4LN5A

Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bamb_6123), target efi-510059, with bound glycerol and chloride ion
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
302
structure length
302
Chain Sequence
RVFRSADVHGDSFPTNMAVKFMGDELSKLTGGKDSIKVFGNSALGSEKDTVDQVRIGAIDMARVNGASFNEIVPESLIPSFPFLFRDVDHFRKAMYGPAGQKILDAFAAKGMIALTFYESGARSIYAKRPVRTPADMKGLKVRVQPSDLMVDEIRAMGGTPTPMPFAEVYTGLKTGLVDAAENNLPSYEETKHFEVAPDYSETQHAMTPEVLVFSKKIWDTLSPQEQAAIRKAAADSVPYYQKLWTAREASAQQAVTKGGANILPAAQVDRAAFVKAMQPLWTKYEKTPQMKQIVDEIEATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Burkholderia ambifaria
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
total genus 117
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ln5A00
4MMPA 5LTCA 4NF0A 4N91A 4NAPA 2ZZXA 2WX9A 4NN3A 2VPOA 2WYPA 2HZLA 2XWVA 4NQ8A 4NX1A 3B50A 4P9KA 4PF6A 4LN5A 4DI3D 4PGNA 4MIJA 4MNCA 4N15A 4OVRA 2XWIA 4PBHA 4PETA 4X04A 5IGAA 2PFYA 4OVTA 4MAGA 4PDDA 4X8RA 4N6DA 4N6KA 4MHFA 2CEYA 4OA4A 5I7IA 2WYKA 4OVQA 2PFZA 4P1EA 2XXKA 4OVPA 4PF8A 5IZZA 4PAIA 4MEVA 4PFRA 5IM2A 4PFBA 4XF5A 3GYYA 2V4CA 4MX6A 4OVSA 2XWOA 4NGUA 4PC9A 4PBQA 5CM6A 4XFEA 5I5PA 4N8GA 2HPGA 4OANA 4NG7A 4P8BA 4O7MA 4UABA 4PDHA 4PAFA 2CEXA 2ZZVA 2VPNA 4PAKA 2XWKA 4P47A 4MNPA 4PFIA 4PGPA 4P3LA 4PE3A 4N17A 4MNIA 4PCDA 4DI4B 4YZZA 4P1LA 4XEQA 3U65A 4N8YA 4NHBA 4O8MA 3FXBA 4N4UA 2ZZWA 2XA5A 4MCOA 2HZKA 4O94A 4P56A 4YICA
chains in the Genus database with same CATH superfamily
4QXDA 4RY1A 4KCDA 2B4MA 4JWXA 2VHAA 2I0BA 4QSEA 2ZYKA 5EYGA 4IGRA 3IO4A 3LBSA 4NQ8A 4BDRA 1FTKA 2D3IA 1DK4A 4HE2A 1B3EA 2F5XA 3UORA 1SBPA 2R71A 1SVXB 2P3NA 2XHDA 4GFRA 5EHSA 5IGAA 1NV4A 4IO4A 1UIVA 1LLSA 4NE4A 1LBVA 3PV0E 5KDTA 1R9LA 3E79A 4O7IA 3D4CA 1XHYA 4YKJA 1QUKA 1FTLA 2P1SA 2FBPA 3C4MA 4G4PA 1NFTA 3OEMA 2XXKA 4HXVA 4ZS9A 5I56B 4OEVA 3MZ1A 3MUQA 3E78A 4LQ2A 1HSJA 1MQIA 1MQJA 1EH3A 1H3DA 3RPWA 4O3AA 2GRVA 3H6TA 2Y7WA 3U92A 3PMWA 2HPGA 2PCRA 3G3JA 3T9HB 2VD3A 4MF3A 1Z7NE 3EHUA 1LCFA 3KBZA 1B3LA 1FW0A 1QUJA 1URGA 1MDQA 1ZKBA 1SW1A 2E1SA 1KWHA 3A3UA 3W9VA 1QVSA 2PBWA 1FJ6A 3EHSA 2RC8A 2IA4A 3FXRA 1MXVA 1D9VA 2CZHA 1ANFA 2HZKA 4Z0IA 5L9SA 3K6VA 4Q0CA 3C35A 3FJGA 4NEDA 4N91A 3ZKKA 4ND9A 4IB2A 1JW1A 4MLVA 1LBCA 2ZZXA 4R72A 4HCYA 1LB8A 1SQYA 4I8CA 2WYPA 2Q88A 2QFLA 1SW2A 4NF4B 1NMUA 3PUYE 5B70A 3WAFA 3RT6B 4X48A 4OESA 3IAZA 4PETA 3GLBA 2QMWA 3QMFA 1MRPA 2UVHA 4F29A 3H6VA 1MS7A 3H6UA 3QSLA 2GHAA 1XI6A 1NUYA 2Y7PA 3KZGA 3B6QA 2OLBA 1A54A 2I58A 4AB5A 3MQ9A 4LZ5A 4PFBA 5A5LA 3MVZA 4NTLA 4QSCA 1DPEA 3GBAA 1O63A 3O6GA 1FPJA 4PFUA 1AOVA 2ZNTA 1D9YA 4P0IA 4XFEA 3I6VA 3MWBA 4U4SA 4DCXA 4PDHA 2XXPA 2ONSA 1D4NA 1P99A 4PAFA 4EXLA 2YPNA 1P1OA 1LAXA 3TTLA 3TQWA 1OLCA 3PPPA 3W15C 3TYHA 3VLUA 3UIFA 4DDDA 3T1BA 4GVOA 4RA1A 2QL3A 2F34A 2HAUA 3O29A 2O7UA 4POWA 2Y7RA 3OO7A 5EQ9A 1OLAA 3VFJA 1IXCA 5I56A 1A40A 4FEDA 1RDZA 2YLNA 2V3QA 5ISUA 4NX1A 3UK4A 2RF1A 3MP8A 4F2QA 3K00A 2O69A 4PGNA 3V89B 3CVGA 1FPBA 1I6BA 2QVVA 2Z8EA 3G3HA 4KCCA 1VSOA 3LUZA 3VXCA 1N76A 3MVWA 1DTGA 4JVCA 1B3HA 1IMFA 3IO6A 1B0LA 3LSWA 1IXGA 4N13A 1Q9DA 1B6HA 2FHYA 2V84A 5M2VA 1GV8A 1B46A 3B6WA 1MM7A 5ET8A 4MX6A 4OVSA 5A5XA 5T3JA 3LSXA 5JK4A 4DXBA 1AH5A 1VE4A 1JVXA 3Q25A 3OO8A 4RJZA 1B9JA 1A55A 4HS7A 3EHTA 4NWCA 4P8BA 4GIZA 5CBSA 4PAKA 5IAIA 4U23A 3BIHA 3VV5A 4HTGA 2F6GA 5I59A 3SERA 2Q89A 3U93A 3CG1A 1PB7A 1M5FA 2UVIA 2VGQA 4YB7A 1KA1A 4GWOA 3PMXA 3QXMA 4JWYA 4KXPA 5IZ3A 5ELVA 4IO2A 1EYIA 5LTCA 1B7ZA 2VT5A 5F24A 3RLFE 1ZU0A 2I3VA 1POTA 3IOVA 1IMAA 3H3GA 5TPAB 4F1VA 2PVUA 3LC8A 5H8HB 4LN5A 2F7BA 1JVYA 2XXTA 2ZYOA 2UYFA 4N6PA 4N15A 3O6HA 5F1QA 4F1YA 1SYIA 3TTRA 2HCAA 3UN6A 2ZMBA 2D5WA 1D9QA 2UVJA 4QFOA 4GWZA 3T96B 5TPAA 3CG3A 2ZNSA 5DVIA 3A09A 4G68B 3C31A 5ESYA 3KEIA 4XKPA 3TMGA 1JW5A 3CFLA 4JSOA 4M1VA 4NGUA 1JP4A 1CE2A 1RYXA 1AL3A 3ECRA 3K1PA 4X1BA 2QS2A 2X26A 4THIA 1FSAA 4L17A 4KI0E 4O7MA 2QVUA 2Q2AA 2RINA 2CZKA 1BIYA 4RXLA 4PGPA 1NV6A 2GH9A 3N94A 3E9XA 4DI4B 2XXVA 4YMAA 4BDQA 4OFOA 4XKRA 2I4CA 4O94A 2ONKE 4BDNA 2KQZA 1MPDA 3MSTA 2HHMA 4GF8A 4NF0A 1RYOA 3O2AA 5DEXB 4QSDA 4Q5TA 3CIJA 5TU0A 5I2KB 2V3TA 4GXAA 4QFKA 