4LN5A

Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bamb_6123), target efi-510059, with bound glycerol and chloride ion
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
302
structure length
302
Chain Sequence
RVFRSADVHGDSFPTNMAVKFMGDELSKLTGGKDSIKVFGNSALGSEKDTVDQVRIGAIDMARVNGASFNEIVPESLIPSFPFLFRDVDHFRKAMYGPAGQKILDAFAAKGMIALTFYESGARSIYAKRPVRTPADMKGLKVRVQPSDLMVDEIRAMGGTPTPMPFAEVYTGLKTGLVDAAENNLPSYEETKHFEVAPDYSETQHAMTPEVLVFSKKIWDTLSPQEQAAIRKAAADSVPYYQKLWTAREASAQQAVTKGGANILPAAQVDRAAFVKAMQPLWTKYEKTPQMKQIVDEIEATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Burkholderia ambifaria
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
total genus 117
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ln5A00
4P1LA 4N4UA 2WYKA 4OA4A 4PF8A 2XWKA 4NX1A 4PAIA 4MNPA 4MNCA 4NHBA 4OVRA 4UABA 4X04A 4YZZA 4P56A 2CEYA 4NGUA 4NN3A 2XWOA 4NG7A 5LTCA 4MEVA 4MHFA 2VPNA 4O8MA 4O7MA 4PFRA 4NAPA 4P47A 4YICA 3B50A 3U65A 4PFBA 4N6KA 4P9KA 2HPGA 4OVSA 4PETA 2XA5A 4PDHA 4PF6A 4MNIA 2ZZVA 2XWVA 4N17A 4PE3A 4NQ8A 4PAKA 4N8GA 2PFZA 4OVTA 4O94A 4XEQA 4PC9A 2CEXA 4PBHA 4MIJA 4OANA 4P3LA 4XF5A 4DI3D 4P1EA 2HZKA 4PFIA 3FXBA 5IGAA 5I5PA 4MCOA 4P8BA 2ZZWA 2VPOA 4MX6A 3GYYA 4DI4B 4MMPA 4PAFA 4N91A 4NF0A 4PBQA 5IZZA 5I7IA 4PCDA 4PGNA 4OVQA 5IM2A 2WX9A 2V4CA 2HZLA 4PGPA 4MAGA 4X8RA 2XWIA 4LN5A 2WYPA 2ZZXA 4N8YA 2XXKA 4PDDA 4XFEA 5CM6A 4N15A 4OVPA 2PFYA 4N6DA
chains in the Genus database with same CATH superfamily
1DMBA 4NWDA 3QAXA 3S9NC 4R6HA 4MNPA 3PUVE 4NEDA 1R9QA 4QXDA 1LGBC 2RC9A 1MXUA 1LBYA 3E4RA 4XTCQ 3OO8A 3N6UA 5KDTB 5AA4B 3PMWA 2UVGA 3SEUA 5H8FB 4G77A 1NH7A 3N5LA 5AE4A 3ZS6A 4NAPA 4P47A 2R9JA 1FJ9A 2NVUB 2VGQA 3H06B 3ZKLA 2V3QA 2XA5A 3TPAA 1GGGA 3KJ7A 2YLNA 4M4GA 1B7ZA 3RGYA 3KEIA 4BLAA 2GQ1A 3FV2A 2XWVA 3RQTA 5EQ9A 4NQ8A 3S4UA 1SPIA 3V89B 2PFZA 1SVXB 2OWTA 2XD3A 4HS7A 4G4PA 4X9TA 3MZ9A 5ICQA 1PB9A 1LB8A 4HXVA 3IR1A 3GLBA 4PC9A 3U92A 2CEXA 2QFLA 4DIGA 4O7IA 3CG1A 3MQ9A 3PPQA 4PFTA 1FPJA 1MRPA 3G3FA 1XVXA 1B0LA 4HCWA 3UORA 3GBAA 5I58B 4H8IA 1NUWA 3MP1A 4PGNA 4GWUA 3BKIB 3O66A 3KN3A 3EHTA 3TMGA 3DP4A 2ANJA 5EQ8A 1K9ZA 1QW0A 1AWBA 1TWYA 4GBWA 1JP4A 3K00A 3EHSA 2DWJA 2X7PA 4POXA 1H44A 3Q25A 1PBPA 1D3KA 3A09A 5JTYB 4H5FA 2DWHA 5CRYA 5IZ1A 4C1UA 4DCYA 1DBZA 1P1QA 4P0IA 2B3FA 1VFEA 3SKPA 2GHBA 4F3BA 5ITPA 4G8HA 4FJPA 2QVRA 3D4GA 2VT5A 3FVNA 1BIYA 4Q5TA 1H3DA 1I6AA 2A5TA 4EXKA 2OJTA 3OD7A 4YB6A 2ZZVA 5B7DA 2HCAA 4LZ8A 1B0HA 4O94A 1R6ZA 1MDP1 1GVCA 3ISPA 4ZZAA 4ZEKA 4DI3D 1NL5A 3MSTA 5B70A 3FIRA 3IO6A 2RF1A 5I5PA 3FXUA 3O97A 5CBSA 1IMFA 4PAFA 4DXUA 1CB6A 4HCYA 4MH5A 1OVBA 1MQHA 2DDKA 4EUOA 3W15C 3RTFB 2XWIA 2DVZA 2WYPA 3T0JA 3K6WA 3PMXA 4PDDA 5I2NB 3TELA 1NV1A 2Z8FA 4R72A 4XKPA 4P1LA 4DLDA 3PD8A 1POTA 3GZGA 4OQOA 3IOUA 4GVOA 2VOZA 1RDXA 3H7MA 1LBVA 1B5HA 5AA3A 3SDFA 1D9YA 4GXAA 4F29A 3G7WA 3R7XA 2PT1A 5CMKA 1UTBA 2QS3A 4JSDA 4NWCA 1M5EA 1JEVA 2KR0A 3VDFA 3T1BA 2Q8MA 3LV0A 4TOZA 4PFWA 1USYE 4X1DA 4PDHA 1US4A 4G8NA 1Q1KA 1SW2A 2B3BA 5I3SA 4ZEDA 4THIA 4OEUA 5DVFA 4QSEA 4KCCA 4ND9A 3USDA 1URDA 5ESYA 4EQ9A 3QUJA 1XI6A 1A55A 1AOVA 4OHNA 2Z23A 4MCOA 2ZZWA 1MM7A 1XVYA 1A40A 3G3JA 3IOVA 4GX3A 4Q8RA 4AB5A 3KJTA 1BP5A 1A8EA 3C35A 1IMBA 2E1SA 5J1DA 2O1MA 4Q0CA 1M5FA 3B6WA 5TU0A 3T93B 3I3VA 3H4ZA 4DXCA 4QFOA 1FSAA 1D4NA 2M8CA 4RK2A 1DK4A 1IIWA 1FJ6A 3O28A 3T9HB 4BDQA 3T9VA 2PVUA 2XD2A 3IORA 1F9BA 4NHBA 1FQCA 3K6VA 1MY0A 5DEXB 2XXUA 3TTRA 1Q9DA 2OWZA 4N81A 2DSFA 4R73A 3CG3A 3MBPA 3SEYA 4ONYA 4MLVA 3VFJA 2GFEA 5K2XA 5I59B 4KR5A 1NFTA 1G0HA 2HPGA 2FA7A 2CZIA 2FHYA 4BDLA 5ET6A 3H6TA 4H5GA 1O7TA 4N17A 3O29A 1MM6A 5TPAA 1IMCA 2QL3A 3Q29A 1JQFA 4F39A 1B5IA 3CRBA 2BJIA 2V25A 2W7YA 3EHUA 3K01A 1ELJA 4H8JA 1VSOA 2CZHA 4RPNA 3FXBA 4P8BA 5F24A 4UA8A 1NV7A 2O84X 4IO4A 3OSQA 4LQ2A 2V3TA 3QSLA 1PDAA 5I7IA 5TP9B 4NTLA 2XXQA 5H8HA 4H46A 2HZLA 1JW5A 1IITA 5F7VA 2I58A 3M3KA 3MVWA 4IO7A 4DE8A 3BBRA 1EYJA 3TCGA 4F1VA 2ZZXA 4MBPA 5CBRA 5I84A 3G3IA 2QJEA 3C36A 1FPFA 2RCBA 4JSOA 4N15A 3Q28A 4MFIA 1L5TA 3RT8A 4IY5A 4N4UA 2WYKA 4P0GA 5DW8A 5DVJA 1B3GA 2AIXA 3IJXB 2VHAA 1FRPA 4ZZEA 4R6YA 2G29A 4Z7EA 4EF1A 