4LN5A

Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bamb_6123), target efi-510059, with bound glycerol and chloride ion
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
302
structure length
302
Chain Sequence
b'RVFRSADVHGDSFPTNMAVKFMGDELSKLTGGKDSIKVFGNSALGSEKDTVDQVRIGAIDMARVNGASFNEIVPESLIPSFPFLFRDVDHFRKAMYGPAGQKILDAFAAKGMIALTFYESGARSIYAKRPVRTPADMKGLKVRVQPSDLMVDEIRAMGGTPTPMPFAEVYTGLKTGLVDAAENNLPSYEETKHFEVAPDYSETQHAMTPEVLVFSKKIWDTLSPQEQAAIRKAAADSVPYYQKLWTAREASAQQAVTKGGANILPAAQVDRAAFVKAMQPLWTKYEKTPQMKQIVDEIEATK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Burkholderia ambifaria
molecule tags Transport protein
total genus 117
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ln5A00
4NGUA 3U65A 4MEVA 2VPOA 2WYKA 2CEYA 4NF0A 4PF8A 4PETA 4PFRA 4OVSA 4PC9A 4OVRA 2XXKA 4P3LA 4N6DA 4MNCA 4PBHA 4NG7A 5IZZA 4OANA 4N4UA 4OVQA 5IM2A 4MHFA 3FXBA 4UABA 2CEXA 4XEQA 4YZZA 4PAFA 4PE3A 4N8GA 4XF5A 4MX6A 4PGNA 4P8BA 2HZLA 2WX9A 4O8MA 4OA4A 4P1LA 2XWKA 4PBQA 2V4CA 2XWVA 4X04A 5CM6A 4DI4B 5IGAA 4PCDA 2XA5A 4OVPA 4PF6A 4XFEA 2ZZWA 4O7MA 4MMPA 4PFIA 2PFZA 4PDHA 4MAGA 2HPGA 2ZZVA 2XWIA 4PAIA 4OVTA 4P9KA 4X8RA 4N6KA 4LN5A 4N91A 5LTCA 2ZZXA 4DI3D 4NAPA 3B50A 2XWOA 2VPNA 4MCOA 4NQ8A 4MNIA 4PAKA 4YICA 4O94A 4P47A 2HZKA 4N15A 4N8YA 4MIJA 2PFYA 5I5PA 4P1EA 4P56A 2WYPA 4NHBA 4PGPA 5I7IA 4NX1A 3GYYA 4MNPA 4PDDA 4N17A 4NN3A 4PFBA
chains in the Genus database with same CATH superfamily
2E0SA 2X26A 1M5EA 2O7UA 3JYRA 3TMGA 4IO4A 1B46A 2PVUA 2WYKA 5L9SA 5ET8A 3TYHA 2PT2A 3Q28A 4PETA 2ANJA 4GVOA 2P3VA 1BIYA 4OVRA 3C35A 1UQWA 4P3LA 4N6DA 3A3CA 5H8QA 4GWWA 4EF2A 1FRPA 3W9VA 2PX1A 4G8NA 3FASA 1BKAA 4XEQA 1B51A 4OQOA 1B4ZA 1YYZA 2RC7A 2Y5KA 3LUZA 2FYIA 1QKBA 3MVYA 4H45A 1SW5A 3VXBA 2OCUA 5FHNA 3SDFA 2UVJA 5H8HA 1Z7ME 2B3FA 3TZAA 2ZYMA 1QW0A 3OXNA 4MAGA 1EYKA 3H6WA 1NUYA 1ZU0A 4OVTA 3GBBA 1FW0A 2ZXTA 3DP8A 2RCAA 1QULA 3RQTA 3BIHA 4JXIA 4NAPA 4OHNA 3U93A 5I2NB 3MAMA 2Z23A 2FIXA 2I3WA 3HFUA 4N8YA 4RNSA 4GXAA 4F2QA 3HHFA 4ONYA 3ECRA 2GHBA 4U4XA 1A8EA 3HCQA 1IMBA 1DPPA 1UTHA 2F8DA 1A7LA 1A99A 4G68B 4AB5A 1FBGA 4N81A 3L6GA 4JWYA 4TLMB 3FIRA 3U65A 4NMYA 2HQ0A 4KHZE 4NF4A 5H8QB 3MZBA 4QFOA 1NKXA 1SVXB 2O68A 3EQ1A 4ISUA 1B7ZA 1URGA 2FVZA 4NWCA 1B4HA 3EKIA 5FTHA 4G77A 3MSTA 1RDZA 2P2AA 1MDP1 4Q30B 4GIZA 2UYFA 1DBZA 1AOVA 4XKPA 1EH3A 1MDQA 1N84A 3KBZA 3BKIB 5ITPA 4GWOA 3OOAA 3IFAA 1MXZA 2XWKA 1D9VA 2PT1A 3RT6B 4R2FA 4U23A 5CM6A 4JVDA 3RGYA 2D5WA 4KYEA 1LGBC 4Q5TA 3D4CA 3K4UA 3OO9A 1TFAA 3BBRA 1A40A 4X9TA 3KFMA 3HPIA 4X8RA 2NUVA 1LCTA 2I3VA 3OEMA 4KCDA 3SEYA 2PCRA 2VPNA 2F36A 3CG3A 4YICA 2CZIA 2DWAA 1UTHB 2GFEA 3T1BA 3O97A 1MQDA 1B5IA 4RK2A 1ZBMA 5CMBA 1KA1A 2I4CA 2LAOA 4MBPA 5EQAA 3GYYA 4NF4B 3KN3A 3LSXA 4MNPA 1DMBA 2GRVA 3KSXA 3PPNA 1FPFA 3H06B 4H8IA 4NGUA 5F24A 4MEVA 1JP4A 4DXBA 1FQFA 4DDDA 2VD2A 1MXXA 1OVBA 4GBVA 4ELOA 3T93B 4U4SA 3S9NC 1H44A 2Y7WA 1YCJA 1JW4A 4MNCA 4O3BA 2QVUA 1BK4A 4YB6A 2H5YA 2KQZA 4JWOA 4AS4A 3ILUB 2DXRA 4TOZA 4ZEIA 1OLAA 4QFKA 4GWXA 4ZEFA 1FCKA 4EQ9A 2GHAA 2OBGA 4JWXA 3TKDA 1NV1A 2KR0A 5M2VA 4O7IA 3LSWA 2Y7IA 2WKYA 4OFOA 2YJPA 4PBQA 1AIVA 1IMCA 1DK4A 3EHTA 4WEDA 1B9JA 2QJEA 2F3DA 1SYIA 2QVVA 2OK2A 2Z22A 3KGCA 1IMAA 4N91A 2R71A 3SKPA 3USDA 1URSA 4NQ8A 3SETA 3MZ1A 5CBSA 1IXHA 4I8CA 3K02A 1IMDA 3LR1A 2B4LA 4OXVA 1JEUA 1NUXA 1XI6A 4FEBA 1FBEA 4YKPA 5DVIA 3U1OA 3EHUA 4G8HA 1P1OA 2P0SA 1MPDA 1ZTYA 2CZHA 3GXAA 3OO8A 4C0RA 2O69A 4LUBA 2R9JA 2QS1A 1LCFA 2VP1A 1MG1A 1VDWA 4PBHA 3W9WA 4NG7A 3CIJA 1NI9A 2DP8A 5KCJA 4ZEBA 1Y1ZA 3PD9A 3RPWA 1NNFA 5F7VA 1YAEA 4XF5A 2IEEA 3RTWB 2RF1A 4X04A 5ITOA 3OSQA 3CG1A 2XA5A 3SEVA 3T9XB 2WBDA 3N26A 2B4MA 1MQGA 4M4GA 3TTRA 1PBQA 5I2KA 2HAVA 3CFLA 2V25A 3WAEA 1N04A 3FXRA 3HO7A 3EF7A 4H5GA 3TCFA 2DE3A 3K2DA 4I3EA 2OWTA 4Q0CA 2FHYA 1QKAA 2RKMA 3TEPA 4HXVA 3OO6A 1WVJA 4QFLA 1MXVA 5I58A 4GRKA 2F6PA 1FSAA 3IX1A 2OLBA 3H6VA 2I58A 3SESA 2D3IA 2O7IA 1OQGA 5LDZA 4R74A 3T22A 1IXCA 3F11A 2XD2A 1TXFA 3IOTA 4ELRA 1LBYA 1FTOA 1K9ZA 1G0HA 3PD8A 1MY1A 2QVRA 4RPOA 5JK4A 4GWYA 2WEFA 1D3KA 5KCJB 2HEUA 1PEBA 1HSEA 3K01A 3QXMA 4R9GA 5I57A 3S9EA 1QGXA 