2V25A 1QJMA 2VD2A 1FQFA 2HZLA 5H8NA 1P1NA 3JV9A 1NV0A 3TUSA 3RPLA 4OFJA 1ZTYA 3TEPA 4PBHA 1IMCA 3KG2A 5JTYB 1XOCA 4X04A 2B3FA 2XXHA 3FV1A 3IL1B 3IB1A 4PDDA 4ZEKA 4PP0A 4TLMB 1SW5A 4H65A 2H98A 3TCHA 5I57A 4U1OA 3U72A 3RT8A 2H25A 1FRPA 1K9YA 5I3SA 1MM6A 4P1EA 5AA4A 1MY3A 1WDNA 4HE0A 1QGXA 4MEVA 1Y3PA 3G3IA 2FIXA 1IXHA 3MC2A 2Y7IA 2ABHA 3TZAA 2GQ1A 1ELJA 2RCBA 3CSBA 4TQUQ 1B1HA 4ZZEA 4GX3A 3T66A 2B3BA 1N3WA 5BUUA 3FASA 3HSTA 2Z22A 3Q29A 3T9XB 3CR9A 4EF2A 1Y1ZA 2VPNA 4P47A 4QFLA 4N17A 1TWYA 2O68A 1OQGA 4O3CA 1VFDA 4O8MA 3PPRA 5AA2D 3G7WA 4RYAA 3ZSFA 3IFAA 3PPQA 4MMPA 3HV1A 4NF5A 3VVFA 4QFNA 1B4ZA 4LA9A 2GHBA 3CFZA 5EQ7A 1J1NA 2VPOA 1HSEA 4AB6A 3B6TA 5I58A 1FJ9A 2PX1A 2NVUB 4LATA 5H8NB 5KDTB 1MXWA 3Q28A 5TP9B 1JEVA 4ELOA 3U94A 3OSRA 3K4UA 3TPAA 2NXOA 4C1TA 3C36A 3ZKLA 3T93B 3NOHA 4ZECA 2Q8MA 4OHNA 2NOOA 2PFZA 2YJPA 3R26A 2A5TA 4OZ9A 5AA1A 2NWJA 1MQHA 2G29A 3S4UA 1A7LA 3E3KA 1PBQA 3TQLA 4MBPA 4QHQA 1S50A 3S9LC 3GYYA 4IO5A 5FHOA 4H0WA 4OFLA 4YU0A 2XXXA 3SDFA 3TFLA 5H8QB 1WODA 5CM6A 2A5SA 1URDA 1LEVA 3E4RA 1LCTA 4NMYA 2DE2A 4OANA 4MH5A 4GQOA 4GD5A 1B4HA 2AL4A 3D4GA 5BWJA 3R7XA 2ZZVA 1R6ZA 5H8HA 3FIRA 4PCDA 1A8EA 1LSTA 2OWTA 3K2DA 4JVDA 5CMCA 3FBPA 4H67A 1IUDA 1LBWA 3U8QA 3E13X 3F11A 1B5IA 5FHNA 1CB6A 4ELPA 4R74A 4AQ4A 2XWVA 1Y4CA 3C33A 2Y5KA 4XKNA 2DWHA 2QJEA 1SYHA 5I59B 2ZNUA 3UP9A 2REGA 4MNCA 4F3PA 4GWXA 3T0JA 2UVGA 3VLWA 2FA7A 3MAMA 5IZ3B 2PMSA 2M8CA 3LUYA 4GL0A 5AA2B 2OWZA 4OA4A 4G68A 2Q8JA 5DTBA 2I48A 1ZJLA 5A5XB 3OXNA 1AWBA 1FPDA 1R9QA 1USYE 3B8BA 1II5A 4PF8A 2CZIA 5KZTA 5HPQA 1H76A 2XXRA 3SEVA 3IORA 5HM4B 2Z8FA 4YB6A 4NWDA 1N0TA 2O6AA 2QPQA 3VXBA 3T9UA 3QAXA 3Q27A 1O64A 4N8GA 3ROJA 2HAVA 3MZBA 4H8JA 5L8DA 3KOTA 3PPOA 1XVXA 3R6UA 3MJNA 1GTKA 4G68C 4MNPA 1BKAA 5LOMA 4MFIA 1FQBA 1NV2A 3MZ9A 5I58B 3K02A 3QUFA 1YPNA 4P1LA 5FTIA 1FPGA 4NHBA 4WEPA 3FXBA 1GVCA 4RNSA 4YB5A 2DYXA 1Y3NA 4DE8A 4U21A 1SD3A 1MXZA 1B58A 2XXWA 2ZYNA 4EDPA 4R9GA 1NI9A 5TP9A 3VE1B 3RN8A 2R6GE 1MY2A 1B5JA 4RK2A 1QKBA 5DW8A 1FPEA 4P11A 4G2ZA 4ZEBA 3VVDA 4C1UA 4PTKA 2Q74A 2LAOA 5KCJA 2O51A 1PB8A 1US5A 1T0KA 4O3BA 4LVQA 3UGWA 4JB7A 2WBBA 1FTJA 4QRZA 1B2HA 1B5HA 1VDWA 4U1ZA 3EN3A 4LZ8A 4POXA 1PC3A 3I3VA 3KJTA 4GWSA 2XXIA 2CMOA 3TTMA 2OBGA 3BFUA 2WKYA 4OXVA 4DZ1A 5I84A 2KR0A 4PFRA 3N5LA 3LSLA 3S2VA 3FV2A 1NV5A 4GWWA 4GL8A 4PBQA 1EZOA 3GBBA 3ILUB 3OOAA 4OVJA 4NG7A 1LBZA 3PUWE 3SEWA 2FVZA 3N6TA 5CMBA 1B1XA 1FQDA 5EYFA 3CSGA 2O7IA 1B32A 4U2RA 2D21A 3FATA 3SZPA 1ZIUA 4ESXA 4Q30B 4ZE8A 2THIA 3OD7A 3V83A 2DOJA 3SEYA 4YICA 4F31B 3CI8A 3IFCA 1BK4A 3MYUA 1Y1MA 4AS5A 2WX9A 1Y9UA 4NN3A 1USYH 1G0HA 5DYHA 4I3EA 3EF7A 1I6AA 1NNTA 3CRBA 3P7IA 2DDKA 2I49A 3Q26A 5CMKA 1B3FA 4MAGA 5H8FA 4R2FA 4H5FA 3KGCA 3K0VA 4G8HA 1QULA 3K1MA 4I1DA 5AA2A 3PTYA 1YYZA 3PUXE 2V3UA 2RC7A 3SKPA 1LFIA 3IOUA 3SEUA 1DPPA 3KC0A 1DTZA 1M5BA 2V4CA 3KN8A 4PFTA 3CHGA 4ELRA 1B51A 2DXYA 1B0HA 4KHZE 4R73A 4FBPA 4R6KA 3M8UA 4G77A 4E0WA 2UXAA 1OMPA 3OELA 3FD3A 2ESNA 4OWDA 2CEXA 5ET6A 1OQHA 4KYDA 3KOSA 5FBPA 1SI0A 5I2NA 2F78A 3JZJA 3UA8A 3SETA 1DCUA 3V8XB 1PEBA 1RDXA 3PMVA 4F1UA 2DVCA 2I4BA 1ZLQA 3FGSA 3SESA 1MQGA 1S7YA 3FXQA 1POY1 3BIGA 2ZXTA 4F3BA 3RPLB 1EZPA 4XIGQ 1NNKA 4EQ7A 2DSFA 1SW4A 2OK2A 2DP8A 1BLFA 4HE1A 1ZBMA 1LBXA 1B40A 4ONYA 1HSLA 3FJ7A 5F7VA 1P1QA 3BKIB 4N6KA 2CEYA 2F7CA 3IK6B 2REJA 1JETA 1MH3A 2FNCA 3ZS6A 2OX3A 1M5EA 4OVPA 4R6HA 1XVYA 1Y20A 1MY0A 4KD5A 3AXFA 1MPBA 2RKMA 5CRYA 1OVBA 3G3FA 1KA0A 3LSFB 3D1RA 3QIMA 1QUIA 1M5CA 2OJTA 1MPCA 2H4IA 4TLLB 1FBDA 5ET7A 1LBBA 1PDAA 1NNPA 2WBDA 5CI5A 3IB2A 3QYTA 4GBWA 1GR2A 2DE4A 1YXIA 4ZEFA 4JDFA 3K01A 1A8FA 2PYYA 1EYJA 2WEFA 4DCYA 2XXYA 1SDXA 2XA5A 2Z8DA 4I62A 2KLFA 1RDYA 1LBYA 3N26A 2OCUA 4ELQA 3IR1A 1P1WA 1IMEA 4JVIA 2AIXA 5FHMA 2HFBA 1LAGE 5DT6A 3B50A 4FORA 2H99A 4OQOA 1B52A 5DEXA 4JBZA 1PBPA 5ICQA 1B7HA 4XXUA 1VR5A 1VFEA 3IB0A 4GOTA 3DELB 4N6DA 3RGYA 1FBEA 1IIWA 4QFPA 2QS4A 3G3GA 4I9DA 3U1OA 3MVXA 5EHMA 1MDP1 2RC9A 1N7WA 4PAIA 4LP2B 2Z23A 1GGGA 4ECFA 1NUXA 1Q1KA 2JJKA 2F6PA 3M3LA 3IJOB 4R9FA 2QS1A 2UYEA 4RPOA 5DVJA 1QKAA 3V5AA 3FXUA 5H8QA 2DE3A 4G61A 3T22A 1JQFA 4ZEIA 3EPEA 4PE5B 