4X04A 3M3LA 4RA1A 1LAHE 3MUQA 3T66A 2XX9A 4FORA 4H45A 2ZYNA 2H25A 2DE4A 3H6WA 2NWJA 4R9FA 4KQPA 1II5A 1Y9UA 1MQGA 1IXIA 3SEWA 4XKQA 1IXCA 3E3KA 2O51A 4HE0A 1N7XA 3PUYE 4LONB 1HSJA 2QMWA 4QRZA 1OLCA 4YKPA 4OVTA 1LB9A 2LAOA 4IO6A 4EQ7A 2I3WA 3CSBA 2ZMBA 3HPIA 1NV5A 2H99A 2FIEA 5L9OA 4ZS9A 4MX6A 1LBXA 2I0CA 5H8FA 1YPNA 3I6VA 4NF5B 2GHAA 1USYH 2GH9A 1LBCA 2QSXA 3B7DA 2HQ0A 4Q30B 5HBCA 3RPWA 2D3IA 2RCAA 2E0SA 4DCXA 4EF2A 2A5TB 5I56A 5I57A 1MY2A 4KPTA 1TFAA 4ELRA 4F3GA 3UN6A 5ET8A 4OETA 2YPNA 1MXWA 4JXIA 3THIA 3TQLA 1EYIA 4NX1A 2F3BA 1JVXA 3OELA 1LEVA 2F5XA 3K1PA 2I49A 2YJPA 4OVRA 1NV4A 1OVTA 3HCQA 4P56A 3FBPA 4GXSB 2DVCA 1FBPA 3EF7A 1BLFA 3E78A 2OK2A 2Z8DA 3SEVA 1EYKA 4O8MA 1ZLQA 4GL0A 1FCKA 4XKRA 2Q88A 3ONMA 4P9KA 1P1WA 4PETA 2O6AA 5EQ7A 4G68A 3OO9A 1B46A 1NUXA 3TCFA 3M3FA 4WKMA 4DDDA 1DOTA 4PAKA 2WEFA 4U4XA 4R2BA 4F2OA 2HHMA 2CZKA 2AL4A 3FV1A 3GXAA 2RKMA 4R74A 1B1XA 2ONSA 1NMUA 4ZECA 4IO2A 1MQDA 1JNFA 3T9XB 3KGCA 2XX7A 1MS7A 4N13A 1NNFA 3G3KA 3U72A 3H3GA 5EYFA 1EZPA 4BDMA 1UIUA 4JWXA 1ATGA 1IQ7A 4LN5A 4GL8A 2P0SA 3LSLA 4AQ4A 1QUJA 3O6IA 1MXVA 3Q27A 4RY1A 3L6HA 3CFZA 2CZLA 3TODA 3FJMA 3PUXE 3C31A 1FPGA 1RDZA 1ZIUA 1QVSA 3KOSA 4FEDA 4GWYA 1RYXA 3HV1A 3PUWE 2R6GE 2NUVA 1B2HA 3MVZA 1B05A 1JW4A 4NN3A 1SW1A 1S7YA 3RN8A 1JVYA 4O7MA 4KHZE 1DSNA 3SZPA 5CMMA 3K2DA 3CFXA 3FJGA 4KCDA 4X48A 3TAJA 3VVEA 4YKIA 2R71A 4R2FA 1MG1A 3DM0A 5L9MA 3CFLA 1NNKA 3D1RA 2REGA 4GD5A 2RINA 3JZJA 1R1NA 3PD9A 2L5VA 2DYXA 3CR9A 3RT6B 2ZNTA 4OANA 1AL3A 2XXPA 4F3SA 5IGAA 4U22A 3U1OA 1FQBA 5H8SA 3MVYA 4NF4B 3K0VA 3RLFE 4NF0A 3IFCA 1LAFE 2DE3A 1OMPA 3VE1B 4MLQA 1IMDA 2XXWA 1UQWA 1B40A 1ZBMA 2H98A 2AYSA 4X8RA 3UIFA 3TUSA 1LSTA 3S9MC 3BIGA 3DP6A 2F3DA 5CI5A 1NV3A 1HSEA 3LSWA 3TEPA 5EQAA 1SI1A 2XWKA 4R9GA 4LQ5A 3TYHA 2I4CA 4MNCA 1EZOA 2RC8A 2WBDA 4U4SA 5EHMA 5CMCA 1IZ1A 3O2AA 5BUUA 2QS1A 3R26A 2XXTA 2XWOA 3MW0A 2OLBA 3L6GA 3KSJA 1US5A 3CSGA 2ALUA 4JB7A 5IKBA 2UYFA 1RKMA 4H65A 5DYHA 5H8QB 2I0BA 4GLIA 4ELQA 1O63A 3O6HA 4PF6A 4PP0A 2HXRA 2QPQA 4N07A 3NOHA 3QUFA 3O6GA 3JV9A 4NMYA 1AIVA 3U94A 1FTKA 3EPEA 1P1NA 3FGSA 1MY1A 1MY3A 2X26A 5ICTA 3N94A 2F78A 2FYIA 3GYYA 4ELPA 4DI4B 3KBRA 4BDRA 4IO5A 2NXOA 4EXLA 4PCDA 5IM2A 2XXHA 2ONKE 4AB6A 4ZEFA 3FZVA 2XXKA 4YKKA 3A3CA 1K9YA 4H0WA 4GWOA 5DTBA 2JJKA 1NUZA 4ELOA 1XT8A 3OMBA 4Z0IA 1N7WA 4RYAA 1SW4A 2F6GA 3DELB 5A5XB 5AA4A 3PPNA 3OSRA 4QFNA 2H9BA 5J16A 5I56B 3KG2A 2DP8A 4H1XA 2DOJA 5LTCA 5A5XA 3LSFB 3RPLB 2Q8JA 1SDXA 2FVZA 1PB8A 3HFUA 4G8MA 4NF5A 2UYEA 2XXIA 1B58A 1NV2A 1FPDA 3MZ1A 1KA0A 4JWYA 4GWXA 4G2ZA 4N6KA 1D9VA 3H6UA 5IAIA 1FBGA 5LDZA 3V83A 1JEUA 4MNIA 3KSXA 2A5SA 4OERA 2DWAA 3MWBA 2R8TA 2B65A 4OWDA 1PB7A 2Y7WA 3IB0A 5H8NB 4XKNA 3W9VA 4GWWA 1LCTA 5AA2B 1FTOA 3QYTA 1LCFA 2XXYA 3MPKA 4L17A 4FAJA 4YMBA 2O68A 3SETA 1MXZA 4U1ZA 4F2QA 1B4HA 4JDFA 2WX9A 4GQOA 3IX1A 1P1UA 1BKAA 1B3HA 1UIVA 3A29A 1FBEA 3KZGA 3LSXA 3KC0A 1FQEA 3HSTA 3I5OA 2QVVA 1B4ZA 4OFJA 1VFDA 5FHMA 1MXXA 3E13X 1MH4A 1A54A 3SERA 4GWZA 4I3EA 2F97A 3RYDA 2WBBA 3FVGA 3FVOA 2DXRA 4O3CA 2P3NA 5F1QA 3TFLA 4FEBA 4JVDA 1JETA 3MJNA 3MVXA 4QBAA 2OWSA 1EZ9A 3FXRA 4AS4A 4MF3A 1FQFA 4BDOA 3K6XA 2PCRA 1LFIA 1DCUA 1Y1MA 2FNCA 1UTHA 1HSLA 4MEVA 2V3UA 4OEVA 1KZ8A 1NI9A 4E0WA 1H76A 2OCUA 1NUYA 1QJMA 1MXYA 4OVJA 1VDWA 1IEJA 1URGA 2KLFA 2F34A 3LC8A 3N26A 1I69A 5KZTA 1DTZA 4N8GA 1MQJA 4K3FA 4O3AA 1A99A 3PUZE 4MIJA 1B7UA 2ESNA 3C34A 5KCJB 1YAEA 5FTHA 4GX6A 4G68B 5HPQA 2HXWA 1OQHA 2VPOA 1NV6A 3OEKA 1RDYA 3CIJA 5I59A 1ZKBA 2Y7KA 3BFTA 1B3EA 1EH3A 3PPPA 5L8DA 1SQYA 2V4CA 3ZKKA 4I8CA 1YXIA 1XOCA 2RC7A 4U1OA 4U21A 3VXBA 4RNSA 1MDQA 3O9PA 1SD3A 1A8FA 3DP8A 2ABHA 2PFYA 1YYZA 1VE4A 5HM4B 3FATA 3LBSA 4KYDA 5L9SA 4GRKA 3TDJA 5IZ3A 2DXYA 2P2AA 1Z7NE 3ROJA 4OMBA 5K2YA 3HHFA 4HTGA 4H6DA 3KBZA 5ET5A 3IB2A 3VLUA 1G0IA 5FBPA 5DVIA 3T96B 1B3FA 3IB1A 4G61A 1NV0A 1N0TA 3SESA 3E79A 4TLLB 1GR2A 3RY3A 3W9WA 4RPOA 2PT2A 4ZDMA 4H67A 5H8HB 4HE1A 4G68C 4GX4A 2O1LA 2FIXA 3UGWA 4FATA 2P3VA 3FD3A 4KYEA 4GWSA 1MQIA 5A5LA 2HEUA 3LUZA 1N3WA 1SBPA 1FBHA 3TTNA 3C33A 3IOTA 3RNNA 3QIMA 2V84A 4N6PA 3UK4A 4XIGQ 1FBDA 4C1TA 4OVQA 2QRYA 3C9HA 3PV0E 