1EYIA 4F19A 2GH9A 1DOTA 1MPCA 4DLDA 4N4UA 4OESA 3MVWA 1B5JA 1PDAA 4PAFA 1FBFA 4C1TA 1FTAA 5A5XA 5EQ8A 4I1DA 1D4NA 1LAXA 3PPPA 5CC2A 4P8BA 3K0VA 3E79A 1R9QA 2ONRA 2ZNUA 5I2KB 4OVJA 2UVIA 4QFPA 4IGTA 4Z7EA 1R1NA 1Y4CA 1MY2A 4AB6A 3G3IA 3MP1A 2XX7A 4OETA 1MQIA 3VE1B 2UXAA 3C9HA 2NOOA 4F22A 5I58B 1LBVA 5EQ9A 3QYTA 1J1NA 3T66A 5AA2D 4YB7A 1CB6A 2QSXA 1FPDA 2V3TA 2QL3A 3TCGA 3WAFA 4YB5A 2QMXA 3QAXA 3FZVA 3G3FA 1B1HA 1FQBA 2ABHA 1RYXA 4PDDA 5DYHA 4I40A 2ZMBA 4F39A 1EYJA 1Y3PA 4PFBA 1POTA 3QSLA 4G4PA 3TQWA 5AA4A 3ODBA 3G3KA 1NMUA 3BFUA 3DLNA 3VVDA 5I57B 2DE2A 5I2NA 3T9VA 4LONB 1MRPA 3SEXA 3KOSA 1WDNA 4F3BA 3UORA 4GX4A 1BLFA 3E3KA 3PMVA 1URDA 1MY4A 3TUSA 4OTEA 3O66A 4G68A 3TTNA 1DPEA 3QUFA 4N8GA 4GWZA 4MLQA 2XXWA 2H4IA 1ZIUA 3IB2A 2Z8EA 4U22A 4LP2B 5LOMA 1FQEA 1DSNA 3PPOA 4ZEKA 1FBCA 3EPEA 1MY3A 3FJ7A 1QJMA 2REGA 3TELA 1NV3A 2THIA 2UYEA 4MF3A 2DS9A 4P9KA 3B6WA 3KBRA 2F7CA 2FBPA 1MQJA 3RY3A 5KZTA 1CNQA 3Q27A 4TLLB 2F7BA 1KA0A 1JVYA 1M5CA 1NV7A 1FTLA 1AH5A 1B0HA 1OVTA 4NHBA 3V89B 1MXUA 5I56A 3KZGA 5AA4B 1M5FA 3IFCA 1YZ0A 4C1UA 1KWHA 2XD3A 4G68C 1GTKA 4X1BA 1IUDA 1SYHA 3OENA 3IOUA 4NF5A 4RYAA 3CR9A 4NF0A 1OLCA 5AA1A 3TQLA 1LFHA 3KJTA 1XVXA 5K2XA 2Y7PA 2M8CA 3FGSA 2G93A 1LBBA 4KCCA 1GR2A 3E9XA 4OENA 1SI1A 4QHQA 5HBCA 3SZPA 1I6BA 1SBPA 5H8NA 3DM0A 4MHFA 4UABA 2G29A 3RN8A 5H8FA 3QMFA 4H1XA 4LZ5A 3M3FA 1MPBA 4RJZA 5IAIA 3B7DA 1B3HA 1RYOA 5A5XB 3A09A 2AIXA 3OO7A 3PUXE 3CFZA 3M3KA 4QSCA 4XFEA 1ZKBA 3C33A 1MQHA 5I3SA 3JZJA 4KYDA 3N5LA 3FATA 4QF9A 4N6KA 1I69A 2R6GE 3FV1A 3VLUA 1Y3QA 2B65A 5I56B 1MM7A 1NL5A 4FIMA 4MCOA 2UVHA 4GX3A 4MNIA 4O94A 4RA1A 3E13X 4MIJA 3PPQA 1S9TA 4YAHX 3MQ9A 4ESXA 1B05A 3TAJA 2V84A 3PV0E 4NF5B 2Q8MA 2W7YA 4FECA 1CE2A 4BDNA 1LFIA 1DTZA 1DCUA 4OFLA 3TTKA 1XS5A 4H65A 4K3FA 4ESWA 4UACA 1T0KA 2AL4A 2F3BA 4IY5A 3S9LC 4JVIA 3T0JA 5CMMA 2O84X 4YKJA 1LBZA 1FTJA 5H8NB 3ZS6A 1MXWA 3MZ9A 5H8FB 4R73A 1WODA 2XXUA 4RXLA 1BP5A 2F34A 3ILTB 4PQJA 3IJXB 4R6HA 3O9PA 1EZOA 2X7PA 4XKNA 1LBCA 1N3XA 2XX8A 3IK6B 3KG2A 1FQCA 4ECFA 5ET7A 1PB9A 2HZLA 5KDTA 2A5SA 4GQOA 2V93A 1II5A 3E4RA 4OVPA 3I3VA 2AYSA 3VVFA 1GGGA 3OMBA 4OEUA 4PDHA 1P1QA 3G3JA 3MJNA 3MVXA 2OZZA 3QIMA 4PFTA 2CZLA 3KOTA 1QUKA 4H0WA 2RC9A 4PFWA 1A54A 4U2RA 1FPLA 5DEXA 4N15A 4POWA 3GLBA 1RDXA 3FXUA 5A5LA 1NFTA 3K6UA 3MBPA 1N7XA 5AE4A 4IGRA 4H6DA 5I59B 2FNCA 3RUMA 1LB9A 3R26A 4EQBA 3U8QA 4N6PA 3PMXA 4HCWA 1FBDA 3IO4A 2NXOA 2VGQA 4I62A 5FTIA 2RINA 4JVCA 4GBWA 3TTMA 5JTYA 4F2OA 1RDYA 3CI8A 2P1SA 2XHDA 4N07A 3TFLA 3L6HA 1O64A 4FJPA 4DXUA 1GVCA 3FXQA 4P0IA 4M1VA 4HW8A 1Y9UA 3LUYA 1SW2A 1MH3A 4FBPA 4OVQA 1XT8A 5KDTB 4NWDA 4KD5A 5IM2A 4JSDA 4U1ZA 3PMWA 1R9LA 2DQVA 2O6AA 2F6GA 2E1SA 4IO5A 1JQFA 4PGNA 4EF1A 4OZ9A 1US5A 3FV2A 1KZ8A 4P1LA 2A5TA 1P99A 1QUJA 1OQHA 4JSOA 4ZEDA 2ZYNA 3HHGA 3G3HA 2I49A 1B32A 4FATA 4LZ7A 4O7MA 3QUJA 1K9YA 3LV0A 1HSJA 2V3QA 4FE8A 4G2ZA 5DEXB 1VSOA 4QBAA 3C32A 1GV8A 1Y1MA 4FORA 1IXGA 2HCAA 1POY1 2R8TA 3BIGA 1F9BA 4DXCA 5ESYA 3MC2A 4E0XA 1UTBA 3A3UA 4DE8A 5JTYB 2DE4A 2NVUB 3V5AA 2CZKA 4HE0A 4QSEA 3UK4A 4EXKA 2DSFA 1FJ6A 2PMSA 4PF8A 4XKQA 3DP6A 3D1RA 3SEUA 2DYXA 1O63A 2P3NA 1UIUA 2BJIA 3K6XA 3B6QA 1SI0A 5CBRA 4KYSA 2Q89A 2A5TB 2I0BA 3ONMA 2OJTA 4XTCQ 5B70A 4MX6A 4O8MA 2QS4A 2REJA 1B3EA 3MPKA 5I84A 3S4UA 2DVCA 2QRYA 2ZZWA 4MMPA 4I9DA 1ZJLA 3BFTA 3K6VA 3C31A 1FPIA 4PAIA 4QRZA 4MH5A 4U1OA 4H46A 4H8JA 3TODA 5LTCA 4P0GA 1Q35A 2HAUA 4MFIA 3PU5A 3O6GA 4DIGA 1UTBB 3ZKLA 5DTBA 2L5VA 1VFEA 4NX1A 5AA2A 4NF8B 2QMWA 3V8XB 3U94A 2QPQA 3FBPA 3O6HA 3HV1A 2ALUA 3FVNA 5FBPA 2IA4A 1FPJA 3MPLA 3JV9A 1XHYA 4Z0IA 4HE2A 4AQ4A 2CEYA 4THIA 3O29A 1R6ZA 2NWJA 5CMKA 3PGFA 3LSFB 4EUOA 5F1QA 1I6QA 1IIWA 1Q9DA 5L8DA 2OWSA 2XXXA 4HTGA 4EXLA 1SPIA 1JW5A 2FA7A 4F18A 5CMCA 4OANA 1SQYA 3B6TA 2O51A 5EYGA 1LAGE 3NOHA 4I3YA 4LVQA 2XXPA 2HXWA 3OD7A 4X1DA 3W15C 2XXQA 4GLIA 1L5TA 1A55A 2I0CA 1US4A 1Y4TA 2Z8DA 5IGAA 2PYYA 3RT8A 4IO6A 3KC0A 4R6KA 3TDJA 4U21A 3R6UA 4LATA 3FJGA 4GF8A 3IO6A 1SD3A 4OYVA 5CRYA 4LN5A 5TU0A 2DWJA 5DW8A 2XXRA 3SEWA 1B7UA 5AA2B 4YMAA 2ZYKA 1VE4A 5ET5A 1B6HA 1FQAA 3KN8A 3TPAA 4BDRA 5J16A 4OERA 3PUVE 5L9MA 