4LN5A

Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bamb_6123), target efi-510059, with bound glycerol and chloride ion
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
302
structure length
302
Chain Sequence
RVFRSADVHGDSFPTNMAVKFMGDELSKLTGGKDSIKVFGNSALGSEKDTVDQVRIGAIDMARVNGASFNEIVPESLIPSFPFLFRDVDHFRKAMYGPAGQKILDAFAAKGMIALTFYESGARSIYAKRPVRTPADMKGLKVRVQPSDLMVDEIRAMGGTPTPMPFAEVYTGLKTGLVDAAENNLPSYEETKHFEVAPDYSETQHAMTPEVLVFSKKIWDTLSPQEQAAIRKAAADSVPYYQKLWTAREASAQQAVTKGGANILPAAQVDRAAFVKAMQPLWTKYEKTPQMKQIVDEIEATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Burkholderia ambifaria
molecule tags Transport protein
total genus 117
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ln5A00
4PBQA 2ZZXA 2HZLA 4PGPA 5IGAA 5CM6A 4PC9A 2PFYA 2HPGA 3FXBA 4P1LA 4LN5A 4UABA 4O8MA 4OA4A 4P47A 2VPNA 4DI4B 5I5PA 2WYKA 4PAIA 4NGUA 3B50A 4PF8A 4O7MA 4PE3A 3GYYA 4OVQA 4P3LA 4PDHA 2XWVA 2ZZWA 4NX1A 4N8GA 4P8BA 2XXKA 4MMPA 2ZZVA 2XA5A 4X8RA 4OVPA 2XWKA 4PFBA 4YZZA 4NHBA 2PFZA 4MNPA 3U65A 4PAKA 4N4UA 4MAGA 4MX6A 4PGNA 2CEYA 4N17A 4P56A 4OVSA 2XWIA 4P1EA 4PETA 4XEQA 4N15A 2WX9A 4NAPA 5I7IA 4OANA 2XWOA 4MCOA 4XF5A 4P9KA 4N8YA 4PF6A 4DI3D 4MEVA 4OVRA 2V4CA 4X04A 2VPOA 4NG7A 4XFEA 4MHFA 4NN3A 4PAFA 4NQ8A 4OVTA 4PCDA 2HZKA 4N91A 4NF0A 4PFRA 4PFIA 2WYPA 4PBHA 5IM2A 4MNIA 4N6KA 5IZZA 4MIJA 4PDDA 4YICA 4MNCA 5LTCA 4N6DA 4O94A 2CEXA
chains in the Genus database with same CATH superfamily
1A8FA 4DZ1A 5ESYA 4MJOA 4LQ2A 4LN5A 4NF5B 3W15C 1DOTA 1YCJA 2KQZA 2I49A 3K6XA 3SESA 3TODA 4H5GA 2M8CA 4F39A 3FASA 3MZBA 2P3NA 1VE4A 5F7VA 4IY5A 4NTLA 2O1MA 1P1OA 3O97A 4MMPA 3PMWA 4GFRA 4RK2A 1MRPA 4LZ8A 3JZJA 1FRPA 1IXIA 4PFWA 2VOZA 4MNPA 1R9LA 2XXIA 1MM7A 2OCUA 3BIGA 3DP8A 3IK6B 4NF8B 2O7UA 2G29A 4FECA 4XEQA 1XHYA 3DP6A 2VD2A 3V8XB 4GQOA 5L9SA 1O7TA 1MS7A 4FEDA 3G3JA 1MPDA 2UYFA 2VHAA 2VPOA 3BFUA 4BDRA 4MHFA 3FUZA 1MXYA 3T22A 3MPKA 2WYPA 2VT5A 1JP4A 4PBHA 5IM2A 4BDNA 2LAOA 1MXVA 3LSFB 3CSBA 4WEDA 3PD8A 1LBZA 3RLFE 2QL3A 2ZYKA 4YAHX 4IGTA 1B7UA 4PGPA 5CM6A 2DQVA 2Q88A 1FPLA 3UGWA 2I58A 3FGSA 2DVCA 4YB7A 1UQWA 1YYZA 3RYDA 4OTEA 4GBWA 4H67A 1DPPA 1XOCA 1TWYA 4I8CA 3VFJA 3Q29A 2THIA 1LCTA 3ROJA 3MZ9A 2UVGA 4H5FA 4R2BA 4HE2A 5M2VA 4MLVA 5I2NA 2RCAA 5BUUA 5K2XA 4U1OA 5H8QA 1OLAA 4X8RA 3RPLA 1DCUA 1JQFA 3TCGA 4KD5A 1SQYA 4EQ9A 4PAKA 1RYXA 4EQBA 3TELA 3Q28A 3OEKA 1NNKA 3K6VA 1I6AA 4PETA 1LBBA 3N6TA 1Z7ME 2VD3A 4RPNA 2DDKA 3IORA 4OVRA 5I58B 2HXWA 4X04A 3CVGA 4GXSB 1UTBB 2V25A 1B5HA 1DK4A 1N7XA 2JJKA 2Q89A 1LB9A 5DYHA 1FPKA 3HHGA 4DDDA 2R8TA 4ZEFA 4Q5TA 1P1NA 5ICQA 2PYYA 1B0LA 1A55A 5CMKA 1CB6A 2F7BA 4YKPA 5FHMA 2H4IA 1SD3A 2RC8A 2HPGA 1I6BA 2XXPA 3T93B 4HXVA 1DTGA 1B05A 3A09A 1EYKA 2PMSA 5I5PA 3ZS6A 4FORA 4PF8A 4AB6A 4U4XA 1LBCA 3H6UA 1B4HA 3MBPA 1SI1A 1M5BA 4FEBA 2XXRA 4DXUA 3B8BA 1LGBC 1XI6A 4O7IA 3LSLA 1JETA 1M5EA 3T96B 3SZPA 5DVIA 4YZZA 4HW8A 1R6ZA 1ZLQA 3MJNA 2AL5A 1NV1A 4RK9A 3H6TA 1WDNA 1GGGA 5EYGA 4GWOA 4WKMA 4F2OA 1RDXA 1Q1KA 2MKZA 3H6VA 3D4GA 4GWZA 1LBXA 3K1MA 5I7IA 3B7DA 1FPGA 3SDFA 4PF6A 4UA8A 1AH5A 2DWAA 4XTCQ 2XXTA 2I6EA 3IJOB 3C35A 1POTA 3E3KA 1FJ9A 1VSOA 3ONMA 1QULA 4C1UA 4GWUA 1UTHB 4IB2A 1DBZA 1OMPA 2Z8FA 4F22A 1LAXA 4KXPA 5ET5A 4R6HA 1NUWA 2D3IA 1KA1A 3K6WA 4R6YA 4BLAA 3PTYA 2NXOA 4G4PA 3CG3A 5JEIA 1D9YA 5I56B 1SYIA 4F29A 1DTZA 4ESXA 3UK4A 2Z22A 4NGUA 1NMUA 1FJ6A 4G8HA 2F6GA 1VDWA 4BDOA 1FTLA 1YAEA 1PC3A 2PT1A 4ZE8A 2GFEA 2QS3A 1EYIA 2VGQA 3PUWE 4Q0CA 3TTRA 3KOTA 5A5XA 3MUQA 1S9TA 2H25A 1RDZA 2WBDA 2ZYNA 1G0IA 2OBGA 3OO6A 1B0HA 2XXYA 2O51A 2IA4A 3KBRA 3MWBA 2QPQA 1MH3A 4MAGA 1MQIA 5H8NB 4BDMA 3EQ1A 1A99A 1USYH 5FTIA 5CMBA 1FSAA 2GHAA 5L8DA 1BTJA 5LDZA 2XWIA 4ONYA 3FV1A 4P0GA 4EF1A 4TLMB 1IUDA 3FVOA 4N6PA 4GXAA 1D9QA 4OWDA 1XVYA 2DWHA 1B5IA 3W9VA 4R2FA 1VFDA 1NL5A 1LFIA 4NF6A 3N6UA 1FQFA 5K2YA 2XXWA 4JWXA 2F8DA 3RQTA 1LSTA 2F7AA 3TCHA 4FBPA 2PX1A 4ZE9A 2IEEA 5EQAA 1NV4A 3N5LA 3T9UA 4FE8A 2ZZXA 2QVRA 3OOAA 3TAJA 1I69A 1H43A 3THIA 4OQOA 3CFZA 4GD5A 2A5SA 2I4BA 3PUYE 1JVYA 3TFLA 3O29A 1FBHA 1AL3A 4FATA 5ITPA 2HQ0A 3EHTA 4Z7EA 3ISPA 3TZAA 3W9WA 2UVHA 3TYHA 4G77A 2X26A 