1Y3QA 4GX6A 4LQ5A 2AYSA 5EYHA 2A5TB 3LR1A 4DXUA 3FVOA 2XX8A 1B7UA 4KYEA 1MQDA 2I3WA 2B4LA 2H9BA 3GZGA 3CFXA 1FQEA 1DOTA 1BP5A 3A3CA 4PFYA 2H5YA 1B3GA 1NUWA 1INPA 5J16A 2DWAA 4P9KA 1IQ7A 1EYKA 2PT2A 4PF6A 4ZEDA 5L9OA 1KZ8A 3H6WA 1FPIA 1FBPA 3RUMA 4DI3D 4DLDA 3KN7A 4H8IA 1FPKA 5ITPA 4N07A 1N7XA 3HFUA 5B7DA 1MH4A 3ONMA 3HHGA 5L9MA 1UTHA 5AA4B 2I0CA 4TOZA 3K6XA 3KN3A 3KSXA 4OYVA 5I57B 4OVQA 1FQCA 4EUOA 5CC2A 2PT1A 1PB9A 4GXSB 1LFGA 4G8NA 1OIBA 3PUVE 2X7QA 2AL5A 4U4XA 1FBCA 2CZLA 3OSQA 2G93A 2DVZA 2XWOA 3IJXB 3FVGA 1SI1A 4F22A 3PU5A 5J1DA 4Z7EA 2HXWA 2F3DA 3O9PA 4F19A 3KJ7A 4EQBA 2DS9A 3QK6A 1MY1A 3ISPA 3KFMA 4YKKA 2W7YA 3S9EA 4OENA 3O6IA 2IEEA 4R6YA 1P1UA 1LAFE 4YZZA 4UA8A 3U65A 2VOZA 1H43A 4OTEA 3MPLA 4MCOA 4P56A 2BJJX 4YKIA 5AA3A 4OEUA 4R75A 4H5GA 1XS5A 3OO9A 4F3GA 1RKMA 4IY6A 1F9BA 4WKMA 3OMBA 2F7AA 1FQAA 1UTHB 1I69A 2OWSA 3FVKA 1NH7A 1CNQA 5IZ1A 2O1MA 3S9NC 3ODBA 2BJIA 1NV1A 4XTCQ 4DIGA 4F18A 4UACA 1Y4TA 2XXQA 3HO7A 4XKQA 3RNNA 4FAJA 2R9JA 3DM0A 2PFYA 1Z7ME 3PUZE 4X8RA 3MPKA 1MG1A 4FATA 1IEJA 2ONRA 3L6HA 3O97A 4JWOA 4DXCA 1TXFA 5IZZA 1YAEA 2XD3A 3C34A 2L5VA 4FEBA 2ANJA 4XF5A 1Q35A 5FTHA 1JW4A 2O1LA 4X1DA 1AIVA 4KQPA 3VDFA 3EKIA 3H4ZA 4NF4A 3MBPA 1H44A 1IZ1A 3OO6A 1JEUA 1H45A 4PFIA 1WVJA 1FTOA 2HXRA 4NF6B 5KCJB 1FPFA 3MW0A 1URSA 3HPIA 1R1NA 1US4A 4Q8RA 1LFHA 3RY3A 4KR5A 4KPTA 3HN0A 1NL5A 2V93A 4IO3A 3TTKA 1MXXA 2DQVA 1DMBA 2NUVA 3FJMA 2P0SA 3DP8A 3OEKA 4FE8A 5I2KA 2QSXA 2F3BA 4I40A 4ZE9A 4ZZAA 4KYSA 4PFWA 2F36A 3DLNA 3C32A 1K9ZA 1LGBC 4FIMA 2P3VA 3FVNA 3L6GA 2Q2CA 4ISUA 3TELA 1NNFA 2Y84A 1NV3A 3PGFA 3IX1A 3DP6A 1IXIA 3KC1A 5I7IA 3SEXA 2QMXA 2WYKA 3C9HA 3TDJA 1NH8A 4MJOA 5EQAA 1IMDA 2QVRA 5CBRA 4EXKA 2RCAA 5ICTA 1A99A 1IMBA 3S9MC 4C0RA 4FECA 3IOTA 4AS4A 1FBFA 4NF6A 4WXJA 4PC9A 1FTAA 2P2AA 1M5DA 2XX7A 4YAHX 3A29A 1OVTA 4GX4A 4OETA 2FYIA 4H6DA 4R2BA 5EQ8A 2Y7KA 4NF5B 3TCFA 4IY5A 2XWKA 1ATGA 1ZMGA 3JYRA 3PPNA 3GXAA 4BLAA 3PD8A 3O66A 4N8YA 1NKXA 4IR8A 4N4UA 2ZZWA 3FUZA 4P0GA 4LONB 2F35A 1JNFA 4H45A 4F2OA 4YKPA 1UIUA 4K3FA 2ALUA 1LB9A 5I2NB 3RQTA 1NV7A 5DVFA 4YMBA 4NAPA 3THIA 3HHFA 4M4GA 3N6UA 1YCJA 5K2XA 3HCQA 2XX9A 3QUJA 3MVYA 4BDMA 4H1XA 3VVEA 4H46A 4JXIA 1FCKA 3PD9A 2XWIA 1LAHE 2XXUA 4BDOA 3M3FA 5JTYA 1DSNA 3K6UA 4IO6A 3IOWA 1EU8A 1FBHA 1BTJA 2MKZA 4LZ7A 4GWYA 4ESWA 4U22A 2FIEA 3USDA 2B65A 4PQJA 1QW0A 3TTNA 4HW8A 4FJPA 2OZZA 5LDZA 2O84X 1UTBB 3TODA 2X7PA 4IO7A 3H03A 5JEIA 1I6QA 5H8FB 1N04A 4IGTA 4MLQA 1DBZA 4KFQA 2DWIA 2F8DA 3TAJA 1MXYA 1B05A 3KBRA 4GLIA 4OERA 3TKDA 1MY4A 1XT8A 3K6WA 4GBVA 1YTVA 3I5OA 1AMFA 1L5TA 1EZ9A 3MP6A 4BDLA 1UTBA 1TT1A 3TCGA 1XC1A 4G8MA 1TFDA 5HBCA 4NF8B 3LV0A 4N81A 4QF9A 3VLVA 2ZYMA 2HQ0A 4JSDA 1IITA 2HEUA 1S9TA 4LUBA 4F39A 3W9WA 1FTMA 1YZ0A 1SPIA 2DXRA 1N3XA 3T9VA 4EQ9A 3RTFB 1D3KA 5K2YA 1G0IA 1FBGA 4MIJA 4OVRA 2VP1A 3WAEA 3BFTA 3K1NA 5ET5A 4OVTA 4OMBA 3RTWB 2XD2A 4MHFA 4ZDMA 4QBAA 3FZVA 3G3KA 5AE4A 5H8SA 2DWJA 2QRYA 2Y5LA 2E0SA 4RK9A 1FPLA 3H7MA 3OENA 5CMMA 5IM2A 4EF1A 1UQWA 3BBRA 4GWUA 2I6EA 5IKBA 4HCWA 3DP4A 3KSJA 2GFEA 5I5PA 2Q9TA 4E0XA 3M3KA 4UABA 1N84A 3B7DA 4I3YA 3H06B 3O28A 4P3LA 4PE3A 2F97A 3ILTB 4F3SA 4MNIA 1NUZA 2R8TA 3MP1A 4XEQA 4GRKA 1MXUA 3RYDA 1TFAA 2QS3A 4WEDA 5ITOA 3EQ1A 4NF8A 4RPNA 4X9TA 1O7TA
chains in the Genus database with same CATH topology
4QXDA 4MMPA 1EYIA 5LTCA 4NF0A 1LBWA 2B4MA 3IFCA 2VT5A 4N91A 5F24A 1BK4A 3BIGA 3MYUA 1NI9A 1NV7A 4NAPA 2ZZXA 3W9WA 5IZ3A 5EQ7A 1NUWA 2WX9A 1INPA 4AS5A 4HCYA 1YZ0A 5EYGA 1IMAA 1IMEA 1SPIA 4JVIA 4NN3A 2VPOA 1G0HA 1RDZA 2HZLA 2WYPA 2XWVA 2V3QA 3RPLB 4NQ8A 4NX1A 5DW8A 4I3EA 1FPEA 1CNQA 3B50A 5IZ1A 4P9KA 1EYKA 4F1VA 4PF6A 1KZ8A 1NV0A 2Y5KA 1DK4A 2QFLA 4HE2A 2BJIA 1FJ9A 4LN5A 1FPIA 1NV1A 1FBPA 2F5XA 4F18A 1G0IA 2F3BA 4PTKA 4PGNA 4H46A 2Q74A 4I40A 1FBGA 1FPKA 4MIJA 4MNCA 5I3SA 3RPLA 4GWXA 4N15A 3T0JA 2XWIA 4OVRA 2P3NA 1IMCA 4PBHA 4PETA 1K9ZA 4X04A 1FPBA 2WBBA 5IGAA 2P3VA 3HFUA 2PFYA 2QVVA 1NV4A 5ET5A 2DDKA 4HE1A 1D9QA 4OVTA 1VDWA 3QMFA 1LBVA 1LBXA 3LUZA 4MAGA 4PDDA 5IZ3B 1FBHA 4X8RA 3E79A 1NV3A 5J16A 4O7IA 2MKZA 4N6DA 3KC1A 4N6KA 4MHFA 3NOHA 2CEYA 2Q8MA 2OWZA 4GWYA 4JVCA 