3IAZA 1S50A 4DZ1A 5EHSA 1AL3A 4F3PA 5ICTA 1EZ9A 4F31B 1MXYA 3MVZA 3OSRA 3D4GA 4XXUA 1B0LA 3K00A 5EYHA 3GZGA 1FBHA 2BJJX 3TTLA 4TQUQ 3N6UA 3H3GA 2RCBA 4GD5A 2YPNA 4H5FA 1EZPA 1Q1KA 1NUWA 1Y20A 3Q29A 3FVKA 4IY6A 1B3GA 2HHMA 4Q8RA 2X7QA 4YZZA 4KFQA 4JBZA 5TP9A 4G8MA 1NH7A 3FVGA 4F1VA 4N13A 1PB7A 2DWHA 3RYDA 4BDQA 2V4CA 1BTJA 3KEIA 5HM4B 1N0TA 1NNKA 4XIGQ 3T96B 1LLSA 1G0IA 3T9UA 4PFIA 4HCYA 4XKRA 4F3GA 2H99A 3OELA 1Y3NA 1PC3A 2Q74A 2XXIA 3AXFA 3UA8A 5BWJA 5K2YA 3LSLA 3DELB 3IR1A 4PAKA 5DT6A 1LAFE 1B5HA 4GFRA 2HFBA 4G61A 3VLWA 3N94A 5IKBA 1VFDA 5L9OA 5TPAA 2YLNA 4ZZEA 4L17A 3E78A 3VXCA 3FVOA 3R7XA 1JNFA 3SERA 4GXSB 1MM6A 1MY0A 1O7TA 2ONKE 4R6YA 3VFJA 3TCHA 2B3BA 1P1NA 3C36A 1N7WA 1PBPA 3VVEA 1ZLQA 4OFJA 3IOVA 3VDFA 4BDMA 1LBWA 4OVSA 4IR8A 5H8HB 2AL5A 1NH8A 4AS5A 2QFLA 5TP9B 1TWYA 3QK6A 4EDPA 3Q25A 5I59A 4WEPA 1NNPA 3IJOB 2XXYA 2Y7RA 4OEVA 4F29A 3I6VA 1ANFA 1IXIA 3UGWA 2HXRA 4ZS9A 3H4ZA 5EYFA 4F3SA 1OMPA 2WX9A 2DXYA 1B3LA 4PCDA 4NEDA 4PF6A 4R72A 3S9MC 4WKMA 1NV2A 3S2VA 2ZYOA 1FTMA 3CHGA 4GWUA 2VT5A 5IZ3A 2F97A 2ONSA 3CSGA 3IOWA 3DP4A 4ZE9A 1IITA 1LBXA 3HN0A 4IO7A 5TPAB 3H7MA 2XWOA 3G3GA 4EQ7A 1UIVA 1D9QA 3ROJA 3MUQA 1XC1A 3MP6A 3PTYA 2F7AA 2GQ1A 1FPEA 1JVXA 1N76A 2PFYA 3FJMA 5I5PA 2H9BA 4P56A 4ELPA 4X48A 4DCXA 5I7IA 4KPTA 3VV5A 2D21A 4KXPA 2F78A 3H6TA 2VD3A 2ESNA 4N17A 4NN3A 4ZDMA 2DOJA 3MW0A 1JW1A 2VPOA 3M8UA 2RC8A 4GX6A 4IO2A 1M5BA 4YU0A 5IZ1A 1P1WA 2VOZA 4O3CA 4ELQA 4QXDA 2Q2CA 4DCYA 1INPA 3MP8A 1LB8A 4OMBA 3OEKA 1IZ1A 5EHMA 3GBAA 1OIBA 3CSBA 2H98A 2WBBA 5CI5A 2O1MA 4KI0E 3RNNA 3VLVA 4PE3A 2I6EA 1B58A 1EU8A 3RPLA 1YTVA 3K6WA 1H43A 4ZECA 3IL1B 2XWVA 5H8SA 4DI4B 4PE5B 5FHOA 5IZ3B 4QFNA 1SDXA 3IB0A 2KLFA 5J1DA 3K1PA 3PPRA 2HPGA 3CFXA 3UN6A 2Y7KA 4MLVA 3UP9A 1JEVA 1RKMA 4DI3D 3IORA 1N3WA 3P7IA 5FHMA 4BLAA 5AA3A 4P47A 1NV4A 2I4BA 5ELVA 1FPBA 3K1NA 2Q9TA 2Z8FA 3I5OA 3IB1A 5DVJA 2WYPA 4PGPA 1SW1A 3CRBA 5JEIA 4O3AA 4PFYA 3C4MA 3PUYE 2MKZA 3KSJA 1XVYA 2QS3A 1QUIA 1P1UA 4GWSA 1FTKA 4BDOA 5EQ7A 1H45A 3C34A 4FEDA 4KR5A 4PC9A 4RY1A 1ELJA 3ZSFA 4ND9A 5ICQA 4ZZAA 1B40A 3MYUA 3UIFA 5IZZA 1S7YA 2DDKA 2DWIA 4QSDA 4R2BA 3KN7A 1D9YA 4NF8A 3RPLB 4PFUA 5BUUA 3RLFE 3ZKKA 1FPGA 1NV0A 4YKKA 1MH4A 2V3UA 1XOCA 1B2HA 1YXIA 3B8BA 5DVFA 4OA4A 4YMBA 5ISUA 5B7DA 3CVGA 1IEJA 3U72A 3LC8A 3FUZA 4YKIA 4NF6A 3KJ7A 3LBSA 2ZZVA 4FAJA 4P11A 2Y84A 2DVZA 3Q26A 3G7WA 4GOTA 2XXHA 3B50A 4LQ2A 2F35A 4HS7A 2H25A 2ZNTA 1USYH 4BDLA 4HE1A 1NV5A 1FJ9A 1B3FA 1MS7A 4P1EA 2F5XA 4RK9A 3T9HB 3EHSA 1B1XA 3O2AA 4RPNA 2I48A 1B52A 1IMFA 4LA9A 2O1LA 3PUWE 4LZ8A 2OWZA 4GL0A 2ZNSA 1ZMGA 1FQDA 1NUZA 1B7HA 1AWBA 4OWDA 4PFRA 4NE4A 2XXKA 1TFDA 3ISPA 3O6IA 1Z7NE 1HSLA 3PUZE 4KQPA 2Q8JA 1I6AA 1IMEA 2FIEA 2Y5LA 3FD3A 4R75A 1LAHE 1LFGA 1FPKA 1QVSA 3FXBA 2CEXA 4IB2A 1DTGA 2CMOA 2Q88A 2QS2A 1SW4A 3H6UA 1AMFA 5ET6A 2UVGA 1TT1A 3A29A 1LSTA 4NTLA 3THIA 4NF6B 4MJOA 1JETA 4UA8A 4WXJA 4ZE8A 3O28A 2JJKA 2PFZA 2OX3A 3KC1A 4PTKA 4E0WA 1NNTA 2VHAA 2XX9A 3MWBA 1IQ7A 4JB7A 3U92A 1NV6A 3M3LA 2XWIA 2XXVA 4LQ5A 2ZZXA 1YPNA 4PP0A 3EN3A 4GL8A 2XXTA 1H3DA 3H03A 2Q2AA 4POXA 5HPQA 4IO3A 2HZKA 1LEVA 1PB8A 1A8FA 3HSTA 1H76A 4F1UA 4R9FA 5T3JA 4F1YA 1ATGA 3V83A 3RTFB 1VR5A 1USYE 1M5DA 4H67A 3N6TA 3K1MA 2PBWA 1FBPA 4JDFA
chains in the Genus database with same CATH topology
4HCWA 1FBDA 2WYKA 4JVCA 1LBYA 5ET8A 4GBWA 1K9ZA 1G0HA 1RDYA 4PETA 1LBWA 4OVSA 2QVRA 4IR8A 2P3VA 5JK4A 4OVRA 4GWYA 2WEFA 4P3LA 4N6DA 4GWWA 1QGXA 4AS5A 1EYIA 4M1VA 4F19A 2QFLA 1FRPA 3W9VA 4N4UA 4FBPA 4OVQA 5IM2A 4XEQA 4PAFA 1FBFA 1FTAA 1YYZA 5EQ8A 2HXRA 2Y5KA 3LUZA 4PGNA 4P8BA 2WX9A 4H45A 3E79A 1KZ8A 4P1LA 4PCDA 4PF6A 4O7MA 1NV2A 4MAGA 1K9YA 1EYKA 3CHGA 4GWUA 1NUYA 2VT5A 5IZ3A 3LV0A 4OVTA 2V3QA 1LBXA 4QBAA 1LBVA 5EQ9A 3BIHA 4NAPA 2XWOA 1D9QA 3ROJA 2FIXA 1FPDA 3HFUA 3PTYA 4N8YA 2GQ1A 2R8TA 1FPEA 2PFYA 5I5PA 3BIGA 4P56A 5I7IA 5ESYA 1IMBA 4KXPA 4PDDA 4N17A 4I40A 1FBGA 4N81A 2DE4A 4NN3A 1EYJA 4PFBA 2CZKA 4HE0A 3U65A 2VPOA 1FJ6A 4GX6A 5IZ1A 2DE2A 4PF8A 4QXDA 2FVZA 3D1RA 1INPA 3EKIA 4GX4A 3MSTA 2P3NA 2BJIA 1RDZA 2WBBA 1DBZA 4PE3A 4N8GA 4GWZA 4MX6A 3RPLA 3KBZA 4O8MA 3IFAA 2XWKA 