2UVJA 4MJOA 2QS2A 1UTBB 1B1HA 3QXMA 2B4MA 4JWOA 4QSDA 4UACA 3B6TA 2BJJX 5FHNA 3QMFA 2IA4A 2Z8EA 2Y7RA 3T9UA 3OXNA 4E0XA 1Y20A 4LATA 3B8BA 1TFDA 2F8DA 3EKIA 4OVPA 1WVJA 2I48A 4X1BA 3PPOA 4NF8A 4PF8A 3S2VA 1B51A 3UP9A 2PMSA 4F22A 4QFPA 5DEXA 1M5CA 3KFMA 2F7BA 1MPDA 5BWJA 3OENA 4IY6A 1H43A 3ODBA 2Y5LA 1MH3A 1GV8A 3TZAA 1VR5A 1FPLA 1SI0A 3E9XA 4MHFA 4PE5B 3OO6A 1S50A 5TP9A 3LUYA 4IO3A 5I57B 1ZTYA 2B4LA 5ELVA 3ECRA 3K6UA 2NOOA 4YAHX 4OYVA 4RXLA 1YTVA 1YCJA 4OFLA 3HO7A 5TPAB 2O69A 4R6KA 4EQBA 3ILUB 1FTJA 4XF5A 1GTKA 2UXAA 1XS5A 4KD5A 1FTLA 2HZKA 2ZNUA 4OZ9A 3PMVA 2KQZA 1DPPA 1FBCA 3KOTA 1JW1A 1B9JA 5T3JA 4IB2A 2Y5KA 2WKYA 4PGPA 3VLWA 3VVFA 4MAGA 1N04A 3V5AA 4IR8A 4OESA 3U93A 1Z7ME 4LZ7A 3LR1A 4ZEIA 1FQDA 1OQGA 1IMAA 2O7IA 3KN8A 5JTYA 3VV5A 4F31B 1FTAA 3ZSFA 4NF8B 2UVIA 4BDNA 4PTKA 1IXGA 3H6VA 5AA1A 4KFQA 4ECFA 2Q9TA 2HAVA 1PBQA 4EDPA 4LVQA 5IZ3B 1S9TA 1Y4TA 3JYRA 2DWIA 3BIHA 4NG7A 1QKBA 3PTYA 4FBPA 3MPLA 1OLAA 4C0RA 4YMAA 3EQ1A 3R6UA 1FPEA 3FJ7A 3V8XB 4YICA 4I9DA 2Q2AA 1ZMGA 2DS9A 3TKDA 4I62A 4OVSA 1LAXA 5JK4A 4TQUQ 1AMFA 4FE8A 2F6PA 4ZE9A 4O3BA 3DLNA 1KA1A 4ESWA 3QK6A 1NH8A 2I3VA 4XEQA 4POWA 1LFGA 4PFIA 3FXQA 3AXFA 1N84A 5ET7A 1AH5A 4MMPA 1FTMA 2THIA 4JBZA 4LUBA 2QVUA 5EHSA 2Y7IA 3OOAA 4ISUA 2Z22A 4GOTA 4U2RA 2VD2A 4XFEA 2PBWA 3IOWA 3PU5A 2VD3A 1INPA 3CVGA 1FQAA 1IXHA 3K02A 4N6DA 4YB5A 4WXJA 3HN0A 4LA9A 3UA8A 3IL1B 1LBBA 3FASA 3TTKA 2VP1A 3H03A 1TT1A 4JVIA 1QUIA 4PFUA 2VPNA 2Y7PA 1B6HA 3IO4A 4GIZA 2REJA 1N3XA 3TCHA 4F3PA 1BTJA 1FPIA 2ONRA 4YB7A 2H5YA 4FIMA 3B50A 3U65A 4QFLA 3U8QA 4PFYA 5JEIA 4XXUA 4QFKA 4F1YA 3EN3A 2DQVA 4R75A 5EYGA 1B32A 3FVKA 1LBZA 3TTMA 3K1MA 3PGFA 3KN7A 1LFHA 3MYUA 2H4IA 5FHOA 4P3LA 4PQJA 1P1OA 3PPRA 2XXVA 4JVCA 1PC3A 4GBVA 5AA2A 5FTIA 2PYYA 5H8QA 3P7IA 2FBPA 4QHQA 2G93A 2O7UA 2XXXA 1R9LA 4I40A 4N91A 5IZZA 3IAZA 3C4MA 5M2VA 2IEEA 3F11A 1WDNA 3A3UA 4NE4A 1UTHB 2ZXTA 2ZYKA 5ITOA 4M1VA 1XHYA 1MY4A 1P99A 1B5JA 4I3YA 3D4CA 1CNQA 2OX3A 1NNPA 1FW0A 1RYOA 2I4BA 4TLMB 1D9QA 2F7CA 4F1UA 5AA2D 2GRVA 2OBGA 4OA4A 1Y3PA 2OZZA 2QMXA 1TXFA 1DPEA 1QGXA 4GF8A 1Q35A 4IGTA 5EYHA 2MKZA 4UABA 2F35A 3K4UA 2XX8A 3VLVA 4U23A 3CI8A 4PFRA 4NF6B 2CMOA 4HE2A 4FECA 5I2KA 1Y4CA 4IGRA 5I58A 4NF4A 1B3LA 3RUMA 5I2NA 2I6EA 4PFBA 3FUZA 2XXRA 3MC2A 1PEBA 2V93A 1O64A 2UVHA 1Y3QA 1POY1 2Y84A 5H8NA 1SYIA 1KWHA 2ZYOA 4LP2B 1IMEA 2HAUA 4GFRA 3Q26A 3TQWA 1I6BA 1MPBA 1SW5A 3BFUA 4I1DA 3G3GA 3B6QA 5KCJA 1Y1ZA 1OIBA 4KYSA 4YU0A 5DT6A 3S9LC 4YKJA 2Q89A 5I2KB 2X7QA 4NF6A 1J1NA 3M8UA 3RPLA 1QULA 4HW8A 4DZ1A 1H45A 3S9EA 5KDTA 3GBBA 3MP8A 1ZJLA 4RK9A 3WAFA 1IUDA 1QKAA 1LLSA 1M5BA 2Q74A 4KXPA 3IK6B 1N76A 1URSA 5CM6A 4ESXA 1NKXA 3OO7A 1QUKA 2P1SA 1Y3NA 4QF9A 4F18A 3SEXA 1A7LA 3G3HA 4PAIA 3TTLA 3OEMA 1CE2A 3ILTB 2DE2A 1ANFA 1SYHA 4ZEBA 4YZZA 1NNTA 1I6QA 2ZNSA 4OFOA 2CEYA 4NGUA 2AL5A 1DTGA 3HHGA 1B7HA 2PX1A 1XC1A 1EU8A 4ZE8A 3CHGA 1MPCA 4WEDA 1LBWA 1BK4A 4F19A 1WODA 2XHDA 2HFBA 5ISUA 3C32A 1FPKA 3VXCA 4PE3A 2F7AA 4DXBA 5CC2A 1YZ0A 2F36A 2ZYMA 1ZU0A 4WEPA 4PBHA 4RJZA 4AS5A 4P1EA 3IFAA 4P11A 4LZ5A 2D5WA 3K1NA 4OXVA 3WAEA 1FBFA 3MP6A 4PBQA 3RTWB 1T0KA 3MZBA 1M5DA 2Q2CA 4QSCA 3T22A 1B52A 1FPBA 5CMBA 4OTEA 2D21A 4N8YA 5LOMA 2QS4A 4KI0E 3MAMA 1LAGE 4OENA 3KC1A 3VVDA 3N6TA 3IJOB
chains in the Genus database with same CATH topology
1YYZA 4P1LA 4N4UA 2WYKA 5DW8A 4F1UA 4OA4A 4PF8A 1EYIA 2XWKA 4GWZA 4NX1A 2WBBA 4I3EA 3RYDA 4F18A 1FTAA 2F3BA 1FRPA 4PAIA 1FPGA 2P3NA 1QGXA 1LEVA 5IZ1A 4MNPA 4MNCA 2DE2A 1RDZA 2F5XA 2WBDA 5IZ3A 4NHBA 5EYHA 1DBZA 4OVRA 2MKZA 4PTKA 4JVDA 5EQAA 1RDXA 4UABA 4X04A 4YZZA 1NV4A 2Q9TA 5J16A 4GWYA 1LBVA 4QXDA 4QBAA 4P56A 2CEYA 4H45A 3ROJA 3FBPA 4NGUA 4AS4A 5IZ3B 1Q9DA 2OWZA 2Y5LA 1LBYA 4JVIA 1FBPA 2PCRA 4NN3A 4N81A 1DCUA 2DE4A 2XWOA 3BIHA 4NG7A 3E78A 5LTCA 3PTYA 4FBPA 3RPLB 4MEVA 1FPLA 3KBZA 5ET5A 4MHFA 2VPNA 2QVRA 1KZ8A 1EYKA 2FVZA 1G0IA 2VT5A 3HFUA 4O8MA 4O7MA 3CHGA 4PFRA 4HE2A 3SZPA 5FBPA 1NV2A 1FPIA 1FPEA 1FPDA 2KR0A 3T1BA 1KA0A 2Q8MA 4NAPA 4P47A 4YICA 3LV0A 1LBWA 1BK4A 3B50A 3U65A 4HE0A 1NI9A 4PFBA 4F19A 1FJ9A 4G61A 1G0HA 1NV0A 1NUYA 4GWXA 4N6KA 2HPGA 4OVSA 4P9KA 2B4LA 