5TP9A 1WVJA 4KHZE 4P8BA 1K9ZA 1OVBA 3FBPA 1MQHA 1MQJA 1CNQA 3EN3A 3MC2A 3U92A 2CMOA 4G68A 4NHBA 3U65A 4PQJA 1KA0A 2HCAA 4GL0A 4PGNA 4JSDA 3PMVA 5I57B 3S4UA 2FA7A 4IR8A 3IOVA 5DVJA 5AA2A 3ECRA 1PBPA 5AA4A 3TEPA 3G3IA 2HHMA 4XF5A 2PVUA 4O3CA 3LUZA 1T0KA 1MQDA 2H5YA 5AA1A 4H1XA 4PAFA 2O7IA 4H45A 5CMCA 5KDTA 5DEXA 4NF0A 4PFIA 1PEBA 2RCBA 1P1WA 3VLUA 5KCJB 5TPAA 3KEIA 5LTCA 2H99A 4DE8A 1D3KA 3HV1A 4TOZA 4H46A 3QIMA 5B7DA 1ZU0A 3FJ7A 4JWOA 1MXUA 4JWYA 4UABA 4YB5A 2I3WA 3FJGA 3OEMA 1EH3A 3USDA 3G3FA 1US4A 1VFEA 2XD3A 3B50A 2XX9A 3PPRA 4N07A 1XT8A 1JW1A 2ONKE 3LBSA 3I3VA 3U8QA 1ZJLA 2FVZA 3LV0A 4HCWA 2RC7A 1I6QA 5FTHA 2XA5A 3OO7A 1IMBA 3KSXA 3GZGA 1YXIA 3OSRA 2X7PA 1NV2A 3KC0A 1QJMA 1B3GA 3E79A 4NF5A 2W7YA 4U22A 4F1VA 4F31B 2Y7RA 2R9JA 1EZOA 2Y7KA 1QGXA 1MDP1 4PFYA 3EHUA 1OQHA 4H8IA 4DI3D 4YMBA 3BFTA 1N0TA 1NKXA 3TMGA 2HZKA 1SPIA 1TT1A 2ABHA 1PB7A 4LA9A 1J1NA 3O2AA 2UYEA 4U2RA 4QFOA 4Z0IA 1M5DA 1RDYA 2F78A 3S9NC 3RT8A 3ZKLA 4NF8A 4I3YA 4R6KA 4I40A 3B6QA 2I48A 2HFBA 4GWXA 5JTYA 1MXWA 5I3SA 2QSXA 2RC9A 1GR2A 4GVOA 2P3VA 3MPLA 1FBDA 1M5FA 1F9BA 1LBVA 5B70A 3MP6A 4R74A 4X1DA 2V84A 4OERA 4OXVA 1KZ8A 4DCXA 2XXKA 2Z8EA 1SI0A 4NE4A 1Y4TA 3GBBA 2KR0A 3PUXE 5IZ1A 1FQAA 1B3HA 4MLQA 4UACA 2NVUB 1YZ0A 4P11A 3LSXA 1II5A 3K0VA 3TTNA 4GWYA 3LUYA 4JBZA 1A40A 1AMFA 4XKNA 5ET6A 4R75A 4PFTA 2XWOA 4MCOA 1NNFA 3ILTB 4IO5A 2DOJA 2HEUA 3HFUA 2WEFA 2A5TA 4OVTA 3H3GA 5ET7A 4XIGQ 1R9QA 3G3KA 3K01A 2O69A 3IL1B 3KN8A 1HSEA 2O1LA 2DS9A 3CHGA 4F3BA 1R1NA 1SDXA 4Q8RA 2F5XA 3PV0E 5DW8A 1FPIA 5CMMA 1WODA 4EXKA 2QMWA 4ZZEA 3EHSA 1FBCA 2ESNA 3PPPA 4O3AA 3PD9A 5ICTA 3PPQA 1O64A 4KCCA 4EXLA 4P47A 2ZNSA 4MBPA 5L9MA 3SERA 1B7ZA 4G61A 1UTBA 4PE3A 4QHQA 2UXAA 4YU0A 2XX7A 3IOWA 4OVQA 1MXXA 2XWVA 2ZYOA 1MM6A 3OO9A 2DYXA 3T1BA 5ELVA 3MW0A 4RNSA 3S2VA 1FBGA 4OFJA 5ITOA 1HSLA 1Q35A 3B6WA 4HTGA 3V89B 2OLBA 3Q27A 3MP8A 3WAEA 2DXRA 2O6AA 3IR1A 4MH5A 3OD7A 4P1EA 3GBAA 3E78A 4X1BA 1TFAA 3KN7A 3DP4A 4F2QA 3FV2A 4LP2B 4KPTA 2F3DA 4OANA 3UORA 3MVYA 3CG1A 2QRYA 3RUMA 3HPIA 1NV6A 1B58A 2ALUA 3IAZA 1H3DA 5I59A 5IZ3B 1FTOA 4GOTA 3H03A 4G68C 3UP9A 3VE1B 3UA8A 4GX4A 4O94A 3A29A 2FBPA 3TQLA 4EUOA 3M8UA 4H65A 1B1XA 3K1PA 5DTBA 4HS7A 4RY1A 4GLIA 4PC9A 5EYHA 1NUXA 4F19A 3KBZA 3IX1A 4EF2A 3R6UA 3U93A 4GL8A 1USYE 4JSOA 5HM4B 3OELA 3ZKKA 3E4RA 4PFUA 1P1UA 4FAJA 1PDAA 2CZIA 2Y7IA 3T9XB 3M3LA 4KFQA 3SEXA 1OIBA 1UTHA 2WKYA 2HAUA 1B3FA 1SW1A 1B9JA 1XVXA 3DM0A 2XWKA 4RXLA 3QSLA 4YKIA 3TQWA 4R72A 4U21A 2PFZA 3QYTA 4ZDMA 4IO6A 5TU0A 2UVJA 1SBPA 5I56A 2I3VA 5ISUA 4N81A 3O6IA 3KSJA 4EQ7A 3TTMA 3P7IA 5I2KB 1BIYA 3FXRA 2AYSA 2XXXA 3MVZA 4EDPA 2OX3A 1B4ZA 1RYOA 1Y3QA 2O84X 2UVIA 4N8YA 4P9KA 3D1RA 5EYFA 4ELOA 1MPCA 3GXAA 2BJJX 4R9FA 4PCDA 1QKBA 4KYEA 3MYUA 3PUVE 3U72A 1B3LA 3O28A 3U94A 4IO2A 4OMBA 5FHNA 1B5JA 3B6TA 5H8NA 1UIVA 3VXCA 5IGAA 5H8SA 1LBWA 2E0SA 1VR5A 3H06B 4OEUA 4ISUA 4R73A 5FHOA 4TQUQ 1MY2A 1P1QA 4F1YA 4OESA 5H8HA 3M3FA 3E13X 5F24A 1DSNA 2ZYMA 3MP1A 5CI5A 3IB2A 2R71A 1LBYA 4F3PA 2O68A 1N76A 4PDHA 3R7XA 2ZZWA 1BK4A 3MSTA 4F1UA 2GH9A 2XHDA 3RTFB 1B51A 1H76A 4GX3A 5FBPA 5CRYA 3FIRA 4PFBA 1XS5A 3D4CA 2DXYA 3VVFA 4WEPA 5J1DA 1A8EA 1YPNA 5AA2D 1D4NA 3EKIA 4JVDA 4AS4A 2WBBA 4L17A 4GWSA 4JVCA 2I0BA 2F7CA 3A3CA 5ET8A 4PTKA 1NFTA 4NAPA 3KG2A 1N04A 1NH8A 3QXMA 3T9HB 2NOOA 5I84A 4I9DA 4U1ZA 3L6GA 3EPEA 4GWWA 2V4CA 3KFMA 1QUKA 2OJTA 4XXUA 5DT6A 3LC8A 1LAHE 4QSCA 1B1HA 3KN3A 4MNIA 3KJTA 4YICA 2R6GE 4HE0A 1AOVA 2Y5LA 1FBFA 1FBEA 2ZMBA 2CEXA 2Y84A 3MVXA 1SW2A 2NWJA 4PP0A 3N94A 5I57A 1B32A 3CR9A 1LCFA 2BJIA 3L6HA 2L5VA 2OK2A 4ZEKA 1GVCA 4R9GA 1EZ9A 4O8MA 4ZEIA 1ATGA 3VVEA 2G93A 4OEVA 4NF4A 5TPAB 3CFLA 5H8FB 1LAGE 1MY1A 2I0CA 5EHSA 3S9MC 4O7MA 2OWSA 3ODBA 4QXDA 4LONB 1YTVA 3HO7A 4P3LA 3JV9A 5KCJA 5KZTA 3IJXB 1IMFA 3EF7A 1IMAA 4Q30B 3PPOA 4QFPA 4OVPA 1BP5A 1NNPA 5A5LA 3TTKA 3OMBA 3UN6A 1ZMGA 3M3KA 1Y4CA 4N4UA 4M1VA 4YMAA 2FIXA 4RA1A 3O66A 4NWDA 1KWHA 3PUZE 4N17A 2OWTA 5EQ9A 3A3UA 3IOUA 2F36A 3FJMA 3H4ZA 5CBSA 2WX9A 4XKQA 3K02A 2QS1A 1B3EA 3VLVA 4MEVA 2ANJA 4LZ5A 2GHBA 4RYAA 3FZVA 3I5OA 1A54A 5J16A 3FATA 4PFRA 2PCRA 1EZPA 3OENA 1FQCA 