2XWVA 5CM6A 4DI4B 4JVDA 5IZ3B 2ZZWA 4MMPA 1FBCA 5J1DA 2HPGA 1FPIA 1NV3A 4X9TA 4PAIA 4P9KA 4X8RA 2FBPA 4H46A 5LTCA 4DI3D 1CNQA 2PCRA 2VPNA 1KA0A 4YICA 2CZIA 4P47A 1NV7A 1NV4A 1FPBA 3T1BA 2Q9TA 2L5VA 2WYPA 4NHBA 4PGPA 4NX1A 1KA1A 5EQAA 3GYYA 4MNPA 3IFCA 1YZ0A 2QPQA 3FBPA 1FPFA 4NGUA 5F24A 4MEVA 5FBPA 1JP4A 1FPJA 2MKZA 4HE2A 2CEYA 4NF0A 4GWSA 4GBVA 5EQ7A 4PC9A 1Q9DA 4MNCA 2QVUA 3MYUA 1SPIA 1BK4A 4F18A 2KQZA 4AS4A 5IZZA 2DDKA 3SZPA 4OANA 4GWXA 3RPLB 5EYGA 4MHFA 4UABA 3NOHA 4I3YA 1NV1A 1FPGA 1NV0A 3QMFA 2KR0A 1YXIA 3B8BA 4O7IA 4OA4A 4PBQA 1IMCA 1DK4A 5IGAA 4XFEA 5I3SA 3KC0A 2ZZVA 2F3DA 2QVVA 2DVZA 4N6KA 1IMAA 4LN5A 4N91A 5DW8A 3B50A 4MCOA 4NQ8A 4GX3A 4MNIA 4O94A 4HE1A 5ET5A 1NV5A 1FJ9A 4MIJA 4P1EA 2F5XA 1IMDA 2B4LA 1NUXA 1XI6A 5J16A 1FBEA 1IMFA 2Q8MA 1DCUA 2OWZA 2CZHA 1NUZA 5EYHA 1FBHA 1AWBA 4PFRA 2F3BA 4JVIA 3T0JA 2XXKA 3ISPA 1LBZA 1VDWA 4PBHA 3W9WA 4NG7A 1NI9A 1IMEA 2FIEA 1NUWA 2Y5LA 1FPKA 2HHMA 3FXBA 2CEXA 4YZZA 4XF5A 4F1VA 5ET6A 5ET7A 3A29A 2HZLA 3RYDA 4MJOA 4X04A 2V4CA 2XA5A 4OVPA 1G0IA 2WBDA 2JJKA 4PFIA 2PFZA 2OX3A 3KC1A 4HCYA 4PTKA 2B4MA 4PDHA 1NV6A 2XWIA 2Q74A 2ZZXA 2DE3A 4I3EA 2FHYA 4HXVA 4PAKA 1FPLA 2HZKA 4G61A 1LEVA 4N15A 1RDXA 5A5LA 4F1UA 5T3JA 1FSAA 3E78A 5LDZA 1FBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGU A;  3U65 A;  4MEV A;  2VPO A;  2WYK A;  2CEY A;  4NF0 A;  4PF8 A;  4PET A;  4PFR A;  4OVS A;  4PC9 A;  4OVR A;  2XXK A;  4P3L A;  4N6D A;  4MNC A;  4PBH A;  4NG7 A;  5IZZ A;  4OAN A;  4N4U A;  4OVQ A;  5IM2 A;  4MHF A;  3FXB A;  4UAB A;  2CEX A;  4XEQ A;  4YZZ A;  4PAF A;  4PE3 A;  4N8G A;  4XF5 A;  4MX6 A;  4PGN A;  4P8B A;  2HZL A;  2WX9 A;  4O8M A;  4OA4 A;  4P1L A;  2XWK A;  4PBQ A;  2V4C A;  2XWV A;  4X04 A;  5CM6 A;  4DI4 B;  5IGA A;  4PCD A;  2XA5 A;  4OVP A;  4PF6 A;  4XFE A;  2ZZW A;  4O7M A;  4MMP A;  4PFI A;  2PFZ A;  4PDH A;  4MAG A;  2HPG A;  2ZZV A;  2XWI A;  4PAI A;  4OVT A;  4P9K A;  4X8R A;  4N6K A;  4LN5 A;  4N91 A;  5LTC A;  2ZZX A;  4DI3 D;  4NAP A;  3B50 A;  2XWO A;  2VPN A;  4MCO A;  4NQ8 A;  4MNI A;  4PAK A;  4YIC A;  4O94 A;  4P47 A;  2HZK A;  4N15 A;  4N8Y A;  4MIJ A;  2PFY A;  5I5P A;  4P1E A;  4P56 A;  2WYP A;  4NHB A;  4PGP A;  5I7I A;  4NX1 A;  3GYY A;  4MNP A;  4PDD A;  4N17 A;  4NN3 A;  4PFB A; 
#chains in the Genus database with same CATH topology
 2E0S A;  2X26 A;  1M5E A;  2O7U A;  3JYR A;  3TMG A;  4IO4 A;  1B46 A;  2PVU A;  2WYK A;  5L9S A;  5ET8 A;  3TYH A;  2PT2 A;  3Q28 A;  4PET A;  2ANJ A;  4GVO A;  2P3V A;  1BIY A;  4OVR A;  3C35 A;  1UQW A;  4P3L A;  4N6D A;  3A3C A;  5H8Q A;  4GWW A;  4EF2 A;  1FRP A;  3W9V A;  2PX1 A;  4G8N A;  3FAS A;  1BKA A;  4XEQ A;  1B51 A;  4OQO A;  1B4Z A;  1YYZ A;  2RC7 A;  2Y5K A;  3LUZ A;  2FYI A;  1QKB A;  3MVY A;  4H45 A;  1SW5 A;  3VXB A;  2OCU A;  5FHN A;  3SDF A;  2UVJ A;  5H8H A;  1Z7M E;  2B3F A;  3TZA A;  2ZYM A;  1QW0 A;  3OXN A;  4MAG A;  1EYK A;  3H6W A;  1NUY A;  1ZU0 A;  4OVT A;  3GBB A;  1FW0 A;  2ZXT A;  3DP8 A;  2RCA A;  1QUL A;  3RQT A;  3BIH A;  4JXI A;  4NAP A;  4OHN A;  3U93 A;  5I2N B;  3MAM A;  2Z23 A;  2FIX A;  2I3W A;  3HFU A;  4N8Y A;  4RNS A;  4GXA A;  4F2Q A;  3HHF A;  4ONY A;  3ECR A;  2GHB A;  4U4X A;  1A8E A;  3HCQ A;  1IMB A;  1DPP A;  1UTH A;  2F8D A;  1A7L A;  1A99 A;  4G68 B;  4AB5 A;  1FBG A;  4N81 A;  3L6G A;  4JWY A;  4TLM B;  3FIR A;  3U65 A;  4NMY A;  2HQ0 A;  4KHZ E;  4NF4 A;  5H8Q B;  3MZB A;  4QFO A;  1NKX A;  1SVX B;  2O68 A;  3EQ1 A;  4ISU A;  1B7Z A;  1URG A;  2FVZ A;  4NWC A;  1B4H A;  3EKI A;  5FTH A;  4G77 A;  3MST A;  1RDZ A;  2P2A A;  1MDP 1;  4Q30 B;  4GIZ A;  2UYF A;  1DBZ A;  1AOV A;  4XKP A;  1EH3 A;  1MDQ A;  1N84 A;  3KBZ A;  3BKI B;  5ITP A;  4GWO A;  3OOA A;  3IFA A;  1MXZ A;  2XWK A;  1D9V A;  2PT1 A;  3RT6 B;  4R2F A;  4U23 A;  5CM6 A;  4JVD A;  3RGY A;  2D5W A;  4KYE A;  1LGB C;  4Q5T A;  3D4C A;  3K4U A;  3OO9 A;  1TFA A;  3BBR A;  1A40 A;  4X9T A;  3KFM A;  3HPI A;  4X8R A;  2NUV A;  1LCT A;  2I3V A;  3OEM A;  4KCD A;  3SEY A;  2PCR A;  2VPN A;  2F36 A;  3CG3 A;  4YIC A;  2CZI A;  2DWA A;  