1VDWA 4PETA 3E79A 2CZIA 2FHYA 5EQ7A 2V3QA 2XA5A 5JK4A 4PDHA 5ET6A 1FBGA 4PF6A 3W9WA 5LDZA 2HXRA 2QPQA 3D1RA 1NUXA 1FPKA 5I3SA 4MNIA 2GQ1A 3NOHA 2ZZVA 2XWVA 4N17A 5EQ9A 4PE3A 5EYGA 4NQ8A 4PAKA 1KA1A 1SPIA 2R8TA 2PFZA 1LBZA 4N8GA 1IMCA 4OVTA 1IMEA 2L5VA 2WEFA 4HE1A 4O94A 4X9TA 1YZ0A 4HXVA 2HHMA 2CZKA 4GX4A 2FIXA 3MYUA 4XEQA 4PC9A 2P3VA 2CEXA 3ISPA 2QFLA 4GWSA 4PBHA 5ESYA 4O7IA 2BJIA 4MIJA 3W9VA 1XI6A 4OANA 4P3LA 4GWWA 4XF5A 4AS5A 4DI3D 5A5LA 1NV5A 3LUZA 1FPJA 4GX6A 4JVCA 3MSTA 4P1EA 2CZHA 2HZKA 3IFAA 1FBHA 4GBVA 4PFIA 2FIEA 3FXBA 5I5PA 5IGAA 4MCOA 4P8BA 2ZZWA 2VPOA 1NV6A 1RDYA 1LBXA 3GYYA 4MX6A 5F24A 5ET7A 4HCWA 1NV7A 2FBPA 4DI4B 2KQZA 1FBFA 1FBCA 4GX3A 4MMPA 1IMFA 4I40A 4N91A 4NF0A 4PAFA 1FBDA 2DE3A 1NUWA 3IFCA 4PBQA 5I7IA 5IZZA 4PCDA 2QVUA 4PGNA 4OVQA 5IM2A 5T3JA 4HCYA 1IMBA 4GWUA 2WX9A 4MJOA 1IMDA 2PFYA 2V4CA 2Y5KA 2HZLA 4H46A 4PGPA 3RPLA 5J1DA 2DDKA 1FPBA 4MAGA 2B4MA 4M1VA 4X8RA 3A29A 2XWIA 1FBEA 4LN5A 4IR8A 1EYJA 2DVZA 2WYPA 4F1VA 2ZZXA 1YXIA 4N8YA 3T0JA 2XXKA 5EQ8A 3KC0A 1K9ZA 1K9YA 3QMFA 3BIGA 1AWBA 4I3YA 4PDDA 1FSAA 4GBWA 2F3DA 1JP4A 2QVVA 1CNQA 1NV1A 4XFEA 1DK4A 2OX3A 2Q74A 4KXPA 2JJKA 1FPFA 1NUZA 1NV3A 3B8BA 5CM6A 1FJ6A 3KC1A 3EKIA 4N15A 4OVPA 1INPA 5ET8A 1D9QA 1IMAA 4N6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1L A;  4N4U A;  2WYK A;  4OA4 A;  4PF8 A;  2XWK A;  4NX1 A;  4PAI A;  4MNP A;  4MNC A;  4NHB A;  4OVR A;  4UAB A;  4X04 A;  4YZZ A;  4P56 A;  2CEY A;  4NGU A;  4NN3 A;  2XWO A;  4NG7 A;  5LTC A;  4MEV A;  4MHF A;  2VPN A;  4O8M A;  4O7M A;  4PFR A;  4NAP A;  4P47 A;  4YIC A;  3B50 A;  3U65 A;  4PFB A;  4N6K A;  4P9K A;  2HPG A;  4OVS A;  4PET A;  2XA5 A;  4PDH A;  4PF6 A;  4MNI A;  2ZZV A;  2XWV A;  4N17 A;  4PE3 A;  4NQ8 A;  4PAK A;  4N8G A;  2PFZ A;  4OVT A;  4O94 A;  4XEQ A;  4PC9 A;  2CEX A;  4PBH A;  4MIJ A;  4OAN A;  4P3L A;  4XF5 A;  4DI3 D;  4P1E A;  2HZK A;  4PFI A;  3FXB A;  5IGA A;  5I5P A;  4MCO A;  4P8B A;  2ZZW A;  2VPO A;  4MX6 A;  3GYY A;  4DI4 B;  4MMP A;  4PAF A;  4N91 A;  4NF0 A;  4PBQ A;  5IZZ A;  5I7I A;  4PCD A;  4PGN A;  4OVQ A;  5IM2 A;  2WX9 A;  2V4C A;  2HZL A;  4PGP A;  4MAG A;  4X8R A;  2XWI A;  4LN5 A;  2WYP A;  2ZZX A;  4N8Y A;  2XXK A;  4PDD A;  4XFE A;  5CM6 A;  4N15 A;  4OVP A;  2PFY A;  4N6D A; 
#chains in the Genus database with same CATH topology
 1DMB A;  4NWD A;  3QAX A;  3S9N C;  4R6H A;  4MNP A;  3PUV E;  4NED A;  1R9Q A;  4QXD A;  1LGB C;  2RC9 A;  1MXU A;  1LBY A;  3E4R A;  4XTC Q;  3OO8 A;  3N6U A;  5KDT B;  5AA4 B;  3PMW A;  2UVG A;  3SEU A;  5H8F B;  4G77 A;  1NH7 A;  3N5L A;  5AE4 A;  3ZS6 A;  4NAP A;  4P47 A;  2R9J A;  1FJ9 A;  2NVU B;  2VGQ A;  3H06 B;  3ZKL A;  2V3Q A;  2XA5 A;  3TPA A;  1GGG A;  3KJ7 A;  2YLN A;  4M4G A;  1B7Z A;  3RGY A;  3KEI A;  4BLA A;  2GQ1 A;  3FV2 A;  2XWV A;  3RQT A;  5EQ9 A;  4NQ8 A;  3S4U A;  1SPI A;  3V89 B;  2PFZ A;  1SVX B;  2OWT A;  2XD3 A;  4HS7 A;  4G4P A;  4X9T A;  3MZ9 A;  5ICQ A;  1PB9 A;  1LB8 A;  4HXV A;  3IR1 A;  3GLB A;  4PC9 A;  3U92 A;  2CEX A;  2QFL A;  4DIG A;  4O7I A;  3CG1 A;  3MQ9 A;  3PPQ A;  4PFT A;  1FPJ A;  1MRP A;  3G3F A;  1XVX A;  1B0L A;  4HCW A;  3UOR A;  3GBA A;  5I58 B;  4H8I A;  1NUW A;  3MP1 A;  4PGN A;  4GWU A;  3BKI B;  3O66 A;  3KN3 A;  3EHT A;  3TMG A;  3DP4 A;  2ANJ A;  5EQ8 A;  1K9Z A;  1QW0 A;  1AWB A;  1TWY A;  4GBW A;  1JP4 A;  3K00 A;  3EHS A;  2DWJ A;  2X7P A;  4POX A;  1H44 A;  3Q25 A;  1PBP A;  1D3K A;  3A09 A;  5JTY B;  4H5F A;  2DWH A;  5CRY A;  5IZ1 A;  4C1U A;  4DCY A;  1DBZ A;  1P1Q A;  4P0I A;  2B3F A;  1VFE A;  3SKP A;  2GHB A;  4F3B A;  5ITP A;  4G8H A;  4FJP A;  2QVR A;  3D4G A;  2VT5 A;  3FVN A;  1BIY A;  4Q5T A;  1H3D A;  1I6A A;  2A5T A;  4EXK A;  2OJT A;  3OD7 A;  4YB6 A;  2ZZV A;  5B7D A;  2HCA A;  4LZ8 A;  1B0H A;  4O94 A;  1R6Z A;  1MDP 1;  1GVC A;  3ISP A;  4ZZA A;  4ZEK A;  4DI3 D;  1NL5 A;  3MST A;  5B70 A;  3FIR A;  3IO6 A;  2RF1 A;  5I5P A;  3FXU A;  3O97 A;  5CBS A;  1IMF A;  4PAF A;  4DXU A;  1CB6 A;  4HCY A;  4MH5 A;  1OVB A;  1MQH A;  2DDK A;  4EUO A;  3W15 C;  3RTF B;  