4OA4A 4QBAA 5I7IA 4DI3D 1XI6A 4GWZA 2WYKA 1IMFA 1FBEA 1NUYA 1FRPA 1K9YA 2FBPA 3PTYA 2PFZA 4MJOA 2FIEA 4OVQA 4GWSA 4P1EA 1YYZA 5EQAA 2OX3A 1IMDA 1AWBA 1FPDA 2QVRA 2XXKA 1Q9DA 2FHYA 3B8BA 4HXVA 4OVPA 2Y5LA 4PF8A 2CZIA 1FPLA 4HE0A 5IZZA 1QGXA 4MEVA 4PAIA 5ESYA 5LDZA 1IMBA 2FIXA 2KR0A 2L5VA 3KC0A 4PFRA 5IM2A 3E78A 4PFBA 4XF5A 5A5LA 3GYYA 2V4CA 1NUXA 1KA0A 2JJKA 3CHGA 4MX6A 1FBCA 5ET8A 3IFAA 4AS4A 4OVSA 5JK4A 1DBZA 2XWOA 1FBFA 1NV5A 2DVZA 4GWWA 4M1VA 4NGUA 5T3JA 4GWUA 2GQ1A 1JP4A 3D1RA 4PBQA 4PC9A 1FTAA 1FPJA 2QPQA 5CM6A 4HCWA 3A29A 4FBPA 4GX3A 1LEVA 4XFEA 4N8GA 2Q9TA 1FBDA 3EKIA 4GX4A 5ET7A 3ROJA 2DE2A 1FSAA 2HPGA 2F3DA 2PCRA 2WBDA 1LBZA 4NG7A 4GBWA 4OANA 4F19A 4P8BA 2DE4A 2DE3A 2FVZA 5EQ8A 4O7MA 1YXIA 4UABA 3KBZA 4GBVA 3ISPA 5J1DA 4PDHA 4G61A 2QVUA 4PAFA 2CEXA 2ZZVA 4I3YA 2CZKA 2VPNA 4PAKA 5ET6A 2XWKA 4P47A 5FBPA 3BIHA 4MNPA 4PFIA 4PGPA 4P3LA 4PE3A 3W9VA 1NV6A 1FJ6A 4N17A 5I5PA 4GX6A 1EYJA 4MNIA 1NV2A 4PCDA 3SZPA 5EYHA 4DI4B 2HXRA 3LV0A 1NUZA 4YZZA 2WEFA 2R8TA 1DCUA 1FPFA 4N81A 4N8YA 1FPGA 4P1LA 4XEQA 3U65A 2CZHA 4NHBA 4O8MA 3RYDA 1RDXA 3FXBA 4IR8A 4N4UA 3T1BA 2ZZWA 2XA5A 4MCOA 4F1UA 2HZKA 4JVDA 4O94A 4P56A 4YICA 2KQZA 1KA1A 4H45A 3MSTA 4X9TA 2B4LA 2HHMA 3FBPA 1RDYA 4KXPA 1LBYA 5EQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMP A;  5LTC A;  4NF0 A;  4N91 A;  4NAP A;  2ZZX A;  2WX9 A;  4NN3 A;  2VPO A;  2WYP A;  2HZL A;  2XWV A;  4NQ8 A;  4NX1 A;  3B50 A;  4P9K A;  4PF6 A;  4LN5 A;  4DI3 D;  4PGN A;  4MIJ A;  4MNC A;  4N15 A;  4OVR A;  2XWI A;  4PBH A;  4PET A;  4X04 A;  5IGA A;  2PFY A;  4OVT A;  4MAG A;  4PDD A;  4X8R A;  4N6D A;  4N6K A;  4MHF A;  2CEY A;  4OA4 A;  5I7I A;  2WYK A;  4OVQ A;  2PFZ A;  4P1E A;  2XXK A;  4OVP A;  4PF8 A;  5IZZ A;  4PAI A;  4MEV A;  4PFR A;  5IM2 A;  4PFB A;  4XF5 A;  3GYY A;  2V4C A;  4MX6 A;  4OVS A;  2XWO A;  4NGU A;  4PC9 A;  4PBQ A;  5CM6 A;  4XFE A;  5I5P A;  4N8G A;  2HPG A;  4OAN A;  4NG7 A;  4P8B A;  4O7M A;  4UAB A;  4PDH A;  4PAF A;  2CEX A;  2ZZV A;  2VPN A;  4PAK A;  2XWK A;  4P47 A;  4MNP A;  4PFI A;  4PGP A;  4P3L A;  4PE3 A;  4N17 A;  4MNI A;  4PCD A;  4DI4 B;  4YZZ A;  4P1L A;  4XEQ A;  3U65 A;  4N8Y A;  4NHB A;  4O8M A;  3FXB A;  4N4U A;  2ZZW A;  2XA5 A;  4MCO A;  2HZK A;  4O94 A;  4P56 A;  4YIC A; 
#chains in the Genus database with same CATH topology
 4QXD A;  4RY1 A;  4KCD A;  2B4M A;  4JWX A;  2VHA A;  2I0B A;  4QSE A;  2ZYK A;  5EYG A;  4IGR A;  3IO4 A;  3LBS A;  4NQ8 A;  4BDR A;  1FTK A;  2D3I A;  1DK4 A;  4HE2 A;  1B3E A;  2F5X A;  3UOR A;  1SBP A;  2R71 A;  1SVX B;  2P3N A;  2XHD A;  4GFR A;  5EHS A;  5IGA A;  1NV4 A;  4IO4 A;  1UIV A;  1LLS A;  4NE4 A;  1LBV A;  3PV0 E;  5KDT A;  1R9L A;  3E79 A;  4O7I A;  3D4C A;  1XHY A;  4YKJ A;  1QUK A;  1FTL A;  2P1S A;  2FBP A;  3C4M A;  4G4P A;  1NFT A;  3OEM A;  2XXK A;  4HXV A;  4ZS9 A;  5I56 B;  4OEV A;  3MZ1 A;  3MUQ A;  3E78 A;  4LQ2 A;  1HSJ A;  1MQI A;  1MQJ A;  1EH3 A;  1H3D A;  3RPW A;  4O3A A;  2GRV A;  3H6T A;  2Y7W A;  3U92 A;  3PMW A;  2HPG A;  2PCR A;  3G3J A;  3T9H B;  2VD3 A;  4MF3 A;  1Z7N E;  3EHU A;  1LCF A;  3KBZ A;  1B3L A;  1FW0 A;  1QUJ A;  1URG A;  1MDQ A;  1ZKB A;  1SW1 A;  2E1S A;  1KWH A;  3A3U A;  3W9V A;  1QVS A;  2PBW A;  1FJ6 A;  3EHS A;  2RC8 A;  2IA4 A;  3FXR A;  1MXV A;  1D9V A;  2CZH A;  1ANF A;  2HZK A;  4Z0I A;  5L9S A;  3K6V A;  4Q0C A;  3C35 A;  3FJG A;  4NED A;  4N91 A;  3ZKK A;  4ND9 A;  4IB2 A;  1JW1 A;  4MLV A;  1LBC A;  2ZZX A;  4R72 A;  4HCY A;  1LB8 A;  1SQY A;  4I8C A;  2WYP A;  2Q88 A;  2QFL A;  1SW2 A;  4NF4 B;  1NMU A;  3PUY E;  5B70 A;  3WAF A;  3RT6 B;  4X48 A;  4OES A;  3IAZ A;  4PET A;  3GLB A;  2QMW A;  3QMF A;  1MRP A;  2UVH A;  4F29 A;  3H6V A;  1MS7 A;  3H6U A;  3QSL A;  2GHA A;  1XI6 A;  1NUY A;  2Y7P A;  3KZG A;  3B6Q A;  2OLB A;  1A54 A;  2I58 A;  4AB5 A;  3MQ9 A;  4LZ5 A;  4PFB A;  5A5L A;  3MVZ A;  4NTL A;  4QSC A;  1DPE A;  3GBA A;  1O63 A;  3O6G A;  1FPJ A;  4PFU A;  1AOV A;  2ZNT A;  1D9Y A;  4P0I A;  4XFE A;  3I6V A;  3MWB A;  4U4S A;  4DCX A;  4PDH A;  2XXP A;  2ONS A;  