1UTH B;  2GFE A;  3T1B A;  3O97 A;  1MQD A;  1B5I A;  4RK2 A;  1ZBM A;  5CMB A;  1KA1 A;  2I4C A;  2LAO A;  4MBP A;  5EQA A;  3GYY A;  4NF4 B;  3KN3 A;  3LSX A;  4MNP A;  1DMB A;  2GRV A;  3KSX A;  3PPN A;  1FPF A;  3H06 B;  4H8I A;  4NGU A;  5F24 A;  4MEV A;  1JP4 A;  4DXB A;  1FQF A;  4DDD A;  2VD2 A;  1MXX A;  1OVB A;  4GBV A;  4ELO A;  3T93 B;  4U4S A;  3S9N C;  1H44 A;  2Y7W A;  1YCJ A;  1JW4 A;  4MNC A;  4O3B A;  2QVU A;  1BK4 A;  4YB6 A;  2H5Y A;  2KQZ A;  4JWO A;  4AS4 A;  3ILU B;  2DXR A;  4TOZ A;  4ZEI A;  1OLA A;  4QFK A;  4GWX A;  4ZEF A;  1FCK A;  4EQ9 A;  2GHA A;  2OBG A;  4JWX A;  3TKD A;  1NV1 A;  2KR0 A;  5M2V A;  4O7I A;  3LSW A;  2Y7I A;  2WKY A;  4OFO A;  2YJP A;  4PBQ A;  1AIV A;  1IMC A;  1DK4 A;  3EHT A;  4WED A;  1B9J A;  2QJE A;  2F3D A;  1SYI A;  2QVV A;  2OK2 A;  2Z22 A;  3KGC A;  1IMA A;  4N91 A;  2R71 A;  3SKP A;  3USD A;  1URS A;  4NQ8 A;  3SET A;  3MZ1 A;  5CBS A;  1IXH A;  4I8C A;  3K02 A;  1IMD A;  3LR1 A;  2B4L A;  4OXV A;  1JEU A;  1NUX A;  1XI6 A;  4FEB A;  1FBE A;  4YKP A;  5DVI A;  3U1O A;  3EHU A;  4G8H A;  1P1O A;  2P0S A;  1MPD A;  1ZTY A;  2CZH A;  3GXA A;  3OO8 A;  4C0R A;  2O69 A;  4LUB A;  2R9J A;  2QS1 A;  1LCF A;  2VP1 A;  1MG1 A;  1VDW A;  4PBH A;  3W9W A;  4NG7 A;  3CIJ A;  1NI9 A;  2DP8 A;  5KCJ A;  4ZEB A;  1Y1Z A;  3PD9 A;  3RPW A;  1NNF A;  5F7V A;  1YAE A;  4XF5 A;  2IEE A;  3RTW B;  2RF1 A;  4X04 A;  5ITO A;  3OSQ A;  3CG1 A;  2XA5 A;  3SEV A;  3T9X B;  2WBD A;  3N26 A;  2B4M A;  1MQG A;  4M4G A;  3TTR A;  1PBQ A;  5I2K A;  2HAV A;  3CFL A;  2V25 A;  3WAE A;  1N04 A;  3FXR A;  3HO7 A;  3EF7 A;  4H5G A;  3TCF A;  2DE3 A;  3K2D A;  4I3E A;  2OWT A;  4Q0C A;  2FHY A;  1QKA A;  2RKM A;  3TEP A;  4HXV A;  3OO6 A;  1WVJ A;  4QFL A;  1MXV A;  5I58 A;  4GRK A;  2F6P A;  1FSA A;  3IX1 A;  2OLB A;  3H6V A;  2I58 A;  3SES A;  2D3I A;  2O7I A;  1OQG A;  5LDZ A;  4R74 A;  3T22 A;  1IXC A;  3F11 A;  2XD2 A;  1TXF A;  3IOT A;  4ELR A;  1LBY A;  1FTO A;  1K9Z A;  1G0H A;  3PD8 A;  1MY1 A;  2QVR A;  4RPO A;  5JK4 A;  4GWY A;  2WEF A;  1D3K A;  5KCJ B;  2HEU A;  1PEB A;  1HSE A;  3K01 A;  3QXM A;  4R9G A;  5I57 A;  3S9E A;  1QGX A;  1EYI A;  4F19 A;  2GH9 A;  1DOT A;  1MPC A;  4DLD A;  4N4U A;  4OES A;  3MVW A;  1B5J A;  1PDA A;  4PAF A;  1FBF A;  4C1T A;  1FTA A;  5A5X A;  5EQ8 A;  4I1D A;  1D4N A;  1LAX A;  3PPP A;  5CC2 A;  4P8B A;  3K0V A;  3E79 A;  1R9Q A;  2ONR A;  2ZNU A;  5I2K B;  4OVJ A;  2UVI A;  4QFP A;  4IGT A;  4Z7E A;  1R1N A;  1Y4C A;  1MY2 A;  4AB6 A;  3G3I A;  3MP1 A;  2XX7 A;  4OET A;  1MQI A;  3VE1 B;  2UXA A;  3C9H A;  2NOO A;  4F22 A;  5I58 B;  1LBV A;  5EQ9 A;  3QYT A;  1J1N A;  3T66 A;  5AA2 D;  4YB7 A;  1CB6 A;  2QSX A;  1FPD A;  2V3T A;  2QL3 A;  3TCG A;  3WAF A;  4YB5 A;  2QMX A;  3QAX A;  3FZV A;  3G3F A;  1B1H A;  1FQB A;  2ABH A;  1RYX A;  4PDD A;  5DYH A;  4I40 A;  2ZMB A;  4F39 A;  1EYJ A;  1Y3P A;  4PFB A;  1POT A;  3QSL A;  4G4P A;  3TQW A;  5AA4 A;  3ODB A;  3G3K A;  1NMU A;  3BFU A;  3DLN A;  3VVD A;  5I57 B;  2DE2 A;  5I2N A;  3T9V A;  4LON B;  1MRP A;  3SEX A;  3KOS A;  1WDN A;  4F3B A;  3UOR A;  4GX4 A;  1BLF A;  3E3K A;  3PMV A;  1URD A;  1MY4 A;  3TUS A;  4OTE A;  3O66 A;  4G68 A;  3TTN A;  1DPE A;  3QUF A;  4N8G A;  4GWZ A;  4MLQ A;  2XXW A;  2H4I A;  1ZIU A;  3IB2 A;  2Z8E A;  4U22 A;  4LP2 B;  5LOM A;  1FQE A;  1DSN A;  3PPO A;  4ZEK A;  1FBC A;  3EPE A;  1MY3 A;  3FJ7 A;  1QJM A;  2REG A;  3TEL A;  1NV3 A;  2THI A;  2UYE A;  4MF3 A;  2DS9 A;  4P9K A;  3B6W A;  3KBR A;  2F7C A;  2FBP A;  1MQJ A;  3RY3 A;  5KZT A;  1CNQ A;  3Q27 A;  4TLL B;  2F7B A;  1KA0 A;  1JVY A;  1M5C A;  1NV7 A;  1FTL A;  1AH5 A;  1B0H A;  1OVT A;  4NHB A;  3V89 B;  1MXU A;  5I56 A;  3KZG A;  5AA4 B;  1M5F A;  3IFC A;  1YZ0 A;  4C1U A;  1KWH A;  2XD3 A;  4G68 C;  1GTK A;  4X1B A;  1IUD A;  1SYH A;  3OEN A;  3IOU A;  4NF5 A;  4RYA A;  3CR9 A;  4NF0 A;  1OLC A;  5AA1 A;  3TQL A;  1LFH A;  3KJT A;  1XVX A;  5K2X A;  2Y7P A;  2M8C A;  3FGS A;  2G93 A;  1LBB A;  4KCC A;  1GR2 A;  3E9X A;  4OEN A;  