4ZEDA 3RT6B 2HXRA 1B40A 4N6DA 2VP1A 4FIMA 4TLLB 4RJZA 4AQ4A 1NUZA 4OYVA 3TDJA 3DLNA 2P2AA 2GRVA 1IXHA 5EHMA 3RN8A 3VVDA 3K4UA 3KJ7A 2Y7PA 1B6HA 3I6VA 3V83A 4OVJA 4DI4B 2XXHA 1S7YA 2Y5KA 2QMXA 3NOHA 2PBWA 3IB1A 1Z7NE 4G8MA 5LOMA 4F18A 1FBPA 3RGYA 1MPBA 5JTYB 4FJPA 1PB8A 3TKDA 1IITA 4XKRA 3U1OA 1NV0A 1BLFA 1Y1ZA 3FVGA 4IO3A 5IAIA 4ZZAA 2B4LA 2DSFA 1D9VA 4YB6A 3MVWA 2DVZA 1HSJA 1A7LA 2ONSA 3MZ1A 3G7WA 4U4SA 2DE2A 4OVSA 1LLSA 1IEJA 4LUBA 4LZ7A 4G2ZA 1ANFA 4K3FA 2OZZA 3T0JA 3OSQA 1FPBA 4DXCA 5DVFA 4DCYA 1ZIUA 1FTJA 1IIWA 3H7MA 4IGRA 1N7WA 3QAXA 4XKPA 3SEYA 4NQ8A 4N91A 4ND9A 3PU5A 3IB0A 3Q25A 4LATA 5I2NB 1Q9DA 2F6PA 3SETA 2Q8JA 5H8QB 3RY3A 4YKKA 4JVIA 2E1SA 4ZEBA 3RPLB 1H44A 3MAMA 3O6GA 4E0WA 4WXJA 3TUSA 4HE1A 2XXQA 4P1LA 1UIUA 2A5TB 1Y3NA 4GBVA 3C33A 4OZ9A 2CZHA 4AB5A 2VPNA 2RINA 2WYKA 3BKIB 5EQ8A 4NEDA 4OENA 3O6HA 4HCYA 3FVKA 1SYHA 4QSEA 1S50A 2V3TA 2H9BA 4DXBA 3VLWA 3C4MA 2ZZVA 3SEUA 3SKPA 4H6DA 1MY0A 2QVUA 5I58A 4F3SA 3KOSA 4IO7A 5CC2A 1ZBMA 1Y20A 4DIGA 3IO6A 1QUIA 3G3GA 1AWBA 4KYDA 4OHNA 1N3XA 3IFAA 1NH7A 1Y9UA 4GX6A 2DP8A 4I62A 1MH4A 4NWCA 1FPJA 1FQBA 2DE4A 2QFLA 3FD3A 1H45A 2Q2CA 2PT2A 2QVVA 1N3WA 4XFEA 3RTWB 1JVXA 2Q8MA 1DMBA 3OXNA 4BDLA 2P1SA 4BDQA 4MIJA 4PDDA 4YKJA 1EYJA 1ELJA 3CSGA 3ILUB 3MQ9A 4MNCA 1LFHA 1SW4A 3RPWA 3S9EA 4ZECA 2H98A 4PBQA 2HZLA 4ELRA 1N84A 1FQDA 2PFYA 3Q26A 3UIFA 1FCKA 1PBQA 1MG1A 4I1DA 5I59B 3QUFA 3V5AA 4MFIA 5HBCA 4P0IA 1Y3PA 2B4MA 3PPNA 1LB8A 1URDA 5IZ3A 3PGFA 4C1TA 4ZS9A 4NX1A 1GTKA 4N8GA 3S9LC 4QSDA 1JNFA 3G3HA 5AE4A 1MY3A 4KCDA 1FTKA 3SEWA 3OO8A 2QS4A 4X48A 1NNTA 5JK4A 1AIVA 3E9XA 3C32A 3WAFA 5AA3A 2FIEA 3T66A 4ECFA 1US5A 2CEYA 2Y7WA 5EQ7A 3AXFA 2Q74A 3VXBA 4C0RA 4QFKA 3QMFA 2DWIA 1XC1A 3CRBA 4N15A 2I4CA 4POXA 1NV5A 1JEVA 4GIZA 2Z8DA 2KLFA 3TTLA 3C34A 1B46A 1IQ7A 4NG7A 3KZGA 1OQGA 1O63A 3QUJA 3R26A 3BIHA 4THIA 5A5XB 3GLBA 2FHYA 4N13A 4KR5A 5CBRA 5F1QA 2AIXA 2REGA 1TXFA 5L9OA 2DWJA 3DELB 2QJEA 3HSTA 4PE5B 3K1NA 1NV3A 4LQ5A 5I2KA 2NUVA 3FXBA 1B7HA 2V3UA 2Q2AA 1CE2A 3FVNA 4IO4A 4AS5A 3T9VA 4OA4A 1IXGA 1ZTYA 4OETA 2Q9TA 2D5WA 2F34A 3CIJA 3K2DA 3SEVA 4E0XA 1ZKBA 1B2HA 1MXZA 2ZXTA 3HHFA 1BKAA 3CI8A 4I3EA 2AL4A 4POWA 2F97A 1IMEA 2YJPA 1INPA 4NF6B 1G0HA 4ESWA 1NUYA 3C9HA 2OWZA 3FXQA 5H8HB 1TFDA 1FPFA 4KQPA 2FYIA 1OLCA 1JW4A 3VDFA 1IMCA 4MF3A 3HN0A 4ELQA 4P56A 1IZ1A 4GF8A 1FTAA 1IXCA 1FW0A 1DPEA 1LAFE 2REJA 4DLDA 1QUJA 4QFLA 3F11A 4OFLA 2B3BA 2Z23A 2B65A 3ZSFA 4H8JA 2XX8A 4LVQA 2XD2A 4KYSA 1FPEA 1URGA 2QS2A 5TP9B 2HAVA 3C31A 3CFXA 2CZLA 3FXUA 1LEVA 2P0SA 5IKBA 3H6WA 2B3FA 4QFNA 2F3BA 4U23A 1POY1 2ZNUA 3TPAA 3K6UA 1B52A 4OFOA 2GQ1A 1IMDA 2CZKA 3RNNA 3KC1A 4G68B 1URSA 1MDQA 4JDFA 1QW0A 3IO4A 3HCQA 3N26A 2YPNA 2YLNA 3PMXA 4QRZA 4ELPA 3LSWA 5AA2B 2ONRA 4QBAA 4PAIA 4O3BA 1P99A 4JB7A 5HPQA 5AA4B 5T3JA 1MQGA 2F35A 3VV5A 3GYYA 3KGCA 4KI0E 4JXIA 1JW5A 3IOTA 3LR1A 3IFCA 2V93A 4F3GA 1FTMA 5KDTB 5DEXB 1K9YA 1SW5A 2D21A 1OVTA 1QVSA 2DE3A 1FPDA 4NF4B 4MX6A 4X9TA 4GRKA 4IY6A 2X7QA 3O9PA 2V3QA 1M5CA 4RPOA 2RKMA 5H8FA 1GV8A 1NV7A 3JYRA 1Y1MA 1EU8A 3QK6A 1LFGA 3C36A 2XXUA 1JEUA 2ZNTA 3TCFA 4QF9A 1FQEA 4G8NA 1L5TA 2RF1A 1RKMA 1PB9A 3BBRA 4NN3A 1SVXB 1MY4A 1NI9A 2FNCA 2XXVA 1QKAA 4M4GA 4N6KA 5IZZA 3K00A 4H0WA 5BWJA 4NMYA
chains in the Genus database with same CATH topology
1NV4A 2ZZXA 2QVRA 5ESYA 4MJOA 4PC9A 5EYHA 1NUXA 4F19A 3KBZA 4HE1A 4P1LA 4LN5A 4GBVA 2CZHA 2VPNA 2WYKA 2KQZA 1FBHA 5EQ8A 2CZIA 2P3NA 3ISPA 4HCYA 3W9WA 4P8BA 4MMPA 2ZZVA 1K9ZA 3FBPA 1FRPA 2XWKA 1CNQA 2QVUA 2PFZA 4MNPA 4NHBA 3U65A 1KA0A 3BIGA 4PGNA 4N81A 1AWBA 4IR8A 3IFAA 4GX6A 4XEQA 1FPJA 2OX3A 2DE4A 2QFLA 2HHMA 4XF5A 4P9KA 4N8YA 3LUZA 3D1RA 2QVVA 2VPOA 4XFEA 4MHFA 4PAFA 4H45A 4PCDA 2Q8MA 4NF0A 3MYUA 4PFIA 2WYPA 2VT5A 1JP4A 4PBHA 5IM2A 4MIJA 4PDDA 1EYJA 4MNCA 5LTCA 1LBZA 4PBQA 4H46A 2HZLA 4PGPA 5IGAA 5CM6A 1LBWA 2PFYA 1FPLA 4UABA 1YYZA 3RYDA 4GBWA 3B50A 2B4MA 5F24A 3ROJA 1LBYA 4HE2A 2FVZA 5IZ3A 3LV0A 4PDHA 4HCWA 2ZZWA 4NX1A 1BK4A 3MSTA 4N8GA 4F1UA 4GX3A 2XA5A 1IMBA 4X8RA 5FBPA 3RPLA 1DCUA 1YXIA 4PFBA 5JK4A 5J1DA 1NV2A 2FIEA 3KC0A 4PAKA 3E79A 3EKIA 4JVDA 4AS4A 2CEYA 2WBBA 5EQ7A 