1D4N A;  1P99 A;  4PAF A;  4EXL A;  2YPN A;  1P1O A;  1LAX A;  3TTL A;  3TQW A;  1OLC A;  3PPP A;  3W15 C;  3TYH A;  3VLU A;  3UIF A;  4DDD A;  3T1B A;  4GVO A;  4RA1 A;  2QL3 A;  2F34 A;  2HAU A;  3O29 A;  2O7U A;  4POW A;  2Y7R A;  3OO7 A;  5EQ9 A;  1OLA A;  3VFJ A;  1IXC A;  5I56 A;  1A40 A;  4FED A;  1RDZ A;  2YLN A;  2V3Q A;  5ISU A;  4NX1 A;  3UK4 A;  2RF1 A;  3MP8 A;  4F2Q A;  3K00 A;  2O69 A;  4PGN A;  3V89 B;  3CVG A;  1FPB A;  1I6B A;  2QVV A;  2Z8E A;  3G3H A;  4KCC A;  1VSO A;  3LUZ A;  3VXC A;  1N76 A;  3MVW A;  1DTG A;  4JVC A;  1B3H A;  1IMF A;  3IO6 A;  1B0L A;  3LSW A;  1IXG A;  4N13 A;  1Q9D A;  1B6H A;  2FHY A;  2V84 A;  5M2V A;  1GV8 A;  1B46 A;  3B6W A;  1MM7 A;  5ET8 A;  4MX6 A;  4OVS A;  5A5X A;  5T3J A;  3LSX A;  5JK4 A;  4DXB A;  1AH5 A;  1VE4 A;  1JVX A;  3Q25 A;  3OO8 A;  4RJZ A;  1B9J A;  1A55 A;  4HS7 A;  3EHT A;  4NWC A;  4P8B A;  4GIZ A;  5CBS A;  4PAK A;  5IAI A;  4U23 A;  3BIH A;  3VV5 A;  4HTG A;  2F6G A;  5I59 A;  3SER A;  2Q89 A;  3U93 A;  3CG1 A;  1PB7 A;  1M5F A;  2UVI A;  2VGQ A;  4YB7 A;  1KA1 A;  4GWO A;  3PMX A;  3QXM A;  4JWY A;  4KXP A;  5IZ3 A;  5ELV A;  4IO2 A;  1EYI A;  5LTC A;  1B7Z A;  2VT5 A;  5F24 A;  3RLF E;  1ZU0 A;  2I3V A;  1POT A;  3IOV A;  1IMA A;  3H3G A;  5TPA B;  4F1V A;  2PVU A;  3LC8 A;  5H8H B;  4LN5 A;  2F7B A;  1JVY A;  2XXT A;  2ZYO A;  2UYF A;  4N6P A;  4N15 A;  3O6H A;  5F1Q A;  4F1Y A;  1SYI A;  3TTR A;  2HCA A;  3UN6 A;  2ZMB A;  2D5W A;  1D9Q A;  2UVJ A;  4QFO A;  4GWZ A;  3T96 B;  5TPA A;  3CG3 A;  2ZNS A;  5DVI A;  3A09 A;  4G68 B;  3C31 A;  5ESY A;  3KEI A;  4XKP A;  3TMG A;  1JW5 A;  3CFL A;  4JSO A;  4M1V A;  4NGU A;  1JP4 A;  1CE2 A;  1RYX A;  1AL3 A;  3ECR A;  3K1P A;  4X1B A;  2QS2 A;  2X26 A;  4THI A;  1FSA A;  4L17 A;  4KI0 E;  4O7M A;  2QVU A;  2Q2A A;  2RIN A;  2CZK A;  1BIY A;  4RXL A;  4PGP A;  1NV6 A;  2GH9 A;  3N94 A;  3E9X A;  4DI4 B;  2XXV A;  4YMA A;  4BDQ A;  4OFO A;  4XKR A;  2I4C A;  4O94 A;  2ONK E;  4BDN A;  2KQZ A;  1MPD A;  3MST A;  2HHM A;  4GF8 A;  4NF0 A;  1RYO A;  3O2A A;  5DEX B;  4QSD A;  4Q5T A;  3CIJ A;  5TU0 A;  5I2K B;  2V3T A;  4GXA A;  4QFK A;  2V25 A;  1QJM A;  2VD2 A;  1FQF A;  2HZL A;  5H8N A;  1P1N A;  3JV9 A;  1NV0 A;  3TUS A;  3RPL A;  4OFJ A;  1ZTY A;  3TEP A;  4PBH A;  1IMC A;  3KG2 A;  5JTY B;  1XOC A;  4X04 A;  2B3F A;  2XXH A;  3FV1 A;  3IL1 B;  3IB1 A;  4PDD A;  4ZEK A;  4PP0 A;  4TLM B;  1SW5 A;  4H65 A;  2H98 A;  3TCH A;  5I57 A;  4U1O A;  3U72 A;  3RT8 A;  2H25 A;  1FRP A;  1K9Y A;  5I3S A;  1MM6 A;  4P1E A;  5AA4 A;  1MY3 A;  1WDN A;  4HE0 A;  1QGX A;  4MEV A;  1Y3P A;  3G3I A;  2FIX A;  1IXH A;  3MC2 A;  2Y7I A;  2ABH A;  3TZA A;  2GQ1 A;  1ELJ A;  2RCB A;  3CSB A;  4TQU Q;  1B1H A;  4ZZE A;  4GX3 A;  3T66 A;  2B3B A;  1N3W A;  5BUU A;  3FAS A;  3HST A;  2Z22 A;  3Q29 A;  3T9X B;  3CR9 A;  4EF2 A;  1Y1Z A;  2VPN A;  4P47 A;  4QFL A;  4N17 A;  1TWY A;  2O68 A;  1OQG A;  4O3C A;  1VFD A;  4O8M A;  3PPR A;  5AA2 D;  3G7W A;  4RYA A;  3ZSF A;  3IFA A;  3PPQ A;  4MMP A;  3HV1 A;  4NF5 A;  3VVF A;  4QFN A;  1B4Z A;  4LA9 A;  2GHB A;  3CFZ A;  5EQ7 A;  1J1N A;  2VPO A;  1HSE A;  4AB6 A;  3B6T A;  5I58 A;  1FJ9 A;  2PX1 A;  2NVU B;  4LAT A;  5H8N B;  5KDT B;  1MXW A;  3Q28 A;  5TP9 B;  1JEV A;  4ELO A;  3U94 A;  3OSR A;  3K4U A;  3TPA A;  2NXO A;  4C1T A;  3C36 A;  3ZKL A;  3T93 B;  3NOH A;  4ZEC A;  2Q8M A;  4OHN A;  2NOO A;  2PFZ A;  2YJP A;  3R26 A;  2A5T A;  4OZ9 A;  5AA1 A;  2NWJ A;  1MQH A;  2G29 A;  3S4U A;  1A7L A;  3E3K A;  1PBQ A;  3TQL A;  4MBP A;  4QHQ A;  1S50 A;  3S9L C;  3GYY A;  4IO5 A;  5FHO A;  4H0W A;  4OFL A;  4YU0 A;  2XXX A;  3SDF A;  3TFL A;  5H8Q B;  1WOD A;  5CM6 A;  2A5S A;  1URD A;  1LEV A;  3E4R A;  1LCT A;  4NMY A;  2DE2 A;  4OAN A;  4MH5 A;  4GQO A;  4GD5 A;  1B4H A;  2AL4 A;  3D4G A;  5BWJ A;  3R7X A;  2ZZV A;  1R6Z A;  5H8H A;  3FIR A;  4PCD A;  1A8E A;  1LST A;  2OWT A;  3K2D A;  4JVD A;  5CMC A;  3FBP A;  4H67 A;  1IUD A;  1LBW A;  3U8Q A;  3E13 X;  3F11 A;  1B5I A;  5FHN A;  1CB6 A;  4ELP A;  