNOA 3OLYA