4F1VA 2Q74A 4GWSA 3QMFA 4JVCA 4PETA 4N15A 4PTKA 5ET8A 1QGXA 4NAPA 1NV5A 2DDKA 4DI3D 4OVRA 4GWWA 2V4CA 4X04A 4NG7A 2HZKA 1SPIA 1DK4A 3BIHA 4MNIA 4YICA 2JJKA 2FHYA 4HE0A 1FPKA 2Y5LA 1RDYA 1FBFA 1FBEA 2R8TA 2CEXA 4I3YA 4I40A 2BJIA 1NV3A 2L5VA 4GWXA 2HPGA 3FXBA 5I3SA 4O8MA 4AS5A 4HXVA 4OA4A 1EYKA 5I5PA 2P3VA 2Q9TA 1FBDA 1LBVA 4PF8A 4O7MA 4QXDA 4I3EA 4P3LA 1KZ8A 1IMEA 2XXKA 1IMFA 3B8BA 1INPA 1G0HA 1IMAA 1XI6A 4O7IA 2KR0A 4OVPA 5IZ1A 1NUYA 2OWZA 3SZPA 5A5LA 4YZZA 4N4UA 1FPFA 1YZ0A 4M1VA 2FIXA 1IMCA 1NV1A 4N17A 4GWYA 4P56A 5EYGA 5EQ9A 1FTAA 1RDXA 2MKZA 5ET6A 4GWZA 2WX9A 1LBXA 5I7IA 2XWOA 4MCOA 1FPGA 4PF6A 4MEVA 3HFUA 2WEFA 1FJ9A 5J16A 4OVTA 1FPEA 5ET7A 4GWUA 4PFRA 2PCRA 1LEVA 1DBZA 2HXRA 4N6DA 4KXPA 3CHGA 5ET5A 2F3BA 1NUWA 1KA1A 2F5XA 5DW8A 1FPIA 3PTYA 1NUZA 2GQ1A 1IMDA 2CZKA 3KC1A 1FBCA 4P47A 4QBAA 4DI4B 4PAIA 4NGUA 2Y5KA 1FJ6A 5T3JA 1VDWA 3NOHA 4G61A 4PE3A 3GYYA 4OVQA 1EYIA 4F18A 1FBPA 2XWVA 3IFCA 1RDZA 3T1BA 2WBDA 1K9YA 1G0IA 1NV0A 2DE3A 1FBGA 1FPDA 2B4LA 2QPQA 2DVZA 4MAGA 4MX6A 4X9TA 1FSAA 2DE2A 5LDZA 4OVSA 2V3QA 2XWIA 4P1EA 3E78A 3T0JA 1NV7A 1FPBA 2F3DA 4OANA 1D9QA 1NV6A 3W9VA 4NN3A 4NQ8A 4N91A 1NI9A 5IZ3B 1Q9DA 4N6KA 5IZZA 4GX4A 4JVIA 4O94A 3A29A 2FBPA 3RPLB 4FBPA 5EQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PBQ A;  2ZZX A;  2HZL A;  4PGP A;  5IGA A;  5CM6 A;  4PC9 A;  2PFY A;  2HPG A;  3FXB A;  4P1L A;  4LN5 A;  4UAB A;  4O8M A;  4OA4 A;  4P47 A;  2VPN A;  4DI4 B;  5I5P A;  2WYK A;  4PAI A;  4NGU A;  3B50 A;  4PF8 A;  4O7M A;  4PE3 A;  3GYY A;  4OVQ A;  4P3L A;  4PDH A;  2XWV A;  2ZZW A;  4NX1 A;  4N8G A;  4P8B A;  2XXK A;  4MMP A;  2ZZV A;  2XA5 A;  4X8R A;  4OVP A;  2XWK A;  4PFB A;  4YZZ A;  4NHB A;  2PFZ A;  4MNP A;  3U65 A;  4PAK A;  4N4U A;  4MAG A;  4MX6 A;  4PGN A;  2CEY A;  4N17 A;  4P56 A;  4OVS A;  2XWI A;  4P1E A;  4PET A;  4XEQ A;  4N15 A;  2WX9 A;  4NAP A;  5I7I A;  4OAN A;  2XWO A;  4MCO A;  4XF5 A;  4P9K A;  4N8Y A;  4PF6 A;  4DI3 D;  4MEV A;  4OVR A;  2V4C A;  4X04 A;  2VPO A;  4NG7 A;  4XFE A;  4MHF A;  4NN3 A;  4PAF A;  4NQ8 A;  4OVT A;  4PCD A;  2HZK A;  4N91 A;  4NF0 A;  4PFR A;  4PFI A;  2WYP A;  4PBH A;  5IM2 A;  4MNI A;  4N6K A;  5IZZ A;  4MIJ A;  4PDD A;  4YIC A;  4MNC A;  5LTC A;  4N6D A;  4O94 A;  2CEX A; 
#chains in the Genus database with same CATH topology
 1A8F A;  4DZ1 A;  5ESY A;  4MJO A;  4LQ2 A;  4LN5 A;  4NF5 B;  3W15 C;  1DOT A;  1YCJ A;  2KQZ A;  2I49 A;  3K6X A;  3SES A;  3TOD A;  4H5G A;  2M8C A;  4F39 A;  3FAS A;  3MZB A;  2P3N A;  1VE4 A;  5F7V A;  4IY5 A;  4NTL A;  2O1M A;  1P1O A;  3O97 A;  4MMP A;  3PMW A;  4GFR A;  4RK2 A;  1MRP A;  4LZ8 A;  3JZJ A;  1FRP A;  1IXI A;  4PFW A;  2VOZ A;  4MNP A;  1R9L A;  2XXI A;  1MM7 A;  2OCU A;  3BIG A;  3DP8 A;  3IK6 B;  4NF8 B;  2O7U A;  2G29 A;  4FEC A;  4XEQ A;  1XHY A;  3DP6 A;  2VD2 A;  3V8X B;  4GQO A;  5L9S A;  1O7T A;  1MS7 A;  4FED A;  3G3J A;  1MPD A;  2UYF A;  2VHA A;  2VPO A;  3BFU A;  4BDR A;  4MHF A;  3FUZ A;  1MXY A;  3T22 A;  3MPK A;  2WYP A;  2VT5 A;  1JP4 A;  4PBH A;  5IM2 A;  4BDN A;  2LAO A;  1MXV A;  3LSF B;  3CSB A;  4WED A;  3PD8 A;  1LBZ A;  3RLF E;  2QL3 A;  2ZYK A;  4YAH X;  4IGT A;  1B7U A;  4PGP A;  5CM6 A;  2DQV A;  2Q88 A;  1FPL A;  3UGW A;  2I58 A;  3FGS A;  2DVC A;  4YB7 A;  1UQW A;  1YYZ A;  3RYD A;  4OTE A;  4GBW A;  4H67 A;  1DPP A;  1XOC A;  1TWY A;  4I8C A;  3VFJ A;  3Q29 A;  2THI A;  1LCT A;  3ROJ A;  3MZ9 A;  2UVG A;  4H5F A;  4R2B A;  4HE2 A;  5M2V A;  4MLV A;  5I2N A;  2RCA A;  5BUU A;  5K2X A;  4U1O A;  5H8Q A;  1OLA A;  4X8R A;  3RPL A;  1DCU A;  1JQF A;  3TCG A;  4KD5 A;  1SQY A;  4EQ9 A;  4PAK A;  1RYX A;  4EQB A;  3TEL A;  3Q28 A;  3OEK A;  1NNK A;  3K6V A;  1I6A A;  4PET A;  1LBB A;  3N6T A;  1Z7M E;  2VD3 A;  4RPN A;  2DDK A;  3IOR A;  4OVR A;  5I58 B;  2HXW A;  4X04 A;  3CVG A;  4GXS B;  1UTB B;  2V25 A;  1B5H A;  1DK4 A;  1N7X A;  2JJK A;  2Q89 A;  1LB9 A;  5DYH A;  1FPK A;  3HHG A;  4DDD A;  2R8T A;  4ZEF A;  4Q5T A;  1P1N A;  5ICQ A;  2PYY A;  1B0L A;  1A55 A;  5CMK A;  1CB6 A;  2F7B A;  4YKP A;  