4R74 A;  4AQ4 A;  2XWV A;  1Y4C A;  3C33 A;  2Y5K A;  4XKN A;  2DWH A;  2QJE A;  1SYH A;  5I59 B;  2ZNU A;  3UP9 A;  2REG A;  4MNC A;  4F3P A;  4GWX A;  3T0J A;  2UVG A;  3VLW A;  2FA7 A;  3MAM A;  5IZ3 B;  2PMS A;  2M8C A;  3LUY A;  4GL0 A;  5AA2 B;  2OWZ A;  4OA4 A;  4G68 A;  2Q8J A;  5DTB A;  2I48 A;  1ZJL A;  5A5X B;  3OXN A;  1AWB A;  1FPD A;  1R9Q A;  1USY E;  3B8B A;  1II5 A;  4PF8 A;  2CZI A;  5KZT A;  5HPQ A;  1H76 A;  2XXR A;  3SEV A;  3IOR A;  5HM4 B;  2Z8F A;  4YB6 A;  4NWD A;  1N0T A;  2O6A A;  2QPQ A;  3VXB A;  3T9U A;  3QAX A;  3Q27 A;  1O64 A;  4N8G A;  3ROJ A;  2HAV A;  3MZB A;  4H8J A;  5L8D A;  3KOT A;  3PPO A;  1XVX A;  3R6U A;  3MJN A;  1GTK A;  4G68 C;  4MNP A;  1BKA A;  5LOM A;  4MFI A;  1FQB A;  1NV2 A;  3MZ9 A;  5I58 B;  3K02 A;  3QUF A;  1YPN A;  4P1L A;  5FTI A;  1FPG A;  4NHB A;  4WEP A;  3FXB A;  1GVC A;  4RNS A;  4YB5 A;  2DYX A;  1Y3N A;  4DE8 A;  4U21 A;  1SD3 A;  1MXZ A;  1B58 A;  2XXW A;  2ZYN A;  4EDP A;  4R9G A;  1NI9 A;  5TP9 A;  3VE1 B;  3RN8 A;  2R6G E;  1MY2 A;  1B5J A;  4RK2 A;  1QKB A;  5DW8 A;  1FPE A;  4P11 A;  4G2Z A;  4ZEB A;  3VVD A;  4C1U A;  4PTK A;  2Q74 A;  2LAO A;  5KCJ A;  2O51 A;  1PB8 A;  1US5 A;  1T0K A;  4O3B A;  4LVQ A;  3UGW A;  4JB7 A;  2WBB A;  1FTJ A;  4QRZ A;  1B2H A;  1B5H A;  1VDW A;  4U1Z A;  3EN3 A;  4LZ8 A;  4POX A;  1PC3 A;  3I3V A;  3KJT A;  4GWS A;  2XXI A;  2CMO A;  3TTM A;  2OBG A;  3BFU A;  2WKY A;  4OXV A;  4DZ1 A;  5I84 A;  2KR0 A;  4PFR A;  3N5L A;  3LSL A;  3S2V A;  3FV2 A;  1NV5 A;  4GWW A;  4GL8 A;  4PBQ A;  1EZO A;  3GBB A;  3ILU B;  3OOA A;  4OVJ A;  4NG7 A;  1LBZ A;  3PUW E;  3SEW A;  2FVZ A;  3N6T A;  5CMB A;  1B1X A;  1FQD A;  5EYF A;  3CSG A;  2O7I A;  1B32 A;  4U2R A;  2D21 A;  3FAT A;  3SZP A;  1ZIU A;  4ESX A;  4Q30 B;  4ZE8 A;  2THI A;  3OD7 A;  3V83 A;  2DOJ A;  3SEY A;  4YIC A;  4F31 B;  3CI8 A;  3IFC A;  1BK4 A;  3MYU A;  1Y1M A;  4AS5 A;  2WX9 A;  1Y9U A;  4NN3 A;  1USY H;  1G0H A;  5DYH A;  4I3E A;  3EF7 A;  1I6A A;  1NNT A;  3CRB A;  3P7I A;  2DDK A;  2I49 A;  3Q26 A;  5CMK A;  1B3F A;  4MAG A;  5H8F A;  4R2F A;  4H5F A;  3KGC A;  3K0V A;  4G8H A;  1QUL A;  3K1M A;  4I1D A;  5AA2 A;  3PTY A;  1YYZ A;  3PUX E;  2V3U A;  2RC7 A;  3SKP A;  1LFI A;  3IOU A;  3SEU A;  1DPP A;  3KC0 A;  1DTZ A;  1M5B A;  2V4C A;  3KN8 A;  4PFT A;  3CHG A;  4ELR A;  1B51 A;  2DXY A;  1B0H A;  4KHZ E;  4R73 A;  4FBP A;  4R6K A;  3M8U A;  4G77 A;  4E0W A;  2UXA A;  1OMP A;  3OEL A;  3FD3 A;  2ESN A;  4OWD A;  2CEX A;  5ET6 A;  1OQH A;  4KYD A;  3KOS A;  5FBP A;  1SI0 A;  5I2N A;  2F78 A;  3JZJ A;  3UA8 A;  3SET A;  1DCU A;  3V8X B;  1PEB A;  1RDX A;  3PMV A;  4F1U A;  2DVC A;  2I4B A;  1ZLQ A;  3FGS A;  3SES A;  1MQG A;  1S7Y A;  3FXQ A;  1POY 1;  3BIG A;  2ZXT A;  4F3B A;  3RPL B;  1EZP A;  4XIG Q;  1NNK A;  4EQ7 A;  2DSF A;  1SW4 A;  2OK2 A;  2DP8 A;  1BLF A;  4HE1 A;  1ZBM A;  1LBX A;  1B40 A;  4ONY A;  1HSL A;  3FJ7 A;  5F7V A;  1P1Q A;  3BKI B;  4N6K A;  2CEY A;  2F7C A;  3IK6 B;  2REJ A;  1JET A;  1MH3 A;  2FNC A;  3ZS6 A;  2OX3 A;  1M5E A;  4OVP A;  4R6H A;  1XVY A;  1Y20 A;  1MY0 A;  4KD5 A;  3AXF A;  1MPB A;  2RKM A;  5CRY A;  1OVB A;  3G3F A;  1KA0 A;  3LSF B;  3D1R A;  3QIM A;  1QUI A;  1M5C A;  2OJT A;  1MPC A;  2H4I A;  4TLL B;  1FBD A;  5ET7 A;  1LBB A;  1PDA A;  1NNP A;  2WBD A;  5CI5 A;  3IB2 A;  3QYT A;  4GBW A;  1GR2 A;  2DE4 A;  1YXI A;  4ZEF A;  4JDF A;  3K01 A;  1A8F A;  2PYY A;  1EYJ A;  2WEF A;  4DCY A;  2XXY A;  1SDX A;  2XA5 A;  2Z8D A;  4I62 A;  2KLF A;  1RDY A;  1LBY A;  3N26 A;  2OCU A;  4ELQ A;  3IR1 A;  1P1W A;  1IME A;  4JVI A;  2AIX A;  5FHM A;  2HFB A;  1LAG E;  5DT6 A;  3B50 A;  4FOR A;  2H99 A;  4OQO A;  1B52 A;  5DEX A;  4JBZ A;  1PBP A;  5ICQ A;  1B7H A;  4XXU A;  1VR5 A;  1VFE A;  3IB0 A;  4GOT A;  3DEL B;  4N6D A;  3RGY A;  1FBE A;  1IIW A;  4QFP A;  2QS4 A;  3G3G A;  4I9D A;  3U1O A;  3MVX A;  5EHM A;  1MDP 1;  2RC9 A;  1N7W A;  4PAI A;  4LP2 B;  2Z23 A;  1GGG A;  4ECF A;  1NUX A;  1Q1K A;  2JJK A;  2F6P A;  3M3L A;  3IJO B;  4R9F A;  2QS1 