1SI1 A;  4QHQ A;  5HBC A;  3SZP A;  1I6B A;  1SBP A;  5H8N A;  3DM0 A;  4MHF A;  4UAB A;  2G29 A;  3RN8 A;  5H8F A;  3QMF A;  4H1X A;  4LZ5 A;  3M3F A;  1MPB A;  4RJZ A;  5IAI A;  3B7D A;  1B3H A;  1RYO A;  5A5X B;  3A09 A;  2AIX A;  3OO7 A;  3PUX E;  3CFZ A;  3M3K A;  4QSC A;  4XFE A;  1ZKB A;  3C33 A;  1MQH A;  5I3S A;  3JZJ A;  4KYD A;  3N5L A;  3FAT A;  4QF9 A;  4N6K A;  1I69 A;  2R6G E;  3FV1 A;  3VLU A;  1Y3Q A;  2B65 A;  5I56 B;  1MM7 A;  1NL5 A;  4FIM A;  4MCO A;  2UVH A;  4GX3 A;  4MNI A;  4O94 A;  4RA1 A;  3E13 X;  4MIJ A;  3PPQ A;  1S9T A;  4YAH X;  3MQ9 A;  4ESX A;  1B05 A;  3TAJ A;  2V84 A;  3PV0 E;  4NF5 B;  2Q8M A;  2W7Y A;  4FEC A;  1CE2 A;  4BDN A;  1LFI A;  1DTZ A;  1DCU A;  4OFL A;  3TTK A;  1XS5 A;  4H65 A;  4K3F A;  4ESW A;  4UAC A;  1T0K A;  2AL4 A;  2F3B A;  4IY5 A;  3S9L C;  4JVI A;  3T0J A;  5CMM A;  2O84 X;  4YKJ A;  1LBZ A;  1FTJ A;  5H8N B;  3ZS6 A;  1MXW A;  3MZ9 A;  5H8F B;  4R73 A;  1WOD A;  2XXU A;  4RXL A;  1BP5 A;  2F34 A;  3ILT B;  4PQJ A;  3IJX B;  4R6H A;  3O9P A;  1EZO A;  2X7P A;  4XKN A;  1LBC A;  1N3X A;  2XX8 A;  3IK6 B;  3KG2 A;  1FQC A;  4ECF A;  5ET7 A;  1PB9 A;  2HZL A;  5KDT A;  2A5S A;  4GQO A;  2V93 A;  1II5 A;  3E4R A;  4OVP A;  3I3V A;  2AYS A;  3VVF A;  1GGG A;  3OMB A;  4OEU A;  4PDH A;  1P1Q A;  3G3J A;  3MJN A;  3MVX A;  2OZZ A;  3QIM A;  4PFT A;  2CZL A;  3KOT A;  1QUK A;  4H0W A;  2RC9 A;  4PFW A;  1A54 A;  4U2R A;  1FPL A;  5DEX A;  4N15 A;  4POW A;  3GLB A;  1RDX A;  3FXU A;  5A5L A;  1NFT A;  3K6U A;  3MBP A;  1N7X A;  5AE4 A;  4IGR A;  4H6D A;  5I59 B;  2FNC A;  3RUM A;  1LB9 A;  3R26 A;  4EQB A;  3U8Q A;  4N6P A;  3PMX A;  4HCW A;  1FBD A;  3IO4 A;  2NXO A;  2VGQ A;  4I62 A;  5FTI A;  2RIN A;  4JVC A;  4GBW A;  3TTM A;  5JTY A;  4F2O A;  1RDY A;  3CI8 A;  2P1S A;  2XHD A;  4N07 A;  3TFL A;  3L6H A;  1O64 A;  4FJP A;  4DXU A;  1GVC A;  3FXQ A;  4P0I A;  4M1V A;  4HW8 A;  1Y9U A;  3LUY A;  1SW2 A;  1MH3 A;  4FBP A;  4OVQ A;  1XT8 A;  5KDT B;  4NWD A;  4KD5 A;  5IM2 A;  4JSD A;  4U1Z A;  3PMW A;  1R9L A;  2DQV A;  2O6A A;  2F6G A;  2E1S A;  4IO5 A;  1JQF A;  4PGN A;  4EF1 A;  4OZ9 A;  1US5 A;  3FV2 A;  1KZ8 A;  4P1L A;  2A5T A;  1P99 A;  1QUJ A;  1OQH A;  4JSO A;  4ZED A;  2ZYN A;  3HHG A;  3G3H A;  2I49 A;  1B32 A;  4FAT A;  4LZ7 A;  4O7M A;  3QUJ A;  1K9Y A;  3LV0 A;  1HSJ A;  2V3Q A;  4FE8 A;  4G2Z A;  5DEX B;  1VSO A;  4QBA A;  3C32 A;  1GV8 A;  1Y1M A;  4FOR A;  1IXG A;  2HCA A;  1POY 1;  2R8T A;  3BIG A;  1F9B A;  4DXC A;  5ESY A;  3MC2 A;  4E0X A;  1UTB A;  3A3U A;  4DE8 A;  5JTY B;  2DE4 A;  2NVU B;  3V5A A;  2CZK A;  4HE0 A;  4QSE A;  3UK4 A;  4EXK A;  2DSF A;  1FJ6 A;  2PMS A;  4PF8 A;  4XKQ A;  3DP6 A;  3D1R A;  3SEU A;  2DYX A;  1O63 A;  2P3N A;  1UIU A;  2BJI A;  3K6X A;  3B6Q A;  1SI0 A;  5CBR A;  4KYS A;  2Q89 A;  2A5T B;  2I0B A;  3ONM A;  2OJT A;  4XTC Q;  5B70 A;  4MX6 A;  4O8M A;  2QS4 A;  2REJ A;  1B3E A;  3MPK A;  5I84 A;  3S4U A;  2DVC A;  2QRY A;  2ZZW A;  4MMP A;  4I9D A;  1ZJL A;  3BFT A;  3K6V A;  3C31 A;  1FPI A;  4PAI A;  4QRZ A;  4MH5 A;  4U1O A;  4H46 A;  4H8J A;  3TOD A;  5LTC A;  4P0G A;  1Q35 A;  2HAU A;  4MFI A;  3PU5 A;  3O6G A;  4DIG A;  1UTB B;  3ZKL A;  5DTB A;  2L5V A;  1VFE A;  4NX1 A;  5AA2 A;  4NF8 B;  2QMW A;  3V8X B;  3U94 A;  2QPQ A;  3FBP A;  3O6H A;  3HV1 A;  2ALU A;  3FVN A;  5FBP A;  2IA4 A;  1FPJ A;  3MPL A;  3JV9 A;  1XHY A;  4Z0I A;  4HE2 A;  4AQ4 A;  2CEY A;  4THI A;  3O29 A;  1R6Z A;  2NWJ A;  5CMK A;  3PGF A;  3LSF B;  4EUO A;  5F1Q A;  1I6Q A;  1IIW A;  1Q9D A;  5L8D A;  2OWS A;  2XXX A;  4HTG A;  4EXL A;  1SPI A;  1JW5 A;  2FA7 A;  4F18 A;  5CMC A;  4OAN A;  1SQY A;  3B6T A;  2O51 A;  5EYG A;  1LAG E;  3NOH A;  4I3Y A;  4LVQ A;  2XXP A;  2HXW A;  3OD7 A;  4X1D A;  3W15 C;  2XXQ A;  4GLI A;  1L5T A;  1A55 A;  2I0C A;  1US4 A;  1Y4T A;  2Z8D A;  5IGA A;  2PYY A;  3RT8 A;  4IO6 A;  3KC0 A;  4R6K A;  3TDJ A;  4U21 A;  3R6U A;  4LAT A;  3FJG A;  4GF8 A;  3IO6 A;  1SD3 A;  4OYV A;  5CRY A;  4LN5 A;  5TU0 A;  2DWJ A;  5DW8 A;  2XXR A;  