5FHM A;  2H4I A;  1SD3 A;  2RC8 A;  2HPG A;  1I6B A;  2XXP A;  3T93 B;  4HXV A;  1DTG A;  1B05 A;  3A09 A;  1EYK A;  2PMS A;  5I5P A;  3ZS6 A;  4FOR A;  4PF8 A;  4AB6 A;  4U4X A;  1LBC A;  3H6U A;  1B4H A;  3MBP A;  1SI1 A;  1M5B A;  4FEB A;  2XXR A;  4DXU A;  3B8B A;  1LGB C;  1XI6 A;  4O7I A;  3LSL A;  1JET A;  1M5E A;  3T96 B;  3SZP A;  5DVI A;  4YZZ A;  4HW8 A;  1R6Z A;  1ZLQ A;  3MJN A;  2AL5 A;  1NV1 A;  4RK9 A;  3H6T A;  1WDN A;  1GGG A;  5EYG A;  4GWO A;  4WKM A;  4F2O A;  1RDX A;  1Q1K A;  2MKZ A;  3H6V A;  3D4G A;  4GWZ A;  1LBX A;  3K1M A;  5I7I A;  3B7D A;  1FPG A;  3SDF A;  4PF6 A;  4UA8 A;  1AH5 A;  2DWA A;  4XTC Q;  2XXT A;  2I6E A;  3IJO B;  3C35 A;  1POT A;  3E3K A;  1FJ9 A;  1VSO A;  3ONM A;  1QUL A;  4C1U A;  4GWU A;  1UTH B;  4IB2 A;  1DBZ A;  1OMP A;  2Z8F A;  4F22 A;  1LAX A;  4KXP A;  5ET5 A;  4R6H A;  1NUW A;  2D3I A;  1KA1 A;  3K6W A;  4R6Y A;  4BLA A;  3PTY A;  2NXO A;  4G4P A;  3CG3 A;  5JEI A;  1D9Y A;  5I56 B;  1SYI A;  4F29 A;  1DTZ A;  4ESX A;  3UK4 A;  2Z22 A;  4NGU A;  1NMU A;  1FJ6 A;  4G8H A;  2F6G A;  1VDW A;  4BDO A;  1FTL A;  1YAE A;  1PC3 A;  2PT1 A;  4ZE8 A;  2GFE A;  2QS3 A;  1EYI A;  2VGQ A;  3PUW E;  4Q0C A;  3TTR A;  3KOT A;  5A5X A;  3MUQ A;  1S9T A;  2H25 A;  1RDZ A;  2WBD A;  2ZYN A;  1G0I A;  2OBG A;  3OO6 A;  1B0H A;  2XXY A;  2O51 A;  2IA4 A;  3KBR A;  3MWB A;  2QPQ A;  1MH3 A;  4MAG A;  1MQI A;  5H8N B;  4BDM A;  3EQ1 A;  1A99 A;  1USY H;  5FTI A;  5CMB A;  1FSA A;  2GHA A;  5L8D A;  1BTJ A;  5LDZ A;  2XWI A;  4ONY A;  3FV1 A;  4P0G A;  4EF1 A;  4TLM B;  1IUD A;  3FVO A;  4N6P A;  4GXA A;  1D9Q A;  4OWD A;  1XVY A;  2DWH A;  1B5I A;  3W9V A;  4R2F A;  1VFD A;  1NL5 A;  1LFI A;  4NF6 A;  3N6U A;  1FQF A;  5K2Y A;  2XXW A;  4JWX A;  2F8D A;  3RQT A;  1LST A;  2F7A A;  3TCH A;  4FBP A;  2PX1 A;  4ZE9 A;  2IEE A;  5EQA A;  1NV4 A;  3N5L A;  3T9U A;  4FE8 A;  2ZZX A;  2QVR A;  3OOA A;  3TAJ A;  1I69 A;  1H43 A;  3THI A;  4OQO A;  3CFZ A;  4GD5 A;  2A5S A;  2I4B A;  3PUY E;  1JVY A;  3TFL A;  3O29 A;  1FBH A;  1AL3 A;  4FAT A;  5ITP A;  2HQ0 A;  3EHT A;  4Z7E A;  3ISP A;  3TZA A;  3W9W A;  2UVH A;  3TYH A;  4G77 A;  2X26 A;  5TP9 A;  1WVJ A;  4KHZ E;  4P8B A;  1K9Z A;  1OVB A;  3FBP A;  1MQH A;  1MQJ A;  1CNQ A;  3EN3 A;  3MC2 A;  3U92 A;  2CMO A;  4G68 A;  4NHB A;  3U65 A;  4PQJ A;  1KA0 A;  2HCA A;  4GL0 A;  4PGN A;  4JSD A;  3PMV A;  5I57 B;  3S4U A;  2FA7 A;  4IR8 A;  3IOV A;  5DVJ A;  5AA2 A;  3ECR A;  1PBP A;  5AA4 A;  3TEP A;  3G3I A;  2HHM A;  4XF5 A;  2PVU A;  4O3C A;  3LUZ A;  1T0K A;  1MQD A;  2H5Y A;  5AA1 A;  4H1X A;  4PAF A;  2O7I A;  4H45 A;  5CMC A;  5KDT A;  5DEX A;  4NF0 A;  4PFI A;  1PEB A;  2RCB A;  1P1W A;  3VLU A;  5KCJ B;  5TPA A;  3KEI A;  5LTC A;  2H99 A;  4DE8 A;  1D3K A;  3HV1 A;  4TOZ A;  4H46 A;  3QIM A;  5B7D A;  1ZU0 A;  3FJ7 A;  4JWO A;  1MXU A;  4JWY A;  4UAB A;  4YB5 A;  2I3W A;  3FJG A;  3OEM A;  1EH3 A;  3USD A;  3G3F A;  1US4 A;  1VFE A;  2XD3 A;  3B50 A;  2XX9 A;  3PPR A;  4N07 A;  1XT8 A;  1JW1 A;  2ONK E;  3LBS A;  3I3V A;  3U8Q A;  1ZJL A;  2FVZ A;  3LV0 A;  4HCW A;  2RC7 A;  1I6Q A;  5FTH A;  2XA5 A;  3OO7 A;  1IMB A;  3KSX A;  3GZG A;  1YXI A;  3OSR A;  2X7P A;  1NV2 A;  3KC0 A;  1QJM A;  1B3G A;  3E79 A;  4NF5 A;  2W7Y A;  4U22 A;  4F1V A;  4F31 B;  2Y7R A;  2R9J A;  1EZO A;  2Y7K A;  1QGX A;  1MDP 1;  4PFY A;  3EHU A;  1OQH A;  4H8I A;  4DI3 D;  4YMB A;  3BFT A;  1N0T A;  1NKX A;  3TMG A;  2HZK A;  1SPI A;  1TT1 A;  2ABH A;  1PB7 A;  4LA9 A;  1J1N A;  3O2A A;  2UYE A;  4U2R A;  4QFO A;  4Z0I A;  1M5D A;  1RDY A;  2F78 A;  3S9N C;  3RT8 A;  3ZKL A;  4NF8 A;  4I3Y A;  4R6K A;  4I40 A;  3B6Q A;  2I48 A;  2HFB A;  4GWX A;  5JTY A;  1MXW A;  5I3S A;  2QSX A;  2RC9 A;  1GR2 A;  4GVO A;  2P3V A;  3MPL A;  1FBD A;  1M5F A;  1F9B A;  1LBV A;  5B70 A;  3MP6 A;  4R74 A;  4X1D A;  2V84 A;  4OER A;  4OXV A;  1KZ8 A;  4DCX A;  2XXK A;  2Z8E A;  1SI0 A;  4NE4 A;  1Y4T A;  3GBB A;  2KR0 A;  3PUX E;  5IZ1 A;  1FQA A;  1B3H A;  4MLQ A;  4UAC A;  2NVU B;  1YZ0 A;  4P11 A;  