2XWI A;  2DVZ A;  2WYP A;  3T0J A;  3K6W A;  3PMX A;  4PDD A;  5I2N B;  3TEL A;  1NV1 A;  2Z8F A;  4R72 A;  4XKP A;  4P1L A;  4DLD A;  3PD8 A;  1POT A;  3GZG A;  4OQO A;  3IOU A;  4GVO A;  2VOZ A;  1RDX A;  3H7M A;  1LBV A;  1B5H A;  5AA3 A;  3SDF A;  1D9Y A;  4GXA A;  4F29 A;  3G7W A;  3R7X A;  2PT1 A;  5CMK A;  1UTB A;  2QS3 A;  4JSD A;  4NWC A;  1M5E A;  1JEV A;  2KR0 A;  3VDF A;  3T1B A;  2Q8M A;  3LV0 A;  4TOZ A;  4PFW A;  1USY E;  4X1D A;  4PDH A;  1US4 A;  4G8N A;  1Q1K A;  1SW2 A;  2B3B A;  5I3S A;  4ZED A;  4THI A;  4OEU A;  5DVF A;  4QSE A;  4KCC A;  4ND9 A;  3USD A;  1URD A;  5ESY A;  4EQ9 A;  3QUJ A;  1XI6 A;  1A55 A;  1AOV A;  4OHN A;  2Z23 A;  4MCO A;  2ZZW A;  1MM7 A;  1XVY A;  1A40 A;  3G3J A;  3IOV A;  4GX3 A;  4Q8R A;  4AB5 A;  3KJT A;  1BP5 A;  1A8E A;  3C35 A;  1IMB A;  2E1S A;  5J1D A;  2O1M A;  4Q0C A;  1M5F A;  3B6W A;  5TU0 A;  3T93 B;  3I3V A;  3H4Z A;  4DXC A;  4QFO A;  1FSA A;  1D4N A;  2M8C A;  4RK2 A;  1DK4 A;  1IIW A;  1FJ6 A;  3O28 A;  3T9H B;  4BDQ A;  3T9V A;  2PVU A;  2XD2 A;  3IOR A;  1F9B A;  4NHB A;  1FQC A;  3K6V A;  1MY0 A;  5DEX B;  2XXU A;  3TTR A;  1Q9D A;  2OWZ A;  4N81 A;  2DSF A;  4R73 A;  3CG3 A;  3MBP A;  3SEY A;  4ONY A;  4MLV A;  3VFJ A;  2GFE A;  5K2X A;  5I59 B;  4KR5 A;  1NFT A;  1G0H A;  2HPG A;  2FA7 A;  2CZI A;  2FHY A;  4BDL A;  5ET6 A;  3H6T A;  4H5G A;  1O7T A;  4N17 A;  3O29 A;  1MM6 A;  5TPA A;  1IMC A;  2QL3 A;  3Q29 A;  1JQF A;  4F39 A;  1B5I A;  3CRB A;  2BJI A;  2V25 A;  2W7Y A;  3EHU A;  3K01 A;  1ELJ A;  4H8J A;  1VSO A;  2CZH A;  4RPN A;  3FXB A;  4P8B A;  5F24 A;  4UA8 A;  1NV7 A;  2O84 X;  4IO4 A;  3OSQ A;  4LQ2 A;  2V3T A;  3QSL A;  1PDA A;  5I7I A;  5TP9 B;  4NTL A;  2XXQ A;  5H8H A;  4H46 A;  2HZL A;  1JW5 A;  1IIT A;  5F7V A;  2I58 A;  3M3K A;  3MVW A;  4IO7 A;  4DE8 A;  3BBR A;  1EYJ A;  3TCG A;  4F1V A;  2ZZX A;  4MBP A;  5CBR A;  5I84 A;  3G3I A;  2QJE A;  3C36 A;  1FPF A;  2RCB A;  4JSO A;  4N15 A;  3Q28 A;  4MFI A;  1L5T A;  3RT8 A;  4IY5 A;  4N4U A;  2WYK A;  4P0G A;  5DW8 A;  5DVJ A;  1B3G A;  2AIX A;  3IJX B;  2VHA A;  1FRP A;  4ZZE A;  4R6Y A;  2G29 A;  4Z7E A;  4EF1 A;  4X04 A;  3M3L A;  4RA1 A;  1LAH E;  3MUQ A;  3T66 A;  2XX9 A;  4FOR A;  4H45 A;  2ZYN A;  2H25 A;  2DE4 A;  3H6W A;  2NWJ A;  4R9F A;  4KQP A;  1II5 A;  1Y9U A;  1MQG A;  1IXI A;  3SEW A;  4XKQ A;  1IXC A;  3E3K A;  2O51 A;  4HE0 A;  1N7X A;  3PUY E;  4LON B;  1HSJ A;  2QMW A;  4QRZ A;  1OLC A;  4YKP A;  4OVT A;  1LB9 A;  2LAO A;  4IO6 A;  4EQ7 A;  2I3W A;  3CSB A;  2ZMB A;  3HPI A;  1NV5 A;  2H99 A;  2FIE A;  5L9O A;  4ZS9 A;  4MX6 A;  1LBX A;  2I0C A;  5H8F A;  1YPN A;  3I6V A;  4NF5 B;  2GHA A;  1USY H;  2GH9 A;  1LBC A;  2QSX A;  3B7D A;  2HQ0 A;  4Q30 B;  5HBC A;  3RPW A;  2D3I A;  2RCA A;  2E0S A;  4DCX A;  4EF2 A;  2A5T B;  5I56 A;  5I57 A;  1MY2 A;  4KPT A;  1TFA A;  4ELR A;  4F3G A;  3UN6 A;  5ET8 A;  4OET A;  2YPN A;  1MXW A;  4JXI A;  3THI A;  3TQL A;  1EYI A;  4NX1 A;  2F3B A;  1JVX A;  3OEL A;  1LEV A;  2F5X A;  3K1P A;  2I49 A;  2YJP A;  4OVR A;  1NV4 A;  1OVT A;  3HCQ A;  4P56 A;  3FBP A;  4GXS B;  2DVC A;  1FBP A;  3EF7 A;  1BLF A;  3E78 A;  2OK2 A;  2Z8D A;  3SEV A;  1EYK A;  4O8M A;  1ZLQ A;  4GL0 A;  1FCK A;  4XKR A;  2Q88 A;  3ONM A;  4P9K A;  1P1W A;  4PET A;  2O6A A;  5EQ7 A;  4G68 A;  3OO9 A;  1B46 A;  1NUX A;  3TCF A;  3M3F A;  4WKM A;  4DDD A;  1DOT A;  4PAK A;  2WEF A;  4U4X A;  4R2B A;  4F2O A;  2HHM A;  2CZK A;  2AL4 A;  3FV1 A;  3GXA A;  2RKM A;  4R74 A;  1B1X A;  2ONS A;  1NMU A;  4ZEC A;  4IO2 A;  1MQD A;  1JNF A;  3T9X B;  3KGC A;  2XX7 A;  1MS7 A;  4N13 A;  1NNF A;  3G3K A;  3U72 A;  3H3G A;  5EYF A;  1EZP A;  4BDM A;  1UIU A;  4JWX A;  1ATG A;  1IQ7 A;  4LN5 A;  4GL8 A;  2P0S A;  3LSL A;  4AQ4 A;  1QUJ A;  3O6I A;  1MXV A;  3Q27 A;  4RY1 A;  3L6H A;  3CFZ A;  2CZL A;  3TOD A;  3FJM A;  3PUX E;  3C31 A;  1FPG A;  1RDZ A;  1ZIU A;  1QVS A;  3KOS A;  4FED A;  4GWY A;  1RYX A;  3HV1 A;  3PUW E;  2R6G E;  2NUV A;  1B2H A;  3MVZ A;  1B05 A;  1JW4 A;  4NN3 A;  1SW1 A;  