A;  2UYE A;  4RPO A;  5DVJ A;  1QKA A;  3V5A A;  3FXU A;  5H8Q A;  2DE3 A;  4G61 A;  3T22 A;  1JQF A;  4ZEI A;  3EPE A;  4PE5 B;  1Y3Q A;  4GX6 A;  4LQ5 A;  2AYS A;  5EYH A;  2A5T B;  3LR1 A;  4DXU A;  3FVO A;  2XX8 A;  1B7U A;  4KYE A;  1MQD A;  2I3W A;  2B4L A;  2H9B A;  3GZG A;  3CFX A;  1FQE A;  1DOT A;  1BP5 A;  3A3C A;  4PFY A;  2H5Y A;  1B3G A;  1NUW A;  1INP A;  5J16 A;  2DWA A;  4P9K A;  1IQ7 A;  1EYK A;  2PT2 A;  4PF6 A;  4ZED A;  5L9O A;  1KZ8 A;  3H6W A;  1FPI A;  1FBP A;  3RUM A;  4DI3 D;  4DLD A;  3KN7 A;  4H8I A;  1FPK A;  5ITP A;  4N07 A;  1N7X A;  3HFU A;  5B7D A;  1MH4 A;  3ONM A;  3HHG A;  5L9M A;  1UTH A;  5AA4 B;  2I0C A;  4TOZ A;  3K6X A;  3KN3 A;  3KSX A;  4OYV A;  5I57 B;  4OVQ A;  1FQC A;  4EUO A;  5CC2 A;  2PT1 A;  1PB9 A;  4GXS B;  1LFG A;  4G8N A;  1OIB A;  3PUV E;  2X7Q A;  2AL5 A;  4U4X A;  1FBC A;  2CZL A;  3OSQ A;  2G93 A;  2DVZ A;  2XWO A;  3IJX B;  3FVG A;  1SI1 A;  4F22 A;  3PU5 A;  5J1D A;  4Z7E A;  2HXW A;  2F3D A;  3O9P A;  4F19 A;  3KJ7 A;  4EQB A;  2DS9 A;  3QK6 A;  1MY1 A;  3ISP A;  3KFM A;  4YKK A;  2W7Y A;  3S9E A;  4OEN A;  3O6I A;  2IEE A;  4R6Y A;  1P1U A;  1LAF E;  4YZZ A;  4UA8 A;  3U65 A;  2VOZ A;  1H43 A;  4OTE A;  3MPL A;  4MCO A;  4P56 A;  2BJJ X;  4YKI A;  5AA3 A;  4OEU A;  4R75 A;  4H5G A;  1XS5 A;  3OO9 A;  4F3G A;  1RKM A;  4IY6 A;  1F9B A;  4WKM A;  3OMB A;  2F7A A;  1FQA A;  1UTH B;  1I69 A;  2OWS A;  3FVK A;  1NH7 A;  1CNQ A;  5IZ1 A;  2O1M A;  3S9N C;  3ODB A;  2BJI A;  1NV1 A;  4XTC Q;  4DIG A;  4F18 A;  4UAC A;  1Y4T A;  2XXQ A;  3HO7 A;  4XKQ A;  3RNN A;  4FAJ A;  2R9J A;  3DM0 A;  2PFY A;  1Z7M E;  3PUZ E;  4X8R A;  3MPK A;  1MG1 A;  4FAT A;  1IEJ A;  2ONR A;  3L6H A;  3O97 A;  4JWO A;  4DXC A;  1TXF A;  5IZZ A;  1YAE A;  2XD3 A;  3C34 A;  2L5V A;  4FEB A;  2ANJ A;  4XF5 A;  1Q35 A;  5FTH A;  1JW4 A;  2O1L A;  4X1D A;  1AIV A;  4KQP A;  3VDF A;  3EKI A;  3H4Z A;  4NF4 A;  3MBP A;  1H44 A;  1IZ1 A;  3OO6 A;  1JEU A;  1H45 A;  4PFI A;  1WVJ A;  1FTO A;  2HXR A;  4NF6 B;  5KCJ B;  1FPF A;  3MW0 A;  1URS A;  3HPI A;  1R1N A;  1US4 A;  4Q8R A;  1LFH A;  3RY3 A;  4KR5 A;  4KPT A;  3HN0 A;  1NL5 A;  2V93 A;  4IO3 A;  3TTK A;  1MXX A;  2DQV A;  1DMB A;  2NUV A;  3FJM A;  2P0S A;  3DP8 A;  3OEK A;  4FE8 A;  5I2K A;  2QSX A;  2F3B A;  4I40 A;  4ZE9 A;  4ZZA A;  4KYS A;  4PFW A;  2F36 A;  3DLN A;  3C32 A;  1K9Z A;  1LGB C;  4FIM A;  2P3V A;  3FVN A;  3L6G A;  2Q2C A;  4ISU A;  3TEL A;  1NNF A;  2Y84 A;  1NV3 A;  3PGF A;  3IX1 A;  3DP6 A;  1IXI A;  3KC1 A;  5I7I A;  3SEX A;  2QMX A;  2WYK A;  3C9H A;  3TDJ A;  1NH8 A;  4MJO A;  5EQA A;  1IMD A;  2QVR A;  5CBR A;  4EXK A;  2RCA A;  5ICT A;  1A99 A;  1IMB A;  3S9M C;  4C0R A;  4FEC A;  3IOT A;  4AS4 A;  1FBF A;  4NF6 A;  4WXJ A;  4PC9 A;  1FTA A;  2P2A A;  1M5D A;  2XX7 A;  4YAH X;  3A29 A;  1OVT A;  4GX4 A;  4OET A;  2FYI A;  4H6D A;  4R2B A;  5EQ8 A;  2Y7K A;  4NF5 B;  3TCF A;  4IY5 A;  2XWK A;  1ATG A;  1ZMG A;  3JYR A;  3PPN A;  3GXA A;  4BLA A;  3PD8 A;  3O66 A;  4N8Y A;  1NKX A;  4IR8 A;  4N4U A;  2ZZW A;  3FUZ A;  4P0G A;  4LON B;  2F35 A;  1JNF A;  4H45 A;  4F2O A;  4YKP A;  1UIU A;  4K3F A;  2ALU A;  1LB9 A;  5I2N B;  3RQT A;  1NV7 A;  5DVF A;  4YMB A;  4NAP A;  3THI A;  3HHF A;  4M4G A;  3N6U A;  1YCJ A;  5K2X A;  3HCQ A;  2XX9 A;  3QUJ A;  3MVY A;  4BDM A;  4H1X A;  3VVE A;  4H46 A;  4JXI A;  1FCK A;  3PD9 A;  2XWI A;  1LAH E;  2XXU A;  4BDO A;  3M3F A;  5JTY A;  1DSN A;  3K6U A;  4IO6 A;  3IOW A;  1EU8 A;  1FBH A;  1BTJ A;  2MKZ A;  4LZ7 A;  4GWY A;  4ESW A;  4U22 A;  2FIE A;  3USD A;  2B65 A;  4PQJ A;  1QW0 A;  3TTN A;  4HW8 A;  4FJP A;  2OZZ A;  5LDZ A;  2O84 X;  1UTB B;  3TOD A;  2X7P A;  4IO7 A;  3H03 A;  5JEI A;  1I6Q A;  5H8F B;  1N04 A;  4IGT A;  4MLQ A;  1DBZ A;  4KFQ A;  2DWI A;  2F8D A;  3TAJ A;  1MXY A;  1B05 A;  3KBR A;  4GLI A;  4OER A;  3TKD A;  1MY4 A;  1XT8 A;  3K6W A;  4GBV A;  1YTV A;  3I5O A;  1AMF A;  1L5T A;  1EZ9 A;  3MP6 A;  4BDL A;  1UTB A;  1TT1 A;  3TCG A;  1XC1 A;  4G8M A;  1TFD A;  5HBC A;  4NF8 B;  3LV0 