3LSX A;  1II5 A;  3K0V A;  3TTN A;  4GWY A;  3LUY A;  4JBZ A;  1A40 A;  1AMF A;  4XKN A;  5ET6 A;  4R75 A;  4PFT A;  2XWO A;  4MCO A;  1NNF A;  3ILT B;  4IO5 A;  2DOJ A;  2HEU A;  3HFU A;  2WEF A;  2A5T A;  4OVT A;  3H3G A;  5ET7 A;  4XIG Q;  1R9Q A;  3G3K A;  3K01 A;  2O69 A;  3IL1 B;  3KN8 A;  1HSE A;  2O1L A;  2DS9 A;  3CHG A;  4F3B A;  1R1N A;  1SDX A;  4Q8R A;  2F5X A;  3PV0 E;  5DW8 A;  1FPI A;  5CMM A;  1WOD A;  4EXK A;  2QMW A;  4ZZE A;  3EHS A;  1FBC A;  2ESN A;  3PPP A;  4O3A A;  3PD9 A;  5ICT A;  3PPQ A;  1O64 A;  4KCC A;  4EXL A;  4P47 A;  2ZNS A;  4MBP A;  5L9M A;  3SER A;  1B7Z A;  4G61 A;  1UTB A;  4PE3 A;  4QHQ A;  2UXA A;  4YU0 A;  2XX7 A;  3IOW A;  4OVQ A;  1MXX A;  2XWV A;  2ZYO A;  1MM6 A;  3OO9 A;  2DYX A;  3T1B A;  5ELV A;  3MW0 A;  4RNS A;  3S2V A;  1FBG A;  4OFJ A;  5ITO A;  1HSL A;  1Q35 A;  3B6W A;  4HTG A;  3V89 B;  2OLB A;  3Q27 A;  3MP8 A;  3WAE A;  2DXR A;  2O6A A;  3IR1 A;  4MH5 A;  3OD7 A;  4P1E A;  3GBA A;  3E78 A;  4X1B A;  1TFA A;  3KN7 A;  3DP4 A;  4F2Q A;  3FV2 A;  4LP2 B;  4KPT A;  2F3D A;  4OAN A;  3UOR A;  3MVY A;  3CG1 A;  2QRY A;  3RUM A;  3HPI A;  1NV6 A;  1B58 A;  2ALU A;  3IAZ A;  1H3D A;  5I59 A;  5IZ3 B;  1FTO A;  4GOT A;  3H03 A;  4G68 C;  3UP9 A;  3VE1 B;  3UA8 A;  4GX4 A;  4O94 A;  3A29 A;  2FBP A;  3TQL A;  4EUO A;  3M8U A;  4H65 A;  1B1X A;  3K1P A;  5DTB A;  4HS7 A;  4RY1 A;  4GLI A;  4PC9 A;  5EYH A;  1NUX A;  4F19 A;  3KBZ A;  3IX1 A;  4EF2 A;  3R6U A;  3U93 A;  4GL8 A;  1USY E;  4JSO A;  5HM4 B;  3OEL A;  3ZKK A;  3E4R A;  4PFU A;  1P1U A;  4FAJ A;  1PDA A;  2CZI A;  2Y7I A;  3T9X B;  3M3L A;  4KFQ A;  3SEX A;  1OIB A;  1UTH A;  2WKY A;  2HAU A;  1B3F A;  1SW1 A;  1B9J A;  1XVX A;  3DM0 A;  2XWK A;  4RXL A;  3QSL A;  4YKI A;  3TQW A;  4R72 A;  4U21 A;  2PFZ A;  3QYT A;  4ZDM A;  4IO6 A;  5TU0 A;  2UVJ A;  1SBP A;  5I56 A;  2I3V A;  5ISU A;  4N81 A;  3O6I A;  3KSJ A;  4EQ7 A;  3TTM A;  3P7I A;  5I2K B;  1BIY A;  3FXR A;  2AYS A;  2XXX A;  3MVZ A;  4EDP A;  2OX3 A;  1B4Z A;  1RYO A;  1Y3Q A;  2O84 X;  2UVI A;  4N8Y A;  4P9K A;  3D1R A;  5EYF A;  4ELO A;  1MPC A;  3GXA A;  2BJJ X;  4R9F A;  4PCD A;  1QKB A;  4KYE A;  3MYU A;  3PUV E;  3U72 A;  1B3L A;  3O28 A;  3U94 A;  4IO2 A;  4OMB A;  5FHN A;  1B5J A;  3B6T A;  5H8N A;  1UIV A;  3VXC A;  5IGA A;  5H8S A;  1LBW A;  2E0S A;  1VR5 A;  3H06 B;  4OEU A;  4ISU A;  4R73 A;  5FHO A;  4TQU Q;  1MY2 A;  1P1Q A;  4F1Y A;  4OES A;  5H8H A;  3M3F A;  3E13 X;  5F24 A;  1DSN A;  2ZYM A;  3MP1 A;  5CI5 A;  3IB2 A;  2R71 A;  1LBY A;  4F3P A;  2O68 A;  1N76 A;  4PDH A;  3R7X A;  2ZZW A;  1BK4 A;  3MST A;  4F1U A;  2GH9 A;  2XHD A;  3RTF B;  1B51 A;  1H76 A;  4GX3 A;  5FBP A;  5CRY A;  3FIR A;  4PFB A;  1XS5 A;  3D4C A;  2DXY A;  3VVF A;  4WEP A;  5J1D A;  1A8E A;  1YPN A;  5AA2 D;  1D4N A;  3EKI A;  4JVD A;  4AS4 A;  2WBB A;  4L17 A;  4GWS A;  4JVC A;  2I0B A;  2F7C A;  3A3C A;  5ET8 A;  4PTK A;  1NFT A;  4NAP A;  3KG2 A;  1N04 A;  1NH8 A;  3QXM A;  3T9H B;  2NOO A;  5I84 A;  4I9D A;  4U1Z A;  3L6G A;  3EPE A;  4GWW A;  2V4C A;  3KFM A;  1QUK A;  2OJT A;  4XXU A;  5DT6 A;  3LC8 A;  1LAH E;  4QSC A;  1B1H A;  3KN3 A;  4MNI A;  3KJT A;  4YIC A;  2R6G E;  4HE0 A;  1AOV A;  2Y5L A;  1FBF A;  1FBE A;  2ZMB A;  2CEX A;  2Y84 A;  3MVX A;  1SW2 A;  2NWJ A;  4PP0 A;  3N94 A;  5I57 A;  1B32 A;  3CR9 A;  1LCF A;  2BJI A;  3L6H A;  2L5V A;  2OK2 A;  4ZEK A;  1GVC A;  4R9G A;  1EZ9 A;  4O8M A;  4ZEI A;  1ATG A;  3VVE A;  2G93 A;  4OEV A;  4NF4 A;  5TPA B;  3CFL A;  5H8F B;  1LAG E;  1MY1 A;  2I0C A;  5EHS A;  3S9M C;  4O7M A;  2OWS A;  3ODB A;  4QXD A;  4LON B;  1YTV A;  3HO7 A;  4P3L A;  3JV9 A;  5KCJ A;  5KZT A;  3IJX B;  1IMF A;  3EF7 A;  1IMA A;  4Q30 B;  3PPO A;  4QFP A;  4OVP A;  1BP5 A;  1NNP A;  5A5L A;  3TTK A;  3OMB A;  3UN6 A;  1ZMG A;  3M3K A;  1Y4C A;  4N4U A;  4M1V A;  4YMA A;  2FIX A;  4RA1 A;  3O66 A;  4NWD A;  1KWH A;  3PUZ E;  4N17 A;  2OWT A;  5EQ9 A;  3A3U A;  3IOU A;  2F36 A;  3FJM A;  3H4Z A;  5CBS A;  2WX9 A;  4XKQ A;  3K02 A;  2QS1 A;  1B3E A;  