3SEW A;  1B7U A;  5AA2 B;  4YMA A;  2ZYK A;  1VE4 A;  5ET5 A;  1B6H A;  1FQA A;  3KN8 A;  3TPA A;  4BDR A;  5J16 A;  4OER A;  3PUV E;  5L9M A;  3IAZ A;  1S50 A;  4DZ1 A;  5EHS A;  1AL3 A;  4F3P A;  5ICT A;  1EZ9 A;  4F31 B;  1MXY A;  3MVZ A;  3OSR A;  3D4G A;  4XXU A;  1B0L A;  3K00 A;  5EYH A;  3GZG A;  1FBH A;  2BJJ X;  3TTL A;  4TQU Q;  3N6U A;  3H3G A;  2RCB A;  4GD5 A;  2YPN A;  4H5F A;  1EZP A;  1Q1K A;  1NUW A;  1Y20 A;  3Q29 A;  3FVK A;  4IY6 A;  1B3G A;  2HHM A;  4Q8R A;  2X7Q A;  4YZZ A;  4KFQ A;  4JBZ A;  5TP9 A;  4G8M A;  1NH7 A;  3FVG A;  4F1V A;  4N13 A;  1PB7 A;  2DWH A;  3RYD A;  4BDQ A;  2V4C A;  1BTJ A;  3KEI A;  5HM4 B;  1N0T A;  1NNK A;  4XIG Q;  3T96 B;  1LLS A;  1G0I A;  3T9U A;  4PFI A;  4HCY A;  4XKR A;  4F3G A;  2H99 A;  3OEL A;  1Y3N A;  1PC3 A;  2Q74 A;  2XXI A;  3AXF A;  3UA8 A;  5BWJ A;  5K2Y A;  3LSL A;  3DEL B;  3IR1 A;  4PAK A;  5DT6 A;  1LAF E;  1B5H A;  4GFR A;  2HFB A;  4G61 A;  3VLW A;  3N94 A;  5IKB A;  1VFD A;  5L9O A;  5TPA A;  2YLN A;  4ZZE A;  4L17 A;  3E78 A;  3VXC A;  3FVO A;  3R7X A;  1JNF A;  3SER A;  4GXS B;  1MM6 A;  1MY0 A;  1O7T A;  2ONK E;  4R6Y A;  3VFJ A;  3TCH A;  2B3B A;  1P1N A;  3C36 A;  1N7W A;  1PBP A;  3VVE A;  1ZLQ A;  4OFJ A;  3IOV A;  3VDF A;  4BDM A;  1LBW A;  4OVS A;  4IR8 A;  5H8H B;  2AL5 A;  1NH8 A;  4AS5 A;  2QFL A;  5TP9 B;  1TWY A;  3QK6 A;  4EDP A;  3Q25 A;  5I59 A;  4WEP A;  1NNP A;  3IJO B;  2XXY A;  2Y7R A;  4OEV A;  4F29 A;  3I6V A;  1ANF A;  1IXI A;  3UGW A;  2HXR A;  4ZS9 A;  3H4Z A;  5EYF A;  4F3S A;  1OMP A;  2WX9 A;  2DXY A;  1B3L A;  4PCD A;  4NED A;  4PF6 A;  4R72 A;  3S9M C;  4WKM A;  1NV2 A;  3S2V A;  2ZYO A;  1FTM A;  3CHG A;  4GWU A;  2VT5 A;  5IZ3 A;  2F97 A;  2ONS A;  3CSG A;  3IOW A;  3DP4 A;  4ZE9 A;  1IIT A;  1LBX A;  3HN0 A;  4IO7 A;  5TPA B;  3H7M A;  2XWO A;  3G3G A;  4EQ7 A;  1UIV A;  1D9Q A;  3ROJ A;  3MUQ A;  1XC1 A;  3MP6 A;  3PTY A;  2F7A A;  2GQ1 A;  1FPE A;  1JVX A;  1N76 A;  2PFY A;  3FJM A;  5I5P A;  2H9B A;  4P56 A;  4ELP A;  4X48 A;  4DCX A;  5I7I A;  4KPT A;  3VV5 A;  2D21 A;  4KXP A;  2F78 A;  3H6T A;  2VD3 A;  2ESN A;  4N17 A;  4NN3 A;  4ZDM A;  2DOJ A;  3MW0 A;  1JW1 A;  2VPO A;  3M8U A;  2RC8 A;  4GX6 A;  4IO2 A;  1M5B A;  4YU0 A;  5IZ1 A;  1P1W A;  2VOZ A;  4O3C A;  4ELQ A;  4QXD A;  2Q2C A;  4DCY A;  1INP A;  3MP8 A;  1LB8 A;  4OMB A;  3OEK A;  1IZ1 A;  5EHM A;  3GBA A;  1OIB A;  3CSB A;  2H98 A;  2WBB A;  5CI5 A;  2O1M A;  4KI0 E;  3RNN A;  3VLV A;  4PE3 A;  2I6E A;  1B58 A;  1EU8 A;  3RPL A;  1YTV A;  3K6W A;  1H43 A;  4ZEC A;  3IL1 B;  2XWV A;  5H8S A;  4DI4 B;  4PE5 B;  5FHO A;  5IZ3 B;  4QFN A;  1SDX A;  3IB0 A;  2KLF A;  5J1D A;  3K1P A;  3PPR A;  2HPG A;  3CFX A;  3UN6 A;  2Y7K A;  4MLV A;  3UP9 A;  1JEV A;  1RKM A;  4DI3 D;  3IOR A;  1N3W A;  3P7I A;  5FHM A;  4BLA A;  5AA3 A;  4P47 A;  1NV4 A;  2I4B A;  5ELV A;  1FPB A;  3K1N A;  2Q9T A;  2Z8F A;  3I5O A;  3IB1 A;  5DVJ A;  2WYP A;  4PGP A;  1SW1 A;  3CRB A;  5JEI A;  4O3A A;  4PFY A;  3C4M A;  3PUY E;  2MKZ A;  3KSJ A;  1XVY A;  2QS3 A;  1QUI A;  1P1U A;  4GWS A;  1FTK A;  4BDO A;  5EQ7 A;  1H45 A;  3C34 A;  4FED A;  4KR5 A;  4PC9 A;  4RY1 A;  1ELJ A;  3ZSF A;  4ND9 A;  5ICQ A;  4ZZA A;  1B40 A;  3MYU A;  3UIF A;  5IZZ A;  1S7Y A;  2DDK A;  2DWI A;  4QSD A;  4R2B A;  3KN7 A;  1D9Y A;  4NF8 A;  3RPL B;  4PFU A;  5BUU A;  3RLF E;  3ZKK A;  1FPG A;  1NV0 A;  4YKK A;  1MH4 A;  2V3U A;  1XOC A;  1B2H A;  1YXI A;  3B8B A;  5DVF A;  4OA4 A;  4YMB A;  5ISU A;  5B7D A;  3CVG A;  1IEJ A;  3U72 A;  3LC8 A;  3FUZ A;  4YKI A;  4NF6 A;  3KJ7 A;  3LBS A;  2ZZV A;  4FAJ A;  4P11 A;  2Y84 A;  2DVZ A;  3Q26 A;  3G7W A;  4GOT A;  2XXH A;  3B50 A;  4LQ2 A;  2F35 A;  4HS7 A;  2H25 A;  2ZNT A;  1USY H;  4BDL A;  4HE1 A;  1NV5 A;  1FJ9 A;  1B3F A;  1MS7 A;  4P1E A;  2F5X A;  4RK9 A;  3T9H B;  3EHS A;  1B1X A;  3O2A A;  4RPN A;  2I48 A;  1B52 A;  1IMF A;  4LA9 A;  2O1L A;  3PUW E;  4LZ8 A;  2OWZ A;  4GL0 A;  2ZNS A;  1ZMG A;  1FQD A;  1NUZ A;  1B7H A;  1AWB A;  4OWD A;  4PFR A;  4NE4 A;  2XXK