1S7Y A;  3RN8 A;  1JVY A;  4O7M A;  4KHZ E;  1DSN A;  3SZP A;  5CMM A;  3K2D A;  3CFX A;  3FJG A;  4KCD A;  4X48 A;  3TAJ A;  3VVE A;  4YKI A;  2R71 A;  4R2F A;  1MG1 A;  3DM0 A;  5L9M A;  3CFL A;  1NNK A;  3D1R A;  2REG A;  4GD5 A;  2RIN A;  3JZJ A;  1R1N A;  3PD9 A;  2L5V A;  2DYX A;  3CR9 A;  3RT6 B;  2ZNT A;  4OAN A;  1AL3 A;  2XXP A;  4F3S A;  5IGA A;  4U22 A;  3U1O A;  1FQB A;  5H8S A;  3MVY A;  4NF4 B;  3K0V A;  3RLF E;  4NF0 A;  3IFC A;  1LAF E;  2DE3 A;  1OMP A;  3VE1 B;  4MLQ A;  1IMD A;  2XXW A;  1UQW A;  1B40 A;  1ZBM A;  2H98 A;  2AYS A;  4X8R A;  3UIF A;  3TUS A;  1LST A;  3S9M C;  3BIG A;  3DP6 A;  2F3D A;  5CI5 A;  1NV3 A;  1HSE A;  3LSW A;  3TEP A;  5EQA A;  1SI1 A;  2XWK A;  4R9G A;  4LQ5 A;  3TYH A;  2I4C A;  4MNC A;  1EZO A;  2RC8 A;  2WBD A;  4U4S A;  5EHM A;  5CMC A;  1IZ1 A;  3O2A A;  5BUU A;  2QS1 A;  3R26 A;  2XXT A;  2XWO A;  3MW0 A;  2OLB A;  3L6G A;  3KSJ A;  1US5 A;  3CSG A;  2ALU A;  4JB7 A;  5IKB A;  2UYF A;  1RKM A;  4H65 A;  5DYH A;  5H8Q B;  2I0B A;  4GLI A;  4ELQ A;  1O63 A;  3O6H A;  4PF6 A;  4PP0 A;  2HXR A;  2QPQ A;  4N07 A;  3NOH A;  3QUF A;  3O6G A;  3JV9 A;  4NMY A;  1AIV A;  3U94 A;  1FTK A;  3EPE A;  1P1N A;  3FGS A;  1MY1 A;  1MY3 A;  2X26 A;  5ICT A;  3N94 A;  2F78 A;  2FYI A;  3GYY A;  4ELP A;  4DI4 B;  3KBR A;  4BDR A;  4IO5 A;  2NXO A;  4EXL A;  4PCD A;  5IM2 A;  2XXH A;  2ONK E;  4AB6 A;  4ZEF A;  3FZV A;  2XXK A;  4YKK A;  3A3C A;  1K9Y A;  4H0W A;  4GWO A;  5DTB A;  2JJK A;  1NUZ A;  4ELO A;  1XT8 A;  3OMB A;  4Z0I A;  1N7W A;  4RYA A;  1SW4 A;  2F6G A;  3DEL B;  5A5X B;  5AA4 A;  3PPN A;  3OSR A;  4QFN A;  2H9B A;  5J16 A;  5I56 B;  3KG2 A;  2DP8 A;  4H1X A;  2DOJ A;  5LTC A;  5A5X A;  3LSF B;  3RPL B;  2Q8J A;  1SDX A;  2FVZ A;  1PB8 A;  3HFU A;  4G8M A;  4NF5 A;  2UYE A;  2XXI A;  1B58 A;  1NV2 A;  1FPD A;  3MZ1 A;  1KA0 A;  4JWY A;  4GWX A;  4G2Z A;  4N6K A;  1D9V A;  3H6U A;  5IAI A;  1FBG A;  5LDZ A;  3V83 A;  1JEU A;  4MNI A;  3KSX A;  2A5S A;  4OER A;  2DWA A;  3MWB A;  2R8T A;  2B65 A;  4OWD A;  1PB7 A;  2Y7W A;  3IB0 A;  5H8N B;  4XKN A;  3W9V A;  4GWW A;  1LCT A;  5AA2 B;  1FTO A;  3QYT A;  1LCF A;  2XXY A;  3MPK A;  4L17 A;  4FAJ A;  4YMB A;  2O68 A;  3SET A;  1MXZ A;  4U1Z A;  4F2Q A;  1B4H A;  4JDF A;  2WX9 A;  4GQO A;  3IX1 A;  1P1U A;  1BKA A;  1B3H A;  1UIV A;  3A29 A;  1FBE A;  3KZG A;  3LSX A;  3KC0 A;  1FQE A;  3HST A;  3I5O A;  2QVV A;  1B4Z A;  4OFJ A;  1VFD A;  5FHM A;  1MXX A;  3E13 X;  1MH4 A;  1A54 A;  3SER A;  4GWZ A;  4I3E A;  2F97 A;  3RYD A;  2WBB A;  3FVG A;  3FVO A;  2DXR A;  4O3C A;  2P3N A;  5F1Q A;  3TFL A;  4FEB A;  4JVD A;  1JET A;  3MJN A;  3MVX A;  4QBA A;  2OWS A;  1EZ9 A;  3FXR A;  4AS4 A;  4MF3 A;  1FQF A;  4BDO A;  3K6X A;  2PCR A;  1LFI A;  1DCU A;  1Y1M A;  2FNC A;  1UTH A;  1HSL A;  4MEV A;  2V3U A;  4OEV A;  1KZ8 A;  1NI9 A;  4E0W A;  1H76 A;  2OCU A;  1NUY A;  1QJM A;  1MXY A;  4OVJ A;  1VDW A;  1IEJ A;  1URG A;  2KLF A;  2F34 A;  3LC8 A;  3N26 A;  1I69 A;  5KZT A;  1DTZ A;  4N8G A;  1MQJ A;  4K3F A;  4O3A A;  1A99 A;  3PUZ E;  4MIJ A;  1B7U A;  2ESN A;  3C34 A;  5KCJ B;  1YAE A;  5FTH A;  4GX6 A;  4G68 B;  5HPQ A;  2HXW A;  1OQH A;  2VPO A;  1NV6 A;  3OEK A;  1RDY A;  3CIJ A;  5I59 A;  1ZKB A;  2Y7K A;  3BFT A;  1B3E A;  1EH3 A;  3PPP A;  5L8D A;  1SQY A;  2V4C A;  3ZKK A;  4I8C A;  1YXI A;  1XOC A;  2RC7 A;  4U1O A;  4U21 A;  3VXB A;  4RNS A;  1MDQ A;  3O9P A;  1SD3 A;  1A8F A;  3DP8 A;  2ABH A;  2PFY A;  1YYZ A;  1VE4 A;  5HM4 B;  3FAT A;  3LBS A;  4KYD A;  5L9S A;  4GRK A;  3TDJ A;  5IZ3 A;  2DXY A;  2P2A A;  1Z7N E;  3ROJ A;  4OMB A;  5K2Y A;  3HHF A;  4HTG A;  4H6D A;  3KBZ A;  5ET5 A;  3IB2 A;  3VLU A;  1G0I A;  5FBP A;  5DVI A;  3T96 B;  1B3F A;  3IB1 A;  4G61 A;  1NV0 A;  1N0T A;  3SES A;  3E79 A;  4TLL B;  1GR2 A;  3RY3 A;  3W9W A;  4RPO A;  2PT2 A;  4ZDM A;  4H67 A;  5H8H B;  4HE1 A;  4G68 C;  4GX4 A;  2O1L A;  2FIX A;  3UGW A;  4FAT A;  2P3V A;  3FD3 A;  4KYE A;  4GWS A;  1MQI A;  5A5L A;  2HEU A;  3LUZ A;  1N3W A;  1SBP A;  1FBH A;  3TTN