A;  4N81 A;  4QF9 A;  3VLV A;  2ZYM A;  2HQ0 A;  4JSD A;  1IIT A;  2HEU A;  1S9T A;  4LUB A;  4F39 A;  3W9W A;  1FTM A;  1YZ0 A;  1SPI A;  2DXR A;  1N3X A;  3T9V A;  4EQ9 A;  3RTF B;  1D3K A;  5K2Y A;  1G0I A;  1FBG A;  4MIJ A;  4OVR A;  2VP1 A;  3WAE A;  3BFT A;  3K1N A;  5ET5 A;  4OVT A;  4OMB A;  3RTW B;  2XD2 A;  4MHF A;  4ZDM A;  4QBA A;  3FZV A;  3G3K A;  5AE4 A;  5H8S A;  2DWJ A;  2QRY A;  2Y5L A;  2E0S A;  4RK9 A;  1FPL A;  3H7M A;  3OEN A;  5CMM A;  5IM2 A;  4EF1 A;  1UQW A;  3BBR A;  4GWU A;  2I6E A;  5IKB A;  4HCW A;  3DP4 A;  3KSJ A;  2GFE A;  5I5P A;  2Q9T A;  4E0X A;  3M3K A;  4UAB A;  1N84 A;  3B7D A;  4I3Y A;  3H06 B;  3O28 A;  4P3L A;  4PE3 A;  2F97 A;  3ILT B;  4F3S A;  4MNI A;  1NUZ A;  2R8T A;  3MP1 A;  4XEQ A;  4GRK A;  1MXU A;  3RYD A;  1TFA A;  2QS3 A;  4WED A;  5ITO A;  3EQ1 A;  4NF8 A;  4RPN A;  4X9T A;  1O7T A; 
#chains in the Genus database with same CATH homology
 4QXD A;  4MMP A;  1EYI A;  5LTC A;  4NF0 A;  1LBW A;  2B4M A;  3IFC A;  2VT5 A;  4N91 A;  5F24 A;  1BK4 A;  3BIG A;  3MYU A;  1NI9 A;  1NV7 A;  4NAP A;  2ZZX A;  3W9W A;  5IZ3 A;  5EQ7 A;  1NUW A;  2WX9 A;  1INP A;  4AS5 A;  4HCY A;  1YZ0 A;  5EYG A;  1IMA A;  1IME A;  1SPI A;  4JVI A;  4NN3 A;  2VPO A;  1G0H A;  1RDZ A;  2HZL A;  2WYP A;  2XWV A;  2V3Q A;  3RPL B;  4NQ8 A;  4NX1 A;  5DW8 A;  4I3E A;  1FPE A;  1CNQ A;  3B50 A;  5IZ1 A;  4P9K A;  1EYK A;  4F1V A;  4PF6 A;  1KZ8 A;  1NV0 A;  2Y5K A;  1DK4 A;  2QFL A;  4HE2 A;  2BJI A;  1FJ9 A;  4LN5 A;  1FPI A;  1NV1 A;  1FBP A;  2F5X A;  4F18 A;  1G0I A;  2F3B A;  4PTK A;  4PGN A;  4H46 A;  2Q74 A;  4I40 A;  1FBG A;  1FPK A;  4MIJ A;  4MNC A;  5I3S A;  3RPL A;  4GWX A;  4N15 A;  3T0J A;  2XWI A;  4OVR A;  2P3N A;  1IMC A;  4PBH A;  4PET A;  1K9Z A;  4X04 A;  1FPB A;  2WBB A;  5IGA A;  2P3V A;  3HFU A;  2PFY A;  2QVV A;  1NV4 A;  5ET5 A;  2DDK A;  4HE1 A;  1D9Q A;  4OVT A;  1VDW A;  3QMF A;  1LBV A;  1LBX A;  3LUZ A;  4MAG A;  4PDD A;  5IZ3 B;  1FBH A;  4X8R A;  3E79 A;  1NV3 A;  5J16 A;  4O7I A;  2MKZ A;  4N6D A;  3KC1 A;  4N6K A;  4MHF A;  3NOH A;  2CEY A;  2Q8M A;  2OWZ A;  4GWY A;  4JVC A;  4OA4 A;  4QBA A;  5I7I A;  4DI3 D;  1XI6 A;  4GWZ A;  2WYK A;  1IMF A;  1FBE A;  1NUY A;  1FRP A;  1K9Y A;  2FBP A;  3PTY A;  2PFZ A;  4MJO A;  2FIE A;  4OVQ A;  4GWS A;  4P1E A;  1YYZ A;  5EQA A;  2OX3 A;  1IMD A;  1AWB A;  1FPD A;  2QVR A;  2XXK A;  1Q9D A;  2FHY A;  3B8B A;  4HXV A;  4OVP A;  2Y5L A;  4PF8 A;  2CZI A;  1FPL A;  4HE0 A;  5IZZ A;  1QGX A;  4MEV A;  4PAI A;  5ESY A;  5LDZ A;  1IMB A;  2FIX A;  2KR0 A;  2L5V A;  3KC0 A;  4PFR A;  5IM2 A;  3E78 A;  4PFB A;  4XF5 A;  5A5L A;  3GYY A;  2V4C A;  1NUX A;  1KA0 A;  2JJK A;  3CHG A;  4MX6 A;  1FBC A;  5ET8 A;  3IFA A;  4AS4 A;  4OVS A;  5JK4 A;  1DBZ A;  2XWO A;  1FBF A;  1NV5 A;  2DVZ A;  4GWW A;  4M1V A;  4NGU A;  5T3J A;  4GWU A;  2GQ1 A;  1JP4 A;  3D1R A;  4PBQ A;  4PC9 A;  1FTA A;  1FPJ A;  2QPQ A;  5CM6 A;  4HCW A;  3A29 A;  4FBP A;  4GX3 A;  1LEV A;  4XFE A;  4N8G A;  2Q9T A;  1FBD A;  3EKI A;  4GX4 A;  5ET7 A;  3ROJ A;  2DE2 A;  1FSA A;  2HPG A;  2F3D A;  2PCR A;  2WBD A;  1LBZ A;  4NG7 A;  4GBW A;  4OAN A;  4F19 A;  4P8B A;  2DE4 A;  2DE3 A;  2FVZ A;  5EQ8 A;  4O7M A;  1YXI A;  4UAB A;  3KBZ A;  4GBV A;  3ISP A;  5J1D A;  4PDH A;  4G61 A;  2QVU A;  4PAF A;  2CEX A;  2ZZV A;  4I3Y A;  2CZK A;  2VPN A;  4PAK A;  5ET6 A;  2XWK A;  4P47 A;  5FBP A;  3BIH A;  4MNP A;  4PFI A;  4PGP A;  4P3L A;  4PE3 A;  3W9V A;  1NV6 A;  1FJ6 A;  4N17 A;  5I5P A;  4GX6 A;  1EYJ A;  4MNI A;  1NV2 A;  4PCD A;  3SZP A;  5EYH A;  4DI4 B;  2HXR A;  3LV0 A;  1NUZ A;  4YZZ A;  2WEF A;  2R8T A;  1DCU A;  1FPF A;  4N81 A;  4N8Y A;  1FPG A;  4P1L A;  4XEQ A;  3U65 A;  2CZH A;  4NHB A;  4O8M A;  3RYD A;  1RDX A;  3FXB A;  4IR8 A;  4N4U A;  3T1B A;  2ZZW A;  2XA5 A;  4MCO A;  4F1U A;  2HZK A;  4JVD A;  4O94 A;  4P56 A;  4YIC A;  2KQZ A;  1KA1 A;  4H45 A;  3MST A;  4X9T A;  2B4L A;  2HHM A;  3FBP A;  1RDY A;  4KXP A;  1LBY A;  5EQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...