A;  1TFD A;  3ISP A;  3O6I A;  1Z7N E;  1HSL A;  3PUZ E;  4KQP A;  2Q8J A;  1I6A A;  1IME A;  2FIE A;  2Y5L A;  3FD3 A;  4R75 A;  1LAH E;  1LFG A;  1FPK A;  1QVS A;  3FXB A;  2CEX A;  4IB2 A;  1DTG A;  2CMO A;  2Q88 A;  2QS2 A;  1SW4 A;  3H6U A;  1AMF A;  5ET6 A;  2UVG A;  1TT1 A;  3A29 A;  1LST A;  4NTL A;  3THI A;  4NF6 B;  4MJO A;  1JET A;  4UA8 A;  4WXJ A;  4ZE8 A;  3O28 A;  2JJK A;  2PFZ A;  2OX3 A;  3KC1 A;  4PTK A;  4E0W A;  1NNT A;  2VHA A;  2XX9 A;  3MWB A;  1IQ7 A;  4JB7 A;  3U92 A;  1NV6 A;  3M3L A;  2XWI A;  2XXV A;  4LQ5 A;  2ZZX A;  1YPN A;  4PP0 A;  3EN3 A;  4GL8 A;  2XXT A;  1H3D A;  3H03 A;  2Q2A A;  4POX A;  5HPQ A;  4IO3 A;  2HZK A;  1LEV A;  1PB8 A;  1A8F A;  3HST A;  1H76 A;  4F1U A;  4R9F A;  5T3J A;  4F1Y A;  1ATG A;  3V83 A;  3RTF B;  1VR5 A;  1USY E;  1M5D A;  4H67 A;  3N6T A;  3K1M A;  2PBW A;  1FBP A;  4JDF A; 
#chains in the Genus database with same CATH homology
 4HCW A;  1FBD A;  2WYK A;  4JVC A;  1LBY A;  5ET8 A;  4GBW A;  1K9Z A;  1G0H A;  1RDY A;  4PET A;  1LBW A;  4OVS A;  2QVR A;  4IR8 A;  2P3V A;  5JK4 A;  4OVR A;  4GWY A;  2WEF A;  4P3L A;  4N6D A;  4GWW A;  1QGX A;  4AS5 A;  1EYI A;  4M1V A;  4F19 A;  2QFL A;  1FRP A;  3W9V A;  4N4U A;  4FBP A;  4OVQ A;  5IM2 A;  4XEQ A;  4PAF A;  1FBF A;  1FTA A;  1YYZ A;  5EQ8 A;  2HXR A;  2Y5K A;  3LUZ A;  4PGN A;  4P8B A;  2WX9 A;  4H45 A;  3E79 A;  1KZ8 A;  4P1L A;  4PCD A;  4PF6 A;  4O7M A;  1NV2 A;  4MAG A;  1K9Y A;  1EYK A;  3CHG A;  4GWU A;  1NUY A;  2VT5 A;  5IZ3 A;  3LV0 A;  4OVT A;  2V3Q A;  1LBX A;  4QBA A;  1LBV A;  5EQ9 A;  3BIH A;  4NAP A;  2XWO A;  1D9Q A;  3ROJ A;  2FIX A;  1FPD A;  3HFU A;  3PTY A;  4N8Y A;  2GQ1 A;  2R8T A;  1FPE A;  2PFY A;  5I5P A;  3BIG A;  4P56 A;  5I7I A;  5ESY A;  1IMB A;  4KXP A;  4PDD A;  4N17 A;  4I40 A;  1FBG A;  4N81 A;  2DE4 A;  4NN3 A;  1EYJ A;  4PFB A;  2CZK A;  4HE0 A;  3U65 A;  2VPO A;  1FJ6 A;  4GX6 A;  5IZ1 A;  2DE2 A;  4PF8 A;  4QXD A;  2FVZ A;  3D1R A;  1INP A;  3EKI A;  4GX4 A;  3MST A;  2P3N A;  2BJI A;  1RDZ A;  2WBB A;  1DBZ A;  4PE3 A;  4N8G A;  4GWZ A;  4MX6 A;  3RPL A;  3KBZ A;  4O8M A;  3IFA A;  2XWK A;  2XWV A;  5CM6 A;  4DI4 B;  4JVD A;  5IZ3 B;  2ZZW A;  4MMP A;  1FBC A;  5J1D A;  2HPG A;  1FPI A;  1NV3 A;  4X9T A;  4PAI A;  4P9K A;  4X8R A;  2FBP A;  4H46 A;  5LTC A;  4DI3 D;  1CNQ A;  2PCR A;  2VPN A;  1KA0 A;  4YIC A;  2CZI A;  4P47 A;  1NV7 A;  1NV4 A;  1FPB A;  3T1B A;  2Q9T A;  2L5V A;  2WYP A;  4NHB A;  4PGP A;  4NX1 A;  1KA1 A;  5EQA A;  3GYY A;  4MNP A;  3IFC A;  1YZ0 A;  2QPQ A;  3FBP A;  1FPF A;  4NGU A;  5F24 A;  4MEV A;  5FBP A;  1JP4 A;  1FPJ A;  2MKZ A;  4HE2 A;  2CEY A;  4NF0 A;  4GWS A;  4GBV A;  5EQ7 A;  4PC9 A;  1Q9D A;  4MNC A;  2QVU A;  3MYU A;  1SPI A;  1BK4 A;  4F18 A;  2KQZ A;  4AS4 A;  5IZZ A;  2DDK A;  3SZP A;  4OAN A;  4GWX A;  3RPL B;  5EYG A;  4MHF A;  4UAB A;  3NOH A;  4I3Y A;  1NV1 A;  1FPG A;  1NV0 A;  3QMF A;  2KR0 A;  1YXI A;  3B8B A;  4O7I A;  4OA4 A;  4PBQ A;  1IMC A;  1DK4 A;  5IGA A;  4XFE A;  5I3S A;  3KC0 A;  2ZZV A;  2F3D A;  2QVV A;  2DVZ A;  4N6K A;  1IMA A;  4LN5 A;  4N91 A;  5DW8 A;  3B50 A;  4MCO A;  4NQ8 A;  4GX3 A;  4MNI A;  4O94 A;  4HE1 A;  5ET5 A;  1NV5 A;  1FJ9 A;  4MIJ A;  4P1E A;  2F5X A;  1IMD A;  2B4L A;  1NUX A;  1XI6 A;  5J16 A;  1FBE A;  1IMF A;  2Q8M A;  1DCU A;  2OWZ A;  2CZH A;  1NUZ A;  5EYH A;  1FBH A;  1AWB A;  4PFR A;  2F3B A;  4JVI A;  3T0J A;  2XXK A;  3ISP A;  1LBZ A;  1VDW A;  4PBH A;  3W9W A;  4NG7 A;  1NI9 A;  1IME A;  2FIE A;  1NUW A;  2Y5L A;  1FPK A;  2HHM A;  3FXB A;  2CEX A;  4YZZ A;  4XF5 A;  4F1V A;  5ET6 A;  5ET7 A;  3A29 A;  2HZL A;  3RYD A;  4MJO A;  4X04 A;  2V4C A;  2XA5 A;  4OVP A;  1G0I A;  2WBD A;  2JJK A;  4PFI A;  2PFZ A;  2OX3 A;  3KC1 A;  4HCY A;  4PTK A;  2B4M A;  4PDH A;  1NV6 A;  2XWI A;  2Q74 A;  2ZZX A;  2DE3 A;  4I3E A;  2FHY A;  4HXV A;  4PAK A;  1FPL A;  2HZK A;  4G61 A;  1LEV A;  4N15 A;  1RDX A;  5A5L A;  4F1U A;  5T3J A;  1FSA A;  3E78 A;  5LDZ A;  1FBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...