A;  3C33 A;  3IOT A;  3RNN A;  3QIM A;  2V84 A;  4N6P A;  3UK4 A;  4XIG Q;  1FBD A;  4C1T A;  4OVQ A;  2QRY A;  3C9H A;  3PV0 E;  2UVJ A;  4MJO A;  2QS2 A;  1UTB B;  1B1H A;  3QXM A;  2B4M A;  4JWO A;  4QSD A;  4UAC A;  3B6T A;  2BJJ X;  5FHN A;  3QMF A;  2IA4 A;  2Z8E A;  2Y7R A;  3T9U A;  3OXN A;  4E0X A;  1Y20 A;  4LAT A;  3B8B A;  1TFD A;  2F8D A;  3EKI A;  4OVP A;  1WVJ A;  2I48 A;  4X1B A;  3PPO A;  4NF8 A;  4PF8 A;  3S2V A;  1B51 A;  3UP9 A;  2PMS A;  4F22 A;  4QFP A;  5DEX A;  1M5C A;  3KFM A;  2F7B A;  1MPD A;  5BWJ A;  3OEN A;  4IY6 A;  1H43 A;  3ODB A;  2Y5L A;  1MH3 A;  1GV8 A;  3TZA A;  1VR5 A;  1FPL A;  1SI0 A;  3E9X A;  4MHF A;  4PE5 B;  3OO6 A;  1S50 A;  5TP9 A;  3LUY A;  4IO3 A;  5I57 B;  1ZTY A;  2B4L A;  5ELV A;  3ECR A;  3K6U A;  2NOO A;  4YAH X;  4OYV A;  4RXL A;  1YTV A;  1YCJ A;  4OFL A;  3HO7 A;  5TPA B;  2O69 A;  4R6K A;  4EQB A;  3ILU B;  1FTJ A;  4XF5 A;  1GTK A;  2UXA A;  1XS5 A;  4KD5 A;  1FTL A;  2HZK A;  2ZNU A;  4OZ9 A;  3PMV A;  2KQZ A;  1DPP A;  1FBC A;  3KOT A;  1JW1 A;  1B9J A;  5T3J A;  4IB2 A;  2Y5K A;  2WKY A;  4PGP A;  3VLW A;  3VVF A;  4MAG A;  1N04 A;  3V5A A;  4IR8 A;  4OES A;  3U93 A;  1Z7M E;  4LZ7 A;  3LR1 A;  4ZEI A;  1FQD A;  1OQG A;  1IMA A;  2O7I A;  3KN8 A;  5JTY A;  3VV5 A;  4F31 B;  1FTA A;  3ZSF A;  4NF8 B;  2UVI A;  4BDN A;  4PTK A;  1IXG A;  3H6V A;  5AA1 A;  4KFQ A;  4ECF A;  2Q9T A;  2HAV A;  1PBQ A;  4EDP A;  4LVQ A;  5IZ3 B;  1S9T A;  1Y4T A;  3JYR A;  2DWI A;  3BIH A;  4NG7 A;  1QKB A;  3PTY A;  4FBP A;  3MPL A;  1OLA A;  4C0R A;  4YMA A;  3EQ1 A;  3R6U A;  1FPE A;  3FJ7 A;  3V8X B;  4YIC A;  4I9D A;  2Q2A A;  1ZMG A;  2DS9 A;  3TKD A;  4I62 A;  4OVS A;  1LAX A;  5JK4 A;  4TQU Q;  1AMF A;  4FE8 A;  2F6P A;  4ZE9 A;  4O3B A;  3DLN A;  1KA1 A;  4ESW A;  3QK6 A;  1NH8 A;  2I3V A;  4XEQ A;  4POW A;  1LFG A;  4PFI A;  3FXQ A;  3AXF A;  1N84 A;  5ET7 A;  1AH5 A;  4MMP A;  1FTM A;  2THI A;  4JBZ A;  4LUB A;  2QVU A;  5EHS A;  2Y7I A;  3OOA A;  4ISU A;  2Z22 A;  4GOT A;  4U2R A;  2VD2 A;  4XFE A;  2PBW A;  3IOW A;  3PU5 A;  2VD3 A;  1INP A;  3CVG A;  1FQA A;  1IXH A;  3K02 A;  4N6D A;  4YB5 A;  4WXJ A;  3HN0 A;  4LA9 A;  3UA8 A;  3IL1 B;  1LBB A;  3FAS A;  3TTK A;  2VP1 A;  3H03 A;  1TT1 A;  4JVI A;  1QUI A;  4PFU A;  2VPN A;  2Y7P A;  1B6H A;  3IO4 A;  4GIZ A;  2REJ A;  1N3X A;  3TCH A;  4F3P A;  1BTJ A;  1FPI A;  2ONR A;  4YB7 A;  2H5Y A;  4FIM A;  3B50 A;  3U65 A;  4QFL A;  3U8Q A;  4PFY A;  5JEI A;  4XXU A;  4QFK A;  4F1Y A;  3EN3 A;  2DQV A;  4R75 A;  5EYG A;  1B32 A;  3FVK A;  1LBZ A;  3TTM A;  3K1M A;  3PGF A;  3KN7 A;  1LFH A;  3MYU A;  2H4I A;  5FHO A;  4P3L A;  4PQJ A;  1P1O A;  3PPR A;  2XXV A;  4JVC A;  1PC3 A;  4GBV A;  5AA2 A;  5FTI A;  2PYY A;  5H8Q A;  3P7I A;  2FBP A;  4QHQ A;  2G93 A;  2O7U A;  2XXX A;  1R9L A;  4I40 A;  4N91 A;  5IZZ A;  3IAZ A;  3C4M A;  5M2V A;  2IEE A;  3F11 A;  1WDN A;  3A3U A;  4NE4 A;  1UTH B;  2ZXT A;  2ZYK A;  5ITO A;  4M1V A;  1XHY A;  1MY4 A;  1P99 A;  1B5J A;  4I3Y A;  3D4C A;  1CNQ A;  2OX3 A;  1NNP A;  1FW0 A;  1RYO A;  2I4B A;  4TLM B;  1D9Q A;  2F7C A;  4F1U A;  5AA2 D;  2GRV A;  2OBG A;  4OA4 A;  1Y3P A;  2OZZ A;  2QMX A;  1TXF A;  1DPE A;  1QGX A;  4GF8 A;  1Q35 A;  4IGT A;  5EYH A;  2MKZ A;  4UAB A;  2F35 A;  3K4U A;  2XX8 A;  3VLV A;  4U23 A;  3CI8 A;  4PFR A;  4NF6 B;  2CMO A;  4HE2 A;  4FEC A;  5I2K A;  1Y4C A;  4IGR A;  5I58 A;  4NF4 A;  1B3L A;  3RUM A;  5I2N A;  2I6E A;  4PFB A;  3FUZ A;  2XXR A;  3MC2 A;  1PEB A;  2V93 A;  1O64 A;  2UVH A;  1Y3Q A;  1POY 1;  2Y84 A;  5H8N A;  1SYI A;  1KWH A;  2ZYO A;  4LP2 B;  1IME A;  2HAU A;  4GFR A;  3Q26 A;  3TQW A;  1I6B A;  1MPB A;  1SW5 A;  3BFU A;  4I1D A;  3G3G A;  3B6Q A;  5KCJ A;  1Y1Z A;  1OIB A;  4KYS A;  4YU0 A;  5DT6 A;  3S9L C;  4YKJ A;  2Q89 A;  5I2K B;  2X7Q A;  4NF6 A;  1J1N A;  3M8U A;  3RPL A;  1QUL A;  4HW8 A;  4DZ1 A;  1H45 A;  3S9E A;  5KDT A;  3GBB A;  3MP8 A;  1ZJL A;  4RK9 A;  3WAF A;  1IUD A;  1QKA A;  1LLS A;  1M5B A;  2Q74 A;  4KXP A;  3IK6 B;  1N76 A;  1URS A;  5CM6 