3VLV A;  4MEV A;  2ANJ A;  4LZ5 A;  2GHB A;  4RYA A;  3FZV A;  3I5O A;  1A54 A;  5J16 A;  3FAT A;  4PFR A;  2PCR A;  1EZP A;  3OEN A;  1FQC A;  4ZED A;  3RT6 B;  2HXR A;  1B40 A;  4N6D A;  2VP1 A;  4FIM A;  4TLL B;  4RJZ A;  4AQ4 A;  1NUZ A;  4OYV A;  3TDJ A;  3DLN A;  2P2A A;  2GRV A;  1IXH A;  5EHM A;  3RN8 A;  3VVD A;  3K4U A;  3KJ7 A;  2Y7P A;  1B6H A;  3I6V A;  3V83 A;  4OVJ A;  4DI4 B;  2XXH A;  1S7Y A;  2Y5K A;  2QMX A;  3NOH A;  2PBW A;  3IB1 A;  1Z7N E;  4G8M A;  5LOM A;  4F18 A;  1FBP A;  3RGY A;  1MPB A;  5JTY B;  4FJP A;  1PB8 A;  3TKD A;  1IIT A;  4XKR A;  3U1O A;  1NV0 A;  1BLF A;  1Y1Z A;  3FVG A;  4IO3 A;  5IAI A;  4ZZA A;  2B4L A;  2DSF A;  1D9V A;  4YB6 A;  3MVW A;  2DVZ A;  1HSJ A;  1A7L A;  2ONS A;  3MZ1 A;  3G7W A;  4U4S A;  2DE2 A;  4OVS A;  1LLS A;  1IEJ A;  4LUB A;  4LZ7 A;  4G2Z A;  1ANF A;  4K3F A;  2OZZ A;  3T0J A;  3OSQ A;  1FPB A;  4DXC A;  5DVF A;  4DCY A;  1ZIU A;  1FTJ A;  1IIW A;  3H7M A;  4IGR A;  1N7W A;  3QAX A;  4XKP A;  3SEY A;  4NQ8 A;  4N91 A;  4ND9 A;  3PU5 A;  3IB0 A;  3Q25 A;  4LAT A;  5I2N B;  1Q9D A;  2F6P A;  3SET A;  2Q8J A;  5H8Q B;  3RY3 A;  4YKK A;  4JVI A;  2E1S A;  4ZEB A;  3RPL B;  1H44 A;  3MAM A;  3O6G A;  4E0W A;  4WXJ A;  3TUS A;  4HE1 A;  2XXQ A;  4P1L A;  1UIU A;  2A5T B;  1Y3N A;  4GBV A;  3C33 A;  4OZ9 A;  2CZH A;  4AB5 A;  2VPN A;  2RIN A;  2WYK A;  3BKI B;  5EQ8 A;  4NED A;  4OEN A;  3O6H A;  4HCY A;  3FVK A;  1SYH A;  4QSE A;  1S50 A;  2V3T A;  2H9B A;  4DXB A;  3VLW A;  3C4M A;  2ZZV A;  3SEU A;  3SKP A;  4H6D A;  1MY0 A;  2QVU A;  5I58 A;  4F3S A;  3KOS A;  4IO7 A;  5CC2 A;  1ZBM A;  1Y20 A;  4DIG A;  3IO6 A;  1QUI A;  3G3G A;  1AWB A;  4KYD A;  4OHN A;  1N3X A;  3IFA A;  1NH7 A;  1Y9U A;  4GX6 A;  2DP8 A;  4I62 A;  1MH4 A;  4NWC A;  1FPJ A;  1FQB A;  2DE4 A;  2QFL A;  3FD3 A;  1H45 A;  2Q2C A;  2PT2 A;  2QVV A;  1N3W A;  4XFE A;  3RTW B;  1JVX A;  2Q8M A;  1DMB A;  3OXN A;  4BDL A;  2P1S A;  4BDQ A;  4MIJ A;  4PDD A;  4YKJ A;  1EYJ A;  1ELJ A;  3CSG A;  3ILU B;  3MQ9 A;  4MNC A;  1LFH A;  1SW4 A;  3RPW A;  3S9E A;  4ZEC A;  2H98 A;  4PBQ A;  2HZL A;  4ELR A;  1N84 A;  1FQD A;  2PFY A;  3Q26 A;  3UIF A;  1FCK A;  1PBQ A;  1MG1 A;  4I1D A;  5I59 B;  3QUF A;  3V5A A;  4MFI A;  5HBC A;  4P0I A;  1Y3P A;  2B4M A;  3PPN A;  1LB8 A;  1URD A;  5IZ3 A;  3PGF A;  4C1T A;  4ZS9 A;  4NX1 A;  1GTK A;  4N8G A;  3S9L C;  4QSD A;  1JNF A;  3G3H A;  5AE4 A;  1MY3 A;  4KCD A;  1FTK A;  3SEW A;  3OO8 A;  2QS4 A;  4X48 A;  1NNT A;  5JK4 A;  1AIV A;  3E9X A;  3C32 A;  3WAF A;  5AA3 A;  2FIE A;  3T66 A;  4ECF A;  1US5 A;  2CEY A;  2Y7W A;  5EQ7 A;  3AXF A;  2Q74 A;  3VXB A;  4C0R A;  4QFK A;  3QMF A;  2DWI A;  1XC1 A;  3CRB A;  4N15 A;  2I4C A;  4POX A;  1NV5 A;  1JEV A;  4GIZ A;  2Z8D A;  2KLF A;  3TTL A;  3C34 A;  1B46 A;  1IQ7 A;  4NG7 A;  3KZG A;  1OQG A;  1O63 A;  3QUJ A;  3R26 A;  3BIH A;  4THI A;  5A5X B;  3GLB A;  2FHY A;  4N13 A;  4KR5 A;  5CBR A;  5F1Q A;  2AIX A;  2REG A;  1TXF A;  5L9O A;  2DWJ A;  3DEL B;  2QJE A;  3HST A;  4PE5 B;  3K1N A;  1NV3 A;  4LQ5 A;  5I2K A;  2NUV A;  3FXB A;  1B7H A;  2V3U A;  2Q2A A;  1CE2 A;  3FVN A;  4IO4 A;  4AS5 A;  3T9V A;  4OA4 A;  1IXG A;  1ZTY A;  4OET A;  2Q9T A;  2D5W A;  2F34 A;  3CIJ A;  3K2D A;  3SEV A;  4E0X A;  1ZKB A;  1B2H A;  1MXZ A;  2ZXT A;  3HHF A;  1BKA A;  3CI8 A;  4I3E A;  2AL4 A;  4POW A;  2F97 A;  1IME A;  2YJP A;  1INP A;  4NF6 B;  1G0H A;  4ESW A;  1NUY A;  3C9H A;  2OWZ A;  3FXQ A;  5H8H B;  1TFD A;  1FPF A;  4KQP A;  2FYI A;  1OLC A;  1JW4 A;  3VDF A;  1IMC A;  4MF3 A;  3HN0 A;  4ELQ A;  4P56 A;  1IZ1 A;  4GF8 A;  1FTA A;  1IXC A;  1FW0 A;  1DPE A;  1LAF E;  2REJ A;  4DLD A;  1QUJ A;  4QFL A;  3F11 A;  4OFL A;  2B3B A;  2Z23 A;  2B65 A;  3ZSF A;  4H8J A;  2XX8 A;  4LVQ A;  2XD2 A;  4KYS A;  1FPE A;  1URG A;  2QS2 A;  5TP9 B;  2HAV A;  3C31 A;  3CFX A;  2CZL A;  3FXU A;  1LEV A;  2P0S A;  5IKB A;  3H6W A;  2B3F A;  4QFN A;  2F3B A;  4U23 A;  1POY 1;  2ZNU A;  3TPA A;  3K6U A;  1B52 A;  4OFO A;  2GQ1 A;  1IMD A;  2CZK A;  3RNN A;  3KC1 A;  4G68 B;  1URS A;  1MDQ A;  4JDF A;  1QW0 A;  3IO4 A;  3HCQ A;  3N26 A;  2YPN A;  2YLN A;  3PMX A;  4QRZ A;  4ELP A;  3LSW A;  5AA2 B;  2ONR A;  4QBA A;  4PAI A;  4O3B A;  1P99 A;  4JB7 A;  5HPQ A;  5AA4 B;  5T3J A;  1MQG A;  2F35 A;  3VV5 A;  3GYY A;  3KGC A;  4KI0 E;  4JXI A;  1JW5 A;  3IOT A;  3LR1 A;  3IFC A;  2V93 A;  4F3G A;  1FTM A;  5KDT B;  5DEX B;  1K9Y A;  1SW5 A;  2D21 A;  1OVT A;  1QVS A;  2DE3 A;  1FPD A;  4NF4 B;  4MX6 A;  4X9T A;  4GRK A;  4IY6 A;  2X7Q A;  3O9P A;  2V3Q A;  1M5C A;  4RPO A;  2RKM A;  5H8F A;  1GV8 A;  1NV7 A;  3JYR A;  1Y1M A;  1EU8 A;  3QK6 A;  1LFG A;  3C36 A;  2XXU A;  1JEU A;  2ZNT A;  3TCF A;  4QF9 A;  1FQE A;  4G8N A;  1L5T A;  2RF1 A;  1RKM A;  1PB9 A;  3BBR A;  4NN3 A;  1SVX B;  1MY4 A;  1NI9 A;  2FNC A;  2XXV A;  1QKA A;  4M4G A;  4N6K A;  5IZZ A;  3K00 A;  4H0W A;  5BWJ A;  4NMY A; 
#chains in the Genus database with same CATH homology
 1NV4 A;  2ZZX A;  2QVR A;  5ESY A;  4MJO A;  4PC9 A;  5EYH A;  1NUX A;  4F19 A;  3KBZ A;  4HE1 A;  4P1L A;  4LN5 A;  4GBV A;  2CZH A;  2VPN A;  2WYK A;  2KQZ A;  1FBH A;  5EQ8 A;  2CZI A;  2P3N A;  3ISP A;  4HCY A;  3W9W A;  4P8B A;  4MMP A;  2ZZV A;  1K9Z A;  3FBP A;  1FRP A;  2XWK A;  1CNQ A;  2QVU A;  2PFZ A;  4MNP A;  4NHB A;  3U65 A;  1KA0 A;  3BIG A;  4PGN A;  4N81 A;  1AWB A;  4IR8 A;  3IFA A;  4GX6 A;  4XEQ A;  1FPJ A;  2OX3 A;  2DE4 A;  2QFL A;  2HHM A;  4XF5 A;  4P9K A;  4N8Y A;  3LUZ A;  3D1R A;  2QVV A;  2VPO A;  4XFE A;  4MHF A;  4PAF A;  4H45 A;  4PCD A;  2Q8M A;  4NF0 A;  3MYU A;  4PFI A;  2WYP A;  2VT5 A;  1JP4 A;  4PBH A;  5IM2 A;  4MIJ A;  4PDD A;  1EYJ A;  4MNC A;  5LTC A;  1LBZ A;  4PBQ A;  4H46 A;  2HZL A;  4PGP A;  5IGA A;  5CM6 A;  1LBW A;  2PFY A;  1FPL A;  4UAB A;  1YYZ A;  3RYD A;  4GBW A;  3B50 A;  2B4M A;  5F24 A;  3ROJ A;  1LBY A;  4HE2 A;  2FVZ A;  5IZ3 A;  3LV0 A;  4PDH A;  4HCW A;  2ZZW A;  4NX1 A;  1BK4 A;  3MST A;  4N8G A;  4F1U A;  4GX3 A;  2XA5 A;  1IMB A;  4X8R A;  5FBP A;  3RPL A;  1DCU A;  1YXI A;  4PFB A;  5JK4 A;  5J1D A;  1NV2 A;  2FIE A;  3KC0 A;  4PAK A;  3E79 A;  3EKI A;  4JVD A;  4AS4 A;  2CEY A;  2WBB A;  5EQ7 A;  4F1V A;  2Q74 A;  4GWS A;  3QMF A;  4JVC A;  4PET A;  4N15 A;  4PTK A;  5ET8 A;  1QGX A;  4NAP A;  1NV5 A;  2DDK A;  4DI3 D;  4OVR A;  4GWW A;  2V4C A;  4X04 A;  4NG7 A;  2HZK A;  1SPI A;  1DK4 A;  3BIH A;  4MNI A;  4YIC A;  2JJK A;  2FHY A;  4HE0 A;  1FPK A;  2Y5L A;  1RDY A;  1FBF A;  1FBE A;  2R8T A;  2CEX A;  4I3Y A;  4I40 A;  2BJI A;  1NV3 A;  2L5V A;  4GWX A;  2HPG A;  3FXB A;  5I3S A;  4O8M A;  4AS5 A;  4HXV A;  4OA4 A;  1EYK A;  5I5P A;  2P3V A;  2Q9T A;  1FBD A;  1LBV A;  4PF8 A;  4O7M A;  4QXD A;  4I3E A;  4P3L A;  1KZ8 A;  1IME A;  2XXK A;  1IMF A;  3B8B A;  1INP A;  1G0H A;  1IMA A;  1XI6 A;  4O7I A;  2KR0 A;  4OVP A;  5IZ1 A;  1NUY A;  2OWZ A;  3SZP A;  5A5L A;  4YZZ A;  4N4U A;  1FPF A;  1YZ0 A;  4M1V A;  2FIX A;  1IMC A;  1NV1 A;  4N17 A;  4GWY A;  4P56 A;  5EYG A;  5EQ9 A;  1FTA A;  1RDX A;  2MKZ A;  5ET6 A;  4GWZ A;  2WX9 A;  1LBX A;  5I7I A;  2XWO A;  4MCO A;  1FPG A;  4PF6 A;  4MEV A;  3HFU A;  2WEF A;  1FJ9 A;  5J16 A;  4OVT A;  1FPE A;  5ET7 A;  4GWU A;  4PFR A;  2PCR A;  1LEV A;  1DBZ A;  2HXR A;  4N6D A;  4KXP A;  3CHG A;  5ET5 A;  2F3B A;  1NUW A;  1KA1 A;  2F5X A;  5DW8 A;  1FPI A;  3PTY A;  1NUZ A;  2GQ1 A;  1IMD A;  2CZK A;  3KC1 A;  1FBC A;  4P47 A;  4QBA A;  4DI4 B;  4PAI A;  4NGU A;  2Y5K A;  1FJ6 A;  5T3J A;  1VDW A;  3NOH A;  4G61 A;  4PE3 A;  3GYY A;  4OVQ A;  1EYI A;  4F18 A;  1FBP A;  2XWV A;  3IFC A;  1RDZ A;  3T1B A;  2WBD A;  1K9Y A;  1G0I A;  1NV0 A;  2DE3 A;  1FBG A;  1FPD A;  2B4L A;  2QPQ A;  2DVZ A;  4MAG A;  4MX6 A;  4X9T A;  1FSA A;  2DE2 A;  5LDZ A;  4OVS A;  2V3Q A;  2XWI A;  4P1E A;  3E78 A;  3T0J A;  1NV7 A;  1FPB A;  2F3D A;  4OAN A;  1D9Q A;  1NV6 A;  3W9V A;  4NN3 A;  4NQ8 A;  4N91 A;  1NI9 A;  5IZ3 B;  1Q9D A;  4N6K A;  5IZZ A;  4GX4 A;  4JVI A;  4O94 A;  3A29 A;  2FBP A;  3RPL B;  4FBP A;  5EQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...