A;  4ESX A;  1NKX A;  3OO7 A;  1QUK A;  2P1S A;  1Y3N A;  4QF9 A;  4F18 A;  3SEX A;  1A7L A;  3G3H A;  4PAI A;  3TTL A;  3OEM A;  1CE2 A;  3ILT B;  2DE2 A;  1ANF A;  1SYH A;  4ZEB A;  4YZZ A;  1NNT A;  1I6Q A;  2ZNS A;  4OFO A;  2CEY A;  4NGU A;  2AL5 A;  1DTG A;  3HHG A;  1B7H A;  2PX1 A;  1XC1 A;  1EU8 A;  4ZE8 A;  3CHG A;  1MPC A;  4WED A;  1LBW A;  1BK4 A;  4F19 A;  1WOD A;  2XHD A;  2HFB A;  5ISU A;  3C32 A;  1FPK A;  3VXC A;  4PE3 A;  2F7A A;  4DXB A;  5CC2 A;  1YZ0 A;  2F36 A;  2ZYM A;  1ZU0 A;  4WEP A;  4PBH A;  4RJZ A;  4AS5 A;  4P1E A;  3IFA A;  4P11 A;  4LZ5 A;  2D5W A;  3K1N A;  4OXV A;  3WAE A;  1FBF A;  3MP6 A;  4PBQ A;  3RTW B;  1T0K A;  3MZB A;  1M5D A;  2Q2C A;  4QSC A;  3T22 A;  1B52 A;  1FPB A;  5CMB A;  4OTE A;  2D21 A;  4N8Y A;  5LOM A;  2QS4 A;  4KI0 E;  3MAM A;  1LAG E;  4OEN A;  3KC1 A;  3VVD A;  3N6T A;  3IJO B; 
#chains in the Genus database with same CATH homology
 1YYZ A;  4P1L A;  4N4U A;  2WYK A;  5DW8 A;  4F1U A;  4OA4 A;  4PF8 A;  1EYI A;  2XWK A;  4GWZ A;  4NX1 A;  2WBB A;  4I3E A;  3RYD A;  4F18 A;  1FTA A;  2F3B A;  1FRP A;  4PAI A;  1FPG A;  2P3N A;  1QGX A;  1LEV A;  5IZ1 A;  4MNP A;  4MNC A;  2DE2 A;  1RDZ A;  2F5X A;  2WBD A;  5IZ3 A;  4NHB A;  5EYH A;  1DBZ A;  4OVR A;  2MKZ A;  4PTK A;  4JVD A;  5EQA A;  1RDX A;  4UAB A;  4X04 A;  4YZZ A;  1NV4 A;  2Q9T A;  5J16 A;  4GWY A;  1LBV A;  4QXD A;  4QBA A;  4P56 A;  2CEY A;  4H45 A;  3ROJ A;  3FBP A;  4NGU A;  4AS4 A;  5IZ3 B;  1Q9D A;  2OWZ A;  2Y5L A;  1LBY A;  4JVI A;  1FBP A;  2PCR A;  4NN3 A;  4N81 A;  1DCU A;  2DE4 A;  2XWO A;  3BIH A;  4NG7 A;  3E78 A;  5LTC A;  3PTY A;  4FBP A;  3RPL B;  4MEV A;  1FPL A;  3KBZ A;  5ET5 A;  4MHF A;  2VPN A;  2QVR A;  1KZ8 A;  1EYK A;  2FVZ A;  1G0I A;  2VT5 A;  3HFU A;  4O8M A;  4O7M A;  3CHG A;  4PFR A;  4HE2 A;  3SZP A;  5FBP A;  1NV2 A;  1FPI A;  1FPE A;  1FPD A;  2KR0 A;  3T1B A;  1KA0 A;  2Q8M A;  4NAP A;  4P47 A;  4YIC A;  3LV0 A;  1LBW A;  1BK4 A;  3B50 A;  3U65 A;  4HE0 A;  1NI9 A;  4PFB A;  4F19 A;  1FJ9 A;  4G61 A;  1G0H A;  1NV0 A;  1NUY A;  4GWX A;  4N6K A;  2HPG A;  4OVS A;  4P9K A;  2B4L A;  1VDW A;  4PET A;  3E79 A;  2CZI A;  2FHY A;  5EQ7 A;  2V3Q A;  2XA5 A;  5JK4 A;  4PDH A;  5ET6 A;  1FBG A;  4PF6 A;  3W9W A;  5LDZ A;  2HXR A;  2QPQ A;  3D1R A;  1NUX A;  1FPK A;  5I3S A;  4MNI A;  2GQ1 A;  3NOH A;  2ZZV A;  2XWV A;  4N17 A;  5EQ9 A;  4PE3 A;  5EYG A;  4NQ8 A;  4PAK A;  1KA1 A;  1SPI A;  2R8T A;  2PFZ A;  1LBZ A;  4N8G A;  1IMC A;  4OVT A;  1IME A;  2L5V A;  2WEF A;  4HE1 A;  4O94 A;  4X9T A;  1YZ0 A;  4HXV A;  2HHM A;  2CZK A;  4GX4 A;  2FIX A;  3MYU A;  4XEQ A;  4PC9 A;  2P3V A;  2CEX A;  3ISP A;  2QFL A;  4GWS A;  4PBH A;  5ESY A;  4O7I A;  2BJI A;  4MIJ A;  3W9V A;  1XI6 A;  4OAN A;  4P3L A;  4GWW A;  4XF5 A;  4AS5 A;  4DI3 D;  5A5L A;  1NV5 A;  3LUZ A;  1FPJ A;  4GX6 A;  4JVC A;  3MST A;  4P1E A;  2CZH A;  2HZK A;  3IFA A;  1FBH A;  4GBV A;  4PFI A;  2FIE A;  3FXB A;  5I5P A;  5IGA A;  4MCO A;  4P8B A;  2ZZW A;  2VPO A;  1NV6 A;  1RDY A;  1LBX A;  3GYY A;  4MX6 A;  5F24 A;  5ET7 A;  4HCW A;  1NV7 A;  2FBP A;  4DI4 B;  2KQZ A;  1FBF A;  1FBC A;  4GX3 A;  4MMP A;  1IMF A;  4I40 A;  4N91 A;  4NF0 A;  4PAF A;  1FBD A;  2DE3 A;  1NUW A;  3IFC A;  4PBQ A;  5I7I A;  5IZZ A;  4PCD A;  2QVU A;  4PGN A;  4OVQ A;  5IM2 A;  5T3J A;  4HCY A;  1IMB A;  4GWU A;  2WX9 A;  4MJO A;  1IMD A;  2PFY A;  2V4C A;  2Y5K A;  2HZL A;  4H46 A;  4PGP A;  3RPL A;  5J1D A;  2DDK A;  1FPB A;  4MAG A;  2B4M A;  4M1V A;  4X8R A;  3A29 A;  2XWI A;  1FBE A;  4LN5 A;  4IR8 A;  1EYJ A;  2DVZ A;  2WYP A;  4F1V A;  2ZZX A;  1YXI A;  4N8Y A;  3T0J A;  2XXK A;  5EQ8 A;  3KC0 A;  1K9Z A;  1K9Y A;  3QMF A;  3BIG A;  1AWB A;  4I3Y A;  4PDD A;  1FSA A;  4GBW A;  2F3D A;  1JP4 A;  2QVV A;  1CNQ A;  1NV1 A;  4XFE A;  1DK4 A;  2OX3 A;  2Q74 A;  4KXP A;  2JJK A;  1FPF A;  1NUZ A;  1NV3 A;  3B8B A;  5CM6 A;  1FJ6 A;  3KC1 A;  3EKI A;  4N15 A;  4OVP A;  1INP A;  5ET8 A;  1D9Q A;  1IMA A;  4N6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...